F487993

General Info

Members Datasets Scaffolds Average Seq Length
1005 494 938 274

Family's Representative Sequence

Representative Sequence 3300046524|Ga0495648_0035570|Ga0495648_0035570_119_1048
Length 309
Sequence MSTTRTFPGPATNPPNPXXXXAVRRCGRARRVSGSRGGSALLGWTAANLVILGLSLVPVLWLVSLSFKTSDTIDDGRFVPRAWTLENYRGIFDTSLFTRALVNSIGIAVIATALAVVFGSMAAYAVARLRFPGKGVLVGLSLLIAMFPQISLVSPLFNLWRQLGLFDTWPGLIIPYLTFALPLSIYTLSAFFREIPWDLEKAAAMDGATPAQAFRRVIAPLAAPGMVTTAILVFILCWNDFLFAISLTSTDRARTAPAAIAFFTGASQFAQPIGSIAAAAVVITIPIIVFVLLFQRRIVAGLTSGAVKG

Samples

Sample ID Description Type Environment
1 2508501039 Frankia saprophytica CN3 Isolate Nodule
2 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
3 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
4 2643221714 Streptomyces sp. Root264 Isolate Unclassified
5 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
6 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
7 2687453737 Frankia sp. BMG5.36 Isolate Nodule
8 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
9 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
10 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
11 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
12 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
13 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
14 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
15 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
16 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
17 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
18 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
19 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
20 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
21 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
22 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
23 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
24 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
25 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
26 2855683550 Micromonospora sp. RP3T Isolate Unclassified
27 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
28 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
29 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
30 2858868258 Micromonospora sp. MH33 Isolate Unclassified
31 2858882152 Micromonospora noduli MED15 Isolate Nodule
32 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
33 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
34 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
35 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
36 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
37 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
38 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
39 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
40 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
41 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
42 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
43 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
44 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
45 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
46 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
47 2902582711 Micromonospora sp. AP08 Isolate Unclassified
48 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
49 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
50 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
51 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
52 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
53 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
54 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
55 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
56 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
57 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
58 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
59 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
60 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
61 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
62 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
63 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
64 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
65 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
66 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
67 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
68 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
69 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
70 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
71 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
72 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
73 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
74 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
75 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
76 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
77 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
78 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
79 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
80 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
81 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
82 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
83 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
84 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
85 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
86 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
87 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
88 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
89 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
90 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
91 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
92 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
93 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
94 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
95 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
96 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
97 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
98 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
99 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
100 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
101 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
102 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
103 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
104 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
105 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
106 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
107 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
108 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
109 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
110 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
111 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
112 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
113 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
114 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
115 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
116 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
117 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
118 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
119 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
120 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
121 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
122 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
123 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
124 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
125 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
126 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
127 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
128 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
129 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
130 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
131 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
132 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
133 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
134 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
135 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
136 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
137 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
138 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
139 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
140 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
141 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
142 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
143 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
144 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
145 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
146 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
147 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
148 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
149 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
150 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
151 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
152 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
153 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
154 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
155 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
156 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
157 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
158 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
159 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
160 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
161 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
162 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
163 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
164 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
165 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
166 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
167 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
168 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
169 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
170 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
171 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
172 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
173 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
174 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
175 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
176 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
177 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
178 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
179 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
180 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
181 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
182 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
183 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
184 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
185 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
186 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
187 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
188 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
189 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
190 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
191 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
192 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
193 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
194 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
247 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
254 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
257 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
258 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
259 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
260 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
261 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
262 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
263 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
264 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
265 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
266 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
267 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
268 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
269 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
270 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
271 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
272 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
273 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
274 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
275 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
276 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
277 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
278 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
279 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
280 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
281 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
282 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
283 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
284 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
285 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
286 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
287 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
288 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
289 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
290 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
291 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
292 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
293 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
294 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
295 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
296 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
297 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
298 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
299 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
300 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
301 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
302 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
303 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
304 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
305 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
306 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
307 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
308 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
309 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
310 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
311 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
312 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
313 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
314 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
315 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
316 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
317 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
318 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
319 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
320 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
321 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
322 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
323 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
324 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
325 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
326 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
327 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
328 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
329 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
330 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
331 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
332 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
333 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
334 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
335 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
336 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
337 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
338 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
339 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
340 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
341 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
342 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
343 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
344 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
345 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
346 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
347 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
348 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
349 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
350 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
351 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
352 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
353 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
354 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
355 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
356 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
357 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
358 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
359 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
360 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
361 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
362 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
363 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
364 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
365 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
366 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
367 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
368 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
369 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
370 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
371 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
372 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
373 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
374 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
375 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
376 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
377 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
378 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
379 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
380 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
381 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
382 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
383 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
384 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
385 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
386 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
387 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
388 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
389 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
390 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
391 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
392 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
393 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
394 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
395 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
396 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
397 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
398 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
399 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
400 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
401 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
402 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
403 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
404 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
405 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
406 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
407 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
408 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
409 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
410 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
411 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
412 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
413 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
414 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
415 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
416 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
417 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
418 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
419 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
420 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
421 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
422 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
423 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
424 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
425 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
426 3300053113 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 endosphere Metagenome Endosphere
427 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
428 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
429 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
430 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
431 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
432 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
433 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
434 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
435 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
436 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
437 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
438 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
439 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
440 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
441 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
442 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
443 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
444 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
445 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
446 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
447 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
448 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
449 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
450 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
451 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
452 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
453 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
454 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
455 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
456 3300059514 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
457 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
458 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
459 3300059608 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 166R_SD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
460 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
461 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
462 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
463 3300059625 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
464 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
465 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
466 3300059631 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
467 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
468 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
469 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
470 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
471 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
472 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
473 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
474 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
475 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
476 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
477 3300059654 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
478 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
479 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
480 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
481 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
482 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
483 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
484 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
485 649633069 Micromonospora sp. L5 Isolate Unclassified
486 8002775197 Frankia nepalensis CN7 Isolate Nodule
487 8002784119 Frankia sp. AgB1.9 Isolate Nodule
488 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
489 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
490 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
491 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
492 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
493 8054734606 Micromonospora hortensis NIE111 Isolate Nodule
494 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 81.29
Metatranscriptomes 12.04
Isolates 6.67

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.67
Nodule 1.19
Rhizoplane 5.37
Rhizosphere 77.51
Stem 0
Stem Tuber 0
Unclassified 9.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1001603 3300000546 Bacteria 3092
2 JGI24746J21847_1001314 3300001977 Bacteria 3967
3 JGI24747J21853_1002149 3300001978 Bacteria 1570
4 JGI24735J21928_10058516 3300002067 Bacteria 1109
5 JGI24745J21846_1005536 3300002073 Bacteria 1381
6 JGI24749J21850_1004653 3300002076 Bacteria 1923
7 JGI24744J21845_10004230 3300002077 Bacteria 2961
8 JGI24744J21845_10016379 3300002077 Bacteria 1476
9 JGI24034J26672_10001767 3300002239 Bacteria 2911
10 JGI24034J26672_10014301 3300002239 Bacteria 1210
11 JGI24742J22300_10005722 3300002244 Bacteria 2046
12 JGI25406J46586_10008147 3300003203 Bacteria 4758
13 JGI25407J50210_10007409 3300003373 Bacteria 2747
14 JGI25407J50210_10009310 3300003373 Bacteria 2486
15 JGI25407J50210_10014238 3300003373 Bacteria 2050
16 JGI25407J50210_10016954 3300003373 Bacteria 1889
17 JGI25407J50210_10037730 3300003373 Bacteria 1241
18 Ga0055540_1000052 3300003792 Bacteria 143472
19 Ga0058861_10086516 3300004800 Bacteria 1397
20 Ga0058861_11829308 3300004800 Bacteria 1338
21 Ga0070676_10010720 3300005328 Bacteria 4974
22 Ga0070683_100052814 3300005329 Bacteria 3766
23 Ga0070683_100122935 3300005329 Bacteria 2452
24 Ga0070683_100535648 3300005329 Bacteria 1119
25 Ga0070690_100062101 3300005330 Bacteria 2409
26 Ga0068869_100017957 3300005334 Bacteria 4808
27 Ga0068869_100161527 3300005334 Bacteria 1744
28 Ga0070666_10047885 3300005335 Bacteria 2871
29 Ga0070680_100086833 3300005336 Bacteria 2586
30 Ga0070682_100027496 3300005337 Bacteria 3414
31 Ga0070682_100101197 3300005337 Bacteria 1902
32 Ga0068868_100001568 3300005338 Bacteria 15606
33 Ga0068868_100003817 3300005338 Bacteria 10523
34 Ga0068868_100069439 3300005338 Bacteria 2807
35 Ga0068868_100402530 3300005338 Bacteria 1181
36 Ga0068868_100592220 3300005338 Bacteria 981
37 Ga0070689_100020006 3300005340 Bacteria 4960
38 Ga0070691_10002308 3300005341 Bacteria 8450
39 Ga0070687_100041581 3300005343 Bacteria 2323
40 Ga0070661_100014688 3300005344 Bacteria 5523
41 Ga0070692_10035997 3300005345 Bacteria 2510
42 Ga0070668_100002116 3300005347 Bacteria 14535
43 Ga0070668_100003728 3300005347 Bacteria 11237
44 Ga0070669_100043351 3300005353 Bacteria 3277
45 Ga0070669_100158882 3300005353 Bacteria 1755
46 Ga0070675_100002879 3300005354 Bacteria 12967
47 Ga0070675_100468630 3300005354 Bacteria 1131
48 Ga0070671_100104704 3300005355 Bacteria 2375
49 Ga0070674_100002080 3300005356 Bacteria 10960
50 Ga0070674_100285704 3300005356 Bacteria 1309
51 Ga0070673_100175871 3300005364 Bacteria 1829
52 Ga0070673_100442063 3300005364 Bacteria 1169
53 Ga0070659_100007023 3300005366 Bacteria 8156
54 Ga0070659_100018803 3300005366 Bacteria 5216
55 Ga0070659_100068570 3300005366 Bacteria 2814
56 Ga0070667_100014491 3300005367 Bacteria 6515
57 Ga0070667_100020043 3300005367 Bacteria 5552
58 Ga0070667_100091206 3300005367 Bacteria 2620
59 Ga0070667_100646209 3300005367 Bacteria 976
60 Ga0070667_100715179 3300005367 Bacteria 927
61 Ga0070714_100083352 3300005435 Bacteria 2787
62 Ga0070714_100676765 3300005435 Bacteria 994
63 Ga0070713_100300198 3300005436 Bacteria 1478
64 Ga0070713_100341387 3300005436 Bacteria 1388
65 Ga0070713_100436686 3300005436 Bacteria 1227
66 Ga0070710_10001629 3300005437 Bacteria 10609
67 Ga0070710_10019372 3300005437 Bacteria 3515
68 Ga0070710_10085938 3300005437 Bacteria 1846
69 Ga0070701_10000238 3300005438 Bacteria 17648
70 Ga0070701_10164151 3300005438 Bacteria 1289
71 Ga0070711_100000410 3300005439 Bacteria 22249
72 Ga0070711_100007257 3300005439 Bacteria 6733
73 Ga0070700_100051409 3300005441 Bacteria 2565
74 Ga0070700_100112453 3300005441 Bacteria 1813
75 Ga0070700_100121551 3300005441 Bacteria 1750
76 Ga0070694_100044717 3300005444 Bacteria 2964
77 Ga0070663_100341124 3300005455 Bacteria 1211
78 Ga0070678_100036033 3300005456 Bacteria 3460
79 Ga0070678_100078483 3300005456 Bacteria 2494
80 Ga0070678_100125947 3300005456 Bacteria 2028
81 Ga0070678_100231819 3300005456 Bacteria 1540
82 Ga0070662_100062646 3300005457 Bacteria 2718
83 Ga0070662_100106712 3300005457 Bacteria 2128
84 Ga0068867_100040433 3300005459 Bacteria 3403
85 Ga0068867_100329808 3300005459 Bacteria 1267
86 Ga0068867_100406644 3300005459 Bacteria 1149
87 Ga0070679_100036973 3300005530 Bacteria 4847
88 Ga0070679_100069137 3300005530 Bacteria 3522
89 Ga0070684_100006940 3300005535 Bacteria 8794
90 Ga0070684_100129879 3300005535 Bacteria 2272
91 Ga0070697_100218563 3300005536 Bacteria 1624
92 Ga0068853_100023981 3300005539 Bacteria 5114
93 Ga0070672_100259579 3300005543 Bacteria 1465
94 Ga0070695_100018514 3300005545 Bacteria 4230
95 Ga0070693_100009709 3300005547 Bacteria 4794
96 Ga0070693_100058231 3300005547 Bacteria 2235
97 Ga0070665_100042854 3300005548 Bacteria 4549
98 Ga0070665_100209382 3300005548 Bacteria 1950
99 Ga0070665_100244513 3300005548 Bacteria 1795
100 Ga0070704_100000737 3300005549 Bacteria 16034
101 Ga0068855_100028863 3300005563 Bacteria 6637
102 Ga0068855_100340163 3300005563 Bacteria 1655
103 Ga0068855_100392201 3300005563 Bacteria 1523
104 Ga0070664_100000709 3300005564 Bacteria 25499
105 Ga0070664_100045804 3300005564 Bacteria 3694
106 Ga0068857_100018243 3300005577 Bacteria 6155
107 Ga0068854_100076440 3300005578 Bacteria 2461
108 Ga0068856_100039634 3300005614 Bacteria 4625
109 Ga0070702_100008329 3300005615 Bacteria 5016
110 Ga0070702_100039920 3300005615 Bacteria 2622
111 Ga0070702_100083299 3300005615 Bacteria 1921
112 Ga0068852_100037223 3300005616 Bacteria 4077
113 Ga0068852_100046213 3300005616 Bacteria 3709
114 Ga0068852_100293440 3300005616 Bacteria 1572
115 Ga0068852_100321149 3300005616 Bacteria 1504
116 Ga0068852_100624212 3300005616 Bacteria 1083
117 Ga0068859_100000134 3300005617 Bacteria 69536
118 Ga0068859_100002049 3300005617 Bacteria 20587
119 Ga0068859_100015497 3300005617 Bacteria 7660
120 Ga0068859_100501126 3300005617 Bacteria 1309
121 Ga0068864_100362156 3300005618 Bacteria 1371
122 Ga0068866_10000579 3300005718 Bacteria 16629
123 Ga0068866_10023252 3300005718 Bacteria 2880
124 Ga0068861_100000671 3300005719 Bacteria 20372
125 Ga0068861_100019822 3300005719 Bacteria 4807
126 Ga0068861_100156491 3300005719 Bacteria 1875
127 Ga0068861_100429810 3300005719 Bacteria 1178
128 Ga0068870_10095922 3300005840 Bacteria 1667
129 Ga0068863_100000189 3300005841 Bacteria 65435
130 Ga0068863_100000833 3300005841 Bacteria 30909
131 Ga0068858_100000014 3300005842 Bacteria 214686
132 Ga0068858_100008568 3300005842 Bacteria 9820
133 Ga0068858_100009472 3300005842 Bacteria 9289
134 Ga0068858_100209104 3300005842 Bacteria 1846
135 Ga0068858_100223656 3300005842 Bacteria 1783
136 Ga0068858_100272920 3300005842 Bacteria 1609
137 Ga0068860_100000174 3300005843 Bacteria 105338
138 Ga0068860_100001236 3300005843 Bacteria 27875
139 Ga0068860_100209743 3300005843 Bacteria 1889
140 Ga0068862_100000009 3300005844 Bacteria 298620
141 Ga0068862_100000019 3300005844 Bacteria 229485
142 Ga0068862_100008993 3300005844 Bacteria 8268
143 Ga0068862_100072262 3300005844 Bacteria 2980
144 Ga0068862_100162505 3300005844 Bacteria 1994
145 Ga0081455_10001610 3300005937 Bacteria 27562
146 Ga0081455_10020131 3300005937 Bacteria 6294
147 Ga0081455_10022912 3300005937 Bacteria 5822
148 Ga0081455_10087959 3300005937 Bacteria 2526
149 Ga0081455_10212614 3300005937 Bacteria 1440
150 Ga0081538_10000927 3300005981 Bacteria 31625
151 Ga0081538_10003181 3300005981 Bacteria 15594
152 Ga0081538_10007006 3300005981 Bacteria 9807
153 Ga0081538_10007094 3300005981 Bacteria 9735
154 Ga0081538_10007779 3300005981 Bacteria 9208
155 Ga0081538_10009238 3300005981 Bacteria 8257
156 Ga0081538_10043924 3300005981 Bacteria 2797
157 Ga0081540_1015573 3300005983 Bacteria 4809
158 Ga0081540_1058775 3300005983 Bacteria 1850
159 Ga0081539_10000256 3300005985 Bacteria 122838
160 Ga0081539_10000424 3300005985 Bacteria 89967
161 Ga0081539_10002011 3300005985 Bacteria 30800
162 Ga0081539_10010650 3300005985 Bacteria 7422
163 Ga0081539_10064620 3300005985 Bacteria 1990
164 Ga0070717_10005059 3300006028 Bacteria 9611
165 Ga0070717_10057268 3300006028 Bacteria 3222
166 Ga0070717_10074143 3300006028 Bacteria 2845
167 Ga0075365_10009152 3300006038 Bacteria 5674
168 Ga0075365_10068328 3300006038 Bacteria 2387
169 Ga0075365_10162947 3300006038 Bacteria 1554
170 Ga0075368_10042061 3300006042 Bacteria 1797
171 Ga0075363_100000960 3300006048 Bacteria 10237
172 Ga0075363_100001005 3300006048 Bacteria 10113
173 Ga0075363_100099383 3300006048 Bacteria 1609
174 Ga0075363_100116335 3300006048 Bacteria 1489
175 Ga0075363_100165068 3300006048 Bacteria 1255
176 Ga0075364_10006557 3300006051 Bacteria 6847
177 Ga0075364_10020556 3300006051 Bacteria 4153
178 Ga0075364_10051397 3300006051 Bacteria 2692
179 Ga0075432_10067546 3300006058 Bacteria 1281
180 Ga0070716_100008409 3300006173 Bacteria 5119
181 Ga0070712_100001020 3300006175 Bacteria 16891
182 Ga0070712_100064076 3300006175 Bacteria 2605
183 Ga0070712_100075006 3300006175 Bacteria 2431
184 Ga0075367_10000123 3300006178 Bacteria 22531
185 Ga0075369_10002320 3300006186 Bacteria 6767
186 Ga0075369_10005620 3300006186 Bacteria 4696
187 Ga0075369_10018741 3300006186 Bacteria 2820
188 Ga0075369_10056399 3300006186 Bacteria 1707
189 Ga0075369_10058207 3300006186 Bacteria 1682
190 Ga0075369_10150251 3300006186 Bacteria 1064
191 Ga0097621_100136590 3300006237 Bacteria 2092
192 Ga0097621_100550660 3300006237 Bacteria 1050
193 Ga0075370_10022826 3300006353 Bacteria 3440
194 Ga0075370_10035285 3300006353 Bacteria 2806
195 Ga0075370_10071153 3300006353 Bacteria 1990
196 Ga0075370_10212847 3300006353 Bacteria 1141
197 Ga0068871_100126997 3300006358 Bacteria 2159
198 Ga0075431_100275306 3300006847 Bacteria 1705
199 Ga0075434_100106111 3300006871 Bacteria 2819
200 Ga0075429_100189876 3300006880 Bacteria 1800
201 Ga0068865_100013059 3300006881 Bacteria 5238
202 Ga0068865_100133007 3300006881 Bacteria 1866
203 Ga0075436_100010389 3300006914 Bacteria 6379
204 Ga0097620_100000134 3300006931 Bacteria 69536
205 Ga0097620_100002049 3300006931 Bacteria 20587
206 Ga0097620_100015497 3300006931 Bacteria 7660
207 Ga0097620_100501108 3300006931 Bacteria 1309
208 Ga0075435_100029787 3300007076 Bacteria 4286
209 Ga0105250_10058136 3300009092 Bacteria 1552
210 Ga0105240_10304768 3300009093 Bacteria 1821
211 Ga0111539_10001616 3300009094 Bacteria 30103
212 Ga0111539_10245169 3300009094 Bacteria 2086
213 Ga0111539_10458410 3300009094 Bacteria 1485
214 Ga0105245_10006195 3300009098 Bacteria 10528
215 Ga0105245_10084748 3300009098 Bacteria 2904
216 Ga0105245_10149004 3300009098 Bacteria 2210
217 Ga0105245_10727307 3300009098 Bacteria 1027
218 Ga0105247_10000023 3300009101 Bacteria 215645
219 Ga0105247_10000335 3300009101 Bacteria 41099
220 Ga0105247_10000864 3300009101 Bacteria 22922
221 Ga0105247_10001279 3300009101 Bacteria 18560
222 Ga0105247_10208866 3300009101 Bacteria 1316
223 Ga0105247_10387827 3300009101 Bacteria 992
224 Ga0105243_10003250 3300009148 Bacteria 13240
225 Ga0105243_10566692 3300009148 Bacteria 1088
226 Ga0105243_10810457 3300009148 Bacteria 924
227 Ga0105241_10011583 3300009174 Bacteria 6466
228 Ga0105241_10183085 3300009174 Bacteria 1739
229 Ga0105242_10003744 3300009176 Bacteria 11816
230 Ga0105242_10055349 3300009176 Bacteria 3245
231 Ga0105248_10000111 3300009177 Bacteria 91627
232 Ga0105248_10000557 3300009177 Bacteria 42285
233 Ga0105248_10002739 3300009177 Bacteria 19567
234 Ga0105248_10221983 3300009177 Bacteria 2127
235 Ga0105237_10023752 3300009545 Bacteria 6276
236 Ga0105237_10056472 3300009545 Bacteria 3930
237 Ga0105238_10345085 3300009551 Bacteria 1477
238 Ga0105249_10000033 3300009553 Bacteria 213834
239 Ga0105249_10006292 3300009553 Bacteria 10314
240 Ga0105249_10008171 3300009553 Bacteria 9120
241 Ga0105249_10113955 3300009553 Bacteria 2559
242 Ga0105249_10634440 3300009553 Bacteria 1125
243 Ga0105249_10639138 3300009553 Bacteria 1121
244 Ga0099796_10019399 3300010159 Bacteria 2060
245 Ga0105239_10009697 3300010375 Bacteria 10827
246 Ga0105239_10367611 3300010375 Bacteria 1625
247 Ga0105246_10094339 3300011119 Bacteria 2164
248 Ga0105246_10134630 3300011119 Bacteria 1850
249 Ga0105246_10364338 3300011119 Bacteria 1189
250 Ga0157371_10336534 3300013102 Bacteria 1097
251 Ga0157370_10285810 3300013104 Bacteria 1524
252 Ga0157369_10116239 3300013105 Bacteria 2840
253 Ga0157369_10248916 3300013105 Bacteria 1855
254 Ga0157374_10003977 3300013296 Bacteria 12419
255 Ga0157374_10063104 3300013296 Bacteria 3475
256 Ga0157374_10158206 3300013296 Bacteria 2206
257 Ga0157378_10008995 3300013297 Bacteria 8694
258 Ga0157378_10342351 3300013297 Bacteria 1459
259 Ga0163162_10043832 3300013306 Bacteria 4479
260 Ga0163162_10064518 3300013306 Bacteria 3707
261 Ga0163162_10153933 3300013306 Bacteria 2418
262 Ga0163162_10261893 3300013306 Bacteria 1861
263 Ga0157372_10475564 3300013307 Bacteria 1457
264 Ga0157372_10530889 3300013307 Bacteria 1372
265 Ga0163163_10012428 3300014325 Bacteria 7756
266 Ga0163163_10016062 3300014325 Bacteria 6943
267 Ga0163163_10119081 3300014325 Bacteria 2673
268 Ga0157380_10001016 3300014326 Bacteria 17845
269 Ga0157380_10095822 3300014326 Bacteria 2459
270 Ga0182008_10162084 3300014497 Bacteria 1126
271 Ga0157377_10015911 3300014745 Bacteria 3858
272 Ga0157377_10060232 3300014745 Bacteria 2166
273 Ga0157377_10195281 3300014745 Bacteria 1281
274 Ga0157379_10000701 3300014968 Bacteria 27163
275 Ga0157379_10040777 3300014968 Bacteria 4145
276 Ga0157379_10062736 3300014968 Bacteria 3323
277 Ga0157379_10800662 3300014968 Bacteria 890
278 Ga0157376_10216351 3300014969 Bacteria 1772
279 Ga0163161_10002273 3300017792 Bacteria 13778
280 Ga0163161_10050163 3300017792 Bacteria 3020
281 Ga0197907_10138387 3300020069 Bacteria 1612
282 Ga0197907_10164538 3300020069 Bacteria 5320
283 Ga0206356_10142785 3300020070 Bacteria 1195
284 Ga0206356_10784647 3300020070 Bacteria 1724
285 Ga0206349_1441571 3300020075 Bacteria 2636
286 Ga0206355_1590120 3300020076 Bacteria 1952
287 Ga0206351_10342753 3300020077 Bacteria 4692
288 Ga0206351_10861399 3300020077 Bacteria 2535
289 Ga0206351_10883250 3300020077 Bacteria 1167
290 Ga0206352_10462433 3300020078 Bacteria 2648
291 Ga0206352_10839311 3300020078 Bacteria 2303
292 Ga0206350_10364331 3300020080 Bacteria 4920
293 Ga0206350_11454667 3300020080 Bacteria 4242
294 Ga0206353_10025707 3300020082 Bacteria 2293
295 Ga0206353_10380294 3300020082 Bacteria 1314
296 Ga0206353_10985316 3300020082 Bacteria 4917
297 Ga0154015_1204111 3300020610 Bacteria 1422
298 Ga0154015_1334133 3300020610 Bacteria 1920
299 Ga0154015_1356031 3300020610 Bacteria 1986
300 Ga0213876_10002715 3300021384 Bacteria 10304
301 Ga0213875_10001331 3300021388 Bacteria 16269
302 Ga0213875_10015787 3300021388 Bacteria 3671
303 Ga0224712_10001641 3300022467 Bacteria 5263
304 Ga0224712_10004633 3300022467 Bacteria 3730
305 Ga0209051_1000057 3300025303 Bacteria 263902
306 Ga0209051_1000840 3300025303 Bacteria 31631
307 Ga0207656_10144121 3300025321 Bacteria 1124
308 Ga0207653_10039748 3300025885 Bacteria 1541
309 Ga0207692_10024484 3300025898 Bacteria 2807
310 Ga0207642_10000950 3300025899 Bacteria 9058
311 Ga0207710_10000010 3300025900 Bacteria 482087
312 Ga0207710_10000027 3300025900 Bacteria 307001
313 Ga0207710_10000035 3300025900 Bacteria 253729
314 Ga0207710_10000169 3300025900 Bacteria 67027
315 Ga0207710_10005078 3300025900 Bacteria 5695
316 Ga0207710_10033045 3300025900 Bacteria 2268
317 Ga0207688_10000298 3300025901 Bacteria 22742
318 Ga0207688_10001099 3300025901 Bacteria 13864
319 Ga0207688_10150079 3300025901 Bacteria 1376
320 Ga0207680_10018611 3300025903 Bacteria 3697
321 Ga0207647_10030802 3300025904 Bacteria 3458
322 Ga0207647_10082320 3300025904 Bacteria 1928
323 Ga0207647_10131933 3300025904 Bacteria 1468
324 Ga0207647_10135487 3300025904 Bacteria 1445
325 Ga0207685_10040604 3300025905 Bacteria 1735
326 Ga0207645_10002891 3300025907 Bacteria 13286
327 Ga0207643_10029382 3300025908 Bacteria 3057
328 Ga0207643_10108777 3300025908 Bacteria 1631
329 Ga0207643_10162419 3300025908 Bacteria 1344
330 Ga0207705_10053803 3300025909 Bacteria 2901
331 Ga0207705_10158431 3300025909 Bacteria 1699
332 Ga0207654_10150448 3300025911 Bacteria 1493
333 Ga0207707_10065555 3300025912 Bacteria 3163
334 Ga0207707_10090182 3300025912 Bacteria 2679
335 Ga0207695_10010135 3300025913 Bacteria 11564
336 Ga0207693_10009379 3300025915 Bacteria 7982
337 Ga0207693_10009544 3300025915 Bacteria 7902
338 Ga0207693_10299375 3300025915 Bacteria 1260
339 Ga0207663_10010760 3300025916 Bacteria 4884
340 Ga0207663_10012044 3300025916 Bacteria 4663
341 Ga0207660_10128317 3300025917 Bacteria 1928
342 Ga0207662_10078508 3300025918 Bacteria 2009
343 Ga0207662_10097511 3300025918 Bacteria 1817
344 Ga0207657_10034090 3300025919 Bacteria 4582
345 Ga0207657_10315307 3300025919 Bacteria 1237
346 Ga0207649_10031520 3300025920 Bacteria 3152
347 Ga0207652_10009033 3300025921 Bacteria 8029
348 Ga0207652_10314055 3300025921 Bacteria 1415
349 Ga0207681_10079897 3300025923 Bacteria 2305
350 Ga0207681_10217496 3300025923 Bacteria 1476
351 Ga0207694_10042292 3300025924 Bacteria 3515
352 Ga0207694_10245281 3300025924 Bacteria 1465
353 Ga0207659_10010045 3300025926 Bacteria 5929
354 Ga0207659_10172390 3300025926 Bacteria 1708
355 Ga0207687_10006588 3300025927 Bacteria 7660
356 Ga0207687_10009588 3300025927 Bacteria 6329
357 Ga0207687_10123981 3300025927 Bacteria 1936
358 Ga0207687_10189067 3300025927 Bacteria 1601
359 Ga0207700_10021743 3300025928 Bacteria 4386
360 Ga0207700_10206097 3300025928 Bacteria 1660
361 Ga0207700_10255813 3300025928 Bacteria 1498
362 Ga0207664_10119237 3300025929 Bacteria 2206
363 Ga0207664_10240465 3300025929 Bacteria 1576
364 Ga0207664_10269155 3300025929 Bacteria 1492
365 Ga0207644_10005414 3300025931 Bacteria 8323
366 Ga0207644_10105197 3300025931 Bacteria 2126
367 Ga0207644_10199132 3300025931 Bacteria 1579
368 Ga0207690_10034524 3300025932 Bacteria 3260
369 Ga0207690_10068989 3300025932 Bacteria 2431
370 Ga0207706_10030955 3300025933 Bacteria 4771
371 Ga0207706_10050689 3300025933 Bacteria 3668
372 Ga0207706_10129417 3300025933 Bacteria 2220
373 Ga0207706_10331279 3300025933 Bacteria 1324
374 Ga0207706_10422822 3300025933 Bacteria 1154
375 Ga0207709_10004200 3300025935 Bacteria 8359
376 Ga0207709_10132174 3300025935 Bacteria 1702
377 Ga0207709_10309691 3300025935 Bacteria 1178
378 Ga0207670_10007082 3300025936 Bacteria 6244
379 Ga0207669_10003926 3300025937 Bacteria 6486
380 Ga0207669_10148192 3300025937 Bacteria 1640
381 Ga0207669_10208931 3300025937 Bacteria 1423
382 Ga0207704_10000259 3300025938 Bacteria 25518
383 Ga0207665_10038269 3300025939 Bacteria 3193
384 Ga0207665_10171719 3300025939 Bacteria 1566
385 Ga0207691_10335222 3300025940 Bacteria 1295
386 Ga0207691_10375232 3300025940 Bacteria 1215
387 Ga0207711_10000089 3300025941 Bacteria 97575
388 Ga0207711_10000605 3300025941 Bacteria 36233
389 Ga0207711_10006034 3300025941 Bacteria 10239
390 Ga0207711_10006477 3300025941 Bacteria 9855
391 Ga0207711_10093462 3300025941 Bacteria 2649
392 Ga0207689_10002494 3300025942 Bacteria 17101
393 Ga0207661_10024630 3300025944 Bacteria 4563
394 Ga0207661_10042838 3300025944 Bacteria 3570
395 Ga0207661_10250697 3300025944 Bacteria 1573
396 Ga0207661_10313150 3300025944 Bacteria 1409
397 Ga0207661_10479596 3300025944 Bacteria 1135
398 Ga0207661_10578585 3300025944 Bacteria 1030
399 Ga0207679_10051683 3300025945 Bacteria 3009
400 Ga0207679_10093173 3300025945 Bacteria 2335
401 Ga0207679_10233997 3300025945 Bacteria 1553
402 Ga0207667_10076811 3300025949 Bacteria 3465
403 Ga0207667_10177133 3300025949 Bacteria 2190
404 Ga0207667_10185357 3300025949 Bacteria 2137
405 Ga0207651_10527955 3300025960 Bacteria 1024
406 Ga0207712_10000031 3300025961 Bacteria 213662
407 Ga0207712_10005734 3300025961 Bacteria 7826
408 Ga0207712_10220291 3300025961 Bacteria 1517
409 Ga0207668_10000408 3300025972 Bacteria 27061
410 Ga0207668_10014418 3300025972 Bacteria 4892
411 Ga0207668_10033738 3300025972 Bacteria 3392
412 Ga0207668_10289736 3300025972 Bacteria 1346
413 Ga0207658_10002658 3300025986 Bacteria 12945
414 Ga0207658_10008494 3300025986 Bacteria 6988
415 Ga0207658_10033165 3300025986 Bacteria 3681
416 Ga0207658_10042675 3300025986 Bacteria 3292
417 Ga0207658_10292970 3300025986 Bacteria 1399
418 Ga0207677_10006496 3300026023 Bacteria 6423
419 Ga0207677_10023533 3300026023 Bacteria 3808
420 Ga0207677_10073088 3300026023 Bacteria 2427
421 Ga0207703_10000005 3300026035 Bacteria 506356
422 Ga0207703_10005856 3300026035 Bacteria 9847
423 Ga0207703_10012404 3300026035 Bacteria 6642
424 Ga0207703_10082485 3300026035 Bacteria 2683
425 Ga0207703_10182543 3300026035 Bacteria 1852
426 Ga0207703_10490280 3300026035 Bacteria 1152
427 Ga0207639_10002094 3300026041 Bacteria 13433
428 Ga0207678_10010534 3300026067 Bacteria 8119
429 Ga0207678_10019979 3300026067 Bacteria 5887
430 Ga0207678_10027774 3300026067 Bacteria 4940
431 Ga0207678_10128426 3300026067 Bacteria 2162
432 Ga0207708_10012670 3300026075 Bacteria 6288
433 Ga0207708_10016979 3300026075 Bacteria 5480
434 Ga0207708_10085568 3300026075 Bacteria 2425
435 Ga0207708_10153439 3300026075 Bacteria 1815
436 Ga0207702_10082105 3300026078 Bacteria 2802
437 Ga0207702_10346742 3300026078 Bacteria 1420
438 Ga0207641_10001086 3300026088 Bacteria 27378
439 Ga0207641_10001166 3300026088 Bacteria 26450
440 Ga0207641_10009378 3300026088 Bacteria 8065
441 Ga0207641_10188505 3300026088 Bacteria 1894
442 Ga0207648_10005843 3300026089 Bacteria 12320
443 Ga0207648_10053292 3300026089 Bacteria 3536
444 Ga0207648_10158836 3300026089 Bacteria 1996
445 Ga0207648_10210479 3300026089 Bacteria 1726
446 Ga0207648_10272233 3300026089 Bacteria 1513
447 Ga0207676_10311038 3300026095 Bacteria 1442
448 Ga0207676_10757192 3300026095 Bacteria 945
449 Ga0207674_10005413 3300026116 Bacteria 15177
450 Ga0207674_10082270 3300026116 Bacteria 3221
451 Ga0207674_10086919 3300026116 Bacteria 3121
452 Ga0207674_10161410 3300026116 Bacteria 2195
453 Ga0207675_100001181 3300026118 Bacteria 25992
454 Ga0207675_100079791 3300026118 Bacteria 3067
455 Ga0207675_100114755 3300026118 Bacteria 2544
456 Ga0207675_100122167 3300026118 Bacteria 2465
457 Ga0207675_100200125 3300026118 Bacteria 1918
458 Ga0207683_10001691 3300026121 Bacteria 19748
459 Ga0207683_10030388 3300026121 Bacteria 4681
460 Ga0207683_10140612 3300026121 Bacteria 2175
461 Ga0207683_10238610 3300026121 Bacteria 1658
462 Ga0207683_10275097 3300026121 Bacteria 1538
463 Ga0207683_10321754 3300026121 Bacteria 1417
464 Ga0207698_10030924 3300026142 Bacteria 3858
465 Ga0207698_10060704 3300026142 Bacteria 2942
466 Ga0207698_10586865 3300026142 Bacteria 1097
467 Ga0207698_10616809 3300026142 Bacteria 1071
468 Ga0207428_10018411 3300027907 Bacteria 5968
469 Ga0268266_10090810 3300028379 Bacteria 2677
470 Ga0268266_10124476 3300028379 Bacteria 2298
471 Ga0268266_10230640 3300028379 Bacteria 1705
472 Ga0268265_10000029 3300028380 Bacteria 229499
473 Ga0268265_10000050 3300028380 Bacteria 175787
474 Ga0268265_10023069 3300028380 Bacteria 4382
475 Ga0268265_10031124 3300028380 Bacteria 3852
476 Ga0268265_10145402 3300028380 Bacteria 1991
477 Ga0268265_10658567 3300028380 Bacteria 1007
478 Ga0268264_10000236 3300028381 Bacteria 105352
479 Ga0268264_10014360 3300028381 Bacteria 6511
480 Ga0268264_10070656 3300028381 Bacteria 2956
481 Ga0268264_10211079 3300028381 Bacteria 1782
482 Ga0307517_10001164 3300028786 Bacteria 44365
483 Ga0307515_10000883 3300028794 Bacteria 68971
484 Ga0307511_10082473 3300030521 Bacteria 2248
485 Ga0265327_10002217 3300031251 Bacteria 21198
486 Ga0307408_100016830 3300031548 Bacteria 4887
487 Ga0307408_100064187 3300031548 Bacteria 2689
488 Ga0307408_100098885 3300031548 Bacteria 2219
489 Ga0307508_10193221 3300031616 Bacteria 1636
490 Ga0307514_10007338 3300031649 Bacteria 9502
491 Ga0307516_10005181 3300031730 Bacteria 15706
492 Ga0307516_10007141 3300031730 Bacteria 12894
493 Ga0307516_10023699 3300031730 Bacteria 6282
494 Ga0307405_10015905 3300031731 Bacteria 4088
495 Ga0307405_10081833 3300031731 Bacteria 2112
496 Ga0307405_10107468 3300031731 Bacteria 1883
497 Ga0307405_10445334 3300031731 Bacteria 1025
498 Ga0307413_10010833 3300031824 Bacteria 4447
499 Ga0307413_10031735 3300031824 Bacteria 2985
500 Ga0307413_10057231 3300031824 Bacteria 2383
501 Ga0307413_10310879 3300031824 Bacteria 1199
502 Ga0307410_10019957 3300031852 Bacteria 4089
503 Ga0307410_10175865 3300031852 Bacteria 1617
504 Ga0307410_10252171 3300031852 Bacteria 1372
505 Ga0326468_10000024 3300031889 Bacteria 11908
506 Ga0326468_10001396 3300031889 Bacteria 2100
507 Ga0307406_10024588 3300031901 Bacteria 3600
508 Ga0307406_10041370 3300031901 Bacteria 2871
509 Ga0307406_10093893 3300031901 Bacteria 2027
510 Ga0307406_10208689 3300031901 Bacteria 1443
511 Ga0307407_10034939 3300031903 Bacteria 2757
512 Ga0307412_10042639 3300031911 Bacteria 2950
513 Ga0307412_10345204 3300031911 Bacteria 1193
514 Ga0307409_100001399 3300031995 Bacteria 11795
515 Ga0307409_100002234 3300031995 Bacteria 10003
516 Ga0307409_100004802 3300031995 Bacteria 7667
517 Ga0307409_100088604 3300031995 Bacteria 2527
518 Ga0307409_100179070 3300031995 Bacteria 1875
519 Ga0307416_100000560 3300032002 Bacteria 19013
520 Ga0307416_100018292 3300032002 Bacteria 4932
521 Ga0307416_100048291 3300032002 Bacteria 3375
522 Ga0307416_100195112 3300032002 Bacteria 1914
523 Ga0307416_100222056 3300032002 Bacteria 1813
524 Ga0307414_10017217 3300032004 Bacteria 4416
525 Ga0307414_10186247 3300032004 Bacteria 1675
526 Ga0307411_10013884 3300032005 Bacteria 4463
527 Ga0307415_100000569 3300032126 Bacteria 16187
528 Ga0307415_100015820 3300032126 Bacteria 4479
529 Ga0307415_100042696 3300032126 Bacteria 3019
530 Ga0307415_100044653 3300032126 Bacteria 2964
531 Ga0307415_100056453 3300032126 Bacteria 2692
532 Ga0307415_100100587 3300032126 Bacteria 2119
533 Ga0307415_100162214 3300032126 Bacteria 1734
534 Ga0307415_100242563 3300032126 Bacteria 1458
535 Ga0307415_100339830 3300032126 Bacteria 1259
536 Ga0307415_100494750 3300032126 Bacteria 1067
537 Ga0307507_10019583 3300033179 Bacteria 7616
538 Ga0307507_10231306 3300033179 Bacteria 1225
539 Ga0307510_10305145 3300033180 Bacteria 1053
540 Ga0373932_0024314 3300035112 Bacteria 1630
541 Ga0373932_0103668 3300035112 Bacteria 929
542 Ga0373942_0000130 3300035207 Bacteria 17733
543 Ga0373962_0002006 3300035242 Bacteria 4852
544 Ga0373935_0017067 3300035692 Bacteria 4398
545 Ga0395899_0083486 3300037312 Bacteria 2323
546 Ga0395898_0032987 3300037466 Bacteria 5169
547 Ga0395905_0063971 3300037471 Bacteria 3442
548 Ga0395905_0124577 3300037471 Bacteria 2423
549 Ga0436364_0032767 3300037853 Bacteria 3940
550 Ga0436364_0177961 3300037853 Bacteria 37248
551 Ga0436364_0423427 3300037853 Bacteria 28417
552 Ga0436364_0918955 3300037853 Bacteria 3061
553 Ga0436364_1435407 3300037853 Bacteria 3883
554 Ga0395901_0001169 3300038443 Bacteria 27889
555 Ga0395901_0651256 3300038443 Bacteria 1057
556 Ga0436365_1083994 3300039437 Bacteria 225582
557 Ga0436365_1211143 3300039437 Bacteria 11027
558 Ga0436365_1544123 3300039437 Bacteria 29426
559 Ga0436360_0460535 3300039438 Bacteria 1487
560 Ga0439436_0005008 3300041404 Bacteria 4060
561 Ga0439436_0025436 3300041404 Bacteria 1738
562 Ga0439439_0002809 3300041406 Bacteria 3756
563 Ga0439461_0000759 3300041410 Bacteria 4717
564 Ga0439466_0001646 3300041411 Bacteria 8741
565 Ga0439466_0046696 3300041411 Bacteria 1429
566 Ga0439465_0002076 3300041413 Bacteria 6574
567 Ga0439433_0002902 3300041999 Bacteria 3669
568 Ga0439442_009028 3300042002 Bacteria 2015
569 Ga0439442_015909 3300042002 Bacteria 1550
570 Ga0439445_0008638 3300042004 Bacteria 2386
571 Ga0439448_0000544 3300042005 Bacteria 8785
572 Ga0439449_0004579 3300042007 Bacteria 5345
573 Ga0439449_0015223 3300042007 Bacteria 2890
574 Ga0439451_014983 3300042009 Bacteria 1563
575 Ga0439456_002526 3300042013 Bacteria 3686
576 Ga0439457_001263 3300042014 Bacteria 7583
577 Ga0439457_002746 3300042014 Bacteria 4946
578 Ga0439462_0023041 3300042015 Bacteria 1631
579 Ga0439463_001659 3300042016 Bacteria 5864
580 Ga0450894_000134 3300042131 Bacteria 12966
581 Ga0450898_001094 3300042134 Bacteria 3454
582 Ga0450904_002255 3300042139 Bacteria 2346
583 Ga0450906_002132 3300042145 Bacteria 4325
584 Ga0450908_006979 3300042184 Bacteria 2138
585 Ga0439444_0004278 3300042437 Bacteria 2067
586 Ga0439464_0002713 3300042439 Bacteria 4389
587 Ga0439464_0068920 3300042439 Bacteria 1044
588 Ga0439460_0002006 3300042461 Bacteria 4873
589 Ga0439440_0003695 3300042993 Bacteria 2971
590 Ga0439440_0009200 3300042993 Bacteria 2043
591 Ga0466969_0039913 3300044656 Bacteria 2355
592 Ga0466972_0119010 3300044658 Bacteria 1246
593 Ga0466965_0042151 3300044683 Bacteria 2250
594 Ga0466966_0005219 3300044684 Bacteria 8538
595 Ga0466966_0069792 3300044684 Bacteria 2204
596 Ga0466966_0101801 3300044684 Bacteria 1776
597 Ga0466961_0031454 3300044693 Bacteria 3411
598 Ga0466963_0045022 3300044694 Bacteria 2905
599 Ga0466963_0087432 3300044694 Bacteria 2119
600 Ga0466971_0036263 3300044719 Bacteria 2212
601 Ga0466968_0002409 3300044735 Bacteria 6855
602 Ga0466968_0105304 3300044735 Bacteria 1263
603 Ga0466970_0008763 3300044765 Bacteria 5097
604 Ga0466970_0046140 3300044765 Bacteria 2321
605 Ga0466970_0051168 3300044765 Unclassified 2204
606 Ga0466970_0304445 3300044765 Bacteria 899
607 Ga0466957_0042147 3300044842 Bacteria 2761
608 Ga0466960_0002025 3300044901 Bacteria 7523
609 Ga0466960_0045500 3300044901 Bacteria 2097
610 Ga0466959_0003962 3300045049 Bacteria 9839
611 Ga0466958_0009520 3300045836 Bacteria 5416
612 Ga0466958_0014730 3300045836 Bacteria 4466
613 Ga0466958_0032757 3300045836 Bacteria 3093
614 Ga0466958_0140735 3300045836 Bacteria 1519
615 Ga0466958_0273884 3300045836 Bacteria 1081
616 Ga0466967_0035598 3300045976 Bacteria 4241
617 Ga0466967_0077041 3300045976 Bacteria 3001
618 Ga0466967_0272725 3300045976 Bacteria 1621
619 Ga0466967_0273571 3300045976 Bacteria 1619
620 Ga0466967_0318253 3300045976 Bacteria 1500
621 Ga0466967_0562572 3300045976 Bacteria 1123
622 Ga0495603_0132418 3300046455 Bacteria 1451
623 Ga0495638_0013732 3300046460 Bacteria 5502
624 Ga0495594_0233039 3300046499 Bacteria 1049
625 Ga0495643_0004303 3300046522 Bacteria 10031
626 Ga0495648_0035570 3300046524 Bacteria 3227
627 Ga0495609_0087525 3300046538 Bacteria 1357
628 Ga0495645_0234315 3300046543 Bacteria 1228
629 Ga0495588_0141763 3300046674 Bacteria 1270
630 Ga0495657_0022884 3300046675 Bacteria 4471
631 Ga0495623_0082943 3300046679 Bacteria 1980
632 Ga0495613_0057280 3300046689 Bacteria 2861
633 Ga0495613_0141747 3300046689 Bacteria 1717
634 Ga0495624_0091296 3300046690 Bacteria 1879
635 Ga0495670_0039733 3300046691 Bacteria 2346
636 Ga0495670_0070897 3300046691 Bacteria 1764
637 Ga0495670_0104173 3300046691 Bacteria 1464
638 Ga0495649_0246127 3300046694 Bacteria 919
639 Ga0495600_0349640 3300046809 Bacteria 926
640 Ga0495660_0056153 3300046810 Bacteria 2129
641 Ga0495581_0012834 3300047315 Bacteria 4853
642 Ga0495604_0006369 3300047317 Bacteria 9362
643 Ga0495636_0002703 3300047318 Bacteria 6843
644 Ga0495672_0016422 3300047320 Bacteria 4989
645 Ga0495672_0087428 3300047320 Bacteria 1721
646 Ga0495683_0043999 3300047323 Bacteria 2246
647 Ga0495675_0043768 3300047444 Bacteria 2852
648 Ga0495685_000690 3300047447 Bacteria 10311
649 Ga0495685_059784 3300047447 Bacteria 1286
650 Ga0495681_0001547 3300047470 Bacteria 17173
651 Ga0496100_0000077 3300048903 Bacteria 54852
652 Ga0496100_0018315 3300048903 Bacteria 4152
653 Ga0496100_0025627 3300048903 Bacteria 3608
654 Ga0496100_0029147 3300048903 Bacteria 3412
655 Ga0496100_0098789 3300048903 Bacteria 2007
656 Ga0496101_0000042 3300048904 Bacteria 163148
657 Ga0496101_0004926 3300048904 Bacteria 8472
658 Ga0496101_0031562 3300048904 Bacteria 3726
659 Ga0496101_0040473 3300048904 Bacteria 3319
660 Ga0496101_0356773 3300048904 Bacteria 1149
661 Ga0496102_0000205 3300048905 Bacteria 79771
662 Ga0496102_0002438 3300048905 Bacteria 15864
663 Ga0496102_0003855 3300048905 Bacteria 12702
664 Ga0496102_0008636 3300048905 Bacteria 8743
665 Ga0496102_0032380 3300048905 Bacteria 4696
666 Ga0496102_0043348 3300048905 Bacteria 4079
667 Ga0496102_0258876 3300048905 Bacteria 1640
668 Ga0496103_0000315 3300048906 Bacteria 44709
669 Ga0496103_0000751 3300048906 Bacteria 23896
670 Ga0496103_0001957 3300048906 Bacteria 13324
671 Ga0496103_0026574 3300048906 Bacteria 3503
672 Ga0496103_0150061 3300048906 Bacteria 1493
673 Ga0496104_0048840 3300048907 Bacteria 3990
674 Ga0496105_0091491 3300048908 Bacteria 2512
675 Ga0496105_0161901 3300048908 Bacteria 1837
676 Ga0496105_0240028 3300048908 Bacteria 1471
677 Ga0496106_0000103 3300048909 Bacteria 65242
678 Ga0496106_0003070 3300048909 Bacteria 12451
679 Ga0496106_0104259 3300048909 Bacteria 2202
680 Ga0496107_0000558 3300048910 Bacteria 20825
681 Ga0496107_0016029 3300048910 Bacteria 5258
682 Ga0496107_0044153 3300048910 Bacteria 3203
683 Ga0496107_0077432 3300048910 Bacteria 2422
684 Ga0496107_0086828 3300048910 Bacteria 2284
685 Ga0496107_0175438 3300048910 Bacteria 1591
686 Ga0496108_0000916 3300048911 Bacteria 22967
687 Ga0496109_0000312 3300048912 Bacteria 45661
688 Ga0496109_0021301 3300048912 Bacteria 5731
689 Ga0496109_0033108 3300048912 Bacteria 4649
690 Ga0496110_0013273 3300048913 Bacteria 6803
691 Ga0496110_0191579 3300048913 Bacteria 1857
692 Ga0496110_0313728 3300048913 Bacteria 1428
693 Ga0496111_0002512 3300048914 Bacteria 11066
694 Ga0496111_0084517 3300048914 Bacteria 2320
695 Ga0496112_0040858 3300048915 Bacteria 4536
696 Ga0496112_0042718 3300048915 Bacteria 4436
697 Ga0496112_0193900 3300048915 Bacteria 1993
698 Ga0496113_0068985 3300048916 Bacteria 2684
699 Ga0496114_0000309 3300048917 Bacteria 35722
700 Ga0496114_0001352 3300048917 Bacteria 18588
701 Ga0496114_0043703 3300048917 Bacteria 3715
702 Ga0496114_0152444 3300048917 Bacteria 2006
703 Ga0496115_0001893 3300048918 Bacteria 14983
704 Ga0496115_0026196 3300048918 Bacteria 4548
705 Ga0496116_0000287 3300048919 Bacteria 85981
706 Ga0496116_0032191 3300048919 Bacteria 3741
707 Ga0496117_0000725 3300048920 Bacteria 51801
708 Ga0496117_0011140 3300048920 Bacteria 8086
709 Ga0496118_0001131 3300048921 Bacteria 41154
710 Ga0496118_0002778 3300048921 Bacteria 22922
711 Ga0496118_0108323 3300048921 Bacteria 1852
712 Ga0496119_0000337 3300048922 Bacteria 65601
713 Ga0496119_0001488 3300048922 Bacteria 28066
714 Ga0496119_0008756 3300048922 Bacteria 8825
715 Ga0496120_0000250 3300048923 Bacteria 90632
716 Ga0496120_0020465 3300048923 Bacteria 4204
717 Ga0496121_0000139 3300048924 Bacteria 163176
718 Ga0496121_0014730 3300048924 Bacteria 8262
719 Ga0496121_0071666 3300048924 Bacteria 2785
720 Ga0496122_0000149 3300048925 Bacteria 163504
721 Ga0496122_0209722 3300048925 Bacteria 1130
722 Ga0496123_0011118 3300048926 Bacteria 7850
723 Ga0496124_0000114 3300048927 Bacteria 165215
724 Ga0496124_0099753 3300048927 Bacteria 2354
725 Ga0496125_0000130 3300048928 Bacteria 163176
726 Ga0496125_0039006 3300048928 Bacteria 4099
727 Ga0496125_0087033 3300048928 Bacteria 2361
728 Ga0496126_0000149 3300048929 Bacteria 163176
729 Ga0496126_0014251 3300048929 Bacteria 8044
730 Ga0496126_0040663 3300048929 Bacteria 4309
731 Ga0496126_0070611 3300048929 Bacteria 3111
732 Ga0496126_0231508 3300048929 Bacteria 1548
733 Ga0496126_0409036 3300048929 Bacteria 1099
734 Ga0501031_0069939 3300049568 Bacteria 2286
735 Ga0501032_0000730 3300049569 Bacteria 26674
736 Ga0501032_0027441 3300049569 Bacteria 3912
737 Ga0501033_0055422 3300049570 Bacteria 2931
738 Ga0501034_0001381 3300049571 Bacteria 32655
739 Ga0501034_0429582 3300049571 Bacteria 1241
740 Ga0501034_0597670 3300049571 Bacteria 1009
741 Ga0501036_0007479 3300049572 Bacteria 8907
742 Ga0501036_0038054 3300049572 Bacteria 4070
743 Ga0501036_0115889 3300049572 Bacteria 2263
744 Ga0501037_0007301 3300049573 Bacteria 8079
745 Ga0501037_0009763 3300049573 Bacteria 7047
746 Ga0501037_0024074 3300049573 Bacteria 4502
747 Ga0501038_0003179 3300049574 Bacteria 15312
748 Ga0501038_0035146 3300049574 Bacteria 4401
749 Ga0501039_0002246 3300049575 Bacteria 14315
750 Ga0501039_0029856 3300049575 Bacteria 4200
751 Ga0501039_0039114 3300049575 Bacteria 3663
752 Ga0501040_0001054 3300049576 Bacteria 17474
753 Ga0501040_0103890 3300049576 Bacteria 1984
754 Ga0501041_0000376 3300049577 Bacteria 22319
755 Ga0501042_0000037 3300049578 Bacteria 43512
756 Ga0501043_0000567 3300049579 Bacteria 33043
757 Ga0501046_0000625 3300049580 Bacteria 34675
758 Ga0501046_0001102 3300049580 Bacteria 26442
759 Ga0501047_0012357 3300049581 Bacteria 8083
760 Ga0501047_0041303 3300049581 Bacteria 4457
761 Ga0501047_0323044 3300049581 Bacteria 1383
762 Ga0501048_0002018 3300049582 Bacteria 15410
763 Ga0501048_0037170 3300049582 Bacteria 3496
764 Ga0501067_0064946 3300049583 Bacteria 2020
765 Ga0501067_0163467 3300049583 Bacteria 1240
766 Ga0501068_0003411 3300049584 Bacteria 8550
767 Ga0501068_0206065 3300049584 Bacteria 1248
768 Ga0501068_0289823 3300049584 Bacteria 1047
769 Ga0501069_0092886 3300049585 Bacteria 1707
770 Ga0501070_0007150 3300049586 Bacteria 9485
771 Ga0501071_0012792 3300049587 Bacteria 5706
772 Ga0501071_0015082 3300049587 Bacteria 5298
773 Ga0501074_0011636 3300049590 Bacteria 6395
774 Ga0501075_0013757 3300049591 Bacteria 5783
775 Ga0501076_0018077 3300049592 Bacteria 5367
776 Ga0501077_0007867 3300049593 Bacteria 6583
777 Ga0501243_015058 3300049675 Bacteria 1241
778 Ga0501079_0000524 3300049741 Bacteria 24959
779 Ga0501081_0002265 3300049743 Bacteria 12106
780 Ga0501081_0222341 3300049743 Bacteria 1373
781 Ga0501035_0000407 3300049822 Bacteria 48754
782 Ga0501035_0001095 3300049822 Bacteria 28404
783 Ga0501035_0023137 3300049822 Bacteria 5702
784 Ga0501044_0000554 3300049823 Bacteria 45441
785 Ga0501044_0000771 3300049823 Bacteria 38852
786 Ga0501044_0036089 3300049823 Bacteria 5174
787 Ga0501044_0349348 3300049823 Bacteria 1399
788 Ga0501045_0000908 3300049824 Bacteria 19290
789 nmdc:mga03683_99144_c1 3300050489 Bacteria 1279
790 nmdc:mga03n38_2328_c1 3300050490 Bacteria 5834
791 nmdc:mga03n38_36974_c1 3300050490 Bacteria 2103
792 nmdc:mga00v17_16530_c1 3300050491 Bacteria 4157
793 nmdc:mga00v17_33236_c1 3300050491 Bacteria 3055
794 nmdc:mga00v17_82760_c1 3300050491 Bacteria 2006
795 nmdc:mga0yw44_18180_c1 3300050492 Bacteria 3844
796 nmdc:mga0yw44_18819_c1 3300050492 Bacteria 3792
797 nmdc:mga0yw44_245778_c1 3300050492 Bacteria 1190
798 nmdc:mga0yw44_64485_c1 3300050492 Bacteria 2255
799 nmdc:mga0yw44_96066_c1 3300050492 Bacteria 1881
800 nmdc:mga06z11_185690_c1 3300050494 Bacteria 1201
801 nmdc:mga06z11_2945_c1 3300050494 Bacteria 6555
802 nmdc:mga06z11_44352_c1 3300050494 Bacteria 2242
803 nmdc:mga04h51_5144_c1 3300050495 Bacteria 3316
804 nmdc:mga07m45_27403_c1 3300050496 Bacteria 3138
805 nmdc:mga08y16_205421_c1 3300050511 Bacteria 2041
806 nmdc:mga08y16_443365_c1 3300050511 Bacteria 1325
807 nmdc:mga08y16_56429_c1 3300050511 Bacteria 4105
808 nmdc:mga0n895_16329_c1 3300050512 Bacteria 6809
809 nmdc:mga0rr50_421893_c1 3300050513 Bacteria 1129
810 nmdc:mga08x19_2634_c1 3300050514 Bacteria 10851
811 nmdc:mga0sz30_19838_c1 3300050516 Bacteria 2706
812 nmdc:mga0sz30_25058_c2 3300050516 Bacteria 2052
813 nmdc:mga0sz30_41671_c1 3300050516 Bacteria 1930
814 nmdc:mga0sz30_86992_c1 3300050516 Bacteria 1357
815 Ga0500610_0171133 3300053079 Bacteria 1072
816 Ga0500578_0009672 3300053086 Bacteria 6258
817 Ga0500566_0098871 3300053094 Bacteria 1602
818 Ga0500654_048071 3300053099 Bacteria 2333
819 Ga0500553_033794 3300053101 Bacteria 2543
820 Ga0500580_084609 3300053113 Bacteria 1279
821 Ga0500614_019618 3300053123 Bacteria 1551
822 Ga0500621_110973 3300053126 Bacteria 1071
823 Ga0500628_001445 3300053129 Bacteria 4067
824 Ga0500652_001852 3300053131 Bacteria 6392
825 Ga0500652_006864 3300053131 Bacteria 3692
826 Ga0500658_0010071 3300053134 Bacteria 3489
827 Ga0500559_0177131 3300053136 Bacteria 1004
828 Ga0500579_066362 3300053143 Bacteria 2110
829 Ga0500600_0025708 3300053149 Bacteria 3498
830 Ga0500616_0006180 3300053153 Bacteria 7914
831 Ga0500616_0012979 3300053153 Bacteria 4852
832 Ga0500633_0039723 3300053160 Bacteria 1574
833 Ga0500634_0048886 3300053161 Bacteria 2281
834 Ga0500645_000027 3300053730 Bacteria 124260
835 Ga0500656_001516 3300053732 Bacteria 2011
836 Ga0501084_0001412 3300054114 Bacteria 19016
837 Ga0587084_001810 3300059477 Bacteria 2099
838 Ga0587084_005225 3300059477 Bacteria 1526
839 Ga0587070_003087 3300059491 Bacteria 1962
840 Ga0587070_006734 3300059491 Bacteria 1564
841 Ga0587073_0001083 3300059492 Bacteria 2984
842 Ga0587073_0008309 3300059492 Bacteria 1676
843 Ga0587073_0010568 3300059492 Bacteria 1554
844 Ga0587073_0013845 3300059492 Bacteria 1425
845 Ga0587073_0033745 3300059492 Bacteria 1074
846 Ga0587077_005791 3300059493 Bacteria 1714
847 Ga0587077_011401 3300059493 Bacteria 1397
848 Ga0587077_013365 3300059493 Bacteria 1331
849 Ga0587077_024498 3300059493 Bacteria 1099
850 Ga0587080_001902 3300059503 Bacteria 2370
851 Ga0587080_006380 3300059503 Bacteria 1624
852 Ga0587080_011864 3300059503 Bacteria 1309
853 Ga0587082_001019 3300059504 Bacteria 2713
854 Ga0587082_004182 3300059504 Bacteria 1788
855 Ga0587082_004616 3300059504 Bacteria 1741
856 Ga0587082_005904 3300059504 Bacteria 1611
857 Ga0587082_006413 3300059504 Bacteria 1572
858 Ga0587082_010618 3300059504 Bacteria 1333
859 Ga0587082_026020 3300059504 Bacteria 988
860 Ga0587083_0001326 3300059505 Bacteria 2741
861 Ga0587083_0003648 3300059505 Bacteria 2068
862 Ga0587083_0009769 3300059505 Bacteria 1537
863 Ga0587083_0010943 3300059505 Bacteria 1485
864 Ga0587085_001376 3300059506 Bacteria 2225
865 Ga0587085_025560 3300059506 Bacteria 935
866 Ga0587086_003814 3300059507 Bacteria 1541
867 Ga0587086_004276 3300059507 Bacteria 1484
868 Ga0587088_002262 3300059508 Bacteria 2161
869 Ga0587088_003903 3300059508 Bacteria 1848
870 Ga0587088_013042 3300059508 Bacteria 1268
871 Ga0587089_002814 3300059509 Bacteria 1801
872 Ga0587090_003745 3300059510 Bacteria 1791
873 Ga0587090_006591 3300059510 Bacteria 1498
874 Ga0587090_018054 3300059510 Bacteria 1074
875 Ga0587091_007502 3300059511 Bacteria 1576
876 Ga0587091_025731 3300059511 Bacteria 1066
877 Ga0587092_001127 3300059512 Bacteria 2503
878 Ga0587092_001286 3300059512 Bacteria 2397
879 Ga0587092_026856 3300059512 Bacteria 928
880 Ga0587094_007560 3300059513 Bacteria 1336
881 Ga0587095_002765 3300059514 Bacteria 1201
882 Ga0587106_005755 3300059605 Bacteria 1431
883 Ga0587106_012546 3300059605 Bacteria 1138
884 Ga0587125_002462 3300059607 Bacteria 1487
885 Ga0587129_001759 3300059608 Bacteria 1213
886 Ga0587099_001328 3300059622 Bacteria 1748
887 Ga0587101_002921 3300059623 Bacteria 1687
888 Ga0587109_013288 3300059624 Bacteria 1364
889 Ga0587113_003853 3300059625 Bacteria 1166
890 Ga0587115_003705 3300059626 Bacteria 1629
891 Ga0587115_005862 3300059626 Bacteria 1398
892 Ga0587128_002561 3300059630 Bacteria 1909
893 Ga0587128_015194 3300059630 Bacteria 1112
894 Ga0587130_002349 3300059631 Bacteria 1524
895 Ga0587062_002692 3300059639 Bacteria 1723
896 Ga0587062_005808 3300059639 Bacteria 1379
897 Ga0587067_003784 3300059640 Bacteria 1917
898 Ga0587067_008233 3300059640 Bacteria 1518
899 Ga0587069_003210 3300059642 Bacteria 1744
900 Ga0587069_006862 3300059642 Bacteria 1385
901 Ga0587069_018118 3300059642 Bacteria 1026
902 Ga0587072_002898 3300059643 Bacteria 2354
903 Ga0587072_010797 3300059643 Bacteria 1482
904 Ga0587072_012553 3300059643 Bacteria 1402
905 Ga0587072_017759 3300059643 Bacteria 1230
906 Ga0587075_000862 3300059644 Bacteria 2691
907 Ga0587075_001707 3300059644 Bacteria 2193
908 Ga0587076_024948 3300059645 Bacteria 1018
909 Ga0587078_001197 3300059646 Bacteria 2256
910 Ga0587078_004598 3300059646 Bacteria 1446
911 Ga0587079_001388 3300059647 Bacteria 2693
912 Ga0587079_002060 3300059647 Bacteria 2392
913 Ga0587079_006477 3300059647 Bacteria 1708
914 Ga0587079_008284 3300059647 Bacteria 1584
915 Ga0587079_015253 3300059647 Bacteria 1302
916 Ga0587079_027800 3300059647 Bacteria 1067
917 Ga0587079_028021 3300059647 Bacteria 1064
918 Ga0587102_004451 3300059649 Bacteria 1198
919 Ga0587107_001276 3300059652 Bacteria 2000
920 Ga0587107_002753 3300059652 Bacteria 1630
921 Ga0587107_003893 3300059652 Bacteria 1480
922 Ga0587110_005765 3300059654 Bacteria 1126
923 Ga0587114_000619 3300059655 Bacteria 2518
924 Ga0587114_004976 3300059655 Bacteria 1417
925 Ga0587114_009621 3300059655 Bacteria 1163
926 Ga0587119_004446 3300059658 Bacteria 1389
927 Ga0587071_010847 3300060344 Bacteria 1528
928 Ga0587071_011764 3300060344 Bacteria 1482
929 Ga0587071_022208 3300060344 Bacteria 1170
930 Ga0587111_0003977 3300060346 Bacteria 2157
931 Ga0587111_0010975 3300060346 Bacteria 1569
932 Ga0587111_0013723 3300060346 Bacteria 1453
933 Ga0587111_0014910 3300060346 Bacteria 1412
934 Ga0587111_0038637 3300060346 Bacteria 1008
935 Ga0501082_0001381 3300060353 Bacteria 21353
936 Ga0466962_0101147 3300061719 Bacteria 1384
937 Ga0466962_0151173 3300061719 Bacteria 1126
938 Ga0530510_0000578 3300061734 Bacteria 23511

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046543 Ga0495645_0234315 Ga0495645_0234315_117_926 240
2 3300046675 Ga0495657_0022884 Ga0495657_0022884_379_1188 240
3 3300046689 Ga0495613_0057280 Ga0495613_0057280_603_1412 240
4 3300046809 Ga0495600_0349640 Ga0495600_0349640_76_885 240
5 3300047444 Ga0495675_0043768 Ga0495675_0043768_1922_2731 240
6 3300046499 Ga0495594_0233039 Ga0495594_0233039_154_987 241
7 3300046691 Ga0495670_0104173 Ga0495670_0104173_466_1299 241
8 3300047315 Ga0495581_0012834 Ga0495581_0012834_1384_2217 241
9 3300047318 Ga0495636_0002703 Ga0495636_0002703_4721_5554 241
10 3300059642 Ga0587069_018118 Ga0587069_018118_33_950 242
11 3300046455 Ga0495603_0132418 Ga0495603_0132418_160_993 247
12 3300042002 Ga0439442_015909 Ga0439442_015909_745_1536 249
13 3300059623 Ga0587101_002921 Ga0587101_002921_810_1646 249
14 3300050516 nmdc:mga0sz30_25058_c2 nmdc:mga0sz30_25058_c2_10_765 251
15 3300014745 Ga0157377_10195281 Ga0157377_101952812 253
16 3300042131 Ga0450894_000134 Ga0450894_000134_7542_8375 253
17 3300042134 Ga0450898_001094 Ga0450898_001094_1878_2711 253
18 3300042145 Ga0450906_002132 Ga0450906_002132_1203_2036 253
19 3300042184 Ga0450908_006979 Ga0450908_006979_591_1424 253
20 3300031889 Ga0326468_10000024 Ga0326468_100000249 254
21 3300041404 Ga0439436_0025436 Ga0439436_0025436_495_1328 255
22 3300041999 Ga0439433_0002902 Ga0439433_0002902_2064_2897 255
23 3300042014 Ga0439457_001263 Ga0439457_001263_2597_3430 255
24 3300046679 Ga0495623_0082943 Ga0495623_0082943_49_882 255
25 3300047317 Ga0495604_0006369 Ga0495604_0006369_6917_7750 255
26 3300031901 Ga0307406_10093893 Ga0307406_100938932 256
27 3300032002 Ga0307416_100222056 Ga0307416_1002220562 256
28 3300032126 Ga0307415_100162214 Ga0307415_1001622142 256
29 3300042439 Ga0439464_0068920 Ga0439464_0068920_150_983 256
30 3300044684 Ga0466966_0069792 Ga0466966_0069792_1067_1897 257
31 3300046691 Ga0495670_0070897 Ga0495670_0070897_956_1729 257
32 3300047447 Ga0495685_059784 Ga0495685_059784_335_1165 257
33 3300059505 Ga0587083_0003648 Ga0587083_0003648_871_1707 257
34 3300005338 Ga0068868_100069439 Ga0068868_1000694392 258
35 3300005355 Ga0070671_100104704 Ga0070671_1001047042 258
36 3300005456 Ga0070678_100231819 Ga0070678_1002318192 258
37 3300005614 Ga0068856_100039634 Ga0068856_1000396344 258
38 3300009174 Ga0105241_10183085 Ga0105241_101830852 258
39 3300013296 Ga0157374_10003977 Ga0157374_100039778 258
40 3300020077 Ga0206351_10883250 Ga0206351_108832502 258
41 3300025927 Ga0207687_10009588 Ga0207687_100095882 258
42 3300025931 Ga0207644_10105197 Ga0207644_101051972 258
43 3300026121 Ga0207683_10140612 Ga0207683_101406122 258
44 3300039438 Ga0436360_0460535 Ga0436360_0460535_30_806 258
45 3300048915 Ga0496112_0042718 Ga0496112_0042718_206_1036 258
46 3300049571 Ga0501034_0597670 Ga0501034_0597670_165_995 258
47 3300049572 Ga0501036_0007479 Ga0501036_0007479_4157_4987 258
48 3300049573 Ga0501037_0024074 Ga0501037_0024074_3318_4148 258
49 3300049574 Ga0501038_0003179 Ga0501038_0003179_12440_13270 258
50 3300049575 Ga0501039_0029856 Ga0501039_0029856_3191_4021 258
51 3300049576 Ga0501040_0001054 Ga0501040_0001054_4306_5136 258
52 3300049577 Ga0501041_0000376 Ga0501041_0000376_18091_18921 258
53 3300049578 Ga0501042_0000037 Ga0501042_0000037_4332_5162 258
54 3300049580 Ga0501046_0000625 Ga0501046_0000625_13839_14669 258
55 3300049582 Ga0501048_0002018 Ga0501048_0002018_10216_11046 258
56 3300049583 Ga0501067_0163467 Ga0501067_0163467_113_943 258
57 3300049584 Ga0501068_0003411 Ga0501068_0003411_5356_6186 258
58 3300049587 Ga0501071_0012792 Ga0501071_0012792_532_1362 258
59 3300049590 Ga0501074_0011636 Ga0501074_0011636_143_973 258
60 3300049591 Ga0501075_0013757 Ga0501075_0013757_4532_5362 258
61 3300049592 Ga0501076_0018077 Ga0501076_0018077_3614_4444 258
62 3300049593 Ga0501077_0007867 Ga0501077_0007867_4139_4969 258
63 3300049741 Ga0501079_0000524 Ga0501079_0000524_19787_20617 258
64 3300049743 Ga0501081_0002265 Ga0501081_0002265_313_1143 258
65 3300049822 Ga0501035_0023137 Ga0501035_0023137_1913_2743 258
66 3300049823 Ga0501044_0349348 Ga0501044_0349348_313_1143 258
67 3300049824 Ga0501045_0000908 Ga0501045_0000908_1798_2628 258
68 3300054114 Ga0501084_0001412 Ga0501084_0001412_2550_3380 258
69 3300059504 Ga0587082_026020 Ga0587082_026020_69_851 258
70 3300060353 Ga0501082_0001381 Ga0501082_0001381_18525_19355 258
71 3300061734 Ga0530510_0000578 Ga0530510_0000578_3241_4071 258
72 3300005435 Ga0070714_100676765 Ga0070714_1006767651 259
73 3300005436 Ga0070713_100300198 Ga0070713_1003001982 259
74 3300005437 Ga0070710_10019372 Ga0070710_100193724 259
75 3300005539 Ga0068853_100023981 Ga0068853_1000239812 259
76 3300005937 Ga0081455_10087959 Ga0081455_100879592 259
77 3300006038 Ga0075365_10068328 Ga0075365_100683282 259
78 3300006042 Ga0075368_10042061 Ga0075368_100420612 259
79 3300006048 Ga0075363_100099383 Ga0075363_1000993832 259
80 3300006175 Ga0070712_100075006 Ga0070712_1000750062 259
81 3300006178 Ga0075367_10000123 Ga0075367_1000012320 259
82 3300025915 Ga0207693_10009379 Ga0207693_100093798 259
83 3300025929 Ga0207664_10269155 Ga0207664_102691552 259
84 3300042007 Ga0439449_0015223 Ga0439449_0015223_220_1053 259
85 3300046689 Ga0495613_0141747 Ga0495613_0141747_722_1555 259
86 3300046690 Ga0495624_0091296 Ga0495624_0091296_287_1120 259
87 3300048903 Ga0496100_0025627 Ga0496100_0025627_286_1116 259
88 3300048904 Ga0496101_0031562 Ga0496101_0031562_325_1155 259
89 3300048905 Ga0496102_0043348 Ga0496102_0043348_2158_2988 259
90 3300048908 Ga0496105_0091491 Ga0496105_0091491_17_847 259
91 3300048910 Ga0496107_0044153 Ga0496107_0044153_370_1200 259
92 3300048917 Ga0496114_0043703 Ga0496114_0043703_2742_3572 259
93 3300048918 Ga0496115_0026196 Ga0496115_0026196_163_993 259
94 3300050492 nmdc:mga0yw44_18819_c1 nmdc:mga0yw44_18819_c1_1568_2401 259
95 3300050494 nmdc:mga06z11_2945_c1 nmdc:mga06z11_2945_c1_1205_2038 259
96 3300053101 Ga0500553_033794 Ga0500553_033794_464_1297 259
97 3300053113 Ga0500580_084609 Ga0500580_084609_318_1151 259
98 3300053123 Ga0500614_019618 Ga0500614_019618_313_1146 259
99 3300059608 Ga0587129_001759 Ga0587129_001759_54_836 259
100 3300005329 Ga0070683_100122935 Ga0070683_1001229352 260
101 3300005530 Ga0070679_100036973 Ga0070679_1000369732 260
102 3300005535 Ga0070684_100129879 Ga0070684_1001298792 260
103 3300005563 Ga0068855_100028863 Ga0068855_1000288638 260
104 3300006028 Ga0070717_10057268 Ga0070717_100572682 260
105 3300006871 Ga0075434_100106111 Ga0075434_1001061113 260
106 3300006914 Ga0075436_100010389 Ga0075436_1000103893 260
107 3300007076 Ga0075435_100029787 Ga0075435_1000297873 260
108 3300009093 Ga0105240_10304768 Ga0105240_103047682 260
109 3300009101 Ga0105247_10387827 Ga0105247_103878272 260
110 3300013105 Ga0157369_10116239 Ga0157369_101162392 260
111 3300013306 Ga0163162_10261893 Ga0163162_102618932 260
112 3300017792 Ga0163161_10050163 Ga0163161_100501633 260
113 3300020069 Ga0197907_10138387 Ga0197907_101383872 260
114 3300020070 Ga0206356_10142785 Ga0206356_101427852 260
115 3300020077 Ga0206351_10861399 Ga0206351_108613992 260
116 3300020082 Ga0206353_10380294 Ga0206353_103802942 260
117 3300025321 Ga0207656_10144121 Ga0207656_101441212 260
118 3300025898 Ga0207692_10024484 Ga0207692_100244843 260
119 3300025912 Ga0207707_10065555 Ga0207707_100655553 260
120 3300025913 Ga0207695_10010135 Ga0207695_100101354 260
121 3300025921 Ga0207652_10009033 Ga0207652_100090334 260
122 3300025924 Ga0207694_10042292 Ga0207694_100422922 260
123 3300025928 Ga0207700_10206097 Ga0207700_102060971 260
124 3300025928 Ga0207700_10255813 Ga0207700_102558132 260
125 3300025944 Ga0207661_10024630 Ga0207661_100246303 260
126 3300025944 Ga0207661_10313150 Ga0207661_103131502 260
127 3300025949 Ga0207667_10177133 Ga0207667_101771332 260
128 3300026078 Ga0207702_10346742 Ga0207702_103467422 260
129 3300026116 Ga0207674_10082270 Ga0207674_100822701 260
130 3300037466 Ga0395898_0032987 Ga0395898_0032987_1544_2377 260
131 3300045976 Ga0466967_0273571 Ga0466967_0273571_258_1091 260
132 3300046810 Ga0495660_0056153 Ga0495660_0056153_63_896 260
133 3300049583 Ga0501067_0064946 Ga0501067_0064946_697_1527 260
134 3300050512 nmdc:mga0n895_16329_c1 nmdc:mga0n895_16329_c1_5589_6419 260
135 3300050513 nmdc:mga0rr50_421893_c1 nmdc:mga0rr50_421893_c1_31_861 260
136 3300050514 nmdc:mga08x19_2634_c1 nmdc:mga08x19_2634_c1_2773_3603 260
137 3300059492 Ga0587073_0001083 Ga0587073_0001083_912_1742 260
138 3300059492 Ga0587073_0033745 Ga0587073_0033745_13_849 260
139 3300059493 Ga0587077_005791 Ga0587077_005791_767_1603 260
140 3300059503 Ga0587080_006380 Ga0587080_006380_448_1278 260
141 3300059504 Ga0587082_001019 Ga0587082_001019_981_1811 260
142 3300059504 Ga0587082_004616 Ga0587082_004616_602_1438 260
143 3300059505 Ga0587083_0001326 Ga0587083_0001326_927_1757 260
144 3300059510 Ga0587090_006591 Ga0587090_006591_234_1070 260
145 3300059511 Ga0587091_025731 Ga0587091_025731_108_944 260
146 3300059513 Ga0587094_007560 Ga0587094_007560_291_1121 260
147 3300059626 Ga0587115_003705 Ga0587115_003705_679_1509 260
148 3300059640 Ga0587067_003784 Ga0587067_003784_119_949 260
149 3300059647 Ga0587079_027800 Ga0587079_027800_72_905 260
150 3300005617 Ga0068859_100000134 Ga0068859_10000013447 261
151 3300005617 Ga0068859_100015497 Ga0068859_1000154976 261
152 3300005841 Ga0068863_100000189 Ga0068863_10000018927 261
153 3300005842 Ga0068858_100008568 Ga0068858_1000085689 261
154 3300005844 Ga0068862_100000009 Ga0068862_100000009164 261
155 3300006931 Ga0097620_100000134 Ga0097620_10000013422 261
156 3300006931 Ga0097620_100015497 Ga0097620_1000154972 261
157 3300009092 Ga0105250_10058136 Ga0105250_100581362 261
158 3300009101 Ga0105247_10000335 Ga0105247_100003356 261
159 3300009177 Ga0105248_10002739 Ga0105248_1000273914 261
160 3300009553 Ga0105249_10008171 Ga0105249_100081717 261
161 3300014325 Ga0163163_10012428 Ga0163163_100124288 261
162 3300014968 Ga0157379_10062736 Ga0157379_100627362 261
163 3300025900 Ga0207710_10000169 Ga0207710_1000016954 261
164 3300025941 Ga0207711_10006477 Ga0207711_100064776 261
165 3300025961 Ga0207712_10005734 Ga0207712_100057344 261
166 3300026035 Ga0207703_10182543 Ga0207703_101825432 261
167 3300026088 Ga0207641_10001086 Ga0207641_100010869 261
168 3300028380 Ga0268265_10000050 Ga0268265_1000005038 261
169 3300044765 Ga0466970_0051168 Ga0466970_0051168_1278_2063 261
170 3300048905 Ga0496102_0008636 Ga0496102_0008636_4259_5158 261
171 3300048910 Ga0496107_0175438 Ga0496107_0175438_602_1471 261
172 3300048919 Ga0496116_0000287 Ga0496116_0000287_50803_51702 261
173 3300048920 Ga0496117_0011140 Ga0496117_0011140_224_1123 261
174 3300048921 Ga0496118_0001131 Ga0496118_0001131_9738_10637 261
175 3300048922 Ga0496119_0000337 Ga0496119_0000337_56270_57139 261
176 3300048922 Ga0496119_0008756 Ga0496119_0008756_5967_6866 261
177 3300048923 Ga0496120_0000250 Ga0496120_0000250_42476_43345 261
178 3300059503 Ga0587080_001902 Ga0587080_001902_734_1621 261
179 3300059504 Ga0587082_004182 Ga0587082_004182_158_1045 261
180 3300059646 Ga0587078_001197 Ga0587078_001197_593_1483 261
181 3300003373 JGI25407J50210_10009310 JGI25407J50210_100093102 262
182 3300003373 JGI25407J50210_10037730 JGI25407J50210_100377302 262
183 3300005981 Ga0081538_10000927 Ga0081538_1000092727 262
184 3300005981 Ga0081538_10009238 Ga0081538_100092388 262
185 3300009177 Ga0105248_10000111 Ga0105248_1000011130 262
186 3300025940 Ga0207691_10375232 Ga0207691_103752322 262
187 3300025941 Ga0207711_10000605 Ga0207711_1000060529 262
188 3300028786 Ga0307517_10001164 Ga0307517_1000116430 262
189 3300030521 Ga0307511_10082473 Ga0307511_100824732 262
190 3300031616 Ga0307508_10193221 Ga0307508_101932212 262
191 3300033179 Ga0307507_10231306 Ga0307507_102313062 262
192 3300033180 Ga0307510_10305145 Ga0307510_103051452 262
193 3300037312 Ga0395899_0083486 Ga0395899_0083486_1138_1968 262
194 3300037471 Ga0395905_0063971 Ga0395905_0063971_2261_3091 262
195 3300038443 Ga0395901_0001169 Ga0395901_0001169_14905_15735 262
196 3300041404 Ga0439436_0005008 Ga0439436_0005008_2921_3754 262
197 3300041406 Ga0439439_0002809 Ga0439439_0002809_1992_2825 262
198 3300042007 Ga0439449_0004579 Ga0439449_0004579_1289_2122 262
199 3300042014 Ga0439457_002746 Ga0439457_002746_755_1588 262
200 3300042015 Ga0439462_0023041 Ga0439462_0023041_124_957 262
201 3300045836 Ga0466958_0140735 Ga0466958_0140735_383_1270 262
202 3300046522 Ga0495643_0004303 Ga0495643_0004303_2052_2885 262
203 3300046674 Ga0495588_0141763 Ga0495588_0141763_396_1229 262
204 3300046691 Ga0495670_0039733 Ga0495670_0039733_296_1129 262
205 3300047323 Ga0495683_0043999 Ga0495683_0043999_150_983 262
206 3300047447 Ga0495685_000690 Ga0495685_000690_6342_7175 262
207 3300047470 Ga0495681_0001547 Ga0495681_0001547_3543_4376 262
208 3300049584 Ga0501068_0289823 Ga0501068_0289823_49_849 262
209 3300053079 Ga0500610_0171133 Ga0500610_0171133_218_1051 262
210 3300053086 Ga0500578_0009672 Ga0500578_0009672_72_905 262
211 3300053094 Ga0500566_0098871 Ga0500566_0098871_449_1282 262
212 3300053099 Ga0500654_048071 Ga0500654_048071_601_1434 262
213 3300053126 Ga0500621_110973 Ga0500621_110973_91_924 262
214 3300053129 Ga0500628_001445 Ga0500628_001445_1434_2267 262
215 3300053131 Ga0500652_001852 Ga0500652_001852_2206_3039 262
216 3300053134 Ga0500658_0010071 Ga0500658_0010071_2181_3014 262
217 3300053149 Ga0500600_0025708 Ga0500600_0025708_390_1223 262
218 3300053153 Ga0500616_0012979 Ga0500616_0012979_2939_3772 262
219 3300053160 Ga0500633_0039723 Ga0500633_0039723_363_1196 262
220 3300053161 Ga0500634_0048886 Ga0500634_0048886_345_1178 262
221 3300053732 Ga0500656_001516 Ga0500656_001516_819_1652 262
222 3300003373 JGI25407J50210_10014238 JGI25407J50210_100142382 263
223 3300005981 Ga0081538_10007094 Ga0081538_100070943 263
224 3300031548 Ga0307408_100016830 Ga0307408_1000168303 263
225 3300031731 Ga0307405_10015905 Ga0307405_100159053 263
226 3300031731 Ga0307405_10445334 Ga0307405_104453342 263
227 3300031824 Ga0307413_10031735 Ga0307413_100317352 263
228 3300031852 Ga0307410_10175865 Ga0307410_101758652 263
229 3300031903 Ga0307407_10034939 Ga0307407_100349392 263
230 3300031911 Ga0307412_10345204 Ga0307412_103452042 263
231 3300031995 Ga0307409_100002234 Ga0307409_1000022347 263
232 3300032002 Ga0307416_100000560 Ga0307416_1000005607 263
233 3300032002 Ga0307416_100018292 Ga0307416_1000182923 263
234 3300032126 Ga0307415_100000569 Ga0307415_10000056912 263
235 3300032126 Ga0307415_100044653 Ga0307415_1000446532 263
236 3300049675 Ga0501243_015058 Ga0501243_015058_95_937 263
237 3300059477 Ga0587084_005225 Ga0587084_005225_272_1102 263
238 3300059508 Ga0587088_013042 Ga0587088_013042_267_1097 263
239 3300059605 Ga0587106_005755 Ga0587106_005755_35_865 263
240 3300059626 Ga0587115_005862 Ga0587115_005862_493_1323 263
241 3300059630 Ga0587128_002561 Ga0587128_002561_494_1324 263
242 3300059631 Ga0587130_002349 Ga0587130_002349_497_1327 263
243 3300059647 Ga0587079_006477 Ga0587079_006477_384_1214 263
244 3300059652 Ga0587107_001276 Ga0587107_001276_603_1433 263
245 3300060344 Ga0587071_010847 Ga0587071_010847_434_1264 263
246 3300060346 Ga0587111_0003977 Ga0587111_0003977_1159_1989 263
247 3300005937 Ga0081455_10022912 Ga0081455_100229129 264
248 3300005981 Ga0081538_10043924 Ga0081538_100439243 264
249 3300045976 Ga0466967_0035598 Ga0466967_0035598_1514_2356 264
250 3300059643 Ga0587072_012553 Ga0587072_012553_497_1327 264
251 3300003373 JGI25407J50210_10007409 JGI25407J50210_100074093 265
252 3300005981 Ga0081538_10003181 Ga0081538_1000318114 265
253 3300059491 Ga0587070_003087 Ga0587070_003087_425_1255 265
254 3300059493 Ga0587077_011401 Ga0587077_011401_417_1247 265
255 3300059504 Ga0587082_006413 Ga0587082_006413_278_1108 265
256 3300059505 Ga0587083_0009769 Ga0587083_0009769_544_1374 265
257 3300059506 Ga0587085_001376 Ga0587085_001376_964_1794 265
258 3300059507 Ga0587086_004276 Ga0587086_004276_264_1094 265
259 3300059508 Ga0587088_003903 Ga0587088_003903_170_1000 265
260 3300059509 Ga0587089_002814 Ga0587089_002814_744_1574 265
261 3300059510 Ga0587090_018054 Ga0587090_018054_81_911 265
262 3300059512 Ga0587092_001286 Ga0587092_001286_682_1512 265
263 3300059514 Ga0587095_002765 Ga0587095_002765_272_1102 265
264 3300059607 Ga0587125_002462 Ga0587125_002462_149_979 265
265 3300059622 Ga0587099_001328 Ga0587099_001328_654_1484 265
266 3300059624 Ga0587109_013288 Ga0587109_013288_82_912 265
267 3300059625 Ga0587113_003853 Ga0587113_003853_127_957 265
268 3300059630 Ga0587128_015194 Ga0587128_015194_121_951 265
269 3300059639 Ga0587062_005808 Ga0587062_005808_389_1219 265
270 3300059640 Ga0587067_008233 Ga0587067_008233_154_984 265
271 3300059643 Ga0587072_010797 Ga0587072_010797_509_1339 265
272 3300059644 Ga0587075_000862 Ga0587075_000862_996_1826 265
273 3300059646 Ga0587078_004598 Ga0587078_004598_371_1201 265
274 3300059647 Ga0587079_008284 Ga0587079_008284_149_979 265
275 3300059652 Ga0587107_002753 Ga0587107_002753_647_1477 265
276 3300059655 Ga0587114_004976 Ga0587114_004976_373_1203 265
277 3300060346 Ga0587111_0010975 Ga0587111_0010975_172_1002 265
278 iso_pu_bacteria 2687453737 2689955711 265
279 3300005337 Ga0070682_100027496 Ga0070682_1000274963 266
280 3300005338 Ga0068868_100402530 Ga0068868_1004025301 266
281 3300005438 Ga0070701_10164151 Ga0070701_101641512 266
282 3300005455 Ga0070663_100341124 Ga0070663_1003411241 266
283 3300005616 Ga0068852_100321149 Ga0068852_1003211492 266
284 3300025904 Ga0207647_10131933 Ga0207647_101319332 266
285 3300025927 Ga0207687_10189067 Ga0207687_101890672 266
286 3300025945 Ga0207679_10233997 Ga0207679_102339972 266
287 3300026095 Ga0207676_10757192 Ga0207676_107571922 266
288 3300026116 Ga0207674_10161410 Ga0207674_101614102 266
289 3300026118 Ga0207675_100114755 Ga0207675_1001147552 266
290 3300048913 Ga0496110_0313728 Ga0496110_0313728_195_1028 266
291 3300060344 Ga0587071_022208 Ga0587071_022208_63_896 266
292 3300005937 Ga0081455_10001610 Ga0081455_1000161019 267
293 3300013297 Ga0157378_10342351 Ga0157378_103423512 267
294 3300025918 Ga0207662_10078508 Ga0207662_100785082 267
295 3300026089 Ga0207648_10272233 Ga0207648_102722332 267
296 3300045836 Ga0466958_0273884 Ga0466958_0273884_42_875 268
297 3300048909 Ga0496106_0104259 Ga0496106_0104259_1245_2081 269
298 3300049571 Ga0501034_0429582 Ga0501034_0429582_408_1217 269
299 3300049743 Ga0501081_0222341 Ga0501081_0222341_337_1152 269
300 3300005367 Ga0070667_100715179 Ga0070667_1007151791 271
301 3300005985 Ga0081539_10064620 Ga0081539_100646202 271
302 3300035112 Ga0373932_0024314 Ga0373932_0024314_579_1400 271
303 3300035207 Ga0373942_0000130 Ga0373942_0000130_3166_3987 271
304 3300035242 Ga0373962_0002006 Ga0373962_0002006_767_1588 271
305 3300037853 Ga0436364_0918955 Ga0436364_0918955_1201_2025 271
306 iso_pu_bacteria 2832004796 2832008124 271
307 iso_pu_bacteria 2866065130 2866070067 271
308 3300005937 Ga0081455_10212614 Ga0081455_102126142 272
309 3300005983 Ga0081540_1015573 Ga0081540_10155735 272
310 iso_pu_bacteria 2508501039 2508676887 272
311 iso_pu_bacteria 2675902999 2676201845 272
312 iso_pu_bacteria 2773857921 2774846421 272
313 iso_pu_bacteria 2895880812 2895884640 272
314 iso_pu_bacteria 3002998708 3003009342 272
315 iso_pu_bacteria 8002775197 8002783190 272
316 iso_pu_bacteria 8002784119 8002792514 272
317 3300026118 Ga0207675_100079791 Ga0207675_1000797912 273
318 3300031731 Ga0307405_10107468 Ga0307405_101074682 273
319 3300031824 Ga0307413_10057231 Ga0307413_100572313 273
320 3300031995 Ga0307409_100088604 Ga0307409_1000886042 273
321 3300032126 Ga0307415_100015820 Ga0307415_1000158204 273
322 3300032126 Ga0307415_100494750 Ga0307415_1004947502 273
323 3300046538 Ga0495609_0087525 Ga0495609_0087525_91_921 273
324 3300049568 Ga0501031_0069939 Ga0501031_0069939_1251_2084 273
325 3300049575 Ga0501039_0039114 Ga0501039_0039114_1527_2360 273
326 3300049576 Ga0501040_0103890 Ga0501040_0103890_990_1823 273
327 3300049587 Ga0501071_0015082 Ga0501071_0015082_4017_4850 273
328 iso_pu_bacteria 2554235005 2554260010 273
329 iso_pu_bacteria 2582581313 2585311107 273
330 iso_pu_bacteria 2643221714 2644632538 273
331 iso_pu_bacteria 2751185782 2753265462 273
332 iso_pu_bacteria 2772190715 2772646617 273
333 iso_pu_bacteria 2784746763 2785339704 273
334 iso_pu_bacteria 2784746768 2785372560 273
335 iso_pu_bacteria 2808606375 2808916355 273
336 iso_pu_bacteria 2808606982 2811846410 273
337 iso_pu_bacteria 2811994879 2812354312 273
338 iso_pu_bacteria 2811994917 2812482831 273
339 iso_pu_bacteria 2831935698 2831939652 273
340 iso_pu_bacteria 2852635781 2852635933 273
341 iso_pu_bacteria 2855670206 2855675518 273
342 iso_pu_bacteria 2855676851 2855677585 273
343 iso_pu_bacteria 2855683550 2855683935 273
344 iso_pu_bacteria 2856858025 2856864165 273
345 iso_pu_bacteria 2857288857 2857293240 273
346 iso_pu_bacteria 2858848962 2858852905 273
347 iso_pu_bacteria 2858868258 2858871644 273
348 iso_pu_bacteria 2858882152 2858883344 273
349 iso_pu_bacteria 2858888857 2858891354 273
350 iso_pu_bacteria 2858895516 2858901409 273
351 iso_pu_bacteria 2858902515 2858906516 273
352 iso_pu_bacteria 2863404153 2863410375 273
353 iso_pu_bacteria 2867302475 2867302904 273
354 iso_pu_bacteria 2867312974 2867313875 273
355 iso_pu_bacteria 2867319477 2867325863 273
356 iso_pu_bacteria 2867507094 2867512285 273
357 iso_pu_bacteria 2869048445 2869050393 273
358 iso_pu_bacteria 2869061728 2869064509 273
359 iso_pu_bacteria 2869068681 2869074352 273
360 iso_pu_bacteria 2880489317 2880490016 273
361 iso_pu_bacteria 2880495981 2880502543 273
362 iso_pu_bacteria 2902582711 2902582741 273
363 iso_pu_bacteria 2929226422 2929230975 273
364 iso_pu_bacteria 2946064051 2946071389 273
365 iso_pu_bacteria 2946072368 2946079205 273
366 iso_pu_bacteria 2954691527 2954691713 273
367 iso_pu_bacteria 2954701450 2954706841 273
368 iso_pu_bacteria 2996221748 2996222991 273
369 iso_pu_bacteria 3006486233 3006491959 273
370 iso_pu_bacteria 649633069 649814295 273
371 iso_pu_bacteria 8003830390 8003836389 273
372 iso_pu_bacteria 8003870546 8003873181 273
373 iso_pu_bacteria 8054704163 8054704963 273
374 iso_pu_bacteria 8054727385 8054733291 273
375 iso_pu_bacteria 8054734606 8054738829 273
376 iso_pu_bacteria 8055412473 8055412756 273
377 3300003203 JGI25406J46586_10008147 JGI25406J46586_100081475 274
378 3300005366 Ga0070659_100068570 Ga0070659_1000685703 274
379 3300005441 Ga0070700_100121551 Ga0070700_1001215512 274
380 3300005564 Ga0070664_100045804 Ga0070664_1000458043 274
381 3300005615 Ga0070702_100083299 Ga0070702_1000832991 274
382 3300005616 Ga0068852_100037223 Ga0068852_1000372233 274
383 3300005616 Ga0068852_100293440 Ga0068852_1002934402 274
384 3300005985 Ga0081539_10000256 Ga0081539_10000256107 274
385 3300006028 Ga0070717_10005059 Ga0070717_100050596 274
386 3300006881 Ga0068865_100133007 Ga0068865_1001330072 274
387 3300009094 Ga0111539_10245169 Ga0111539_102451693 274
388 3300009098 Ga0105245_10727307 Ga0105245_107273071 274
389 3300009148 Ga0105243_10810457 Ga0105243_108104571 274
390 3300013102 Ga0157371_10336534 Ga0157371_103365341 274
391 3300013307 Ga0157372_10475564 Ga0157372_104755642 274
392 3300014969 Ga0157376_10216351 Ga0157376_102163512 274
393 3300025901 Ga0207688_10150079 Ga0207688_101500792 274
394 3300025908 Ga0207643_10029382 Ga0207643_100293822 274
395 3300025909 Ga0207705_10158431 Ga0207705_101584312 274
396 3300025919 Ga0207657_10315307 Ga0207657_103153072 274
397 3300025932 Ga0207690_10068989 Ga0207690_100689894 274
398 3300025933 Ga0207706_10050689 Ga0207706_100506893 274
399 3300025935 Ga0207709_10309691 Ga0207709_103096912 274
400 3300025937 Ga0207669_10208931 Ga0207669_102089312 274
401 3300025944 Ga0207661_10479596 Ga0207661_104795962 274
402 3300025945 Ga0207679_10093173 Ga0207679_100931733 274
403 3300025960 Ga0207651_10527955 Ga0207651_105279551 274
404 3300026075 Ga0207708_10153439 Ga0207708_101534392 274
405 3300026089 Ga0207648_10158836 Ga0207648_101588362 274
406 3300026118 Ga0207675_100200125 Ga0207675_1002001253 274
407 3300026121 Ga0207683_10321754 Ga0207683_103217542 274
408 3300026142 Ga0207698_10060704 Ga0207698_100607042 274
409 3300028380 Ga0268265_10658567 Ga0268265_106585672 274
410 3300031548 Ga0307408_100064187 Ga0307408_1000641872 274
411 3300031852 Ga0307410_10019957 Ga0307410_100199572 274
412 3300031901 Ga0307406_10041370 Ga0307406_100413703 274
413 3300031911 Ga0307412_10042639 Ga0307412_100426392 274
414 3300032004 Ga0307414_10017217 Ga0307414_100172173 274
415 3300032126 Ga0307415_100339830 Ga0307415_1003398301 274
416 3300037853 Ga0436364_1435407 Ga0436364_1435407_354_1178 274
417 3300044684 Ga0466966_0101801 Ga0466966_0101801_302_1126 274
418 3300045976 Ga0466967_0318253 Ga0466967_0318253_250_1086 274
419 3300047320 Ga0495672_0087428 Ga0495672_0087428_528_1364 274
420 3300050511 nmdc:mga08y16_205421_c1 nmdc:mga08y16_205421_c1_1003_1839 274
421 3300059647 Ga0587079_015253 Ga0587079_015253_13_846 274
422 iso_pu_bacteria 2675903059 2676485342 274
423 iso_pu_bacteria 2738541264 2738669308 274
424 iso_pu_bacteria 2738541274 2738706554 274
425 iso_pu_bacteria 2738541356 2739147716 274
426 iso_pu_bacteria 2738543028 2739333173 274
427 iso_pu_bacteria 2902799365 2902799961 274
428 iso_pu_bacteria 8003856774 8003856852 274
429 3300003373 JGI25407J50210_10016954 JGI25407J50210_100169542 275
430 3300005367 Ga0070667_100091206 Ga0070667_1000912062 275
431 3300005436 Ga0070713_100436686 Ga0070713_1004366861 275
432 3300005563 Ga0068855_100340163 Ga0068855_1003401632 275
433 3300005719 Ga0068861_100156491 Ga0068861_1001564912 275
434 3300005842 Ga0068858_100000014 Ga0068858_10000001473 275
435 3300005937 Ga0081455_10020131 Ga0081455_100201314 275
436 3300005981 Ga0081538_10007779 Ga0081538_100077794 275
437 3300006028 Ga0070717_10074143 Ga0070717_100741433 275
438 3300006847 Ga0075431_100275306 Ga0075431_1002753062 275
439 3300006880 Ga0075429_100189876 Ga0075429_1001898762 275
440 3300009101 Ga0105247_10000864 Ga0105247_1000086412 275
441 3300009553 Ga0105249_10113955 Ga0105249_101139552 275
442 3300011119 Ga0105246_10134630 Ga0105246_101346302 275
443 3300014968 Ga0157379_10000701 Ga0157379_1000070110 275
444 3300020069 Ga0197907_10164538 Ga0197907_101645383 275
445 3300020075 Ga0206349_1441571 Ga0206349_14415713 275
446 3300020076 Ga0206355_1590120 Ga0206355_15901202 275
447 3300020077 Ga0206351_10342753 Ga0206351_103427533 275
448 3300020080 Ga0206350_10364331 Ga0206350_103643313 275
449 3300020610 Ga0154015_1356031 Ga0154015_13560312 275
450 3300021388 Ga0213875_10001331 Ga0213875_100013318 275
451 3300022467 Ga0224712_10001641 Ga0224712_100016413 275
452 3300025900 Ga0207710_10000035 Ga0207710_10000035122 275
453 3300025904 Ga0207647_10082320 Ga0207647_100823202 275
454 3300025909 Ga0207705_10053803 Ga0207705_100538032 275
455 3300025928 Ga0207700_10021743 Ga0207700_100217432 275
456 3300025929 Ga0207664_10119237 Ga0207664_101192373 275
457 3300025949 Ga0207667_10185357 Ga0207667_101853572 275
458 3300025986 Ga0207658_10042675 Ga0207658_100426753 275
459 3300026035 Ga0207703_10000005 Ga0207703_10000005107 275
460 3300031548 Ga0307408_100098885 Ga0307408_1000988852 275
461 3300031730 Ga0307516_10023699 Ga0307516_100236996 275
462 3300031852 Ga0307410_10252171 Ga0307410_102521712 275
463 3300031901 Ga0307406_10024588 Ga0307406_100245883 275
464 3300031995 Ga0307409_100004802 Ga0307409_1000048026 275
465 3300032002 Ga0307416_100048291 Ga0307416_1000482913 275
466 3300032005 Ga0307411_10013884 Ga0307411_100138843 275
467 3300032126 Ga0307415_100242563 Ga0307415_1002425632 275
468 3300037471 Ga0395905_0124577 Ga0395905_0124577_275_1105 275
469 3300037853 Ga0436364_0423427 Ga0436364_0423427_18549_19439 275
470 3300042005 Ga0439448_0000544 Ga0439448_0000544_4009_4839 275
471 3300042009 Ga0439451_014983 Ga0439451_014983_238_1068 275
472 3300042013 Ga0439456_002526 Ga0439456_002526_2445_3275 275
473 3300042016 Ga0439463_001659 Ga0439463_001659_287_1117 275
474 3300042139 Ga0450904_002255 Ga0450904_002255_399_1229 275
475 3300042437 Ga0439444_0004278 Ga0439444_0004278_966_1796 275
476 3300042439 Ga0439464_0002713 Ga0439464_0002713_94_924 275
477 3300042461 Ga0439460_0002006 Ga0439460_0002006_1975_2805 275
478 3300042993 Ga0439440_0003695 Ga0439440_0003695_395_1225 275
479 3300042993 Ga0439440_0009200 Ga0439440_0009200_155_985 275
480 3300044656 Ga0466969_0039913 Ga0466969_0039913_15_842 275
481 3300044684 Ga0466966_0005219 Ga0466966_0005219_7343_8170 275
482 3300044693 Ga0466961_0031454 Ga0466961_0031454_2437_3264 275
483 3300044694 Ga0466963_0045022 Ga0466963_0045022_1616_2446 275
484 3300044735 Ga0466968_0002409 Ga0466968_0002409_3053_3880 275
485 3300044765 Ga0466970_0008763 Ga0466970_0008763_354_1181 275
486 3300045049 Ga0466959_0003962 Ga0466959_0003962_8566_9393 275
487 3300045836 Ga0466958_0009520 Ga0466958_0009520_1675_2505 275
488 3300045836 Ga0466958_0014730 Ga0466958_0014730_3578_4405 275
489 3300046524 Ga0495648_0035570 Ga0495648_0035570_119_1048 275
490 3300048924 Ga0496121_0014730 Ga0496121_0014730_6132_7025 275
491 3300048929 Ga0496126_0231508 Ga0496126_0231508_57_896 275
492 3300048929 Ga0496126_0409036 Ga0496126_0409036_30_926 275
493 3300053143 Ga0500579_066362 Ga0500579_066362_938_1777 275
494 3300059491 Ga0587070_006734 Ga0587070_006734_575_1405 275
495 3300059493 Ga0587077_013365 Ga0587077_013365_356_1186 275
496 3300059493 Ga0587077_024498 Ga0587077_024498_254_1084 275
497 3300059508 Ga0587088_002262 Ga0587088_002262_397_1287 275
498 3300059639 Ga0587062_002692 Ga0587062_002692_405_1295 275
499 3300059649 Ga0587102_004451 Ga0587102_004451_38_928 275
500 3300059655 Ga0587114_009621 Ga0587114_009621_65_955 275
501 3300061719 Ga0466962_0101147 Ga0466962_0101147_299_1129 275
502 3300061719 Ga0466962_0151173 Ga0466962_0151173_77_907 275
503 iso_pu_bacteria 2929219909 2929224380 275
504 3300004800 Ga0058861_10086516 Ga0058861_100865162 276
505 3300004800 Ga0058861_11829308 Ga0058861_118293082 276
506 3300005329 Ga0070683_100052814 Ga0070683_1000528143 276
507 3300005329 Ga0070683_100535648 Ga0070683_1005356481 276
508 3300005334 Ga0068869_100017957 Ga0068869_1000179572 276
509 3300005336 Ga0070680_100086833 Ga0070680_1000868332 276
510 3300005338 Ga0068868_100003817 Ga0068868_1000038178 276
511 3300005338 Ga0068868_100592220 Ga0068868_1005922201 276
512 3300005344 Ga0070661_100014688 Ga0070661_1000146882 276
513 3300005345 Ga0070692_10035997 Ga0070692_100359972 276
514 3300005347 Ga0070668_100003728 Ga0070668_10000372811 276
515 3300005353 Ga0070669_100158882 Ga0070669_1001588822 276
516 3300005354 Ga0070675_100002879 Ga0070675_1000028793 276
517 3300005364 Ga0070673_100442063 Ga0070673_1004420632 276
518 3300005366 Ga0070659_100018803 Ga0070659_1000188031 276
519 3300005367 Ga0070667_100020043 Ga0070667_1000200432 276
520 3300005441 Ga0070700_100112453 Ga0070700_1001124532 276
521 3300005456 Ga0070678_100125947 Ga0070678_1001259472 276
522 3300005457 Ga0070662_100106712 Ga0070662_1001067123 276
523 3300005459 Ga0068867_100329808 Ga0068867_1003298082 276
524 3300005530 Ga0070679_100069137 Ga0070679_1000691373 276
525 3300005535 Ga0070684_100006940 Ga0070684_1000069406 276
526 3300005543 Ga0070672_100259579 Ga0070672_1002595792 276
527 3300005548 Ga0070665_100209382 Ga0070665_1002093822 276
528 3300005564 Ga0070664_100000709 Ga0070664_10000070919 276
529 3300005577 Ga0068857_100018243 Ga0068857_1000182432 276
530 3300005578 Ga0068854_100076440 Ga0068854_1000764402 276
531 3300005616 Ga0068852_100046213 Ga0068852_1000462133 276
532 3300005719 Ga0068861_100019822 Ga0068861_1000198226 276
533 3300005842 Ga0068858_100209104 Ga0068858_1002091042 276
534 3300005844 Ga0068862_100072262 Ga0068862_1000722623 276
535 3300005981 Ga0081538_10007006 Ga0081538_100070066 276
536 3300005985 Ga0081539_10000424 Ga0081539_1000042466 276
537 3300005985 Ga0081539_10002011 Ga0081539_1000201115 276
538 3300005985 Ga0081539_10010650 Ga0081539_100106507 276
539 3300006058 Ga0075432_10067546 Ga0075432_100675462 276
540 3300006237 Ga0097621_100550660 Ga0097621_1005506602 276
541 3300009094 Ga0111539_10001616 Ga0111539_100016163 276
542 3300009094 Ga0111539_10458410 Ga0111539_104584102 276
543 3300009098 Ga0105245_10084748 Ga0105245_100847483 276
544 3300009148 Ga0105243_10566692 Ga0105243_105666922 276
545 3300009551 Ga0105238_10345085 Ga0105238_103450852 276
546 3300009553 Ga0105249_10634440 Ga0105249_106344402 276
547 3300010375 Ga0105239_10367611 Ga0105239_103676112 276
548 3300011119 Ga0105246_10364338 Ga0105246_103643382 276
549 3300013104 Ga0157370_10285810 Ga0157370_102858102 276
550 3300014497 Ga0182008_10162084 Ga0182008_101620841 276
551 3300014745 Ga0157377_10060232 Ga0157377_100602322 276
552 3300020070 Ga0206356_10784647 Ga0206356_107846472 276
553 3300020078 Ga0206352_10462433 Ga0206352_104624332 276
554 3300020078 Ga0206352_10839311 Ga0206352_108393112 276
555 3300020080 Ga0206350_11454667 Ga0206350_114546672 276
556 3300020082 Ga0206353_10025707 Ga0206353_100257072 276
557 3300020082 Ga0206353_10985316 Ga0206353_109853162 276
558 3300020610 Ga0154015_1204111 Ga0154015_12041112 276
559 3300020610 Ga0154015_1334133 Ga0154015_13341332 276
560 3300022467 Ga0224712_10004633 Ga0224712_100046333 276
561 3300025908 Ga0207643_10162419 Ga0207643_101624192 276
562 3300025912 Ga0207707_10090182 Ga0207707_100901822 276
563 3300025918 Ga0207662_10097511 Ga0207662_100975112 276
564 3300025919 Ga0207657_10034090 Ga0207657_100340903 276
565 3300025920 Ga0207649_10031520 Ga0207649_100315202 276
566 3300025921 Ga0207652_10314055 Ga0207652_103140552 276
567 3300025923 Ga0207681_10217496 Ga0207681_102174962 276
568 3300025924 Ga0207694_10245281 Ga0207694_102452812 276
569 3300025926 Ga0207659_10010045 Ga0207659_100100454 276
570 3300025927 Ga0207687_10123981 Ga0207687_101239812 276
571 3300025932 Ga0207690_10034524 Ga0207690_100345242 276
572 3300025933 Ga0207706_10129417 Ga0207706_101294172 276
573 3300025933 Ga0207706_10422822 Ga0207706_104228222 276
574 3300025935 Ga0207709_10132174 Ga0207709_101321742 276
575 3300025937 Ga0207669_10148192 Ga0207669_101481922 276
576 3300025939 Ga0207665_10038269 Ga0207665_100382692 276
577 3300025940 Ga0207691_10335222 Ga0207691_103352222 276
578 3300025942 Ga0207689_10002494 Ga0207689_100024944 276
579 3300025944 Ga0207661_10042838 Ga0207661_100428383 276
580 3300025944 Ga0207661_10250697 Ga0207661_102506972 276
581 3300025945 Ga0207679_10051683 Ga0207679_100516833 276
582 3300025972 Ga0207668_10000408 Ga0207668_1000040816 276
583 3300025972 Ga0207668_10014418 Ga0207668_100144182 276
584 3300025986 Ga0207658_10292970 Ga0207658_102929702 276
585 3300026023 Ga0207677_10006496 Ga0207677_100064962 276
586 3300026035 Ga0207703_10082485 Ga0207703_100824854 276
587 3300026067 Ga0207678_10019979 Ga0207678_100199792 276
588 3300026067 Ga0207678_10027774 Ga0207678_100277742 276
589 3300026067 Ga0207678_10128426 Ga0207678_101284262 276
590 3300026075 Ga0207708_10012670 Ga0207708_100126706 276
591 3300026089 Ga0207648_10210479 Ga0207648_102104792 276
592 3300026095 Ga0207676_10311038 Ga0207676_103110382 276
593 3300026116 Ga0207674_10005413 Ga0207674_100054136 276
594 3300026116 Ga0207674_10086919 Ga0207674_100869192 276
595 3300026118 Ga0207675_100122167 Ga0207675_1001221672 276
596 3300026121 Ga0207683_10238610 Ga0207683_102386101 276
597 3300026121 Ga0207683_10275097 Ga0207683_102750972 276
598 3300026142 Ga0207698_10030924 Ga0207698_100309242 276
599 3300026142 Ga0207698_10586865 Ga0207698_105868652 276
600 3300027907 Ga0207428_10018411 Ga0207428_100184112 276
601 3300028380 Ga0268265_10031124 Ga0268265_100311243 276
602 3300028380 Ga0268265_10145402 Ga0268265_101454022 276
603 3300028381 Ga0268264_10070656 Ga0268264_100706564 276
604 3300028794 Ga0307515_10000883 Ga0307515_1000088315 276
605 3300031649 Ga0307514_10007338 Ga0307514_100073384 276
606 3300031730 Ga0307516_10005181 Ga0307516_1000518117 276
607 3300031730 Ga0307516_10007141 Ga0307516_1000714110 276
608 3300031824 Ga0307413_10310879 Ga0307413_103108792 276
609 3300031889 Ga0326468_10001396 Ga0326468_100013961 276
610 3300031901 Ga0307406_10208689 Ga0307406_102086892 276
611 3300031995 Ga0307409_100179070 Ga0307409_1001790702 276
612 3300032002 Ga0307416_100195112 Ga0307416_1001951122 276
613 3300032004 Ga0307414_10186247 Ga0307414_101862472 276
614 3300032126 Ga0307415_100042696 Ga0307415_1000426963 276
615 3300032126 Ga0307415_100100587 Ga0307415_1001005872 276
616 3300033179 Ga0307507_10019583 Ga0307507_100195832 276
617 3300035112 Ga0373932_0103668 Ga0373932_0103668_73_906 276
618 3300035692 Ga0373935_0017067 Ga0373935_0017067_2134_2967 276
619 3300044694 Ga0466963_0087432 Ga0466963_0087432_342_1232 276
620 3300044765 Ga0466970_0304445 Ga0466970_0304445_30_863 276
621 3300045976 Ga0466967_0272725 Ga0466967_0272725_671_1561 276
622 3300048929 Ga0496126_0070611 Ga0496126_0070611_1192_2079 276
623 3300050511 nmdc:mga08y16_443365_c1 nmdc:mga08y16_443365_c1_173_1006 276
624 3300050511 nmdc:mga08y16_56429_c1 nmdc:mga08y16_56429_c1_121_954 276
625 3300059477 Ga0587084_001810 Ga0587084_001810_44_877 276
626 3300059492 Ga0587073_0008309 Ga0587073_0008309_688_1521 276
627 3300059492 Ga0587073_0010568 Ga0587073_0010568_147_980 276
628 3300059492 Ga0587073_0013845 Ga0587073_0013845_426_1259 276
629 3300059503 Ga0587080_011864 Ga0587080_011864_148_981 276
630 3300059504 Ga0587082_005904 Ga0587082_005904_52_885 276
631 3300059504 Ga0587082_010618 Ga0587082_010618_59_892 276
632 3300059505 Ga0587083_0010943 Ga0587083_0010943_86_919 276
633 3300059506 Ga0587085_025560 Ga0587085_025560_13_846 276
634 3300059507 Ga0587086_003814 Ga0587086_003814_73_906 276
635 3300059510 Ga0587090_003745 Ga0587090_003745_133_1023 276
636 3300059511 Ga0587091_007502 Ga0587091_007502_10_843 276
637 3300059512 Ga0587092_001127 Ga0587092_001127_696_1529 276
638 3300059512 Ga0587092_026856 Ga0587092_026856_41_874 276
639 3300059605 Ga0587106_012546 Ga0587106_012546_31_921 276
640 3300059642 Ga0587069_003210 Ga0587069_003210_659_1492 276
641 3300059642 Ga0587069_006862 Ga0587069_006862_534_1367 276
642 3300059643 Ga0587072_002898 Ga0587072_002898_656_1546 276
643 3300059643 Ga0587072_017759 Ga0587072_017759_315_1148 276
644 3300059644 Ga0587075_001707 Ga0587075_001707_247_1080 276
645 3300059645 Ga0587076_024948 Ga0587076_024948_11_844 276
646 3300059647 Ga0587079_001388 Ga0587079_001388_73_906 276
647 3300059647 Ga0587079_002060 Ga0587079_002060_398_1231 276
648 3300059647 Ga0587079_028021 Ga0587079_028021_102_935 276
649 3300059652 Ga0587107_003893 Ga0587107_003893_438_1271 276
650 3300059654 Ga0587110_005765 Ga0587110_005765_55_945 276
651 3300059655 Ga0587114_000619 Ga0587114_000619_835_1722 276
652 3300059658 Ga0587119_004446 Ga0587119_004446_423_1313 276
653 3300060344 Ga0587071_011764 Ga0587071_011764_620_1453 276
654 3300060346 Ga0587111_0013723 Ga0587111_0013723_394_1284 276
655 3300060346 Ga0587111_0014910 Ga0587111_0014910_147_980 276
656 3300060346 Ga0587111_0038637 Ga0587111_0038637_136_969 276
657 3300005436 Ga0070713_100341387 Ga0070713_1003413872 277
658 3300006038 Ga0075365_10009152 Ga0075365_100091525 277
659 3300006048 Ga0075363_100000960 Ga0075363_1000009604 277
660 3300006051 Ga0075364_10051397 Ga0075364_100513972 277
661 3300006186 Ga0075369_10058207 Ga0075369_100582072 277
662 3300025904 Ga0207647_10135487 Ga0207647_101354872 277
663 3300026078 Ga0207702_10082105 Ga0207702_100821053 277
664 3300039437 Ga0436365_1544123 Ga0436365_1544123_7006_7902 277
665 3300050490 nmdc:mga03n38_36974_c1 nmdc:mga03n38_36974_c1_536_1369 277
666 3300050492 nmdc:mga0yw44_96066_c1 nmdc:mga0yw44_96066_c1_59_892 277
667 3300050494 nmdc:mga06z11_185690_c1 nmdc:mga06z11_185690_c1_58_891 277
668 3300050495 nmdc:mga04h51_5144_c1 nmdc:mga04h51_5144_c1_1883_2716 277
669 3300050516 nmdc:mga0sz30_41671_c1 nmdc:mga0sz30_41671_c1_655_1488 277
670 3300000546 LJNas_1001603 LJNas_10016033 278
671 3300001977 JGI24746J21847_1001314 JGI24746J21847_10013141 278
672 3300001978 JGI24747J21853_1002149 JGI24747J21853_10021492 278
673 3300002067 JGI24735J21928_10058516 JGI24735J21928_100585161 278
674 3300002073 JGI24745J21846_1005536 JGI24745J21846_10055362 278
675 3300002076 JGI24749J21850_1004653 JGI24749J21850_10046532 278
676 3300002077 JGI24744J21845_10004230 JGI24744J21845_100042301 278
677 3300002077 JGI24744J21845_10016379 JGI24744J21845_100163791 278
678 3300002239 JGI24034J26672_10001767 JGI24034J26672_100017672 278
679 3300002239 JGI24034J26672_10014301 JGI24034J26672_100143012 278
680 3300002244 JGI24742J22300_10005722 JGI24742J22300_100057221 278
681 3300003792 Ga0055540_1000052 Ga0055540_100005214 278
682 3300005328 Ga0070676_10010720 Ga0070676_100107206 278
683 3300005330 Ga0070690_100062101 Ga0070690_1000621012 278
684 3300005334 Ga0068869_100161527 Ga0068869_1001615272 278
685 3300005335 Ga0070666_10047885 Ga0070666_100478852 278
686 3300005337 Ga0070682_100101197 Ga0070682_1001011972 278
687 3300005338 Ga0068868_100001568 Ga0068868_10000156813 278
688 3300005340 Ga0070689_100020006 Ga0070689_1000200065 278
689 3300005341 Ga0070691_10002308 Ga0070691_100023087 278
690 3300005343 Ga0070687_100041581 Ga0070687_1000415812 278
691 3300005347 Ga0070668_100002116 Ga0070668_10000211611 278
692 3300005353 Ga0070669_100043351 Ga0070669_1000433513 278
693 3300005354 Ga0070675_100468630 Ga0070675_1004686302 278
694 3300005356 Ga0070674_100002080 Ga0070674_1000020805 278
695 3300005356 Ga0070674_100285704 Ga0070674_1002857042 278
696 3300005364 Ga0070673_100175871 Ga0070673_1001758712 278
697 3300005366 Ga0070659_100007023 Ga0070659_1000070233 278
698 3300005367 Ga0070667_100014491 Ga0070667_1000144914 278
699 3300005367 Ga0070667_100646209 Ga0070667_1006462091 278
700 3300005435 Ga0070714_100083352 Ga0070714_1000833522 278
701 3300005437 Ga0070710_10001629 Ga0070710_100016295 278
702 3300005437 Ga0070710_10085938 Ga0070710_100859382 278
703 3300005438 Ga0070701_10000238 Ga0070701_1000023813 278
704 3300005439 Ga0070711_100000410 Ga0070711_10000041020 278
705 3300005439 Ga0070711_100007257 Ga0070711_1000072573 278
706 3300005441 Ga0070700_100051409 Ga0070700_1000514093 278
707 3300005444 Ga0070694_100044717 Ga0070694_1000447172 278
708 3300005456 Ga0070678_100036033 Ga0070678_1000360332 278
709 3300005456 Ga0070678_100078483 Ga0070678_1000784831 278
710 3300005457 Ga0070662_100062646 Ga0070662_1000626462 278
711 3300005459 Ga0068867_100040433 Ga0068867_1000404333 278
712 3300005459 Ga0068867_100406644 Ga0068867_1004066442 278
713 3300005536 Ga0070697_100218563 Ga0070697_1002185632 278
714 3300005545 Ga0070695_100018514 Ga0070695_1000185144 278
715 3300005547 Ga0070693_100009709 Ga0070693_1000097092 278
716 3300005547 Ga0070693_100058231 Ga0070693_1000582313 278
717 3300005548 Ga0070665_100042854 Ga0070665_1000428544 278
718 3300005548 Ga0070665_100244513 Ga0070665_1002445132 278
719 3300005549 Ga0070704_100000737 Ga0070704_1000007374 278
720 3300005563 Ga0068855_100392201 Ga0068855_1003922012 278
721 3300005615 Ga0070702_100008329 Ga0070702_1000083295 278
722 3300005615 Ga0070702_100039920 Ga0070702_1000399202 278
723 3300005616 Ga0068852_100624212 Ga0068852_1006242121 278
724 3300005617 Ga0068859_100002049 Ga0068859_10000204910 278
725 3300005617 Ga0068859_100501126 Ga0068859_1005011262 278
726 3300005618 Ga0068864_100362156 Ga0068864_1003621562 278
727 3300005718 Ga0068866_10000579 Ga0068866_100005795 278
728 3300005718 Ga0068866_10023252 Ga0068866_100232522 278
729 3300005719 Ga0068861_100000671 Ga0068861_10000067114 278
730 3300005719 Ga0068861_100429810 Ga0068861_1004298102 278
731 3300005840 Ga0068870_10095922 Ga0068870_100959222 278
732 3300005841 Ga0068863_100000833 Ga0068863_1000008338 278
733 3300005842 Ga0068858_100009472 Ga0068858_1000094725 278
734 3300005842 Ga0068858_100223656 Ga0068858_1002236562 278
735 3300005842 Ga0068858_100272920 Ga0068858_1002729202 278
736 3300005843 Ga0068860_100000174 Ga0068860_10000017426 278
737 3300005843 Ga0068860_100001236 Ga0068860_10000123619 278
738 3300005843 Ga0068860_100209743 Ga0068860_1002097432 278
739 3300005844 Ga0068862_100000019 Ga0068862_100000019193 278
740 3300005844 Ga0068862_100008993 Ga0068862_1000089936 278
741 3300005844 Ga0068862_100162505 Ga0068862_1001625053 278
742 3300005983 Ga0081540_1058775 Ga0081540_10587752 278
743 3300006038 Ga0075365_10162947 Ga0075365_101629471 278
744 3300006048 Ga0075363_100001005 Ga0075363_1000010057 278
745 3300006048 Ga0075363_100116335 Ga0075363_1001163351 278
746 3300006048 Ga0075363_100165068 Ga0075363_1001650682 278
747 3300006051 Ga0075364_10006557 Ga0075364_100065575 278
748 3300006051 Ga0075364_10020556 Ga0075364_100205564 278
749 3300006173 Ga0070716_100008409 Ga0070716_1000084095 278
750 3300006175 Ga0070712_100001020 Ga0070712_1000010203 278
751 3300006175 Ga0070712_100064076 Ga0070712_1000640762 278
752 3300006186 Ga0075369_10002320 Ga0075369_100023205 278
753 3300006186 Ga0075369_10005620 Ga0075369_100056203 278
754 3300006186 Ga0075369_10018741 Ga0075369_100187413 278
755 3300006186 Ga0075369_10056399 Ga0075369_100563992 278
756 3300006186 Ga0075369_10150251 Ga0075369_101502512 278
757 3300006237 Ga0097621_100136590 Ga0097621_1001365902 278
758 3300006353 Ga0075370_10022826 Ga0075370_100228263 278
759 3300006353 Ga0075370_10035285 Ga0075370_100352853 278
760 3300006353 Ga0075370_10071153 Ga0075370_100711532 278
761 3300006353 Ga0075370_10212847 Ga0075370_102128472 278
762 3300006358 Ga0068871_100126997 Ga0068871_1001269972 278
763 3300006881 Ga0068865_100013059 Ga0068865_1000130592 278
764 3300006931 Ga0097620_100002049 Ga0097620_10000204912 278
765 3300006931 Ga0097620_100501108 Ga0097620_1005011082 278
766 3300009098 Ga0105245_10006195 Ga0105245_1000619511 278
767 3300009098 Ga0105245_10149004 Ga0105245_101490042 278
768 3300009101 Ga0105247_10000023 Ga0105247_1000002325 278
769 3300009101 Ga0105247_10001279 Ga0105247_1000127913 278
770 3300009101 Ga0105247_10208866 Ga0105247_102088661 278
771 3300009148 Ga0105243_10003250 Ga0105243_1000325011 278
772 3300009174 Ga0105241_10011583 Ga0105241_100115836 278
773 3300009176 Ga0105242_10003744 Ga0105242_1000374411 278
774 3300009176 Ga0105242_10055349 Ga0105242_100553491 278
775 3300009177 Ga0105248_10000557 Ga0105248_1000055716 278
776 3300009177 Ga0105248_10221983 Ga0105248_102219832 278
777 3300009545 Ga0105237_10023752 Ga0105237_100237525 278
778 3300009545 Ga0105237_10056472 Ga0105237_100564723 278
779 3300009553 Ga0105249_10000033 Ga0105249_10000033172 278
780 3300009553 Ga0105249_10006292 Ga0105249_1000629210 278
781 3300009553 Ga0105249_10639138 Ga0105249_106391382 278
782 3300010159 Ga0099796_10019399 Ga0099796_100193992 278
783 3300010375 Ga0105239_10009697 Ga0105239_1000969710 278
784 3300011119 Ga0105246_10094339 Ga0105246_100943393 278
785 3300013105 Ga0157369_10248916 Ga0157369_102489162 278
786 3300013296 Ga0157374_10063104 Ga0157374_100631042 278
787 3300013296 Ga0157374_10158206 Ga0157374_101582062 278
788 3300013297 Ga0157378_10008995 Ga0157378_100089955 278
789 3300013306 Ga0163162_10043832 Ga0163162_100438324 278
790 3300013306 Ga0163162_10064518 Ga0163162_100645183 278
791 3300013306 Ga0163162_10153933 Ga0163162_101539332 278
792 3300013307 Ga0157372_10530889 Ga0157372_105308892 278
793 3300014325 Ga0163163_10016062 Ga0163163_100160624 278
794 3300014325 Ga0163163_10119081 Ga0163163_101190812 278
795 3300014326 Ga0157380_10001016 Ga0157380_1000101613 278
796 3300014326 Ga0157380_10095822 Ga0157380_100958222 278
797 3300014745 Ga0157377_10015911 Ga0157377_100159113 278
798 3300014968 Ga0157379_10040777 Ga0157379_100407772 278
799 3300014968 Ga0157379_10800662 Ga0157379_108006621 278
800 3300017792 Ga0163161_10002273 Ga0163161_100022735 278
801 3300021384 Ga0213876_10002715 Ga0213876_100027158 278
802 3300021388 Ga0213875_10015787 Ga0213875_100157873 278
803 3300025303 Ga0209051_1000057 Ga0209051_1000057136 278
804 3300025303 Ga0209051_1000840 Ga0209051_100084029 278
805 3300025885 Ga0207653_10039748 Ga0207653_100397482 278
806 3300025899 Ga0207642_10000950 Ga0207642_100009503 278
807 3300025900 Ga0207710_10000010 Ga0207710_10000010418 278
808 3300025900 Ga0207710_10000027 Ga0207710_10000027282 278
809 3300025900 Ga0207710_10005078 Ga0207710_100050785 278
810 3300025900 Ga0207710_10033045 Ga0207710_100330452 278
811 3300025901 Ga0207688_10000298 Ga0207688_100002989 278
812 3300025901 Ga0207688_10001099 Ga0207688_1000109911 278
813 3300025903 Ga0207680_10018611 Ga0207680_100186113 278
814 3300025904 Ga0207647_10030802 Ga0207647_100308023 278
815 3300025905 Ga0207685_10040604 Ga0207685_100406041 278
816 3300025907 Ga0207645_10002891 Ga0207645_100028915 278
817 3300025908 Ga0207643_10108777 Ga0207643_101087772 278
818 3300025911 Ga0207654_10150448 Ga0207654_101504481 278
819 3300025915 Ga0207693_10009544 Ga0207693_100095449 278
820 3300025915 Ga0207693_10299375 Ga0207693_102993751 278
821 3300025916 Ga0207663_10010760 Ga0207663_100107602 278
822 3300025916 Ga0207663_10012044 Ga0207663_100120443 278
823 3300025917 Ga0207660_10128317 Ga0207660_101283172 278
824 3300025923 Ga0207681_10079897 Ga0207681_100798973 278
825 3300025926 Ga0207659_10172390 Ga0207659_101723902 278
826 3300025927 Ga0207687_10006588 Ga0207687_100065885 278
827 3300025929 Ga0207664_10240465 Ga0207664_102404652 278
828 3300025931 Ga0207644_10005414 Ga0207644_100054143 278
829 3300025931 Ga0207644_10199132 Ga0207644_101991322 278
830 3300025933 Ga0207706_10030955 Ga0207706_100309551 278
831 3300025933 Ga0207706_10331279 Ga0207706_103312792 278
832 3300025935 Ga0207709_10004200 Ga0207709_100042008 278
833 3300025936 Ga0207670_10007082 Ga0207670_100070825 278
834 3300025937 Ga0207669_10003926 Ga0207669_100039265 278
835 3300025938 Ga0207704_10000259 Ga0207704_100002596 278
836 3300025939 Ga0207665_10171719 Ga0207665_101717192 278
837 3300025941 Ga0207711_10000089 Ga0207711_1000008979 278
838 3300025941 Ga0207711_10006034 Ga0207711_100060343 278
839 3300025941 Ga0207711_10093462 Ga0207711_100934623 278
840 3300025944 Ga0207661_10578585 Ga0207661_105785852 278
841 3300025949 Ga0207667_10076811 Ga0207667_100768112 278
842 3300025961 Ga0207712_10000031 Ga0207712_1000003126 278
843 3300025961 Ga0207712_10220291 Ga0207712_102202912 278
844 3300025972 Ga0207668_10033738 Ga0207668_100337382 278
845 3300025972 Ga0207668_10289736 Ga0207668_102897362 278
846 3300025986 Ga0207658_10002658 Ga0207658_100026582 278
847 3300025986 Ga0207658_10008494 Ga0207658_100084946 278
848 3300025986 Ga0207658_10033165 Ga0207658_100331653 278
849 3300026023 Ga0207677_10023533 Ga0207677_100235333 278
850 3300026023 Ga0207677_10073088 Ga0207677_100730882 278
851 3300026035 Ga0207703_10005856 Ga0207703_1000585610 278
852 3300026035 Ga0207703_10012404 Ga0207703_100124045 278
853 3300026035 Ga0207703_10490280 Ga0207703_104902801 278
854 3300026041 Ga0207639_10002094 Ga0207639_1000209411 278
855 3300026067 Ga0207678_10010534 Ga0207678_100105341 278
856 3300026075 Ga0207708_10016979 Ga0207708_100169792 278
857 3300026075 Ga0207708_10085568 Ga0207708_100855683 278
858 3300026088 Ga0207641_10001166 Ga0207641_1000116621 278
859 3300026088 Ga0207641_10009378 Ga0207641_100093785 278
860 3300026088 Ga0207641_10188505 Ga0207641_101885052 278
861 3300026089 Ga0207648_10005843 Ga0207648_100058431 278
862 3300026089 Ga0207648_10053292 Ga0207648_100532921 278
863 3300026118 Ga0207675_100001181 Ga0207675_10000118129 278
864 3300026121 Ga0207683_10001691 Ga0207683_1000169122 278
865 3300026121 Ga0207683_10030388 Ga0207683_100303881 278
866 3300026142 Ga0207698_10616809 Ga0207698_106168091 278
867 3300028379 Ga0268266_10090810 Ga0268266_100908102 278
868 3300028379 Ga0268266_10124476 Ga0268266_101244762 278
869 3300028379 Ga0268266_10230640 Ga0268266_102306402 278
870 3300028380 Ga0268265_10000029 Ga0268265_10000029190 278
871 3300028380 Ga0268265_10023069 Ga0268265_100230693 278
872 3300028381 Ga0268264_10000236 Ga0268264_1000023666 278
873 3300028381 Ga0268264_10014360 Ga0268264_100143603 278
874 3300028381 Ga0268264_10211079 Ga0268264_102110792 278
875 3300031251 Ga0265327_10002217 Ga0265327_1000221710 278
876 3300031731 Ga0307405_10081833 Ga0307405_100818332 278
877 3300031824 Ga0307413_10010833 Ga0307413_100108333 278
878 3300031995 Ga0307409_100001399 Ga0307409_1000013996 278
879 3300032126 Ga0307415_100056453 Ga0307415_1000564533 278
880 3300037853 Ga0436364_0032767 Ga0436364_0032767_890_1729 278
881 3300037853 Ga0436364_0177961 Ga0436364_0177961_33431_34267 278
882 3300038443 Ga0395901_0651256 Ga0395901_0651256_68_907 278
883 3300039437 Ga0436365_1083994 Ga0436365_1083994_15320_16159 278
884 3300039437 Ga0436365_1211143 Ga0436365_1211143_5932_6768 278
885 3300041410 Ga0439461_0000759 Ga0439461_0000759_3326_4165 278
886 3300041411 Ga0439466_0001646 Ga0439466_0001646_3777_4616 278
887 3300041411 Ga0439466_0046696 Ga0439466_0046696_326_1162 278
888 3300041413 Ga0439465_0002076 Ga0439465_0002076_1834_2673 278
889 3300042002 Ga0439442_009028 Ga0439442_009028_521_1360 278
890 3300042004 Ga0439445_0008638 Ga0439445_0008638_1266_2102 278
891 3300044658 Ga0466972_0119010 Ga0466972_0119010_94_933 278
892 3300044683 Ga0466965_0042151 Ga0466965_0042151_614_1450 278
893 3300044719 Ga0466971_0036263 Ga0466971_0036263_498_1337 278
894 3300044735 Ga0466968_0105304 Ga0466968_0105304_346_1185 278
895 3300044765 Ga0466970_0046140 Ga0466970_0046140_960_1799 278
896 3300044842 Ga0466957_0042147 Ga0466957_0042147_478_1335 278
897 3300044901 Ga0466960_0002025 Ga0466960_0002025_5036_5893 278
898 3300044901 Ga0466960_0045500 Ga0466960_0045500_1059_1895 278
899 3300045836 Ga0466958_0032757 Ga0466958_0032757_1736_2593 278
900 3300045976 Ga0466967_0077041 Ga0466967_0077041_1367_2203 278
901 3300045976 Ga0466967_0562572 Ga0466967_0562572_72_908 278
902 3300046460 Ga0495638_0013732 Ga0495638_0013732_4082_4918 278
903 3300046694 Ga0495649_0246127 Ga0495649_0246127_22_861 278
904 3300047320 Ga0495672_0016422 Ga0495672_0016422_2428_3264 278
905 3300048903 Ga0496100_0000077 Ga0496100_0000077_6260_7096 278
906 3300048903 Ga0496100_0018315 Ga0496100_0018315_3076_3912 278
907 3300048903 Ga0496100_0029147 Ga0496100_0029147_2113_2958 278
908 3300048903 Ga0496100_0098789 Ga0496100_0098789_984_1820 278
909 3300048904 Ga0496101_0000042 Ga0496101_0000042_115496_116332 278
910 3300048904 Ga0496101_0004926 Ga0496101_0004926_7537_8373 278
911 3300048904 Ga0496101_0040473 Ga0496101_0040473_2307_3143 278
912 3300048904 Ga0496101_0356773 Ga0496101_0356773_73_909 278
913 3300048905 Ga0496102_0000205 Ga0496102_0000205_23006_23842 278
914 3300048905 Ga0496102_0002438 Ga0496102_0002438_1709_2545 278
915 3300048905 Ga0496102_0003855 Ga0496102_0003855_8628_9464 278
916 3300048905 Ga0496102_0032380 Ga0496102_0032380_2005_2847 278
917 3300048905 Ga0496102_0258876 Ga0496102_0258876_394_1230 278
918 3300048906 Ga0496103_0000315 Ga0496103_0000315_13913_14749 278
919 3300048906 Ga0496103_0000751 Ga0496103_0000751_8298_9134 278
920 3300048906 Ga0496103_0001957 Ga0496103_0001957_4497_5333 278
921 3300048906 Ga0496103_0026574 Ga0496103_0026574_2405_3241 278
922 3300048906 Ga0496103_0150061 Ga0496103_0150061_459_1304 278
923 3300048907 Ga0496104_0048840 Ga0496104_0048840_1101_1943 278
924 3300048908 Ga0496105_0161901 Ga0496105_0161901_248_1090 278
925 3300048908 Ga0496105_0240028 Ga0496105_0240028_407_1252 278
926 3300048909 Ga0496106_0000103 Ga0496106_0000103_38400_39236 278
927 3300048909 Ga0496106_0003070 Ga0496106_0003070_3239_4075 278
928 3300048910 Ga0496107_0000558 Ga0496107_0000558_6714_7550 278
929 3300048910 Ga0496107_0016029 Ga0496107_0016029_3348_4184 278
930 3300048910 Ga0496107_0077432 Ga0496107_0077432_444_1280 278
931 3300048910 Ga0496107_0086828 Ga0496107_0086828_1301_2146 278
932 3300048911 Ga0496108_0000916 Ga0496108_0000916_17709_18545 278
933 3300048912 Ga0496109_0000312 Ga0496109_0000312_42171_43007 278
934 3300048912 Ga0496109_0021301 Ga0496109_0021301_725_1561 278
935 3300048912 Ga0496109_0033108 Ga0496109_0033108_3235_4077 278
936 3300048913 Ga0496110_0013273 Ga0496110_0013273_3620_4456 278
937 3300048913 Ga0496110_0191579 Ga0496110_0191579_911_1747 278
938 3300048914 Ga0496111_0002512 Ga0496111_0002512_2404_3240 278
939 3300048914 Ga0496111_0084517 Ga0496111_0084517_767_1603 278
940 3300048915 Ga0496112_0040858 Ga0496112_0040858_431_1267 278
941 3300048915 Ga0496112_0193900 Ga0496112_0193900_420_1256 278
942 3300048916 Ga0496113_0068985 Ga0496113_0068985_266_1102 278
943 3300048917 Ga0496114_0000309 Ga0496114_0000309_4961_5797 278
944 3300048917 Ga0496114_0001352 Ga0496114_0001352_15906_16742 278
945 3300048917 Ga0496114_0152444 Ga0496114_0152444_393_1238 278
946 3300048918 Ga0496115_0001893 Ga0496115_0001893_2756_3592 278
947 3300048919 Ga0496116_0032191 Ga0496116_0032191_1609_2445 278
948 3300048920 Ga0496117_0000725 Ga0496117_0000725_27942_28778 278
949 3300048921 Ga0496118_0002778 Ga0496118_0002778_17406_18242 278
950 3300048921 Ga0496118_0108323 Ga0496118_0108323_825_1661 278
951 3300048922 Ga0496119_0001488 Ga0496119_0001488_17014_17850 278
952 3300048923 Ga0496120_0020465 Ga0496120_0020465_2423_3259 278
953 3300048924 Ga0496121_0000139 Ga0496121_0000139_115496_116332 278
954 3300048924 Ga0496121_0071666 Ga0496121_0071666_925_1761 278
955 3300048925 Ga0496122_0000149 Ga0496122_0000149_115724_116560 278
956 3300048925 Ga0496122_0209722 Ga0496122_0209722_123_959 278
957 3300048926 Ga0496123_0011118 Ga0496123_0011118_4340_5176 278
958 3300048927 Ga0496124_0000114 Ga0496124_0000114_117535_118371 278
959 3300048927 Ga0496124_0099753 Ga0496124_0099753_1165_2001 278
960 3300048928 Ga0496125_0000130 Ga0496125_0000130_115496_116332 278
961 3300048928 Ga0496125_0039006 Ga0496125_0039006_2367_3203 278
962 3300048928 Ga0496125_0087033 Ga0496125_0087033_1407_2243 278
963 3300048929 Ga0496126_0000149 Ga0496126_0000149_46845_47681 278
964 3300048929 Ga0496126_0014251 Ga0496126_0014251_6026_6865 278
965 3300048929 Ga0496126_0040663 Ga0496126_0040663_788_1624 278
966 3300049569 Ga0501032_0000730 Ga0501032_0000730_22791_23642 278
967 3300049569 Ga0501032_0027441 Ga0501032_0027441_772_1617 278
968 3300049570 Ga0501033_0055422 Ga0501033_0055422_1137_1988 278
969 3300049571 Ga0501034_0001381 Ga0501034_0001381_10197_11048 278
970 3300049572 Ga0501036_0038054 Ga0501036_0038054_3151_4002 278
971 3300049572 Ga0501036_0115889 Ga0501036_0115889_1133_1978 278
972 3300049573 Ga0501037_0007301 Ga0501037_0007301_314_1165 278
973 3300049573 Ga0501037_0009763 Ga0501037_0009763_2080_2925 278
974 3300049574 Ga0501038_0035146 Ga0501038_0035146_1218_2063 278
975 3300049575 Ga0501039_0002246 Ga0501039_0002246_10096_10941 278
976 3300049579 Ga0501043_0000567 Ga0501043_0000567_10373_11218 278
977 3300049580 Ga0501046_0001102 Ga0501046_0001102_24521_25372 278
978 3300049581 Ga0501047_0012357 Ga0501047_0012357_5483_6334 278
979 3300049581 Ga0501047_0041303 Ga0501047_0041303_2465_3304 278
980 3300049581 Ga0501047_0323044 Ga0501047_0323044_328_1167 278
981 3300049582 Ga0501048_0037170 Ga0501048_0037170_589_1440 278
982 3300049584 Ga0501068_0206065 Ga0501068_0206065_286_1131 278
983 3300049585 Ga0501069_0092886 Ga0501069_0092886_682_1533 278
984 3300049586 Ga0501070_0007150 Ga0501070_0007150_1315_2166 278
985 3300049822 Ga0501035_0000407 Ga0501035_0000407_15117_15968 278
986 3300049822 Ga0501035_0001095 Ga0501035_0001095_7715_8554 278
987 3300049823 Ga0501044_0000554 Ga0501044_0000554_40754_41593 278
988 3300049823 Ga0501044_0000771 Ga0501044_0000771_7208_8059 278
989 3300049823 Ga0501044_0036089 Ga0501044_0036089_1003_1839 278
990 3300050489 nmdc:mga03683_99144_c1 nmdc:mga03683_99144_c1_280_1119 278
991 3300050490 nmdc:mga03n38_2328_c1 nmdc:mga03n38_2328_c1_4139_4975 278
992 3300050491 nmdc:mga00v17_16530_c1 nmdc:mga00v17_16530_c1_2860_3696 278
993 3300050491 nmdc:mga00v17_33236_c1 nmdc:mga00v17_33236_c1_1928_2764 278
994 3300050491 nmdc:mga00v17_82760_c1 nmdc:mga00v17_82760_c1_891_1727 278
995 3300050492 nmdc:mga0yw44_18180_c1 nmdc:mga0yw44_18180_c1_413_1249 278
996 3300050492 nmdc:mga0yw44_245778_c1 nmdc:mga0yw44_245778_c1_84_920 278
997 3300050492 nmdc:mga0yw44_64485_c1 nmdc:mga0yw44_64485_c1_39_875 278
998 3300050494 nmdc:mga06z11_44352_c1 nmdc:mga06z11_44352_c1_1250_2101 278
999 3300050496 nmdc:mga07m45_27403_c1 nmdc:mga07m45_27403_c1_773_1609 278
1000 3300050516 nmdc:mga0sz30_19838_c1 nmdc:mga0sz30_19838_c1_895_1731 278
1001 3300050516 nmdc:mga0sz30_86992_c1 nmdc:mga0sz30_86992_c1_354_1193 278
1002 3300053131 Ga0500652_006864 Ga0500652_006864_1463_2299 278
1003 3300053136 Ga0500559_0177131 Ga0500559_0177131_73_909 278
1004 3300053153 Ga0500616_0006180 Ga0500616_0006180_4811_5647 278
1005 3300053730 Ga0500645_000027 Ga0500645_000027_22654_23490 278

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

115

304

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
7cad-assembly1.cif.gz_B mycobacterium smegmatis sugabc complex 0.9037 7 278
8hpn-assembly1.cif.gz_B lpqy-sugabc in state 3 0.9014 7 270
7cad-assembly1.cif.gz_B mycobacterium smegmatis sugabc complex 0.8975 7 278
8ja7-assembly1.cif.gz_B cryo-em structure of mycobacterium tuberculosis lpqy-sugabc in complex with trehalose 0.8953 7 276
8hpn-assembly1.cif.gz_B lpqy-sugabc in state 3 0.8951 7 270
ID Description Score Start End Superfamily
af_P9WG01_5_265_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9461 10 268 1.10.3720.10
af_P9WG01_5_265_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9357 10 268 1.10.3720.10
af_Q2G1E7_1_266_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8897 1 264 1.10.3720.10
af_O53483_6_271_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8841 1 268 1.10.3720.10
af_P77716_1_267_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8835 1 264 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A3R8P5L0-F1-model_v4 Carbohydrate ABC transporter permease 0.9625 11 278 GO:0005886
GO:0055085
AF-A0A2G5II45-F1-model_v4 Sugar ABC transporter permease 0.9503 17 274 GO:0005886
GO:0055085
AF-A0A1Q7BRX3-F1-model_v4 Sugar ABC transporter permease 0.9496 10 276 GO:0005886
GO:0055085
AF-Q49977-F1-model_v4 Malg 0.9494 7 278 GO:0005886
GO:0055085
AF-A0A3R8P5L0-F1-model_v4 Carbohydrate ABC transporter permease 0.9487 11 278 GO:0005886
GO:0055085

Feature Viewer

pLDDT pTM Quality
84.61 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map