F487993
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1005 | 494 | 938 | 274 |
Family's Representative Sequence
| Representative Sequence | 3300046524|Ga0495648_0035570|Ga0495648_0035570_119_1048 |
| Length | 309 |
| Sequence | MSTTRTFPGPATNPPNPXXXXAVRRCGRARRVSGSRGGSALLGWTAANLVILGLSLVPVLWLVSLSFKTSDTIDDGRFVPRAWTLENYRGIFDTSLFTRALVNSIGIAVIATALAVVFGSMAAYAVARLRFPGKGVLVGLSLLIAMFPQISLVSPLFNLWRQLGLFDTWPGLIIPYLTFALPLSIYTLSAFFREIPWDLEKAAAMDGATPAQAFRRVIAPLAAPGMVTTAILVFILCWNDFLFAISLTSTDRARTAPAAIAFFTGASQFAQPIGSIAAAAVVITIPIIVFVLLFQRRIVAGLTSGAVKG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501039 | Frankia saprophytica CN3 | Isolate | Nodule |
| 2 | 2554235005 | Streptomyces violaceusniger SPC6 | Isolate | Rhizosphere |
| 3 | 2582581313 | Streptomyces mirabilis OV308 | Isolate | Rhizosphere |
| 4 | 2643221714 | Streptomyces sp. Root264 | Isolate | Unclassified |
| 5 | 2675902999 | Frankia asymbiotica NRRL B-16386 | Isolate | Nodule |
| 6 | 2675903059 | Asanoa hainanensis CGMCC 4.5593 | Isolate | Rhizosphere |
| 7 | 2687453737 | Frankia sp. BMG5.36 | Isolate | Nodule |
| 8 | 2738541264 | Mycobacterium sp. OK889 | Isolate | Unclassified |
| 9 | 2738541274 | Mycobacterium sp. YR708 | Isolate | Unclassified |
| 10 | 2738541356 | Mycobacterium sp. OK887 | Isolate | Unclassified |
| 11 | 2738543028 | Mycobacterium sp. YR782 | Isolate | Unclassified |
| 12 | 2751185782 | Actinoplanes subtropicus NRRL B-24665 | Isolate | Rhizosphere |
| 13 | 2772190715 | Micromonospora chokoriensis NRRL B-24750 | Isolate | Unclassified |
| 14 | 2773857921 | Frankia asymbiotica NRRL B-16386 | Isolate | Nodule |
| 15 | 2784746763 | Streptomyces ossamyceticus SAI-001 | Isolate | Unclassified |
| 16 | 2784746768 | Streptomyces griseorubiginosus SAI-142 | Isolate | Unclassified |
| 17 | 2808606375 | Streptomyces sp. SLBN-31 | Isolate | Unclassified |
| 18 | 2808606982 | Streptomyces sp. SLBN-118 | Isolate | Unclassified |
| 19 | 2811994879 | Streptomyces sp. 4-17 | Isolate | Unclassified |
| 20 | 2811994917 | Streptomyces sp. SLBN-134 | Isolate | Unclassified |
| 21 | 2831935698 | Jishengella sp. AZ1-13 | Isolate | Unclassified |
| 22 | 2832004796 | Micromonospora endophytica JCM 18317 | Isolate | Unclassified |
| 23 | 2852635781 | Streptomyces sp. AK010 | Isolate | Rhizosphere |
| 24 | 2855670206 | Micromonospora noduli Lupac 07 | Isolate | Nodule |
| 25 | 2855676851 | Micromonospora saelicesensis GAR05 | Isolate | Unclassified |
| 26 | 2855683550 | Micromonospora sp. RP3T | Isolate | Unclassified |
| 27 | 2856858025 | Micromonospora aurantiaca 110B(2018) | Isolate | Unclassified |
| 28 | 2857288857 | Micromonospora noduli ONO23 | Isolate | Unclassified |
| 29 | 2858848962 | Micromonospora saelicesensis GAR06 | Isolate | Unclassified |
| 30 | 2858868258 | Micromonospora sp. MH33 | Isolate | Unclassified |
| 31 | 2858882152 | Micromonospora noduli MED15 | Isolate | Nodule |
| 32 | 2858888857 | Micromonospora saelicesensis Lupac 06 | Isolate | Unclassified |
| 33 | 2858895516 | Micromonospora saelicesensis PSN13 | Isolate | Unclassified |
| 34 | 2858902515 | Micromonospora sp. MW-13 | Isolate | Rhizosphere |
| 35 | 2863404153 | Streptomyces scabiei SAI-025 (Annotation) (version 2) | Isolate | Unclassified |
| 36 | 2866065130 | Micromonospora endophytica DSM 45430 | Isolate | Unclassified |
| 37 | 2867302475 | Micromonospora globbae WPS1-2 | Isolate | Unclassified |
| 38 | 2867312974 | Micromonospora musae NGC1-4 | Isolate | Unclassified |
| 39 | 2867319477 | Micromonospora musae MS1-9 | Isolate | Unclassified |
| 40 | 2867507094 | Micromonospora zingiberis PLAI 1-1 | Isolate | Unclassified |
| 41 | 2869048445 | Micromonospora saelicesensis PSN01 | Isolate | Unclassified |
| 42 | 2869061728 | Micromonospora noduli ONO86 | Isolate | Unclassified |
| 43 | 2869068681 | Micromonospora noduli GUI43 | Isolate | Unclassified |
| 44 | 2880489317 | Micromonospora ureilytica DSM 101692 | Isolate | Unclassified |
| 45 | 2880495981 | Micromonospora vinacea DSM 101695 | Isolate | Unclassified |
| 46 | 2895880812 | Frankia sp. BMG5.11 | Isolate | Unclassified |
| 47 | 2902582711 | Micromonospora sp. AP08 | Isolate | Unclassified |
| 48 | 2902799365 | Mycolicibacterium sp. P1-5 | Isolate | Unclassified |
| 49 | 2929219909 | Micromonospora sp. R-75348 Hybrid assembly | Isolate | Unclassified |
| 50 | 2929226422 | Micromonospora sp. R-74116 Hybrid assembly | Isolate | Unclassified |
| 51 | 2946064051 | Streptomyces luteogriseus W4I19-1 | Isolate | Rhizosphere |
| 52 | 2946072368 | Streptomyces achromogenes W4I19-2 | Isolate | Rhizosphere |
| 53 | 2954691527 | Streptomyces sp. SAI-127 | Isolate | Rhizosphere |
| 54 | 2954701450 | Streptomyces sp. SAI-144 | Isolate | Rhizosphere |
| 55 | 2996221748 | Micromonospora veneta CAP181 | Isolate | Unclassified |
| 56 | 3002998708 | Actinomadura barringtoniae GKU 128 | Isolate | Unclassified |
| 57 | 3006486233 | Streptomyces sp. BR123 | Isolate | Rhizosphere |
| 58 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 59 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 60 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 61 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 62 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 63 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 64 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 65 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 66 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 67 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 68 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 69 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 70 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 71 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 73 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 74 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 75 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 77 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 78 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 79 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 80 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 81 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 82 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 84 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 94 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 95 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 96 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 98 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 99 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 103 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 104 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 105 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 106 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 107 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 108 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 109 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 110 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 111 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 112 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 113 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 114 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 115 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 116 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 117 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 118 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 119 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 120 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 121 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 122 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 123 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 124 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 125 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 126 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 127 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 128 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 129 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 130 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 131 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 132 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 133 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 134 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 135 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 136 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 137 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 138 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 139 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 140 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 141 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 142 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 144 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 145 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 146 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 147 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 148 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 149 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 150 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 152 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 153 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 154 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 156 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 157 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 158 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 159 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 160 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 161 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 162 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 163 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 164 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 165 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 166 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 167 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 168 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 169 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 170 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 171 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 172 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 173 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 174 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 175 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 176 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 177 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 178 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 179 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 180 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 181 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 182 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 183 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 184 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 185 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 186 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 187 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 188 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 189 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 190 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 191 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 192 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 193 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 194 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 254 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 258 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 259 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 260 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 261 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 262 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 263 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 264 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 265 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 266 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 267 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 268 | 3300031889 | Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO | Metagenome | Rhizosphere |
| 269 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 270 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 271 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 272 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 273 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 274 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 275 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 276 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 277 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 278 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 279 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 280 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 281 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 282 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 283 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 284 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 285 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 286 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 287 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 288 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 289 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 290 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 291 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 292 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 293 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 294 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 295 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 296 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 297 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 298 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 299 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 300 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 301 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 302 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 303 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 304 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 305 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 306 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 307 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 308 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 309 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 310 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 311 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 312 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 313 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 314 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 315 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 316 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 317 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 318 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 319 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 320 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 321 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 322 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 323 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 324 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 325 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 326 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 327 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 328 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 353 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 354 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 355 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 356 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 357 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 358 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 359 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 360 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 361 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 362 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 363 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 364 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 365 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 366 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 367 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 368 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 369 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 370 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 371 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 372 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 373 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 374 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 375 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 376 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 377 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 378 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 379 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 380 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 381 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 382 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 383 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 384 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 385 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 386 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 387 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 388 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 389 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 390 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 391 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 392 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 393 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 394 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 395 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 396 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 397 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 398 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 399 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 400 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 401 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 402 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 403 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 404 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 405 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 406 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 407 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 408 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 409 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 410 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 411 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 412 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 413 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 414 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 415 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 416 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 417 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 418 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 419 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 420 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 421 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 422 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 423 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 424 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
| 425 | 3300053101 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere | Metagenome | Endosphere |
| 426 | 3300053113 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 endosphere | Metagenome | Endosphere |
| 427 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 428 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 429 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 430 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 431 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 432 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 433 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 434 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 435 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 436 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 437 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 438 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 439 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 440 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 441 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 442 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 443 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 444 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 445 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 446 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 447 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 448 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 449 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 450 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 451 | 3300059509 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 452 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 453 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 454 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 455 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 456 | 3300059514 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 457 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 458 | 3300059607 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 459 | 3300059608 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 166R_SD_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 460 | 3300059622 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 461 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 462 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 463 | 3300059625 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 464 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 465 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 466 | 3300059631 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 467 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 468 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 469 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 470 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 471 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 472 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 473 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 474 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 475 | 3300059649 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 476 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 477 | 3300059654 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 478 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 479 | 3300059658 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 480 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 481 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 482 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 483 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 484 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 485 | 649633069 | Micromonospora sp. L5 | Isolate | Unclassified |
| 486 | 8002775197 | Frankia nepalensis CN7 | Isolate | Nodule |
| 487 | 8002784119 | Frankia sp. AgB1.9 | Isolate | Nodule |
| 488 | 8003830390 | Micromonospora parastrephiae STR1_7 | Isolate | Rhizosphere |
| 489 | 8003856774 | Micromonospora echinofusca MPMI6 | Isolate | Unclassified |
| 490 | 8003870546 | Micromonospora tarensis STR1s_6 | Isolate | Rhizosphere |
| 491 | 8054704163 | Micromonospora trifolii NIE79 | Isolate | Nodule |
| 492 | 8054727385 | Micromonospora alfalfae MED01 | Isolate | Nodule |
| 493 | 8054734606 | Micromonospora hortensis NIE111 | Isolate | Nodule |
| 494 | 8055412473 | Micromonospora phytophila DSM 105363 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 81.29 |
| Metatranscriptomes | 12.04 |
| Isolates | 6.67 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.67 |
| Nodule | 1.19 |
| Rhizoplane | 5.37 |
| Rhizosphere | 77.51 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.25 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJNas_1001603 | 3300000546 | Bacteria | 3092 |
| 2 | JGI24746J21847_1001314 | 3300001977 | Bacteria | 3967 |
| 3 | JGI24747J21853_1002149 | 3300001978 | Bacteria | 1570 |
| 4 | JGI24735J21928_10058516 | 3300002067 | Bacteria | 1109 |
| 5 | JGI24745J21846_1005536 | 3300002073 | Bacteria | 1381 |
| 6 | JGI24749J21850_1004653 | 3300002076 | Bacteria | 1923 |
| 7 | JGI24744J21845_10004230 | 3300002077 | Bacteria | 2961 |
| 8 | JGI24744J21845_10016379 | 3300002077 | Bacteria | 1476 |
| 9 | JGI24034J26672_10001767 | 3300002239 | Bacteria | 2911 |
| 10 | JGI24034J26672_10014301 | 3300002239 | Bacteria | 1210 |
| 11 | JGI24742J22300_10005722 | 3300002244 | Bacteria | 2046 |
| 12 | JGI25406J46586_10008147 | 3300003203 | Bacteria | 4758 |
| 13 | JGI25407J50210_10007409 | 3300003373 | Bacteria | 2747 |
| 14 | JGI25407J50210_10009310 | 3300003373 | Bacteria | 2486 |
| 15 | JGI25407J50210_10014238 | 3300003373 | Bacteria | 2050 |
| 16 | JGI25407J50210_10016954 | 3300003373 | Bacteria | 1889 |
| 17 | JGI25407J50210_10037730 | 3300003373 | Bacteria | 1241 |
| 18 | Ga0055540_1000052 | 3300003792 | Bacteria | 143472 |
| 19 | Ga0058861_10086516 | 3300004800 | Bacteria | 1397 |
| 20 | Ga0058861_11829308 | 3300004800 | Bacteria | 1338 |
| 21 | Ga0070676_10010720 | 3300005328 | Bacteria | 4974 |
| 22 | Ga0070683_100052814 | 3300005329 | Bacteria | 3766 |
| 23 | Ga0070683_100122935 | 3300005329 | Bacteria | 2452 |
| 24 | Ga0070683_100535648 | 3300005329 | Bacteria | 1119 |
| 25 | Ga0070690_100062101 | 3300005330 | Bacteria | 2409 |
| 26 | Ga0068869_100017957 | 3300005334 | Bacteria | 4808 |
| 27 | Ga0068869_100161527 | 3300005334 | Bacteria | 1744 |
| 28 | Ga0070666_10047885 | 3300005335 | Bacteria | 2871 |
| 29 | Ga0070680_100086833 | 3300005336 | Bacteria | 2586 |
| 30 | Ga0070682_100027496 | 3300005337 | Bacteria | 3414 |
| 31 | Ga0070682_100101197 | 3300005337 | Bacteria | 1902 |
| 32 | Ga0068868_100001568 | 3300005338 | Bacteria | 15606 |
| 33 | Ga0068868_100003817 | 3300005338 | Bacteria | 10523 |
| 34 | Ga0068868_100069439 | 3300005338 | Bacteria | 2807 |
| 35 | Ga0068868_100402530 | 3300005338 | Bacteria | 1181 |
| 36 | Ga0068868_100592220 | 3300005338 | Bacteria | 981 |
| 37 | Ga0070689_100020006 | 3300005340 | Bacteria | 4960 |
| 38 | Ga0070691_10002308 | 3300005341 | Bacteria | 8450 |
| 39 | Ga0070687_100041581 | 3300005343 | Bacteria | 2323 |
| 40 | Ga0070661_100014688 | 3300005344 | Bacteria | 5523 |
| 41 | Ga0070692_10035997 | 3300005345 | Bacteria | 2510 |
| 42 | Ga0070668_100002116 | 3300005347 | Bacteria | 14535 |
| 43 | Ga0070668_100003728 | 3300005347 | Bacteria | 11237 |
| 44 | Ga0070669_100043351 | 3300005353 | Bacteria | 3277 |
| 45 | Ga0070669_100158882 | 3300005353 | Bacteria | 1755 |
| 46 | Ga0070675_100002879 | 3300005354 | Bacteria | 12967 |
| 47 | Ga0070675_100468630 | 3300005354 | Bacteria | 1131 |
| 48 | Ga0070671_100104704 | 3300005355 | Bacteria | 2375 |
| 49 | Ga0070674_100002080 | 3300005356 | Bacteria | 10960 |
| 50 | Ga0070674_100285704 | 3300005356 | Bacteria | 1309 |
| 51 | Ga0070673_100175871 | 3300005364 | Bacteria | 1829 |
| 52 | Ga0070673_100442063 | 3300005364 | Bacteria | 1169 |
| 53 | Ga0070659_100007023 | 3300005366 | Bacteria | 8156 |
| 54 | Ga0070659_100018803 | 3300005366 | Bacteria | 5216 |
| 55 | Ga0070659_100068570 | 3300005366 | Bacteria | 2814 |
| 56 | Ga0070667_100014491 | 3300005367 | Bacteria | 6515 |
| 57 | Ga0070667_100020043 | 3300005367 | Bacteria | 5552 |
| 58 | Ga0070667_100091206 | 3300005367 | Bacteria | 2620 |
| 59 | Ga0070667_100646209 | 3300005367 | Bacteria | 976 |
| 60 | Ga0070667_100715179 | 3300005367 | Bacteria | 927 |
| 61 | Ga0070714_100083352 | 3300005435 | Bacteria | 2787 |
| 62 | Ga0070714_100676765 | 3300005435 | Bacteria | 994 |
| 63 | Ga0070713_100300198 | 3300005436 | Bacteria | 1478 |
| 64 | Ga0070713_100341387 | 3300005436 | Bacteria | 1388 |
| 65 | Ga0070713_100436686 | 3300005436 | Bacteria | 1227 |
| 66 | Ga0070710_10001629 | 3300005437 | Bacteria | 10609 |
| 67 | Ga0070710_10019372 | 3300005437 | Bacteria | 3515 |
| 68 | Ga0070710_10085938 | 3300005437 | Bacteria | 1846 |
| 69 | Ga0070701_10000238 | 3300005438 | Bacteria | 17648 |
| 70 | Ga0070701_10164151 | 3300005438 | Bacteria | 1289 |
| 71 | Ga0070711_100000410 | 3300005439 | Bacteria | 22249 |
| 72 | Ga0070711_100007257 | 3300005439 | Bacteria | 6733 |
| 73 | Ga0070700_100051409 | 3300005441 | Bacteria | 2565 |
| 74 | Ga0070700_100112453 | 3300005441 | Bacteria | 1813 |
| 75 | Ga0070700_100121551 | 3300005441 | Bacteria | 1750 |
| 76 | Ga0070694_100044717 | 3300005444 | Bacteria | 2964 |
| 77 | Ga0070663_100341124 | 3300005455 | Bacteria | 1211 |
| 78 | Ga0070678_100036033 | 3300005456 | Bacteria | 3460 |
| 79 | Ga0070678_100078483 | 3300005456 | Bacteria | 2494 |
| 80 | Ga0070678_100125947 | 3300005456 | Bacteria | 2028 |
| 81 | Ga0070678_100231819 | 3300005456 | Bacteria | 1540 |
| 82 | Ga0070662_100062646 | 3300005457 | Bacteria | 2718 |
| 83 | Ga0070662_100106712 | 3300005457 | Bacteria | 2128 |
| 84 | Ga0068867_100040433 | 3300005459 | Bacteria | 3403 |
| 85 | Ga0068867_100329808 | 3300005459 | Bacteria | 1267 |
| 86 | Ga0068867_100406644 | 3300005459 | Bacteria | 1149 |
| 87 | Ga0070679_100036973 | 3300005530 | Bacteria | 4847 |
| 88 | Ga0070679_100069137 | 3300005530 | Bacteria | 3522 |
| 89 | Ga0070684_100006940 | 3300005535 | Bacteria | 8794 |
| 90 | Ga0070684_100129879 | 3300005535 | Bacteria | 2272 |
| 91 | Ga0070697_100218563 | 3300005536 | Bacteria | 1624 |
| 92 | Ga0068853_100023981 | 3300005539 | Bacteria | 5114 |
| 93 | Ga0070672_100259579 | 3300005543 | Bacteria | 1465 |
| 94 | Ga0070695_100018514 | 3300005545 | Bacteria | 4230 |
| 95 | Ga0070693_100009709 | 3300005547 | Bacteria | 4794 |
| 96 | Ga0070693_100058231 | 3300005547 | Bacteria | 2235 |
| 97 | Ga0070665_100042854 | 3300005548 | Bacteria | 4549 |
| 98 | Ga0070665_100209382 | 3300005548 | Bacteria | 1950 |
| 99 | Ga0070665_100244513 | 3300005548 | Bacteria | 1795 |
| 100 | Ga0070704_100000737 | 3300005549 | Bacteria | 16034 |
| 101 | Ga0068855_100028863 | 3300005563 | Bacteria | 6637 |
| 102 | Ga0068855_100340163 | 3300005563 | Bacteria | 1655 |
| 103 | Ga0068855_100392201 | 3300005563 | Bacteria | 1523 |
| 104 | Ga0070664_100000709 | 3300005564 | Bacteria | 25499 |
| 105 | Ga0070664_100045804 | 3300005564 | Bacteria | 3694 |
| 106 | Ga0068857_100018243 | 3300005577 | Bacteria | 6155 |
| 107 | Ga0068854_100076440 | 3300005578 | Bacteria | 2461 |
| 108 | Ga0068856_100039634 | 3300005614 | Bacteria | 4625 |
| 109 | Ga0070702_100008329 | 3300005615 | Bacteria | 5016 |
| 110 | Ga0070702_100039920 | 3300005615 | Bacteria | 2622 |
| 111 | Ga0070702_100083299 | 3300005615 | Bacteria | 1921 |
| 112 | Ga0068852_100037223 | 3300005616 | Bacteria | 4077 |
| 113 | Ga0068852_100046213 | 3300005616 | Bacteria | 3709 |
| 114 | Ga0068852_100293440 | 3300005616 | Bacteria | 1572 |
| 115 | Ga0068852_100321149 | 3300005616 | Bacteria | 1504 |
| 116 | Ga0068852_100624212 | 3300005616 | Bacteria | 1083 |
| 117 | Ga0068859_100000134 | 3300005617 | Bacteria | 69536 |
| 118 | Ga0068859_100002049 | 3300005617 | Bacteria | 20587 |
| 119 | Ga0068859_100015497 | 3300005617 | Bacteria | 7660 |
| 120 | Ga0068859_100501126 | 3300005617 | Bacteria | 1309 |
| 121 | Ga0068864_100362156 | 3300005618 | Bacteria | 1371 |
| 122 | Ga0068866_10000579 | 3300005718 | Bacteria | 16629 |
| 123 | Ga0068866_10023252 | 3300005718 | Bacteria | 2880 |
| 124 | Ga0068861_100000671 | 3300005719 | Bacteria | 20372 |
| 125 | Ga0068861_100019822 | 3300005719 | Bacteria | 4807 |
| 126 | Ga0068861_100156491 | 3300005719 | Bacteria | 1875 |
| 127 | Ga0068861_100429810 | 3300005719 | Bacteria | 1178 |
| 128 | Ga0068870_10095922 | 3300005840 | Bacteria | 1667 |
| 129 | Ga0068863_100000189 | 3300005841 | Bacteria | 65435 |
| 130 | Ga0068863_100000833 | 3300005841 | Bacteria | 30909 |
| 131 | Ga0068858_100000014 | 3300005842 | Bacteria | 214686 |
| 132 | Ga0068858_100008568 | 3300005842 | Bacteria | 9820 |
| 133 | Ga0068858_100009472 | 3300005842 | Bacteria | 9289 |
| 134 | Ga0068858_100209104 | 3300005842 | Bacteria | 1846 |
| 135 | Ga0068858_100223656 | 3300005842 | Bacteria | 1783 |
| 136 | Ga0068858_100272920 | 3300005842 | Bacteria | 1609 |
| 137 | Ga0068860_100000174 | 3300005843 | Bacteria | 105338 |
| 138 | Ga0068860_100001236 | 3300005843 | Bacteria | 27875 |
| 139 | Ga0068860_100209743 | 3300005843 | Bacteria | 1889 |
| 140 | Ga0068862_100000009 | 3300005844 | Bacteria | 298620 |
| 141 | Ga0068862_100000019 | 3300005844 | Bacteria | 229485 |
| 142 | Ga0068862_100008993 | 3300005844 | Bacteria | 8268 |
| 143 | Ga0068862_100072262 | 3300005844 | Bacteria | 2980 |
| 144 | Ga0068862_100162505 | 3300005844 | Bacteria | 1994 |
| 145 | Ga0081455_10001610 | 3300005937 | Bacteria | 27562 |
| 146 | Ga0081455_10020131 | 3300005937 | Bacteria | 6294 |
| 147 | Ga0081455_10022912 | 3300005937 | Bacteria | 5822 |
| 148 | Ga0081455_10087959 | 3300005937 | Bacteria | 2526 |
| 149 | Ga0081455_10212614 | 3300005937 | Bacteria | 1440 |
| 150 | Ga0081538_10000927 | 3300005981 | Bacteria | 31625 |
| 151 | Ga0081538_10003181 | 3300005981 | Bacteria | 15594 |
| 152 | Ga0081538_10007006 | 3300005981 | Bacteria | 9807 |
| 153 | Ga0081538_10007094 | 3300005981 | Bacteria | 9735 |
| 154 | Ga0081538_10007779 | 3300005981 | Bacteria | 9208 |
| 155 | Ga0081538_10009238 | 3300005981 | Bacteria | 8257 |
| 156 | Ga0081538_10043924 | 3300005981 | Bacteria | 2797 |
| 157 | Ga0081540_1015573 | 3300005983 | Bacteria | 4809 |
| 158 | Ga0081540_1058775 | 3300005983 | Bacteria | 1850 |
| 159 | Ga0081539_10000256 | 3300005985 | Bacteria | 122838 |
| 160 | Ga0081539_10000424 | 3300005985 | Bacteria | 89967 |
| 161 | Ga0081539_10002011 | 3300005985 | Bacteria | 30800 |
| 162 | Ga0081539_10010650 | 3300005985 | Bacteria | 7422 |
| 163 | Ga0081539_10064620 | 3300005985 | Bacteria | 1990 |
| 164 | Ga0070717_10005059 | 3300006028 | Bacteria | 9611 |
| 165 | Ga0070717_10057268 | 3300006028 | Bacteria | 3222 |
| 166 | Ga0070717_10074143 | 3300006028 | Bacteria | 2845 |
| 167 | Ga0075365_10009152 | 3300006038 | Bacteria | 5674 |
| 168 | Ga0075365_10068328 | 3300006038 | Bacteria | 2387 |
| 169 | Ga0075365_10162947 | 3300006038 | Bacteria | 1554 |
| 170 | Ga0075368_10042061 | 3300006042 | Bacteria | 1797 |
| 171 | Ga0075363_100000960 | 3300006048 | Bacteria | 10237 |
| 172 | Ga0075363_100001005 | 3300006048 | Bacteria | 10113 |
| 173 | Ga0075363_100099383 | 3300006048 | Bacteria | 1609 |
| 174 | Ga0075363_100116335 | 3300006048 | Bacteria | 1489 |
| 175 | Ga0075363_100165068 | 3300006048 | Bacteria | 1255 |
| 176 | Ga0075364_10006557 | 3300006051 | Bacteria | 6847 |
| 177 | Ga0075364_10020556 | 3300006051 | Bacteria | 4153 |
| 178 | Ga0075364_10051397 | 3300006051 | Bacteria | 2692 |
| 179 | Ga0075432_10067546 | 3300006058 | Bacteria | 1281 |
| 180 | Ga0070716_100008409 | 3300006173 | Bacteria | 5119 |
| 181 | Ga0070712_100001020 | 3300006175 | Bacteria | 16891 |
| 182 | Ga0070712_100064076 | 3300006175 | Bacteria | 2605 |
| 183 | Ga0070712_100075006 | 3300006175 | Bacteria | 2431 |
| 184 | Ga0075367_10000123 | 3300006178 | Bacteria | 22531 |
| 185 | Ga0075369_10002320 | 3300006186 | Bacteria | 6767 |
| 186 | Ga0075369_10005620 | 3300006186 | Bacteria | 4696 |
| 187 | Ga0075369_10018741 | 3300006186 | Bacteria | 2820 |
| 188 | Ga0075369_10056399 | 3300006186 | Bacteria | 1707 |
| 189 | Ga0075369_10058207 | 3300006186 | Bacteria | 1682 |
| 190 | Ga0075369_10150251 | 3300006186 | Bacteria | 1064 |
| 191 | Ga0097621_100136590 | 3300006237 | Bacteria | 2092 |
| 192 | Ga0097621_100550660 | 3300006237 | Bacteria | 1050 |
| 193 | Ga0075370_10022826 | 3300006353 | Bacteria | 3440 |
| 194 | Ga0075370_10035285 | 3300006353 | Bacteria | 2806 |
| 195 | Ga0075370_10071153 | 3300006353 | Bacteria | 1990 |
| 196 | Ga0075370_10212847 | 3300006353 | Bacteria | 1141 |
| 197 | Ga0068871_100126997 | 3300006358 | Bacteria | 2159 |
| 198 | Ga0075431_100275306 | 3300006847 | Bacteria | 1705 |
| 199 | Ga0075434_100106111 | 3300006871 | Bacteria | 2819 |
| 200 | Ga0075429_100189876 | 3300006880 | Bacteria | 1800 |
| 201 | Ga0068865_100013059 | 3300006881 | Bacteria | 5238 |
| 202 | Ga0068865_100133007 | 3300006881 | Bacteria | 1866 |
| 203 | Ga0075436_100010389 | 3300006914 | Bacteria | 6379 |
| 204 | Ga0097620_100000134 | 3300006931 | Bacteria | 69536 |
| 205 | Ga0097620_100002049 | 3300006931 | Bacteria | 20587 |
| 206 | Ga0097620_100015497 | 3300006931 | Bacteria | 7660 |
| 207 | Ga0097620_100501108 | 3300006931 | Bacteria | 1309 |
| 208 | Ga0075435_100029787 | 3300007076 | Bacteria | 4286 |
| 209 | Ga0105250_10058136 | 3300009092 | Bacteria | 1552 |
| 210 | Ga0105240_10304768 | 3300009093 | Bacteria | 1821 |
| 211 | Ga0111539_10001616 | 3300009094 | Bacteria | 30103 |
| 212 | Ga0111539_10245169 | 3300009094 | Bacteria | 2086 |
| 213 | Ga0111539_10458410 | 3300009094 | Bacteria | 1485 |
| 214 | Ga0105245_10006195 | 3300009098 | Bacteria | 10528 |
| 215 | Ga0105245_10084748 | 3300009098 | Bacteria | 2904 |
| 216 | Ga0105245_10149004 | 3300009098 | Bacteria | 2210 |
| 217 | Ga0105245_10727307 | 3300009098 | Bacteria | 1027 |
| 218 | Ga0105247_10000023 | 3300009101 | Bacteria | 215645 |
| 219 | Ga0105247_10000335 | 3300009101 | Bacteria | 41099 |
| 220 | Ga0105247_10000864 | 3300009101 | Bacteria | 22922 |
| 221 | Ga0105247_10001279 | 3300009101 | Bacteria | 18560 |
| 222 | Ga0105247_10208866 | 3300009101 | Bacteria | 1316 |
| 223 | Ga0105247_10387827 | 3300009101 | Bacteria | 992 |
| 224 | Ga0105243_10003250 | 3300009148 | Bacteria | 13240 |
| 225 | Ga0105243_10566692 | 3300009148 | Bacteria | 1088 |
| 226 | Ga0105243_10810457 | 3300009148 | Bacteria | 924 |
| 227 | Ga0105241_10011583 | 3300009174 | Bacteria | 6466 |
| 228 | Ga0105241_10183085 | 3300009174 | Bacteria | 1739 |
| 229 | Ga0105242_10003744 | 3300009176 | Bacteria | 11816 |
| 230 | Ga0105242_10055349 | 3300009176 | Bacteria | 3245 |
| 231 | Ga0105248_10000111 | 3300009177 | Bacteria | 91627 |
| 232 | Ga0105248_10000557 | 3300009177 | Bacteria | 42285 |
| 233 | Ga0105248_10002739 | 3300009177 | Bacteria | 19567 |
| 234 | Ga0105248_10221983 | 3300009177 | Bacteria | 2127 |
| 235 | Ga0105237_10023752 | 3300009545 | Bacteria | 6276 |
| 236 | Ga0105237_10056472 | 3300009545 | Bacteria | 3930 |
| 237 | Ga0105238_10345085 | 3300009551 | Bacteria | 1477 |
| 238 | Ga0105249_10000033 | 3300009553 | Bacteria | 213834 |
| 239 | Ga0105249_10006292 | 3300009553 | Bacteria | 10314 |
| 240 | Ga0105249_10008171 | 3300009553 | Bacteria | 9120 |
| 241 | Ga0105249_10113955 | 3300009553 | Bacteria | 2559 |
| 242 | Ga0105249_10634440 | 3300009553 | Bacteria | 1125 |
| 243 | Ga0105249_10639138 | 3300009553 | Bacteria | 1121 |
| 244 | Ga0099796_10019399 | 3300010159 | Bacteria | 2060 |
| 245 | Ga0105239_10009697 | 3300010375 | Bacteria | 10827 |
| 246 | Ga0105239_10367611 | 3300010375 | Bacteria | 1625 |
| 247 | Ga0105246_10094339 | 3300011119 | Bacteria | 2164 |
| 248 | Ga0105246_10134630 | 3300011119 | Bacteria | 1850 |
| 249 | Ga0105246_10364338 | 3300011119 | Bacteria | 1189 |
| 250 | Ga0157371_10336534 | 3300013102 | Bacteria | 1097 |
| 251 | Ga0157370_10285810 | 3300013104 | Bacteria | 1524 |
| 252 | Ga0157369_10116239 | 3300013105 | Bacteria | 2840 |
| 253 | Ga0157369_10248916 | 3300013105 | Bacteria | 1855 |
| 254 | Ga0157374_10003977 | 3300013296 | Bacteria | 12419 |
| 255 | Ga0157374_10063104 | 3300013296 | Bacteria | 3475 |
| 256 | Ga0157374_10158206 | 3300013296 | Bacteria | 2206 |
| 257 | Ga0157378_10008995 | 3300013297 | Bacteria | 8694 |
| 258 | Ga0157378_10342351 | 3300013297 | Bacteria | 1459 |
| 259 | Ga0163162_10043832 | 3300013306 | Bacteria | 4479 |
| 260 | Ga0163162_10064518 | 3300013306 | Bacteria | 3707 |
| 261 | Ga0163162_10153933 | 3300013306 | Bacteria | 2418 |
| 262 | Ga0163162_10261893 | 3300013306 | Bacteria | 1861 |
| 263 | Ga0157372_10475564 | 3300013307 | Bacteria | 1457 |
| 264 | Ga0157372_10530889 | 3300013307 | Bacteria | 1372 |
| 265 | Ga0163163_10012428 | 3300014325 | Bacteria | 7756 |
| 266 | Ga0163163_10016062 | 3300014325 | Bacteria | 6943 |
| 267 | Ga0163163_10119081 | 3300014325 | Bacteria | 2673 |
| 268 | Ga0157380_10001016 | 3300014326 | Bacteria | 17845 |
| 269 | Ga0157380_10095822 | 3300014326 | Bacteria | 2459 |
| 270 | Ga0182008_10162084 | 3300014497 | Bacteria | 1126 |
| 271 | Ga0157377_10015911 | 3300014745 | Bacteria | 3858 |
| 272 | Ga0157377_10060232 | 3300014745 | Bacteria | 2166 |
| 273 | Ga0157377_10195281 | 3300014745 | Bacteria | 1281 |
| 274 | Ga0157379_10000701 | 3300014968 | Bacteria | 27163 |
| 275 | Ga0157379_10040777 | 3300014968 | Bacteria | 4145 |
| 276 | Ga0157379_10062736 | 3300014968 | Bacteria | 3323 |
| 277 | Ga0157379_10800662 | 3300014968 | Bacteria | 890 |
| 278 | Ga0157376_10216351 | 3300014969 | Bacteria | 1772 |
| 279 | Ga0163161_10002273 | 3300017792 | Bacteria | 13778 |
| 280 | Ga0163161_10050163 | 3300017792 | Bacteria | 3020 |
| 281 | Ga0197907_10138387 | 3300020069 | Bacteria | 1612 |
| 282 | Ga0197907_10164538 | 3300020069 | Bacteria | 5320 |
| 283 | Ga0206356_10142785 | 3300020070 | Bacteria | 1195 |
| 284 | Ga0206356_10784647 | 3300020070 | Bacteria | 1724 |
| 285 | Ga0206349_1441571 | 3300020075 | Bacteria | 2636 |
| 286 | Ga0206355_1590120 | 3300020076 | Bacteria | 1952 |
| 287 | Ga0206351_10342753 | 3300020077 | Bacteria | 4692 |
| 288 | Ga0206351_10861399 | 3300020077 | Bacteria | 2535 |
| 289 | Ga0206351_10883250 | 3300020077 | Bacteria | 1167 |
| 290 | Ga0206352_10462433 | 3300020078 | Bacteria | 2648 |
| 291 | Ga0206352_10839311 | 3300020078 | Bacteria | 2303 |
| 292 | Ga0206350_10364331 | 3300020080 | Bacteria | 4920 |
| 293 | Ga0206350_11454667 | 3300020080 | Bacteria | 4242 |
| 294 | Ga0206353_10025707 | 3300020082 | Bacteria | 2293 |
| 295 | Ga0206353_10380294 | 3300020082 | Bacteria | 1314 |
| 296 | Ga0206353_10985316 | 3300020082 | Bacteria | 4917 |
| 297 | Ga0154015_1204111 | 3300020610 | Bacteria | 1422 |
| 298 | Ga0154015_1334133 | 3300020610 | Bacteria | 1920 |
| 299 | Ga0154015_1356031 | 3300020610 | Bacteria | 1986 |
| 300 | Ga0213876_10002715 | 3300021384 | Bacteria | 10304 |
| 301 | Ga0213875_10001331 | 3300021388 | Bacteria | 16269 |
| 302 | Ga0213875_10015787 | 3300021388 | Bacteria | 3671 |
| 303 | Ga0224712_10001641 | 3300022467 | Bacteria | 5263 |
| 304 | Ga0224712_10004633 | 3300022467 | Bacteria | 3730 |
| 305 | Ga0209051_1000057 | 3300025303 | Bacteria | 263902 |
| 306 | Ga0209051_1000840 | 3300025303 | Bacteria | 31631 |
| 307 | Ga0207656_10144121 | 3300025321 | Bacteria | 1124 |
| 308 | Ga0207653_10039748 | 3300025885 | Bacteria | 1541 |
| 309 | Ga0207692_10024484 | 3300025898 | Bacteria | 2807 |
| 310 | Ga0207642_10000950 | 3300025899 | Bacteria | 9058 |
| 311 | Ga0207710_10000010 | 3300025900 | Bacteria | 482087 |
| 312 | Ga0207710_10000027 | 3300025900 | Bacteria | 307001 |
| 313 | Ga0207710_10000035 | 3300025900 | Bacteria | 253729 |
| 314 | Ga0207710_10000169 | 3300025900 | Bacteria | 67027 |
| 315 | Ga0207710_10005078 | 3300025900 | Bacteria | 5695 |
| 316 | Ga0207710_10033045 | 3300025900 | Bacteria | 2268 |
| 317 | Ga0207688_10000298 | 3300025901 | Bacteria | 22742 |
| 318 | Ga0207688_10001099 | 3300025901 | Bacteria | 13864 |
| 319 | Ga0207688_10150079 | 3300025901 | Bacteria | 1376 |
| 320 | Ga0207680_10018611 | 3300025903 | Bacteria | 3697 |
| 321 | Ga0207647_10030802 | 3300025904 | Bacteria | 3458 |
| 322 | Ga0207647_10082320 | 3300025904 | Bacteria | 1928 |
| 323 | Ga0207647_10131933 | 3300025904 | Bacteria | 1468 |
| 324 | Ga0207647_10135487 | 3300025904 | Bacteria | 1445 |
| 325 | Ga0207685_10040604 | 3300025905 | Bacteria | 1735 |
| 326 | Ga0207645_10002891 | 3300025907 | Bacteria | 13286 |
| 327 | Ga0207643_10029382 | 3300025908 | Bacteria | 3057 |
| 328 | Ga0207643_10108777 | 3300025908 | Bacteria | 1631 |
| 329 | Ga0207643_10162419 | 3300025908 | Bacteria | 1344 |
| 330 | Ga0207705_10053803 | 3300025909 | Bacteria | 2901 |
| 331 | Ga0207705_10158431 | 3300025909 | Bacteria | 1699 |
| 332 | Ga0207654_10150448 | 3300025911 | Bacteria | 1493 |
| 333 | Ga0207707_10065555 | 3300025912 | Bacteria | 3163 |
| 334 | Ga0207707_10090182 | 3300025912 | Bacteria | 2679 |
| 335 | Ga0207695_10010135 | 3300025913 | Bacteria | 11564 |
| 336 | Ga0207693_10009379 | 3300025915 | Bacteria | 7982 |
| 337 | Ga0207693_10009544 | 3300025915 | Bacteria | 7902 |
| 338 | Ga0207693_10299375 | 3300025915 | Bacteria | 1260 |
| 339 | Ga0207663_10010760 | 3300025916 | Bacteria | 4884 |
| 340 | Ga0207663_10012044 | 3300025916 | Bacteria | 4663 |
| 341 | Ga0207660_10128317 | 3300025917 | Bacteria | 1928 |
| 342 | Ga0207662_10078508 | 3300025918 | Bacteria | 2009 |
| 343 | Ga0207662_10097511 | 3300025918 | Bacteria | 1817 |
| 344 | Ga0207657_10034090 | 3300025919 | Bacteria | 4582 |
| 345 | Ga0207657_10315307 | 3300025919 | Bacteria | 1237 |
| 346 | Ga0207649_10031520 | 3300025920 | Bacteria | 3152 |
| 347 | Ga0207652_10009033 | 3300025921 | Bacteria | 8029 |
| 348 | Ga0207652_10314055 | 3300025921 | Bacteria | 1415 |
| 349 | Ga0207681_10079897 | 3300025923 | Bacteria | 2305 |
| 350 | Ga0207681_10217496 | 3300025923 | Bacteria | 1476 |
| 351 | Ga0207694_10042292 | 3300025924 | Bacteria | 3515 |
| 352 | Ga0207694_10245281 | 3300025924 | Bacteria | 1465 |
| 353 | Ga0207659_10010045 | 3300025926 | Bacteria | 5929 |
| 354 | Ga0207659_10172390 | 3300025926 | Bacteria | 1708 |
| 355 | Ga0207687_10006588 | 3300025927 | Bacteria | 7660 |
| 356 | Ga0207687_10009588 | 3300025927 | Bacteria | 6329 |
| 357 | Ga0207687_10123981 | 3300025927 | Bacteria | 1936 |
| 358 | Ga0207687_10189067 | 3300025927 | Bacteria | 1601 |
| 359 | Ga0207700_10021743 | 3300025928 | Bacteria | 4386 |
| 360 | Ga0207700_10206097 | 3300025928 | Bacteria | 1660 |
| 361 | Ga0207700_10255813 | 3300025928 | Bacteria | 1498 |
| 362 | Ga0207664_10119237 | 3300025929 | Bacteria | 2206 |
| 363 | Ga0207664_10240465 | 3300025929 | Bacteria | 1576 |
| 364 | Ga0207664_10269155 | 3300025929 | Bacteria | 1492 |
| 365 | Ga0207644_10005414 | 3300025931 | Bacteria | 8323 |
| 366 | Ga0207644_10105197 | 3300025931 | Bacteria | 2126 |
| 367 | Ga0207644_10199132 | 3300025931 | Bacteria | 1579 |
| 368 | Ga0207690_10034524 | 3300025932 | Bacteria | 3260 |
| 369 | Ga0207690_10068989 | 3300025932 | Bacteria | 2431 |
| 370 | Ga0207706_10030955 | 3300025933 | Bacteria | 4771 |
| 371 | Ga0207706_10050689 | 3300025933 | Bacteria | 3668 |
| 372 | Ga0207706_10129417 | 3300025933 | Bacteria | 2220 |
| 373 | Ga0207706_10331279 | 3300025933 | Bacteria | 1324 |
| 374 | Ga0207706_10422822 | 3300025933 | Bacteria | 1154 |
| 375 | Ga0207709_10004200 | 3300025935 | Bacteria | 8359 |
| 376 | Ga0207709_10132174 | 3300025935 | Bacteria | 1702 |
| 377 | Ga0207709_10309691 | 3300025935 | Bacteria | 1178 |
| 378 | Ga0207670_10007082 | 3300025936 | Bacteria | 6244 |
| 379 | Ga0207669_10003926 | 3300025937 | Bacteria | 6486 |
| 380 | Ga0207669_10148192 | 3300025937 | Bacteria | 1640 |
| 381 | Ga0207669_10208931 | 3300025937 | Bacteria | 1423 |
| 382 | Ga0207704_10000259 | 3300025938 | Bacteria | 25518 |
| 383 | Ga0207665_10038269 | 3300025939 | Bacteria | 3193 |
| 384 | Ga0207665_10171719 | 3300025939 | Bacteria | 1566 |
| 385 | Ga0207691_10335222 | 3300025940 | Bacteria | 1295 |
| 386 | Ga0207691_10375232 | 3300025940 | Bacteria | 1215 |
| 387 | Ga0207711_10000089 | 3300025941 | Bacteria | 97575 |
| 388 | Ga0207711_10000605 | 3300025941 | Bacteria | 36233 |
| 389 | Ga0207711_10006034 | 3300025941 | Bacteria | 10239 |
| 390 | Ga0207711_10006477 | 3300025941 | Bacteria | 9855 |
| 391 | Ga0207711_10093462 | 3300025941 | Bacteria | 2649 |
| 392 | Ga0207689_10002494 | 3300025942 | Bacteria | 17101 |
| 393 | Ga0207661_10024630 | 3300025944 | Bacteria | 4563 |
| 394 | Ga0207661_10042838 | 3300025944 | Bacteria | 3570 |
| 395 | Ga0207661_10250697 | 3300025944 | Bacteria | 1573 |
| 396 | Ga0207661_10313150 | 3300025944 | Bacteria | 1409 |
| 397 | Ga0207661_10479596 | 3300025944 | Bacteria | 1135 |
| 398 | Ga0207661_10578585 | 3300025944 | Bacteria | 1030 |
| 399 | Ga0207679_10051683 | 3300025945 | Bacteria | 3009 |
| 400 | Ga0207679_10093173 | 3300025945 | Bacteria | 2335 |
| 401 | Ga0207679_10233997 | 3300025945 | Bacteria | 1553 |
| 402 | Ga0207667_10076811 | 3300025949 | Bacteria | 3465 |
| 403 | Ga0207667_10177133 | 3300025949 | Bacteria | 2190 |
| 404 | Ga0207667_10185357 | 3300025949 | Bacteria | 2137 |
| 405 | Ga0207651_10527955 | 3300025960 | Bacteria | 1024 |
| 406 | Ga0207712_10000031 | 3300025961 | Bacteria | 213662 |
| 407 | Ga0207712_10005734 | 3300025961 | Bacteria | 7826 |
| 408 | Ga0207712_10220291 | 3300025961 | Bacteria | 1517 |
| 409 | Ga0207668_10000408 | 3300025972 | Bacteria | 27061 |
| 410 | Ga0207668_10014418 | 3300025972 | Bacteria | 4892 |
| 411 | Ga0207668_10033738 | 3300025972 | Bacteria | 3392 |
| 412 | Ga0207668_10289736 | 3300025972 | Bacteria | 1346 |
| 413 | Ga0207658_10002658 | 3300025986 | Bacteria | 12945 |
| 414 | Ga0207658_10008494 | 3300025986 | Bacteria | 6988 |
| 415 | Ga0207658_10033165 | 3300025986 | Bacteria | 3681 |
| 416 | Ga0207658_10042675 | 3300025986 | Bacteria | 3292 |
| 417 | Ga0207658_10292970 | 3300025986 | Bacteria | 1399 |
| 418 | Ga0207677_10006496 | 3300026023 | Bacteria | 6423 |
| 419 | Ga0207677_10023533 | 3300026023 | Bacteria | 3808 |
| 420 | Ga0207677_10073088 | 3300026023 | Bacteria | 2427 |
| 421 | Ga0207703_10000005 | 3300026035 | Bacteria | 506356 |
| 422 | Ga0207703_10005856 | 3300026035 | Bacteria | 9847 |
| 423 | Ga0207703_10012404 | 3300026035 | Bacteria | 6642 |
| 424 | Ga0207703_10082485 | 3300026035 | Bacteria | 2683 |
| 425 | Ga0207703_10182543 | 3300026035 | Bacteria | 1852 |
| 426 | Ga0207703_10490280 | 3300026035 | Bacteria | 1152 |
| 427 | Ga0207639_10002094 | 3300026041 | Bacteria | 13433 |
| 428 | Ga0207678_10010534 | 3300026067 | Bacteria | 8119 |
| 429 | Ga0207678_10019979 | 3300026067 | Bacteria | 5887 |
| 430 | Ga0207678_10027774 | 3300026067 | Bacteria | 4940 |
| 431 | Ga0207678_10128426 | 3300026067 | Bacteria | 2162 |
| 432 | Ga0207708_10012670 | 3300026075 | Bacteria | 6288 |
| 433 | Ga0207708_10016979 | 3300026075 | Bacteria | 5480 |
| 434 | Ga0207708_10085568 | 3300026075 | Bacteria | 2425 |
| 435 | Ga0207708_10153439 | 3300026075 | Bacteria | 1815 |
| 436 | Ga0207702_10082105 | 3300026078 | Bacteria | 2802 |
| 437 | Ga0207702_10346742 | 3300026078 | Bacteria | 1420 |
| 438 | Ga0207641_10001086 | 3300026088 | Bacteria | 27378 |
| 439 | Ga0207641_10001166 | 3300026088 | Bacteria | 26450 |
| 440 | Ga0207641_10009378 | 3300026088 | Bacteria | 8065 |
| 441 | Ga0207641_10188505 | 3300026088 | Bacteria | 1894 |
| 442 | Ga0207648_10005843 | 3300026089 | Bacteria | 12320 |
| 443 | Ga0207648_10053292 | 3300026089 | Bacteria | 3536 |
| 444 | Ga0207648_10158836 | 3300026089 | Bacteria | 1996 |
| 445 | Ga0207648_10210479 | 3300026089 | Bacteria | 1726 |
| 446 | Ga0207648_10272233 | 3300026089 | Bacteria | 1513 |
| 447 | Ga0207676_10311038 | 3300026095 | Bacteria | 1442 |
| 448 | Ga0207676_10757192 | 3300026095 | Bacteria | 945 |
| 449 | Ga0207674_10005413 | 3300026116 | Bacteria | 15177 |
| 450 | Ga0207674_10082270 | 3300026116 | Bacteria | 3221 |
| 451 | Ga0207674_10086919 | 3300026116 | Bacteria | 3121 |
| 452 | Ga0207674_10161410 | 3300026116 | Bacteria | 2195 |
| 453 | Ga0207675_100001181 | 3300026118 | Bacteria | 25992 |
| 454 | Ga0207675_100079791 | 3300026118 | Bacteria | 3067 |
| 455 | Ga0207675_100114755 | 3300026118 | Bacteria | 2544 |
| 456 | Ga0207675_100122167 | 3300026118 | Bacteria | 2465 |
| 457 | Ga0207675_100200125 | 3300026118 | Bacteria | 1918 |
| 458 | Ga0207683_10001691 | 3300026121 | Bacteria | 19748 |
| 459 | Ga0207683_10030388 | 3300026121 | Bacteria | 4681 |
| 460 | Ga0207683_10140612 | 3300026121 | Bacteria | 2175 |
| 461 | Ga0207683_10238610 | 3300026121 | Bacteria | 1658 |
| 462 | Ga0207683_10275097 | 3300026121 | Bacteria | 1538 |
| 463 | Ga0207683_10321754 | 3300026121 | Bacteria | 1417 |
| 464 | Ga0207698_10030924 | 3300026142 | Bacteria | 3858 |
| 465 | Ga0207698_10060704 | 3300026142 | Bacteria | 2942 |
| 466 | Ga0207698_10586865 | 3300026142 | Bacteria | 1097 |
| 467 | Ga0207698_10616809 | 3300026142 | Bacteria | 1071 |
| 468 | Ga0207428_10018411 | 3300027907 | Bacteria | 5968 |
| 469 | Ga0268266_10090810 | 3300028379 | Bacteria | 2677 |
| 470 | Ga0268266_10124476 | 3300028379 | Bacteria | 2298 |
| 471 | Ga0268266_10230640 | 3300028379 | Bacteria | 1705 |
| 472 | Ga0268265_10000029 | 3300028380 | Bacteria | 229499 |
| 473 | Ga0268265_10000050 | 3300028380 | Bacteria | 175787 |
| 474 | Ga0268265_10023069 | 3300028380 | Bacteria | 4382 |
| 475 | Ga0268265_10031124 | 3300028380 | Bacteria | 3852 |
| 476 | Ga0268265_10145402 | 3300028380 | Bacteria | 1991 |
| 477 | Ga0268265_10658567 | 3300028380 | Bacteria | 1007 |
| 478 | Ga0268264_10000236 | 3300028381 | Bacteria | 105352 |
| 479 | Ga0268264_10014360 | 3300028381 | Bacteria | 6511 |
| 480 | Ga0268264_10070656 | 3300028381 | Bacteria | 2956 |
| 481 | Ga0268264_10211079 | 3300028381 | Bacteria | 1782 |
| 482 | Ga0307517_10001164 | 3300028786 | Bacteria | 44365 |
| 483 | Ga0307515_10000883 | 3300028794 | Bacteria | 68971 |
| 484 | Ga0307511_10082473 | 3300030521 | Bacteria | 2248 |
| 485 | Ga0265327_10002217 | 3300031251 | Bacteria | 21198 |
| 486 | Ga0307408_100016830 | 3300031548 | Bacteria | 4887 |
| 487 | Ga0307408_100064187 | 3300031548 | Bacteria | 2689 |
| 488 | Ga0307408_100098885 | 3300031548 | Bacteria | 2219 |
| 489 | Ga0307508_10193221 | 3300031616 | Bacteria | 1636 |
| 490 | Ga0307514_10007338 | 3300031649 | Bacteria | 9502 |
| 491 | Ga0307516_10005181 | 3300031730 | Bacteria | 15706 |
| 492 | Ga0307516_10007141 | 3300031730 | Bacteria | 12894 |
| 493 | Ga0307516_10023699 | 3300031730 | Bacteria | 6282 |
| 494 | Ga0307405_10015905 | 3300031731 | Bacteria | 4088 |
| 495 | Ga0307405_10081833 | 3300031731 | Bacteria | 2112 |
| 496 | Ga0307405_10107468 | 3300031731 | Bacteria | 1883 |
| 497 | Ga0307405_10445334 | 3300031731 | Bacteria | 1025 |
| 498 | Ga0307413_10010833 | 3300031824 | Bacteria | 4447 |
| 499 | Ga0307413_10031735 | 3300031824 | Bacteria | 2985 |
| 500 | Ga0307413_10057231 | 3300031824 | Bacteria | 2383 |
| 501 | Ga0307413_10310879 | 3300031824 | Bacteria | 1199 |
| 502 | Ga0307410_10019957 | 3300031852 | Bacteria | 4089 |
| 503 | Ga0307410_10175865 | 3300031852 | Bacteria | 1617 |
| 504 | Ga0307410_10252171 | 3300031852 | Bacteria | 1372 |
| 505 | Ga0326468_10000024 | 3300031889 | Bacteria | 11908 |
| 506 | Ga0326468_10001396 | 3300031889 | Bacteria | 2100 |
| 507 | Ga0307406_10024588 | 3300031901 | Bacteria | 3600 |
| 508 | Ga0307406_10041370 | 3300031901 | Bacteria | 2871 |
| 509 | Ga0307406_10093893 | 3300031901 | Bacteria | 2027 |
| 510 | Ga0307406_10208689 | 3300031901 | Bacteria | 1443 |
| 511 | Ga0307407_10034939 | 3300031903 | Bacteria | 2757 |
| 512 | Ga0307412_10042639 | 3300031911 | Bacteria | 2950 |
| 513 | Ga0307412_10345204 | 3300031911 | Bacteria | 1193 |
| 514 | Ga0307409_100001399 | 3300031995 | Bacteria | 11795 |
| 515 | Ga0307409_100002234 | 3300031995 | Bacteria | 10003 |
| 516 | Ga0307409_100004802 | 3300031995 | Bacteria | 7667 |
| 517 | Ga0307409_100088604 | 3300031995 | Bacteria | 2527 |
| 518 | Ga0307409_100179070 | 3300031995 | Bacteria | 1875 |
| 519 | Ga0307416_100000560 | 3300032002 | Bacteria | 19013 |
| 520 | Ga0307416_100018292 | 3300032002 | Bacteria | 4932 |
| 521 | Ga0307416_100048291 | 3300032002 | Bacteria | 3375 |
| 522 | Ga0307416_100195112 | 3300032002 | Bacteria | 1914 |
| 523 | Ga0307416_100222056 | 3300032002 | Bacteria | 1813 |
| 524 | Ga0307414_10017217 | 3300032004 | Bacteria | 4416 |
| 525 | Ga0307414_10186247 | 3300032004 | Bacteria | 1675 |
| 526 | Ga0307411_10013884 | 3300032005 | Bacteria | 4463 |
| 527 | Ga0307415_100000569 | 3300032126 | Bacteria | 16187 |
| 528 | Ga0307415_100015820 | 3300032126 | Bacteria | 4479 |
| 529 | Ga0307415_100042696 | 3300032126 | Bacteria | 3019 |
| 530 | Ga0307415_100044653 | 3300032126 | Bacteria | 2964 |
| 531 | Ga0307415_100056453 | 3300032126 | Bacteria | 2692 |
| 532 | Ga0307415_100100587 | 3300032126 | Bacteria | 2119 |
| 533 | Ga0307415_100162214 | 3300032126 | Bacteria | 1734 |
| 534 | Ga0307415_100242563 | 3300032126 | Bacteria | 1458 |
| 535 | Ga0307415_100339830 | 3300032126 | Bacteria | 1259 |
| 536 | Ga0307415_100494750 | 3300032126 | Bacteria | 1067 |
| 537 | Ga0307507_10019583 | 3300033179 | Bacteria | 7616 |
| 538 | Ga0307507_10231306 | 3300033179 | Bacteria | 1225 |
| 539 | Ga0307510_10305145 | 3300033180 | Bacteria | 1053 |
| 540 | Ga0373932_0024314 | 3300035112 | Bacteria | 1630 |
| 541 | Ga0373932_0103668 | 3300035112 | Bacteria | 929 |
| 542 | Ga0373942_0000130 | 3300035207 | Bacteria | 17733 |
| 543 | Ga0373962_0002006 | 3300035242 | Bacteria | 4852 |
| 544 | Ga0373935_0017067 | 3300035692 | Bacteria | 4398 |
| 545 | Ga0395899_0083486 | 3300037312 | Bacteria | 2323 |
| 546 | Ga0395898_0032987 | 3300037466 | Bacteria | 5169 |
| 547 | Ga0395905_0063971 | 3300037471 | Bacteria | 3442 |
| 548 | Ga0395905_0124577 | 3300037471 | Bacteria | 2423 |
| 549 | Ga0436364_0032767 | 3300037853 | Bacteria | 3940 |
| 550 | Ga0436364_0177961 | 3300037853 | Bacteria | 37248 |
| 551 | Ga0436364_0423427 | 3300037853 | Bacteria | 28417 |
| 552 | Ga0436364_0918955 | 3300037853 | Bacteria | 3061 |
| 553 | Ga0436364_1435407 | 3300037853 | Bacteria | 3883 |
| 554 | Ga0395901_0001169 | 3300038443 | Bacteria | 27889 |
| 555 | Ga0395901_0651256 | 3300038443 | Bacteria | 1057 |
| 556 | Ga0436365_1083994 | 3300039437 | Bacteria | 225582 |
| 557 | Ga0436365_1211143 | 3300039437 | Bacteria | 11027 |
| 558 | Ga0436365_1544123 | 3300039437 | Bacteria | 29426 |
| 559 | Ga0436360_0460535 | 3300039438 | Bacteria | 1487 |
| 560 | Ga0439436_0005008 | 3300041404 | Bacteria | 4060 |
| 561 | Ga0439436_0025436 | 3300041404 | Bacteria | 1738 |
| 562 | Ga0439439_0002809 | 3300041406 | Bacteria | 3756 |
| 563 | Ga0439461_0000759 | 3300041410 | Bacteria | 4717 |
| 564 | Ga0439466_0001646 | 3300041411 | Bacteria | 8741 |
| 565 | Ga0439466_0046696 | 3300041411 | Bacteria | 1429 |
| 566 | Ga0439465_0002076 | 3300041413 | Bacteria | 6574 |
| 567 | Ga0439433_0002902 | 3300041999 | Bacteria | 3669 |
| 568 | Ga0439442_009028 | 3300042002 | Bacteria | 2015 |
| 569 | Ga0439442_015909 | 3300042002 | Bacteria | 1550 |
| 570 | Ga0439445_0008638 | 3300042004 | Bacteria | 2386 |
| 571 | Ga0439448_0000544 | 3300042005 | Bacteria | 8785 |
| 572 | Ga0439449_0004579 | 3300042007 | Bacteria | 5345 |
| 573 | Ga0439449_0015223 | 3300042007 | Bacteria | 2890 |
| 574 | Ga0439451_014983 | 3300042009 | Bacteria | 1563 |
| 575 | Ga0439456_002526 | 3300042013 | Bacteria | 3686 |
| 576 | Ga0439457_001263 | 3300042014 | Bacteria | 7583 |
| 577 | Ga0439457_002746 | 3300042014 | Bacteria | 4946 |
| 578 | Ga0439462_0023041 | 3300042015 | Bacteria | 1631 |
| 579 | Ga0439463_001659 | 3300042016 | Bacteria | 5864 |
| 580 | Ga0450894_000134 | 3300042131 | Bacteria | 12966 |
| 581 | Ga0450898_001094 | 3300042134 | Bacteria | 3454 |
| 582 | Ga0450904_002255 | 3300042139 | Bacteria | 2346 |
| 583 | Ga0450906_002132 | 3300042145 | Bacteria | 4325 |
| 584 | Ga0450908_006979 | 3300042184 | Bacteria | 2138 |
| 585 | Ga0439444_0004278 | 3300042437 | Bacteria | 2067 |
| 586 | Ga0439464_0002713 | 3300042439 | Bacteria | 4389 |
| 587 | Ga0439464_0068920 | 3300042439 | Bacteria | 1044 |
| 588 | Ga0439460_0002006 | 3300042461 | Bacteria | 4873 |
| 589 | Ga0439440_0003695 | 3300042993 | Bacteria | 2971 |
| 590 | Ga0439440_0009200 | 3300042993 | Bacteria | 2043 |
| 591 | Ga0466969_0039913 | 3300044656 | Bacteria | 2355 |
| 592 | Ga0466972_0119010 | 3300044658 | Bacteria | 1246 |
| 593 | Ga0466965_0042151 | 3300044683 | Bacteria | 2250 |
| 594 | Ga0466966_0005219 | 3300044684 | Bacteria | 8538 |
| 595 | Ga0466966_0069792 | 3300044684 | Bacteria | 2204 |
| 596 | Ga0466966_0101801 | 3300044684 | Bacteria | 1776 |
| 597 | Ga0466961_0031454 | 3300044693 | Bacteria | 3411 |
| 598 | Ga0466963_0045022 | 3300044694 | Bacteria | 2905 |
| 599 | Ga0466963_0087432 | 3300044694 | Bacteria | 2119 |
| 600 | Ga0466971_0036263 | 3300044719 | Bacteria | 2212 |
| 601 | Ga0466968_0002409 | 3300044735 | Bacteria | 6855 |
| 602 | Ga0466968_0105304 | 3300044735 | Bacteria | 1263 |
| 603 | Ga0466970_0008763 | 3300044765 | Bacteria | 5097 |
| 604 | Ga0466970_0046140 | 3300044765 | Bacteria | 2321 |
| 605 | Ga0466970_0051168 | 3300044765 | Unclassified | 2204 |
| 606 | Ga0466970_0304445 | 3300044765 | Bacteria | 899 |
| 607 | Ga0466957_0042147 | 3300044842 | Bacteria | 2761 |
| 608 | Ga0466960_0002025 | 3300044901 | Bacteria | 7523 |
| 609 | Ga0466960_0045500 | 3300044901 | Bacteria | 2097 |
| 610 | Ga0466959_0003962 | 3300045049 | Bacteria | 9839 |
| 611 | Ga0466958_0009520 | 3300045836 | Bacteria | 5416 |
| 612 | Ga0466958_0014730 | 3300045836 | Bacteria | 4466 |
| 613 | Ga0466958_0032757 | 3300045836 | Bacteria | 3093 |
| 614 | Ga0466958_0140735 | 3300045836 | Bacteria | 1519 |
| 615 | Ga0466958_0273884 | 3300045836 | Bacteria | 1081 |
| 616 | Ga0466967_0035598 | 3300045976 | Bacteria | 4241 |
| 617 | Ga0466967_0077041 | 3300045976 | Bacteria | 3001 |
| 618 | Ga0466967_0272725 | 3300045976 | Bacteria | 1621 |
| 619 | Ga0466967_0273571 | 3300045976 | Bacteria | 1619 |
| 620 | Ga0466967_0318253 | 3300045976 | Bacteria | 1500 |
| 621 | Ga0466967_0562572 | 3300045976 | Bacteria | 1123 |
| 622 | Ga0495603_0132418 | 3300046455 | Bacteria | 1451 |
| 623 | Ga0495638_0013732 | 3300046460 | Bacteria | 5502 |
| 624 | Ga0495594_0233039 | 3300046499 | Bacteria | 1049 |
| 625 | Ga0495643_0004303 | 3300046522 | Bacteria | 10031 |
| 626 | Ga0495648_0035570 | 3300046524 | Bacteria | 3227 |
| 627 | Ga0495609_0087525 | 3300046538 | Bacteria | 1357 |
| 628 | Ga0495645_0234315 | 3300046543 | Bacteria | 1228 |
| 629 | Ga0495588_0141763 | 3300046674 | Bacteria | 1270 |
| 630 | Ga0495657_0022884 | 3300046675 | Bacteria | 4471 |
| 631 | Ga0495623_0082943 | 3300046679 | Bacteria | 1980 |
| 632 | Ga0495613_0057280 | 3300046689 | Bacteria | 2861 |
| 633 | Ga0495613_0141747 | 3300046689 | Bacteria | 1717 |
| 634 | Ga0495624_0091296 | 3300046690 | Bacteria | 1879 |
| 635 | Ga0495670_0039733 | 3300046691 | Bacteria | 2346 |
| 636 | Ga0495670_0070897 | 3300046691 | Bacteria | 1764 |
| 637 | Ga0495670_0104173 | 3300046691 | Bacteria | 1464 |
| 638 | Ga0495649_0246127 | 3300046694 | Bacteria | 919 |
| 639 | Ga0495600_0349640 | 3300046809 | Bacteria | 926 |
| 640 | Ga0495660_0056153 | 3300046810 | Bacteria | 2129 |
| 641 | Ga0495581_0012834 | 3300047315 | Bacteria | 4853 |
| 642 | Ga0495604_0006369 | 3300047317 | Bacteria | 9362 |
| 643 | Ga0495636_0002703 | 3300047318 | Bacteria | 6843 |
| 644 | Ga0495672_0016422 | 3300047320 | Bacteria | 4989 |
| 645 | Ga0495672_0087428 | 3300047320 | Bacteria | 1721 |
| 646 | Ga0495683_0043999 | 3300047323 | Bacteria | 2246 |
| 647 | Ga0495675_0043768 | 3300047444 | Bacteria | 2852 |
| 648 | Ga0495685_000690 | 3300047447 | Bacteria | 10311 |
| 649 | Ga0495685_059784 | 3300047447 | Bacteria | 1286 |
| 650 | Ga0495681_0001547 | 3300047470 | Bacteria | 17173 |
| 651 | Ga0496100_0000077 | 3300048903 | Bacteria | 54852 |
| 652 | Ga0496100_0018315 | 3300048903 | Bacteria | 4152 |
| 653 | Ga0496100_0025627 | 3300048903 | Bacteria | 3608 |
| 654 | Ga0496100_0029147 | 3300048903 | Bacteria | 3412 |
| 655 | Ga0496100_0098789 | 3300048903 | Bacteria | 2007 |
| 656 | Ga0496101_0000042 | 3300048904 | Bacteria | 163148 |
| 657 | Ga0496101_0004926 | 3300048904 | Bacteria | 8472 |
| 658 | Ga0496101_0031562 | 3300048904 | Bacteria | 3726 |
| 659 | Ga0496101_0040473 | 3300048904 | Bacteria | 3319 |
| 660 | Ga0496101_0356773 | 3300048904 | Bacteria | 1149 |
| 661 | Ga0496102_0000205 | 3300048905 | Bacteria | 79771 |
| 662 | Ga0496102_0002438 | 3300048905 | Bacteria | 15864 |
| 663 | Ga0496102_0003855 | 3300048905 | Bacteria | 12702 |
| 664 | Ga0496102_0008636 | 3300048905 | Bacteria | 8743 |
| 665 | Ga0496102_0032380 | 3300048905 | Bacteria | 4696 |
| 666 | Ga0496102_0043348 | 3300048905 | Bacteria | 4079 |
| 667 | Ga0496102_0258876 | 3300048905 | Bacteria | 1640 |
| 668 | Ga0496103_0000315 | 3300048906 | Bacteria | 44709 |
| 669 | Ga0496103_0000751 | 3300048906 | Bacteria | 23896 |
| 670 | Ga0496103_0001957 | 3300048906 | Bacteria | 13324 |
| 671 | Ga0496103_0026574 | 3300048906 | Bacteria | 3503 |
| 672 | Ga0496103_0150061 | 3300048906 | Bacteria | 1493 |
| 673 | Ga0496104_0048840 | 3300048907 | Bacteria | 3990 |
| 674 | Ga0496105_0091491 | 3300048908 | Bacteria | 2512 |
| 675 | Ga0496105_0161901 | 3300048908 | Bacteria | 1837 |
| 676 | Ga0496105_0240028 | 3300048908 | Bacteria | 1471 |
| 677 | Ga0496106_0000103 | 3300048909 | Bacteria | 65242 |
| 678 | Ga0496106_0003070 | 3300048909 | Bacteria | 12451 |
| 679 | Ga0496106_0104259 | 3300048909 | Bacteria | 2202 |
| 680 | Ga0496107_0000558 | 3300048910 | Bacteria | 20825 |
| 681 | Ga0496107_0016029 | 3300048910 | Bacteria | 5258 |
| 682 | Ga0496107_0044153 | 3300048910 | Bacteria | 3203 |
| 683 | Ga0496107_0077432 | 3300048910 | Bacteria | 2422 |
| 684 | Ga0496107_0086828 | 3300048910 | Bacteria | 2284 |
| 685 | Ga0496107_0175438 | 3300048910 | Bacteria | 1591 |
| 686 | Ga0496108_0000916 | 3300048911 | Bacteria | 22967 |
| 687 | Ga0496109_0000312 | 3300048912 | Bacteria | 45661 |
| 688 | Ga0496109_0021301 | 3300048912 | Bacteria | 5731 |
| 689 | Ga0496109_0033108 | 3300048912 | Bacteria | 4649 |
| 690 | Ga0496110_0013273 | 3300048913 | Bacteria | 6803 |
| 691 | Ga0496110_0191579 | 3300048913 | Bacteria | 1857 |
| 692 | Ga0496110_0313728 | 3300048913 | Bacteria | 1428 |
| 693 | Ga0496111_0002512 | 3300048914 | Bacteria | 11066 |
| 694 | Ga0496111_0084517 | 3300048914 | Bacteria | 2320 |
| 695 | Ga0496112_0040858 | 3300048915 | Bacteria | 4536 |
| 696 | Ga0496112_0042718 | 3300048915 | Bacteria | 4436 |
| 697 | Ga0496112_0193900 | 3300048915 | Bacteria | 1993 |
| 698 | Ga0496113_0068985 | 3300048916 | Bacteria | 2684 |
| 699 | Ga0496114_0000309 | 3300048917 | Bacteria | 35722 |
| 700 | Ga0496114_0001352 | 3300048917 | Bacteria | 18588 |
| 701 | Ga0496114_0043703 | 3300048917 | Bacteria | 3715 |
| 702 | Ga0496114_0152444 | 3300048917 | Bacteria | 2006 |
| 703 | Ga0496115_0001893 | 3300048918 | Bacteria | 14983 |
| 704 | Ga0496115_0026196 | 3300048918 | Bacteria | 4548 |
| 705 | Ga0496116_0000287 | 3300048919 | Bacteria | 85981 |
| 706 | Ga0496116_0032191 | 3300048919 | Bacteria | 3741 |
| 707 | Ga0496117_0000725 | 3300048920 | Bacteria | 51801 |
| 708 | Ga0496117_0011140 | 3300048920 | Bacteria | 8086 |
| 709 | Ga0496118_0001131 | 3300048921 | Bacteria | 41154 |
| 710 | Ga0496118_0002778 | 3300048921 | Bacteria | 22922 |
| 711 | Ga0496118_0108323 | 3300048921 | Bacteria | 1852 |
| 712 | Ga0496119_0000337 | 3300048922 | Bacteria | 65601 |
| 713 | Ga0496119_0001488 | 3300048922 | Bacteria | 28066 |
| 714 | Ga0496119_0008756 | 3300048922 | Bacteria | 8825 |
| 715 | Ga0496120_0000250 | 3300048923 | Bacteria | 90632 |
| 716 | Ga0496120_0020465 | 3300048923 | Bacteria | 4204 |
| 717 | Ga0496121_0000139 | 3300048924 | Bacteria | 163176 |
| 718 | Ga0496121_0014730 | 3300048924 | Bacteria | 8262 |
| 719 | Ga0496121_0071666 | 3300048924 | Bacteria | 2785 |
| 720 | Ga0496122_0000149 | 3300048925 | Bacteria | 163504 |
| 721 | Ga0496122_0209722 | 3300048925 | Bacteria | 1130 |
| 722 | Ga0496123_0011118 | 3300048926 | Bacteria | 7850 |
| 723 | Ga0496124_0000114 | 3300048927 | Bacteria | 165215 |
| 724 | Ga0496124_0099753 | 3300048927 | Bacteria | 2354 |
| 725 | Ga0496125_0000130 | 3300048928 | Bacteria | 163176 |
| 726 | Ga0496125_0039006 | 3300048928 | Bacteria | 4099 |
| 727 | Ga0496125_0087033 | 3300048928 | Bacteria | 2361 |
| 728 | Ga0496126_0000149 | 3300048929 | Bacteria | 163176 |
| 729 | Ga0496126_0014251 | 3300048929 | Bacteria | 8044 |
| 730 | Ga0496126_0040663 | 3300048929 | Bacteria | 4309 |
| 731 | Ga0496126_0070611 | 3300048929 | Bacteria | 3111 |
| 732 | Ga0496126_0231508 | 3300048929 | Bacteria | 1548 |
| 733 | Ga0496126_0409036 | 3300048929 | Bacteria | 1099 |
| 734 | Ga0501031_0069939 | 3300049568 | Bacteria | 2286 |
| 735 | Ga0501032_0000730 | 3300049569 | Bacteria | 26674 |
| 736 | Ga0501032_0027441 | 3300049569 | Bacteria | 3912 |
| 737 | Ga0501033_0055422 | 3300049570 | Bacteria | 2931 |
| 738 | Ga0501034_0001381 | 3300049571 | Bacteria | 32655 |
| 739 | Ga0501034_0429582 | 3300049571 | Bacteria | 1241 |
| 740 | Ga0501034_0597670 | 3300049571 | Bacteria | 1009 |
| 741 | Ga0501036_0007479 | 3300049572 | Bacteria | 8907 |
| 742 | Ga0501036_0038054 | 3300049572 | Bacteria | 4070 |
| 743 | Ga0501036_0115889 | 3300049572 | Bacteria | 2263 |
| 744 | Ga0501037_0007301 | 3300049573 | Bacteria | 8079 |
| 745 | Ga0501037_0009763 | 3300049573 | Bacteria | 7047 |
| 746 | Ga0501037_0024074 | 3300049573 | Bacteria | 4502 |
| 747 | Ga0501038_0003179 | 3300049574 | Bacteria | 15312 |
| 748 | Ga0501038_0035146 | 3300049574 | Bacteria | 4401 |
| 749 | Ga0501039_0002246 | 3300049575 | Bacteria | 14315 |
| 750 | Ga0501039_0029856 | 3300049575 | Bacteria | 4200 |
| 751 | Ga0501039_0039114 | 3300049575 | Bacteria | 3663 |
| 752 | Ga0501040_0001054 | 3300049576 | Bacteria | 17474 |
| 753 | Ga0501040_0103890 | 3300049576 | Bacteria | 1984 |
| 754 | Ga0501041_0000376 | 3300049577 | Bacteria | 22319 |
| 755 | Ga0501042_0000037 | 3300049578 | Bacteria | 43512 |
| 756 | Ga0501043_0000567 | 3300049579 | Bacteria | 33043 |
| 757 | Ga0501046_0000625 | 3300049580 | Bacteria | 34675 |
| 758 | Ga0501046_0001102 | 3300049580 | Bacteria | 26442 |
| 759 | Ga0501047_0012357 | 3300049581 | Bacteria | 8083 |
| 760 | Ga0501047_0041303 | 3300049581 | Bacteria | 4457 |
| 761 | Ga0501047_0323044 | 3300049581 | Bacteria | 1383 |
| 762 | Ga0501048_0002018 | 3300049582 | Bacteria | 15410 |
| 763 | Ga0501048_0037170 | 3300049582 | Bacteria | 3496 |
| 764 | Ga0501067_0064946 | 3300049583 | Bacteria | 2020 |
| 765 | Ga0501067_0163467 | 3300049583 | Bacteria | 1240 |
| 766 | Ga0501068_0003411 | 3300049584 | Bacteria | 8550 |
| 767 | Ga0501068_0206065 | 3300049584 | Bacteria | 1248 |
| 768 | Ga0501068_0289823 | 3300049584 | Bacteria | 1047 |
| 769 | Ga0501069_0092886 | 3300049585 | Bacteria | 1707 |
| 770 | Ga0501070_0007150 | 3300049586 | Bacteria | 9485 |
| 771 | Ga0501071_0012792 | 3300049587 | Bacteria | 5706 |
| 772 | Ga0501071_0015082 | 3300049587 | Bacteria | 5298 |
| 773 | Ga0501074_0011636 | 3300049590 | Bacteria | 6395 |
| 774 | Ga0501075_0013757 | 3300049591 | Bacteria | 5783 |
| 775 | Ga0501076_0018077 | 3300049592 | Bacteria | 5367 |
| 776 | Ga0501077_0007867 | 3300049593 | Bacteria | 6583 |
| 777 | Ga0501243_015058 | 3300049675 | Bacteria | 1241 |
| 778 | Ga0501079_0000524 | 3300049741 | Bacteria | 24959 |
| 779 | Ga0501081_0002265 | 3300049743 | Bacteria | 12106 |
| 780 | Ga0501081_0222341 | 3300049743 | Bacteria | 1373 |
| 781 | Ga0501035_0000407 | 3300049822 | Bacteria | 48754 |
| 782 | Ga0501035_0001095 | 3300049822 | Bacteria | 28404 |
| 783 | Ga0501035_0023137 | 3300049822 | Bacteria | 5702 |
| 784 | Ga0501044_0000554 | 3300049823 | Bacteria | 45441 |
| 785 | Ga0501044_0000771 | 3300049823 | Bacteria | 38852 |
| 786 | Ga0501044_0036089 | 3300049823 | Bacteria | 5174 |
| 787 | Ga0501044_0349348 | 3300049823 | Bacteria | 1399 |
| 788 | Ga0501045_0000908 | 3300049824 | Bacteria | 19290 |
| 789 | nmdc:mga03683_99144_c1 | 3300050489 | Bacteria | 1279 |
| 790 | nmdc:mga03n38_2328_c1 | 3300050490 | Bacteria | 5834 |
| 791 | nmdc:mga03n38_36974_c1 | 3300050490 | Bacteria | 2103 |
| 792 | nmdc:mga00v17_16530_c1 | 3300050491 | Bacteria | 4157 |
| 793 | nmdc:mga00v17_33236_c1 | 3300050491 | Bacteria | 3055 |
| 794 | nmdc:mga00v17_82760_c1 | 3300050491 | Bacteria | 2006 |
| 795 | nmdc:mga0yw44_18180_c1 | 3300050492 | Bacteria | 3844 |
| 796 | nmdc:mga0yw44_18819_c1 | 3300050492 | Bacteria | 3792 |
| 797 | nmdc:mga0yw44_245778_c1 | 3300050492 | Bacteria | 1190 |
| 798 | nmdc:mga0yw44_64485_c1 | 3300050492 | Bacteria | 2255 |
| 799 | nmdc:mga0yw44_96066_c1 | 3300050492 | Bacteria | 1881 |
| 800 | nmdc:mga06z11_185690_c1 | 3300050494 | Bacteria | 1201 |
| 801 | nmdc:mga06z11_2945_c1 | 3300050494 | Bacteria | 6555 |
| 802 | nmdc:mga06z11_44352_c1 | 3300050494 | Bacteria | 2242 |
| 803 | nmdc:mga04h51_5144_c1 | 3300050495 | Bacteria | 3316 |
| 804 | nmdc:mga07m45_27403_c1 | 3300050496 | Bacteria | 3138 |
| 805 | nmdc:mga08y16_205421_c1 | 3300050511 | Bacteria | 2041 |
| 806 | nmdc:mga08y16_443365_c1 | 3300050511 | Bacteria | 1325 |
| 807 | nmdc:mga08y16_56429_c1 | 3300050511 | Bacteria | 4105 |
| 808 | nmdc:mga0n895_16329_c1 | 3300050512 | Bacteria | 6809 |
| 809 | nmdc:mga0rr50_421893_c1 | 3300050513 | Bacteria | 1129 |
| 810 | nmdc:mga08x19_2634_c1 | 3300050514 | Bacteria | 10851 |
| 811 | nmdc:mga0sz30_19838_c1 | 3300050516 | Bacteria | 2706 |
| 812 | nmdc:mga0sz30_25058_c2 | 3300050516 | Bacteria | 2052 |
| 813 | nmdc:mga0sz30_41671_c1 | 3300050516 | Bacteria | 1930 |
| 814 | nmdc:mga0sz30_86992_c1 | 3300050516 | Bacteria | 1357 |
| 815 | Ga0500610_0171133 | 3300053079 | Bacteria | 1072 |
| 816 | Ga0500578_0009672 | 3300053086 | Bacteria | 6258 |
| 817 | Ga0500566_0098871 | 3300053094 | Bacteria | 1602 |
| 818 | Ga0500654_048071 | 3300053099 | Bacteria | 2333 |
| 819 | Ga0500553_033794 | 3300053101 | Bacteria | 2543 |
| 820 | Ga0500580_084609 | 3300053113 | Bacteria | 1279 |
| 821 | Ga0500614_019618 | 3300053123 | Bacteria | 1551 |
| 822 | Ga0500621_110973 | 3300053126 | Bacteria | 1071 |
| 823 | Ga0500628_001445 | 3300053129 | Bacteria | 4067 |
| 824 | Ga0500652_001852 | 3300053131 | Bacteria | 6392 |
| 825 | Ga0500652_006864 | 3300053131 | Bacteria | 3692 |
| 826 | Ga0500658_0010071 | 3300053134 | Bacteria | 3489 |
| 827 | Ga0500559_0177131 | 3300053136 | Bacteria | 1004 |
| 828 | Ga0500579_066362 | 3300053143 | Bacteria | 2110 |
| 829 | Ga0500600_0025708 | 3300053149 | Bacteria | 3498 |
| 830 | Ga0500616_0006180 | 3300053153 | Bacteria | 7914 |
| 831 | Ga0500616_0012979 | 3300053153 | Bacteria | 4852 |
| 832 | Ga0500633_0039723 | 3300053160 | Bacteria | 1574 |
| 833 | Ga0500634_0048886 | 3300053161 | Bacteria | 2281 |
| 834 | Ga0500645_000027 | 3300053730 | Bacteria | 124260 |
| 835 | Ga0500656_001516 | 3300053732 | Bacteria | 2011 |
| 836 | Ga0501084_0001412 | 3300054114 | Bacteria | 19016 |
| 837 | Ga0587084_001810 | 3300059477 | Bacteria | 2099 |
| 838 | Ga0587084_005225 | 3300059477 | Bacteria | 1526 |
| 839 | Ga0587070_003087 | 3300059491 | Bacteria | 1962 |
| 840 | Ga0587070_006734 | 3300059491 | Bacteria | 1564 |
| 841 | Ga0587073_0001083 | 3300059492 | Bacteria | 2984 |
| 842 | Ga0587073_0008309 | 3300059492 | Bacteria | 1676 |
| 843 | Ga0587073_0010568 | 3300059492 | Bacteria | 1554 |
| 844 | Ga0587073_0013845 | 3300059492 | Bacteria | 1425 |
| 845 | Ga0587073_0033745 | 3300059492 | Bacteria | 1074 |
| 846 | Ga0587077_005791 | 3300059493 | Bacteria | 1714 |
| 847 | Ga0587077_011401 | 3300059493 | Bacteria | 1397 |
| 848 | Ga0587077_013365 | 3300059493 | Bacteria | 1331 |
| 849 | Ga0587077_024498 | 3300059493 | Bacteria | 1099 |
| 850 | Ga0587080_001902 | 3300059503 | Bacteria | 2370 |
| 851 | Ga0587080_006380 | 3300059503 | Bacteria | 1624 |
| 852 | Ga0587080_011864 | 3300059503 | Bacteria | 1309 |
| 853 | Ga0587082_001019 | 3300059504 | Bacteria | 2713 |
| 854 | Ga0587082_004182 | 3300059504 | Bacteria | 1788 |
| 855 | Ga0587082_004616 | 3300059504 | Bacteria | 1741 |
| 856 | Ga0587082_005904 | 3300059504 | Bacteria | 1611 |
| 857 | Ga0587082_006413 | 3300059504 | Bacteria | 1572 |
| 858 | Ga0587082_010618 | 3300059504 | Bacteria | 1333 |
| 859 | Ga0587082_026020 | 3300059504 | Bacteria | 988 |
| 860 | Ga0587083_0001326 | 3300059505 | Bacteria | 2741 |
| 861 | Ga0587083_0003648 | 3300059505 | Bacteria | 2068 |
| 862 | Ga0587083_0009769 | 3300059505 | Bacteria | 1537 |
| 863 | Ga0587083_0010943 | 3300059505 | Bacteria | 1485 |
| 864 | Ga0587085_001376 | 3300059506 | Bacteria | 2225 |
| 865 | Ga0587085_025560 | 3300059506 | Bacteria | 935 |
| 866 | Ga0587086_003814 | 3300059507 | Bacteria | 1541 |
| 867 | Ga0587086_004276 | 3300059507 | Bacteria | 1484 |
| 868 | Ga0587088_002262 | 3300059508 | Bacteria | 2161 |
| 869 | Ga0587088_003903 | 3300059508 | Bacteria | 1848 |
| 870 | Ga0587088_013042 | 3300059508 | Bacteria | 1268 |
| 871 | Ga0587089_002814 | 3300059509 | Bacteria | 1801 |
| 872 | Ga0587090_003745 | 3300059510 | Bacteria | 1791 |
| 873 | Ga0587090_006591 | 3300059510 | Bacteria | 1498 |
| 874 | Ga0587090_018054 | 3300059510 | Bacteria | 1074 |
| 875 | Ga0587091_007502 | 3300059511 | Bacteria | 1576 |
| 876 | Ga0587091_025731 | 3300059511 | Bacteria | 1066 |
| 877 | Ga0587092_001127 | 3300059512 | Bacteria | 2503 |
| 878 | Ga0587092_001286 | 3300059512 | Bacteria | 2397 |
| 879 | Ga0587092_026856 | 3300059512 | Bacteria | 928 |
| 880 | Ga0587094_007560 | 3300059513 | Bacteria | 1336 |
| 881 | Ga0587095_002765 | 3300059514 | Bacteria | 1201 |
| 882 | Ga0587106_005755 | 3300059605 | Bacteria | 1431 |
| 883 | Ga0587106_012546 | 3300059605 | Bacteria | 1138 |
| 884 | Ga0587125_002462 | 3300059607 | Bacteria | 1487 |
| 885 | Ga0587129_001759 | 3300059608 | Bacteria | 1213 |
| 886 | Ga0587099_001328 | 3300059622 | Bacteria | 1748 |
| 887 | Ga0587101_002921 | 3300059623 | Bacteria | 1687 |
| 888 | Ga0587109_013288 | 3300059624 | Bacteria | 1364 |
| 889 | Ga0587113_003853 | 3300059625 | Bacteria | 1166 |
| 890 | Ga0587115_003705 | 3300059626 | Bacteria | 1629 |
| 891 | Ga0587115_005862 | 3300059626 | Bacteria | 1398 |
| 892 | Ga0587128_002561 | 3300059630 | Bacteria | 1909 |
| 893 | Ga0587128_015194 | 3300059630 | Bacteria | 1112 |
| 894 | Ga0587130_002349 | 3300059631 | Bacteria | 1524 |
| 895 | Ga0587062_002692 | 3300059639 | Bacteria | 1723 |
| 896 | Ga0587062_005808 | 3300059639 | Bacteria | 1379 |
| 897 | Ga0587067_003784 | 3300059640 | Bacteria | 1917 |
| 898 | Ga0587067_008233 | 3300059640 | Bacteria | 1518 |
| 899 | Ga0587069_003210 | 3300059642 | Bacteria | 1744 |
| 900 | Ga0587069_006862 | 3300059642 | Bacteria | 1385 |
| 901 | Ga0587069_018118 | 3300059642 | Bacteria | 1026 |
| 902 | Ga0587072_002898 | 3300059643 | Bacteria | 2354 |
| 903 | Ga0587072_010797 | 3300059643 | Bacteria | 1482 |
| 904 | Ga0587072_012553 | 3300059643 | Bacteria | 1402 |
| 905 | Ga0587072_017759 | 3300059643 | Bacteria | 1230 |
| 906 | Ga0587075_000862 | 3300059644 | Bacteria | 2691 |
| 907 | Ga0587075_001707 | 3300059644 | Bacteria | 2193 |
| 908 | Ga0587076_024948 | 3300059645 | Bacteria | 1018 |
| 909 | Ga0587078_001197 | 3300059646 | Bacteria | 2256 |
| 910 | Ga0587078_004598 | 3300059646 | Bacteria | 1446 |
| 911 | Ga0587079_001388 | 3300059647 | Bacteria | 2693 |
| 912 | Ga0587079_002060 | 3300059647 | Bacteria | 2392 |
| 913 | Ga0587079_006477 | 3300059647 | Bacteria | 1708 |
| 914 | Ga0587079_008284 | 3300059647 | Bacteria | 1584 |
| 915 | Ga0587079_015253 | 3300059647 | Bacteria | 1302 |
| 916 | Ga0587079_027800 | 3300059647 | Bacteria | 1067 |
| 917 | Ga0587079_028021 | 3300059647 | Bacteria | 1064 |
| 918 | Ga0587102_004451 | 3300059649 | Bacteria | 1198 |
| 919 | Ga0587107_001276 | 3300059652 | Bacteria | 2000 |
| 920 | Ga0587107_002753 | 3300059652 | Bacteria | 1630 |
| 921 | Ga0587107_003893 | 3300059652 | Bacteria | 1480 |
| 922 | Ga0587110_005765 | 3300059654 | Bacteria | 1126 |
| 923 | Ga0587114_000619 | 3300059655 | Bacteria | 2518 |
| 924 | Ga0587114_004976 | 3300059655 | Bacteria | 1417 |
| 925 | Ga0587114_009621 | 3300059655 | Bacteria | 1163 |
| 926 | Ga0587119_004446 | 3300059658 | Bacteria | 1389 |
| 927 | Ga0587071_010847 | 3300060344 | Bacteria | 1528 |
| 928 | Ga0587071_011764 | 3300060344 | Bacteria | 1482 |
| 929 | Ga0587071_022208 | 3300060344 | Bacteria | 1170 |
| 930 | Ga0587111_0003977 | 3300060346 | Bacteria | 2157 |
| 931 | Ga0587111_0010975 | 3300060346 | Bacteria | 1569 |
| 932 | Ga0587111_0013723 | 3300060346 | Bacteria | 1453 |
| 933 | Ga0587111_0014910 | 3300060346 | Bacteria | 1412 |
| 934 | Ga0587111_0038637 | 3300060346 | Bacteria | 1008 |
| 935 | Ga0501082_0001381 | 3300060353 | Bacteria | 21353 |
| 936 | Ga0466962_0101147 | 3300061719 | Bacteria | 1384 |
| 937 | Ga0466962_0151173 | 3300061719 | Bacteria | 1126 |
| 938 | Ga0530510_0000578 | 3300061734 | Bacteria | 23511 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046543 | Ga0495645_0234315 | Ga0495645_0234315_117_926 | 240 |
| 2 | 3300046675 | Ga0495657_0022884 | Ga0495657_0022884_379_1188 | 240 |
| 3 | 3300046689 | Ga0495613_0057280 | Ga0495613_0057280_603_1412 | 240 |
| 4 | 3300046809 | Ga0495600_0349640 | Ga0495600_0349640_76_885 | 240 |
| 5 | 3300047444 | Ga0495675_0043768 | Ga0495675_0043768_1922_2731 | 240 |
| 6 | 3300046499 | Ga0495594_0233039 | Ga0495594_0233039_154_987 | 241 |
| 7 | 3300046691 | Ga0495670_0104173 | Ga0495670_0104173_466_1299 | 241 |
| 8 | 3300047315 | Ga0495581_0012834 | Ga0495581_0012834_1384_2217 | 241 |
| 9 | 3300047318 | Ga0495636_0002703 | Ga0495636_0002703_4721_5554 | 241 |
| 10 | 3300059642 | Ga0587069_018118 | Ga0587069_018118_33_950 | 242 |
| 11 | 3300046455 | Ga0495603_0132418 | Ga0495603_0132418_160_993 | 247 |
| 12 | 3300042002 | Ga0439442_015909 | Ga0439442_015909_745_1536 | 249 |
| 13 | 3300059623 | Ga0587101_002921 | Ga0587101_002921_810_1646 | 249 |
| 14 | 3300050516 | nmdc:mga0sz30_25058_c2 | nmdc:mga0sz30_25058_c2_10_765 | 251 |
| 15 | 3300014745 | Ga0157377_10195281 | Ga0157377_101952812 | 253 |
| 16 | 3300042131 | Ga0450894_000134 | Ga0450894_000134_7542_8375 | 253 |
| 17 | 3300042134 | Ga0450898_001094 | Ga0450898_001094_1878_2711 | 253 |
| 18 | 3300042145 | Ga0450906_002132 | Ga0450906_002132_1203_2036 | 253 |
| 19 | 3300042184 | Ga0450908_006979 | Ga0450908_006979_591_1424 | 253 |
| 20 | 3300031889 | Ga0326468_10000024 | Ga0326468_100000249 | 254 |
| 21 | 3300041404 | Ga0439436_0025436 | Ga0439436_0025436_495_1328 | 255 |
| 22 | 3300041999 | Ga0439433_0002902 | Ga0439433_0002902_2064_2897 | 255 |
| 23 | 3300042014 | Ga0439457_001263 | Ga0439457_001263_2597_3430 | 255 |
| 24 | 3300046679 | Ga0495623_0082943 | Ga0495623_0082943_49_882 | 255 |
| 25 | 3300047317 | Ga0495604_0006369 | Ga0495604_0006369_6917_7750 | 255 |
| 26 | 3300031901 | Ga0307406_10093893 | Ga0307406_100938932 | 256 |
| 27 | 3300032002 | Ga0307416_100222056 | Ga0307416_1002220562 | 256 |
| 28 | 3300032126 | Ga0307415_100162214 | Ga0307415_1001622142 | 256 |
| 29 | 3300042439 | Ga0439464_0068920 | Ga0439464_0068920_150_983 | 256 |
| 30 | 3300044684 | Ga0466966_0069792 | Ga0466966_0069792_1067_1897 | 257 |
| 31 | 3300046691 | Ga0495670_0070897 | Ga0495670_0070897_956_1729 | 257 |
| 32 | 3300047447 | Ga0495685_059784 | Ga0495685_059784_335_1165 | 257 |
| 33 | 3300059505 | Ga0587083_0003648 | Ga0587083_0003648_871_1707 | 257 |
| 34 | 3300005338 | Ga0068868_100069439 | Ga0068868_1000694392 | 258 |
| 35 | 3300005355 | Ga0070671_100104704 | Ga0070671_1001047042 | 258 |
| 36 | 3300005456 | Ga0070678_100231819 | Ga0070678_1002318192 | 258 |
| 37 | 3300005614 | Ga0068856_100039634 | Ga0068856_1000396344 | 258 |
| 38 | 3300009174 | Ga0105241_10183085 | Ga0105241_101830852 | 258 |
| 39 | 3300013296 | Ga0157374_10003977 | Ga0157374_100039778 | 258 |
| 40 | 3300020077 | Ga0206351_10883250 | Ga0206351_108832502 | 258 |
| 41 | 3300025927 | Ga0207687_10009588 | Ga0207687_100095882 | 258 |
| 42 | 3300025931 | Ga0207644_10105197 | Ga0207644_101051972 | 258 |
| 43 | 3300026121 | Ga0207683_10140612 | Ga0207683_101406122 | 258 |
| 44 | 3300039438 | Ga0436360_0460535 | Ga0436360_0460535_30_806 | 258 |
| 45 | 3300048915 | Ga0496112_0042718 | Ga0496112_0042718_206_1036 | 258 |
| 46 | 3300049571 | Ga0501034_0597670 | Ga0501034_0597670_165_995 | 258 |
| 47 | 3300049572 | Ga0501036_0007479 | Ga0501036_0007479_4157_4987 | 258 |
| 48 | 3300049573 | Ga0501037_0024074 | Ga0501037_0024074_3318_4148 | 258 |
| 49 | 3300049574 | Ga0501038_0003179 | Ga0501038_0003179_12440_13270 | 258 |
| 50 | 3300049575 | Ga0501039_0029856 | Ga0501039_0029856_3191_4021 | 258 |
| 51 | 3300049576 | Ga0501040_0001054 | Ga0501040_0001054_4306_5136 | 258 |
| 52 | 3300049577 | Ga0501041_0000376 | Ga0501041_0000376_18091_18921 | 258 |
| 53 | 3300049578 | Ga0501042_0000037 | Ga0501042_0000037_4332_5162 | 258 |
| 54 | 3300049580 | Ga0501046_0000625 | Ga0501046_0000625_13839_14669 | 258 |
| 55 | 3300049582 | Ga0501048_0002018 | Ga0501048_0002018_10216_11046 | 258 |
| 56 | 3300049583 | Ga0501067_0163467 | Ga0501067_0163467_113_943 | 258 |
| 57 | 3300049584 | Ga0501068_0003411 | Ga0501068_0003411_5356_6186 | 258 |
| 58 | 3300049587 | Ga0501071_0012792 | Ga0501071_0012792_532_1362 | 258 |
| 59 | 3300049590 | Ga0501074_0011636 | Ga0501074_0011636_143_973 | 258 |
| 60 | 3300049591 | Ga0501075_0013757 | Ga0501075_0013757_4532_5362 | 258 |
| 61 | 3300049592 | Ga0501076_0018077 | Ga0501076_0018077_3614_4444 | 258 |
| 62 | 3300049593 | Ga0501077_0007867 | Ga0501077_0007867_4139_4969 | 258 |
| 63 | 3300049741 | Ga0501079_0000524 | Ga0501079_0000524_19787_20617 | 258 |
| 64 | 3300049743 | Ga0501081_0002265 | Ga0501081_0002265_313_1143 | 258 |
| 65 | 3300049822 | Ga0501035_0023137 | Ga0501035_0023137_1913_2743 | 258 |
| 66 | 3300049823 | Ga0501044_0349348 | Ga0501044_0349348_313_1143 | 258 |
| 67 | 3300049824 | Ga0501045_0000908 | Ga0501045_0000908_1798_2628 | 258 |
| 68 | 3300054114 | Ga0501084_0001412 | Ga0501084_0001412_2550_3380 | 258 |
| 69 | 3300059504 | Ga0587082_026020 | Ga0587082_026020_69_851 | 258 |
| 70 | 3300060353 | Ga0501082_0001381 | Ga0501082_0001381_18525_19355 | 258 |
| 71 | 3300061734 | Ga0530510_0000578 | Ga0530510_0000578_3241_4071 | 258 |
| 72 | 3300005435 | Ga0070714_100676765 | Ga0070714_1006767651 | 259 |
| 73 | 3300005436 | Ga0070713_100300198 | Ga0070713_1003001982 | 259 |
| 74 | 3300005437 | Ga0070710_10019372 | Ga0070710_100193724 | 259 |
| 75 | 3300005539 | Ga0068853_100023981 | Ga0068853_1000239812 | 259 |
| 76 | 3300005937 | Ga0081455_10087959 | Ga0081455_100879592 | 259 |
| 77 | 3300006038 | Ga0075365_10068328 | Ga0075365_100683282 | 259 |
| 78 | 3300006042 | Ga0075368_10042061 | Ga0075368_100420612 | 259 |
| 79 | 3300006048 | Ga0075363_100099383 | Ga0075363_1000993832 | 259 |
| 80 | 3300006175 | Ga0070712_100075006 | Ga0070712_1000750062 | 259 |
| 81 | 3300006178 | Ga0075367_10000123 | Ga0075367_1000012320 | 259 |
| 82 | 3300025915 | Ga0207693_10009379 | Ga0207693_100093798 | 259 |
| 83 | 3300025929 | Ga0207664_10269155 | Ga0207664_102691552 | 259 |
| 84 | 3300042007 | Ga0439449_0015223 | Ga0439449_0015223_220_1053 | 259 |
| 85 | 3300046689 | Ga0495613_0141747 | Ga0495613_0141747_722_1555 | 259 |
| 86 | 3300046690 | Ga0495624_0091296 | Ga0495624_0091296_287_1120 | 259 |
| 87 | 3300048903 | Ga0496100_0025627 | Ga0496100_0025627_286_1116 | 259 |
| 88 | 3300048904 | Ga0496101_0031562 | Ga0496101_0031562_325_1155 | 259 |
| 89 | 3300048905 | Ga0496102_0043348 | Ga0496102_0043348_2158_2988 | 259 |
| 90 | 3300048908 | Ga0496105_0091491 | Ga0496105_0091491_17_847 | 259 |
| 91 | 3300048910 | Ga0496107_0044153 | Ga0496107_0044153_370_1200 | 259 |
| 92 | 3300048917 | Ga0496114_0043703 | Ga0496114_0043703_2742_3572 | 259 |
| 93 | 3300048918 | Ga0496115_0026196 | Ga0496115_0026196_163_993 | 259 |
| 94 | 3300050492 | nmdc:mga0yw44_18819_c1 | nmdc:mga0yw44_18819_c1_1568_2401 | 259 |
| 95 | 3300050494 | nmdc:mga06z11_2945_c1 | nmdc:mga06z11_2945_c1_1205_2038 | 259 |
| 96 | 3300053101 | Ga0500553_033794 | Ga0500553_033794_464_1297 | 259 |
| 97 | 3300053113 | Ga0500580_084609 | Ga0500580_084609_318_1151 | 259 |
| 98 | 3300053123 | Ga0500614_019618 | Ga0500614_019618_313_1146 | 259 |
| 99 | 3300059608 | Ga0587129_001759 | Ga0587129_001759_54_836 | 259 |
| 100 | 3300005329 | Ga0070683_100122935 | Ga0070683_1001229352 | 260 |
| 101 | 3300005530 | Ga0070679_100036973 | Ga0070679_1000369732 | 260 |
| 102 | 3300005535 | Ga0070684_100129879 | Ga0070684_1001298792 | 260 |
| 103 | 3300005563 | Ga0068855_100028863 | Ga0068855_1000288638 | 260 |
| 104 | 3300006028 | Ga0070717_10057268 | Ga0070717_100572682 | 260 |
| 105 | 3300006871 | Ga0075434_100106111 | Ga0075434_1001061113 | 260 |
| 106 | 3300006914 | Ga0075436_100010389 | Ga0075436_1000103893 | 260 |
| 107 | 3300007076 | Ga0075435_100029787 | Ga0075435_1000297873 | 260 |
| 108 | 3300009093 | Ga0105240_10304768 | Ga0105240_103047682 | 260 |
| 109 | 3300009101 | Ga0105247_10387827 | Ga0105247_103878272 | 260 |
| 110 | 3300013105 | Ga0157369_10116239 | Ga0157369_101162392 | 260 |
| 111 | 3300013306 | Ga0163162_10261893 | Ga0163162_102618932 | 260 |
| 112 | 3300017792 | Ga0163161_10050163 | Ga0163161_100501633 | 260 |
| 113 | 3300020069 | Ga0197907_10138387 | Ga0197907_101383872 | 260 |
| 114 | 3300020070 | Ga0206356_10142785 | Ga0206356_101427852 | 260 |
| 115 | 3300020077 | Ga0206351_10861399 | Ga0206351_108613992 | 260 |
| 116 | 3300020082 | Ga0206353_10380294 | Ga0206353_103802942 | 260 |
| 117 | 3300025321 | Ga0207656_10144121 | Ga0207656_101441212 | 260 |
| 118 | 3300025898 | Ga0207692_10024484 | Ga0207692_100244843 | 260 |
| 119 | 3300025912 | Ga0207707_10065555 | Ga0207707_100655553 | 260 |
| 120 | 3300025913 | Ga0207695_10010135 | Ga0207695_100101354 | 260 |
| 121 | 3300025921 | Ga0207652_10009033 | Ga0207652_100090334 | 260 |
| 122 | 3300025924 | Ga0207694_10042292 | Ga0207694_100422922 | 260 |
| 123 | 3300025928 | Ga0207700_10206097 | Ga0207700_102060971 | 260 |
| 124 | 3300025928 | Ga0207700_10255813 | Ga0207700_102558132 | 260 |
| 125 | 3300025944 | Ga0207661_10024630 | Ga0207661_100246303 | 260 |
| 126 | 3300025944 | Ga0207661_10313150 | Ga0207661_103131502 | 260 |
| 127 | 3300025949 | Ga0207667_10177133 | Ga0207667_101771332 | 260 |
| 128 | 3300026078 | Ga0207702_10346742 | Ga0207702_103467422 | 260 |
| 129 | 3300026116 | Ga0207674_10082270 | Ga0207674_100822701 | 260 |
| 130 | 3300037466 | Ga0395898_0032987 | Ga0395898_0032987_1544_2377 | 260 |
| 131 | 3300045976 | Ga0466967_0273571 | Ga0466967_0273571_258_1091 | 260 |
| 132 | 3300046810 | Ga0495660_0056153 | Ga0495660_0056153_63_896 | 260 |
| 133 | 3300049583 | Ga0501067_0064946 | Ga0501067_0064946_697_1527 | 260 |
| 134 | 3300050512 | nmdc:mga0n895_16329_c1 | nmdc:mga0n895_16329_c1_5589_6419 | 260 |
| 135 | 3300050513 | nmdc:mga0rr50_421893_c1 | nmdc:mga0rr50_421893_c1_31_861 | 260 |
| 136 | 3300050514 | nmdc:mga08x19_2634_c1 | nmdc:mga08x19_2634_c1_2773_3603 | 260 |
| 137 | 3300059492 | Ga0587073_0001083 | Ga0587073_0001083_912_1742 | 260 |
| 138 | 3300059492 | Ga0587073_0033745 | Ga0587073_0033745_13_849 | 260 |
| 139 | 3300059493 | Ga0587077_005791 | Ga0587077_005791_767_1603 | 260 |
| 140 | 3300059503 | Ga0587080_006380 | Ga0587080_006380_448_1278 | 260 |
| 141 | 3300059504 | Ga0587082_001019 | Ga0587082_001019_981_1811 | 260 |
| 142 | 3300059504 | Ga0587082_004616 | Ga0587082_004616_602_1438 | 260 |
| 143 | 3300059505 | Ga0587083_0001326 | Ga0587083_0001326_927_1757 | 260 |
| 144 | 3300059510 | Ga0587090_006591 | Ga0587090_006591_234_1070 | 260 |
| 145 | 3300059511 | Ga0587091_025731 | Ga0587091_025731_108_944 | 260 |
| 146 | 3300059513 | Ga0587094_007560 | Ga0587094_007560_291_1121 | 260 |
| 147 | 3300059626 | Ga0587115_003705 | Ga0587115_003705_679_1509 | 260 |
| 148 | 3300059640 | Ga0587067_003784 | Ga0587067_003784_119_949 | 260 |
| 149 | 3300059647 | Ga0587079_027800 | Ga0587079_027800_72_905 | 260 |
| 150 | 3300005617 | Ga0068859_100000134 | Ga0068859_10000013447 | 261 |
| 151 | 3300005617 | Ga0068859_100015497 | Ga0068859_1000154976 | 261 |
| 152 | 3300005841 | Ga0068863_100000189 | Ga0068863_10000018927 | 261 |
| 153 | 3300005842 | Ga0068858_100008568 | Ga0068858_1000085689 | 261 |
| 154 | 3300005844 | Ga0068862_100000009 | Ga0068862_100000009164 | 261 |
| 155 | 3300006931 | Ga0097620_100000134 | Ga0097620_10000013422 | 261 |
| 156 | 3300006931 | Ga0097620_100015497 | Ga0097620_1000154972 | 261 |
| 157 | 3300009092 | Ga0105250_10058136 | Ga0105250_100581362 | 261 |
| 158 | 3300009101 | Ga0105247_10000335 | Ga0105247_100003356 | 261 |
| 159 | 3300009177 | Ga0105248_10002739 | Ga0105248_1000273914 | 261 |
| 160 | 3300009553 | Ga0105249_10008171 | Ga0105249_100081717 | 261 |
| 161 | 3300014325 | Ga0163163_10012428 | Ga0163163_100124288 | 261 |
| 162 | 3300014968 | Ga0157379_10062736 | Ga0157379_100627362 | 261 |
| 163 | 3300025900 | Ga0207710_10000169 | Ga0207710_1000016954 | 261 |
| 164 | 3300025941 | Ga0207711_10006477 | Ga0207711_100064776 | 261 |
| 165 | 3300025961 | Ga0207712_10005734 | Ga0207712_100057344 | 261 |
| 166 | 3300026035 | Ga0207703_10182543 | Ga0207703_101825432 | 261 |
| 167 | 3300026088 | Ga0207641_10001086 | Ga0207641_100010869 | 261 |
| 168 | 3300028380 | Ga0268265_10000050 | Ga0268265_1000005038 | 261 |
| 169 | 3300044765 | Ga0466970_0051168 | Ga0466970_0051168_1278_2063 | 261 |
| 170 | 3300048905 | Ga0496102_0008636 | Ga0496102_0008636_4259_5158 | 261 |
| 171 | 3300048910 | Ga0496107_0175438 | Ga0496107_0175438_602_1471 | 261 |
| 172 | 3300048919 | Ga0496116_0000287 | Ga0496116_0000287_50803_51702 | 261 |
| 173 | 3300048920 | Ga0496117_0011140 | Ga0496117_0011140_224_1123 | 261 |
| 174 | 3300048921 | Ga0496118_0001131 | Ga0496118_0001131_9738_10637 | 261 |
| 175 | 3300048922 | Ga0496119_0000337 | Ga0496119_0000337_56270_57139 | 261 |
| 176 | 3300048922 | Ga0496119_0008756 | Ga0496119_0008756_5967_6866 | 261 |
| 177 | 3300048923 | Ga0496120_0000250 | Ga0496120_0000250_42476_43345 | 261 |
| 178 | 3300059503 | Ga0587080_001902 | Ga0587080_001902_734_1621 | 261 |
| 179 | 3300059504 | Ga0587082_004182 | Ga0587082_004182_158_1045 | 261 |
| 180 | 3300059646 | Ga0587078_001197 | Ga0587078_001197_593_1483 | 261 |
| 181 | 3300003373 | JGI25407J50210_10009310 | JGI25407J50210_100093102 | 262 |
| 182 | 3300003373 | JGI25407J50210_10037730 | JGI25407J50210_100377302 | 262 |
| 183 | 3300005981 | Ga0081538_10000927 | Ga0081538_1000092727 | 262 |
| 184 | 3300005981 | Ga0081538_10009238 | Ga0081538_100092388 | 262 |
| 185 | 3300009177 | Ga0105248_10000111 | Ga0105248_1000011130 | 262 |
| 186 | 3300025940 | Ga0207691_10375232 | Ga0207691_103752322 | 262 |
| 187 | 3300025941 | Ga0207711_10000605 | Ga0207711_1000060529 | 262 |
| 188 | 3300028786 | Ga0307517_10001164 | Ga0307517_1000116430 | 262 |
| 189 | 3300030521 | Ga0307511_10082473 | Ga0307511_100824732 | 262 |
| 190 | 3300031616 | Ga0307508_10193221 | Ga0307508_101932212 | 262 |
| 191 | 3300033179 | Ga0307507_10231306 | Ga0307507_102313062 | 262 |
| 192 | 3300033180 | Ga0307510_10305145 | Ga0307510_103051452 | 262 |
| 193 | 3300037312 | Ga0395899_0083486 | Ga0395899_0083486_1138_1968 | 262 |
| 194 | 3300037471 | Ga0395905_0063971 | Ga0395905_0063971_2261_3091 | 262 |
| 195 | 3300038443 | Ga0395901_0001169 | Ga0395901_0001169_14905_15735 | 262 |
| 196 | 3300041404 | Ga0439436_0005008 | Ga0439436_0005008_2921_3754 | 262 |
| 197 | 3300041406 | Ga0439439_0002809 | Ga0439439_0002809_1992_2825 | 262 |
| 198 | 3300042007 | Ga0439449_0004579 | Ga0439449_0004579_1289_2122 | 262 |
| 199 | 3300042014 | Ga0439457_002746 | Ga0439457_002746_755_1588 | 262 |
| 200 | 3300042015 | Ga0439462_0023041 | Ga0439462_0023041_124_957 | 262 |
| 201 | 3300045836 | Ga0466958_0140735 | Ga0466958_0140735_383_1270 | 262 |
| 202 | 3300046522 | Ga0495643_0004303 | Ga0495643_0004303_2052_2885 | 262 |
| 203 | 3300046674 | Ga0495588_0141763 | Ga0495588_0141763_396_1229 | 262 |
| 204 | 3300046691 | Ga0495670_0039733 | Ga0495670_0039733_296_1129 | 262 |
| 205 | 3300047323 | Ga0495683_0043999 | Ga0495683_0043999_150_983 | 262 |
| 206 | 3300047447 | Ga0495685_000690 | Ga0495685_000690_6342_7175 | 262 |
| 207 | 3300047470 | Ga0495681_0001547 | Ga0495681_0001547_3543_4376 | 262 |
| 208 | 3300049584 | Ga0501068_0289823 | Ga0501068_0289823_49_849 | 262 |
| 209 | 3300053079 | Ga0500610_0171133 | Ga0500610_0171133_218_1051 | 262 |
| 210 | 3300053086 | Ga0500578_0009672 | Ga0500578_0009672_72_905 | 262 |
| 211 | 3300053094 | Ga0500566_0098871 | Ga0500566_0098871_449_1282 | 262 |
| 212 | 3300053099 | Ga0500654_048071 | Ga0500654_048071_601_1434 | 262 |
| 213 | 3300053126 | Ga0500621_110973 | Ga0500621_110973_91_924 | 262 |
| 214 | 3300053129 | Ga0500628_001445 | Ga0500628_001445_1434_2267 | 262 |
| 215 | 3300053131 | Ga0500652_001852 | Ga0500652_001852_2206_3039 | 262 |
| 216 | 3300053134 | Ga0500658_0010071 | Ga0500658_0010071_2181_3014 | 262 |
| 217 | 3300053149 | Ga0500600_0025708 | Ga0500600_0025708_390_1223 | 262 |
| 218 | 3300053153 | Ga0500616_0012979 | Ga0500616_0012979_2939_3772 | 262 |
| 219 | 3300053160 | Ga0500633_0039723 | Ga0500633_0039723_363_1196 | 262 |
| 220 | 3300053161 | Ga0500634_0048886 | Ga0500634_0048886_345_1178 | 262 |
| 221 | 3300053732 | Ga0500656_001516 | Ga0500656_001516_819_1652 | 262 |
| 222 | 3300003373 | JGI25407J50210_10014238 | JGI25407J50210_100142382 | 263 |
| 223 | 3300005981 | Ga0081538_10007094 | Ga0081538_100070943 | 263 |
| 224 | 3300031548 | Ga0307408_100016830 | Ga0307408_1000168303 | 263 |
| 225 | 3300031731 | Ga0307405_10015905 | Ga0307405_100159053 | 263 |
| 226 | 3300031731 | Ga0307405_10445334 | Ga0307405_104453342 | 263 |
| 227 | 3300031824 | Ga0307413_10031735 | Ga0307413_100317352 | 263 |
| 228 | 3300031852 | Ga0307410_10175865 | Ga0307410_101758652 | 263 |
| 229 | 3300031903 | Ga0307407_10034939 | Ga0307407_100349392 | 263 |
| 230 | 3300031911 | Ga0307412_10345204 | Ga0307412_103452042 | 263 |
| 231 | 3300031995 | Ga0307409_100002234 | Ga0307409_1000022347 | 263 |
| 232 | 3300032002 | Ga0307416_100000560 | Ga0307416_1000005607 | 263 |
| 233 | 3300032002 | Ga0307416_100018292 | Ga0307416_1000182923 | 263 |
| 234 | 3300032126 | Ga0307415_100000569 | Ga0307415_10000056912 | 263 |
| 235 | 3300032126 | Ga0307415_100044653 | Ga0307415_1000446532 | 263 |
| 236 | 3300049675 | Ga0501243_015058 | Ga0501243_015058_95_937 | 263 |
| 237 | 3300059477 | Ga0587084_005225 | Ga0587084_005225_272_1102 | 263 |
| 238 | 3300059508 | Ga0587088_013042 | Ga0587088_013042_267_1097 | 263 |
| 239 | 3300059605 | Ga0587106_005755 | Ga0587106_005755_35_865 | 263 |
| 240 | 3300059626 | Ga0587115_005862 | Ga0587115_005862_493_1323 | 263 |
| 241 | 3300059630 | Ga0587128_002561 | Ga0587128_002561_494_1324 | 263 |
| 242 | 3300059631 | Ga0587130_002349 | Ga0587130_002349_497_1327 | 263 |
| 243 | 3300059647 | Ga0587079_006477 | Ga0587079_006477_384_1214 | 263 |
| 244 | 3300059652 | Ga0587107_001276 | Ga0587107_001276_603_1433 | 263 |
| 245 | 3300060344 | Ga0587071_010847 | Ga0587071_010847_434_1264 | 263 |
| 246 | 3300060346 | Ga0587111_0003977 | Ga0587111_0003977_1159_1989 | 263 |
| 247 | 3300005937 | Ga0081455_10022912 | Ga0081455_100229129 | 264 |
| 248 | 3300005981 | Ga0081538_10043924 | Ga0081538_100439243 | 264 |
| 249 | 3300045976 | Ga0466967_0035598 | Ga0466967_0035598_1514_2356 | 264 |
| 250 | 3300059643 | Ga0587072_012553 | Ga0587072_012553_497_1327 | 264 |
| 251 | 3300003373 | JGI25407J50210_10007409 | JGI25407J50210_100074093 | 265 |
| 252 | 3300005981 | Ga0081538_10003181 | Ga0081538_1000318114 | 265 |
| 253 | 3300059491 | Ga0587070_003087 | Ga0587070_003087_425_1255 | 265 |
| 254 | 3300059493 | Ga0587077_011401 | Ga0587077_011401_417_1247 | 265 |
| 255 | 3300059504 | Ga0587082_006413 | Ga0587082_006413_278_1108 | 265 |
| 256 | 3300059505 | Ga0587083_0009769 | Ga0587083_0009769_544_1374 | 265 |
| 257 | 3300059506 | Ga0587085_001376 | Ga0587085_001376_964_1794 | 265 |
| 258 | 3300059507 | Ga0587086_004276 | Ga0587086_004276_264_1094 | 265 |
| 259 | 3300059508 | Ga0587088_003903 | Ga0587088_003903_170_1000 | 265 |
| 260 | 3300059509 | Ga0587089_002814 | Ga0587089_002814_744_1574 | 265 |
| 261 | 3300059510 | Ga0587090_018054 | Ga0587090_018054_81_911 | 265 |
| 262 | 3300059512 | Ga0587092_001286 | Ga0587092_001286_682_1512 | 265 |
| 263 | 3300059514 | Ga0587095_002765 | Ga0587095_002765_272_1102 | 265 |
| 264 | 3300059607 | Ga0587125_002462 | Ga0587125_002462_149_979 | 265 |
| 265 | 3300059622 | Ga0587099_001328 | Ga0587099_001328_654_1484 | 265 |
| 266 | 3300059624 | Ga0587109_013288 | Ga0587109_013288_82_912 | 265 |
| 267 | 3300059625 | Ga0587113_003853 | Ga0587113_003853_127_957 | 265 |
| 268 | 3300059630 | Ga0587128_015194 | Ga0587128_015194_121_951 | 265 |
| 269 | 3300059639 | Ga0587062_005808 | Ga0587062_005808_389_1219 | 265 |
| 270 | 3300059640 | Ga0587067_008233 | Ga0587067_008233_154_984 | 265 |
| 271 | 3300059643 | Ga0587072_010797 | Ga0587072_010797_509_1339 | 265 |
| 272 | 3300059644 | Ga0587075_000862 | Ga0587075_000862_996_1826 | 265 |
| 273 | 3300059646 | Ga0587078_004598 | Ga0587078_004598_371_1201 | 265 |
| 274 | 3300059647 | Ga0587079_008284 | Ga0587079_008284_149_979 | 265 |
| 275 | 3300059652 | Ga0587107_002753 | Ga0587107_002753_647_1477 | 265 |
| 276 | 3300059655 | Ga0587114_004976 | Ga0587114_004976_373_1203 | 265 |
| 277 | 3300060346 | Ga0587111_0010975 | Ga0587111_0010975_172_1002 | 265 |
| 278 | iso_pu_bacteria | 2687453737 | 2689955711 | 265 |
| 279 | 3300005337 | Ga0070682_100027496 | Ga0070682_1000274963 | 266 |
| 280 | 3300005338 | Ga0068868_100402530 | Ga0068868_1004025301 | 266 |
| 281 | 3300005438 | Ga0070701_10164151 | Ga0070701_101641512 | 266 |
| 282 | 3300005455 | Ga0070663_100341124 | Ga0070663_1003411241 | 266 |
| 283 | 3300005616 | Ga0068852_100321149 | Ga0068852_1003211492 | 266 |
| 284 | 3300025904 | Ga0207647_10131933 | Ga0207647_101319332 | 266 |
| 285 | 3300025927 | Ga0207687_10189067 | Ga0207687_101890672 | 266 |
| 286 | 3300025945 | Ga0207679_10233997 | Ga0207679_102339972 | 266 |
| 287 | 3300026095 | Ga0207676_10757192 | Ga0207676_107571922 | 266 |
| 288 | 3300026116 | Ga0207674_10161410 | Ga0207674_101614102 | 266 |
| 289 | 3300026118 | Ga0207675_100114755 | Ga0207675_1001147552 | 266 |
| 290 | 3300048913 | Ga0496110_0313728 | Ga0496110_0313728_195_1028 | 266 |
| 291 | 3300060344 | Ga0587071_022208 | Ga0587071_022208_63_896 | 266 |
| 292 | 3300005937 | Ga0081455_10001610 | Ga0081455_1000161019 | 267 |
| 293 | 3300013297 | Ga0157378_10342351 | Ga0157378_103423512 | 267 |
| 294 | 3300025918 | Ga0207662_10078508 | Ga0207662_100785082 | 267 |
| 295 | 3300026089 | Ga0207648_10272233 | Ga0207648_102722332 | 267 |
| 296 | 3300045836 | Ga0466958_0273884 | Ga0466958_0273884_42_875 | 268 |
| 297 | 3300048909 | Ga0496106_0104259 | Ga0496106_0104259_1245_2081 | 269 |
| 298 | 3300049571 | Ga0501034_0429582 | Ga0501034_0429582_408_1217 | 269 |
| 299 | 3300049743 | Ga0501081_0222341 | Ga0501081_0222341_337_1152 | 269 |
| 300 | 3300005367 | Ga0070667_100715179 | Ga0070667_1007151791 | 271 |
| 301 | 3300005985 | Ga0081539_10064620 | Ga0081539_100646202 | 271 |
| 302 | 3300035112 | Ga0373932_0024314 | Ga0373932_0024314_579_1400 | 271 |
| 303 | 3300035207 | Ga0373942_0000130 | Ga0373942_0000130_3166_3987 | 271 |
| 304 | 3300035242 | Ga0373962_0002006 | Ga0373962_0002006_767_1588 | 271 |
| 305 | 3300037853 | Ga0436364_0918955 | Ga0436364_0918955_1201_2025 | 271 |
| 306 | iso_pu_bacteria | 2832004796 | 2832008124 | 271 |
| 307 | iso_pu_bacteria | 2866065130 | 2866070067 | 271 |
| 308 | 3300005937 | Ga0081455_10212614 | Ga0081455_102126142 | 272 |
| 309 | 3300005983 | Ga0081540_1015573 | Ga0081540_10155735 | 272 |
| 310 | iso_pu_bacteria | 2508501039 | 2508676887 | 272 |
| 311 | iso_pu_bacteria | 2675902999 | 2676201845 | 272 |
| 312 | iso_pu_bacteria | 2773857921 | 2774846421 | 272 |
| 313 | iso_pu_bacteria | 2895880812 | 2895884640 | 272 |
| 314 | iso_pu_bacteria | 3002998708 | 3003009342 | 272 |
| 315 | iso_pu_bacteria | 8002775197 | 8002783190 | 272 |
| 316 | iso_pu_bacteria | 8002784119 | 8002792514 | 272 |
| 317 | 3300026118 | Ga0207675_100079791 | Ga0207675_1000797912 | 273 |
| 318 | 3300031731 | Ga0307405_10107468 | Ga0307405_101074682 | 273 |
| 319 | 3300031824 | Ga0307413_10057231 | Ga0307413_100572313 | 273 |
| 320 | 3300031995 | Ga0307409_100088604 | Ga0307409_1000886042 | 273 |
| 321 | 3300032126 | Ga0307415_100015820 | Ga0307415_1000158204 | 273 |
| 322 | 3300032126 | Ga0307415_100494750 | Ga0307415_1004947502 | 273 |
| 323 | 3300046538 | Ga0495609_0087525 | Ga0495609_0087525_91_921 | 273 |
| 324 | 3300049568 | Ga0501031_0069939 | Ga0501031_0069939_1251_2084 | 273 |
| 325 | 3300049575 | Ga0501039_0039114 | Ga0501039_0039114_1527_2360 | 273 |
| 326 | 3300049576 | Ga0501040_0103890 | Ga0501040_0103890_990_1823 | 273 |
| 327 | 3300049587 | Ga0501071_0015082 | Ga0501071_0015082_4017_4850 | 273 |
| 328 | iso_pu_bacteria | 2554235005 | 2554260010 | 273 |
| 329 | iso_pu_bacteria | 2582581313 | 2585311107 | 273 |
| 330 | iso_pu_bacteria | 2643221714 | 2644632538 | 273 |
| 331 | iso_pu_bacteria | 2751185782 | 2753265462 | 273 |
| 332 | iso_pu_bacteria | 2772190715 | 2772646617 | 273 |
| 333 | iso_pu_bacteria | 2784746763 | 2785339704 | 273 |
| 334 | iso_pu_bacteria | 2784746768 | 2785372560 | 273 |
| 335 | iso_pu_bacteria | 2808606375 | 2808916355 | 273 |
| 336 | iso_pu_bacteria | 2808606982 | 2811846410 | 273 |
| 337 | iso_pu_bacteria | 2811994879 | 2812354312 | 273 |
| 338 | iso_pu_bacteria | 2811994917 | 2812482831 | 273 |
| 339 | iso_pu_bacteria | 2831935698 | 2831939652 | 273 |
| 340 | iso_pu_bacteria | 2852635781 | 2852635933 | 273 |
| 341 | iso_pu_bacteria | 2855670206 | 2855675518 | 273 |
| 342 | iso_pu_bacteria | 2855676851 | 2855677585 | 273 |
| 343 | iso_pu_bacteria | 2855683550 | 2855683935 | 273 |
| 344 | iso_pu_bacteria | 2856858025 | 2856864165 | 273 |
| 345 | iso_pu_bacteria | 2857288857 | 2857293240 | 273 |
| 346 | iso_pu_bacteria | 2858848962 | 2858852905 | 273 |
| 347 | iso_pu_bacteria | 2858868258 | 2858871644 | 273 |
| 348 | iso_pu_bacteria | 2858882152 | 2858883344 | 273 |
| 349 | iso_pu_bacteria | 2858888857 | 2858891354 | 273 |
| 350 | iso_pu_bacteria | 2858895516 | 2858901409 | 273 |
| 351 | iso_pu_bacteria | 2858902515 | 2858906516 | 273 |
| 352 | iso_pu_bacteria | 2863404153 | 2863410375 | 273 |
| 353 | iso_pu_bacteria | 2867302475 | 2867302904 | 273 |
| 354 | iso_pu_bacteria | 2867312974 | 2867313875 | 273 |
| 355 | iso_pu_bacteria | 2867319477 | 2867325863 | 273 |
| 356 | iso_pu_bacteria | 2867507094 | 2867512285 | 273 |
| 357 | iso_pu_bacteria | 2869048445 | 2869050393 | 273 |
| 358 | iso_pu_bacteria | 2869061728 | 2869064509 | 273 |
| 359 | iso_pu_bacteria | 2869068681 | 2869074352 | 273 |
| 360 | iso_pu_bacteria | 2880489317 | 2880490016 | 273 |
| 361 | iso_pu_bacteria | 2880495981 | 2880502543 | 273 |
| 362 | iso_pu_bacteria | 2902582711 | 2902582741 | 273 |
| 363 | iso_pu_bacteria | 2929226422 | 2929230975 | 273 |
| 364 | iso_pu_bacteria | 2946064051 | 2946071389 | 273 |
| 365 | iso_pu_bacteria | 2946072368 | 2946079205 | 273 |
| 366 | iso_pu_bacteria | 2954691527 | 2954691713 | 273 |
| 367 | iso_pu_bacteria | 2954701450 | 2954706841 | 273 |
| 368 | iso_pu_bacteria | 2996221748 | 2996222991 | 273 |
| 369 | iso_pu_bacteria | 3006486233 | 3006491959 | 273 |
| 370 | iso_pu_bacteria | 649633069 | 649814295 | 273 |
| 371 | iso_pu_bacteria | 8003830390 | 8003836389 | 273 |
| 372 | iso_pu_bacteria | 8003870546 | 8003873181 | 273 |
| 373 | iso_pu_bacteria | 8054704163 | 8054704963 | 273 |
| 374 | iso_pu_bacteria | 8054727385 | 8054733291 | 273 |
| 375 | iso_pu_bacteria | 8054734606 | 8054738829 | 273 |
| 376 | iso_pu_bacteria | 8055412473 | 8055412756 | 273 |
| 377 | 3300003203 | JGI25406J46586_10008147 | JGI25406J46586_100081475 | 274 |
| 378 | 3300005366 | Ga0070659_100068570 | Ga0070659_1000685703 | 274 |
| 379 | 3300005441 | Ga0070700_100121551 | Ga0070700_1001215512 | 274 |
| 380 | 3300005564 | Ga0070664_100045804 | Ga0070664_1000458043 | 274 |
| 381 | 3300005615 | Ga0070702_100083299 | Ga0070702_1000832991 | 274 |
| 382 | 3300005616 | Ga0068852_100037223 | Ga0068852_1000372233 | 274 |
| 383 | 3300005616 | Ga0068852_100293440 | Ga0068852_1002934402 | 274 |
| 384 | 3300005985 | Ga0081539_10000256 | Ga0081539_10000256107 | 274 |
| 385 | 3300006028 | Ga0070717_10005059 | Ga0070717_100050596 | 274 |
| 386 | 3300006881 | Ga0068865_100133007 | Ga0068865_1001330072 | 274 |
| 387 | 3300009094 | Ga0111539_10245169 | Ga0111539_102451693 | 274 |
| 388 | 3300009098 | Ga0105245_10727307 | Ga0105245_107273071 | 274 |
| 389 | 3300009148 | Ga0105243_10810457 | Ga0105243_108104571 | 274 |
| 390 | 3300013102 | Ga0157371_10336534 | Ga0157371_103365341 | 274 |
| 391 | 3300013307 | Ga0157372_10475564 | Ga0157372_104755642 | 274 |
| 392 | 3300014969 | Ga0157376_10216351 | Ga0157376_102163512 | 274 |
| 393 | 3300025901 | Ga0207688_10150079 | Ga0207688_101500792 | 274 |
| 394 | 3300025908 | Ga0207643_10029382 | Ga0207643_100293822 | 274 |
| 395 | 3300025909 | Ga0207705_10158431 | Ga0207705_101584312 | 274 |
| 396 | 3300025919 | Ga0207657_10315307 | Ga0207657_103153072 | 274 |
| 397 | 3300025932 | Ga0207690_10068989 | Ga0207690_100689894 | 274 |
| 398 | 3300025933 | Ga0207706_10050689 | Ga0207706_100506893 | 274 |
| 399 | 3300025935 | Ga0207709_10309691 | Ga0207709_103096912 | 274 |
| 400 | 3300025937 | Ga0207669_10208931 | Ga0207669_102089312 | 274 |
| 401 | 3300025944 | Ga0207661_10479596 | Ga0207661_104795962 | 274 |
| 402 | 3300025945 | Ga0207679_10093173 | Ga0207679_100931733 | 274 |
| 403 | 3300025960 | Ga0207651_10527955 | Ga0207651_105279551 | 274 |
| 404 | 3300026075 | Ga0207708_10153439 | Ga0207708_101534392 | 274 |
| 405 | 3300026089 | Ga0207648_10158836 | Ga0207648_101588362 | 274 |
| 406 | 3300026118 | Ga0207675_100200125 | Ga0207675_1002001253 | 274 |
| 407 | 3300026121 | Ga0207683_10321754 | Ga0207683_103217542 | 274 |
| 408 | 3300026142 | Ga0207698_10060704 | Ga0207698_100607042 | 274 |
| 409 | 3300028380 | Ga0268265_10658567 | Ga0268265_106585672 | 274 |
| 410 | 3300031548 | Ga0307408_100064187 | Ga0307408_1000641872 | 274 |
| 411 | 3300031852 | Ga0307410_10019957 | Ga0307410_100199572 | 274 |
| 412 | 3300031901 | Ga0307406_10041370 | Ga0307406_100413703 | 274 |
| 413 | 3300031911 | Ga0307412_10042639 | Ga0307412_100426392 | 274 |
| 414 | 3300032004 | Ga0307414_10017217 | Ga0307414_100172173 | 274 |
| 415 | 3300032126 | Ga0307415_100339830 | Ga0307415_1003398301 | 274 |
| 416 | 3300037853 | Ga0436364_1435407 | Ga0436364_1435407_354_1178 | 274 |
| 417 | 3300044684 | Ga0466966_0101801 | Ga0466966_0101801_302_1126 | 274 |
| 418 | 3300045976 | Ga0466967_0318253 | Ga0466967_0318253_250_1086 | 274 |
| 419 | 3300047320 | Ga0495672_0087428 | Ga0495672_0087428_528_1364 | 274 |
| 420 | 3300050511 | nmdc:mga08y16_205421_c1 | nmdc:mga08y16_205421_c1_1003_1839 | 274 |
| 421 | 3300059647 | Ga0587079_015253 | Ga0587079_015253_13_846 | 274 |
| 422 | iso_pu_bacteria | 2675903059 | 2676485342 | 274 |
| 423 | iso_pu_bacteria | 2738541264 | 2738669308 | 274 |
| 424 | iso_pu_bacteria | 2738541274 | 2738706554 | 274 |
| 425 | iso_pu_bacteria | 2738541356 | 2739147716 | 274 |
| 426 | iso_pu_bacteria | 2738543028 | 2739333173 | 274 |
| 427 | iso_pu_bacteria | 2902799365 | 2902799961 | 274 |
| 428 | iso_pu_bacteria | 8003856774 | 8003856852 | 274 |
| 429 | 3300003373 | JGI25407J50210_10016954 | JGI25407J50210_100169542 | 275 |
| 430 | 3300005367 | Ga0070667_100091206 | Ga0070667_1000912062 | 275 |
| 431 | 3300005436 | Ga0070713_100436686 | Ga0070713_1004366861 | 275 |
| 432 | 3300005563 | Ga0068855_100340163 | Ga0068855_1003401632 | 275 |
| 433 | 3300005719 | Ga0068861_100156491 | Ga0068861_1001564912 | 275 |
| 434 | 3300005842 | Ga0068858_100000014 | Ga0068858_10000001473 | 275 |
| 435 | 3300005937 | Ga0081455_10020131 | Ga0081455_100201314 | 275 |
| 436 | 3300005981 | Ga0081538_10007779 | Ga0081538_100077794 | 275 |
| 437 | 3300006028 | Ga0070717_10074143 | Ga0070717_100741433 | 275 |
| 438 | 3300006847 | Ga0075431_100275306 | Ga0075431_1002753062 | 275 |
| 439 | 3300006880 | Ga0075429_100189876 | Ga0075429_1001898762 | 275 |
| 440 | 3300009101 | Ga0105247_10000864 | Ga0105247_1000086412 | 275 |
| 441 | 3300009553 | Ga0105249_10113955 | Ga0105249_101139552 | 275 |
| 442 | 3300011119 | Ga0105246_10134630 | Ga0105246_101346302 | 275 |
| 443 | 3300014968 | Ga0157379_10000701 | Ga0157379_1000070110 | 275 |
| 444 | 3300020069 | Ga0197907_10164538 | Ga0197907_101645383 | 275 |
| 445 | 3300020075 | Ga0206349_1441571 | Ga0206349_14415713 | 275 |
| 446 | 3300020076 | Ga0206355_1590120 | Ga0206355_15901202 | 275 |
| 447 | 3300020077 | Ga0206351_10342753 | Ga0206351_103427533 | 275 |
| 448 | 3300020080 | Ga0206350_10364331 | Ga0206350_103643313 | 275 |
| 449 | 3300020610 | Ga0154015_1356031 | Ga0154015_13560312 | 275 |
| 450 | 3300021388 | Ga0213875_10001331 | Ga0213875_100013318 | 275 |
| 451 | 3300022467 | Ga0224712_10001641 | Ga0224712_100016413 | 275 |
| 452 | 3300025900 | Ga0207710_10000035 | Ga0207710_10000035122 | 275 |
| 453 | 3300025904 | Ga0207647_10082320 | Ga0207647_100823202 | 275 |
| 454 | 3300025909 | Ga0207705_10053803 | Ga0207705_100538032 | 275 |
| 455 | 3300025928 | Ga0207700_10021743 | Ga0207700_100217432 | 275 |
| 456 | 3300025929 | Ga0207664_10119237 | Ga0207664_101192373 | 275 |
| 457 | 3300025949 | Ga0207667_10185357 | Ga0207667_101853572 | 275 |
| 458 | 3300025986 | Ga0207658_10042675 | Ga0207658_100426753 | 275 |
| 459 | 3300026035 | Ga0207703_10000005 | Ga0207703_10000005107 | 275 |
| 460 | 3300031548 | Ga0307408_100098885 | Ga0307408_1000988852 | 275 |
| 461 | 3300031730 | Ga0307516_10023699 | Ga0307516_100236996 | 275 |
| 462 | 3300031852 | Ga0307410_10252171 | Ga0307410_102521712 | 275 |
| 463 | 3300031901 | Ga0307406_10024588 | Ga0307406_100245883 | 275 |
| 464 | 3300031995 | Ga0307409_100004802 | Ga0307409_1000048026 | 275 |
| 465 | 3300032002 | Ga0307416_100048291 | Ga0307416_1000482913 | 275 |
| 466 | 3300032005 | Ga0307411_10013884 | Ga0307411_100138843 | 275 |
| 467 | 3300032126 | Ga0307415_100242563 | Ga0307415_1002425632 | 275 |
| 468 | 3300037471 | Ga0395905_0124577 | Ga0395905_0124577_275_1105 | 275 |
| 469 | 3300037853 | Ga0436364_0423427 | Ga0436364_0423427_18549_19439 | 275 |
| 470 | 3300042005 | Ga0439448_0000544 | Ga0439448_0000544_4009_4839 | 275 |
| 471 | 3300042009 | Ga0439451_014983 | Ga0439451_014983_238_1068 | 275 |
| 472 | 3300042013 | Ga0439456_002526 | Ga0439456_002526_2445_3275 | 275 |
| 473 | 3300042016 | Ga0439463_001659 | Ga0439463_001659_287_1117 | 275 |
| 474 | 3300042139 | Ga0450904_002255 | Ga0450904_002255_399_1229 | 275 |
| 475 | 3300042437 | Ga0439444_0004278 | Ga0439444_0004278_966_1796 | 275 |
| 476 | 3300042439 | Ga0439464_0002713 | Ga0439464_0002713_94_924 | 275 |
| 477 | 3300042461 | Ga0439460_0002006 | Ga0439460_0002006_1975_2805 | 275 |
| 478 | 3300042993 | Ga0439440_0003695 | Ga0439440_0003695_395_1225 | 275 |
| 479 | 3300042993 | Ga0439440_0009200 | Ga0439440_0009200_155_985 | 275 |
| 480 | 3300044656 | Ga0466969_0039913 | Ga0466969_0039913_15_842 | 275 |
| 481 | 3300044684 | Ga0466966_0005219 | Ga0466966_0005219_7343_8170 | 275 |
| 482 | 3300044693 | Ga0466961_0031454 | Ga0466961_0031454_2437_3264 | 275 |
| 483 | 3300044694 | Ga0466963_0045022 | Ga0466963_0045022_1616_2446 | 275 |
| 484 | 3300044735 | Ga0466968_0002409 | Ga0466968_0002409_3053_3880 | 275 |
| 485 | 3300044765 | Ga0466970_0008763 | Ga0466970_0008763_354_1181 | 275 |
| 486 | 3300045049 | Ga0466959_0003962 | Ga0466959_0003962_8566_9393 | 275 |
| 487 | 3300045836 | Ga0466958_0009520 | Ga0466958_0009520_1675_2505 | 275 |
| 488 | 3300045836 | Ga0466958_0014730 | Ga0466958_0014730_3578_4405 | 275 |
| 489 | 3300046524 | Ga0495648_0035570 | Ga0495648_0035570_119_1048 | 275 |
| 490 | 3300048924 | Ga0496121_0014730 | Ga0496121_0014730_6132_7025 | 275 |
| 491 | 3300048929 | Ga0496126_0231508 | Ga0496126_0231508_57_896 | 275 |
| 492 | 3300048929 | Ga0496126_0409036 | Ga0496126_0409036_30_926 | 275 |
| 493 | 3300053143 | Ga0500579_066362 | Ga0500579_066362_938_1777 | 275 |
| 494 | 3300059491 | Ga0587070_006734 | Ga0587070_006734_575_1405 | 275 |
| 495 | 3300059493 | Ga0587077_013365 | Ga0587077_013365_356_1186 | 275 |
| 496 | 3300059493 | Ga0587077_024498 | Ga0587077_024498_254_1084 | 275 |
| 497 | 3300059508 | Ga0587088_002262 | Ga0587088_002262_397_1287 | 275 |
| 498 | 3300059639 | Ga0587062_002692 | Ga0587062_002692_405_1295 | 275 |
| 499 | 3300059649 | Ga0587102_004451 | Ga0587102_004451_38_928 | 275 |
| 500 | 3300059655 | Ga0587114_009621 | Ga0587114_009621_65_955 | 275 |
| 501 | 3300061719 | Ga0466962_0101147 | Ga0466962_0101147_299_1129 | 275 |
| 502 | 3300061719 | Ga0466962_0151173 | Ga0466962_0151173_77_907 | 275 |
| 503 | iso_pu_bacteria | 2929219909 | 2929224380 | 275 |
| 504 | 3300004800 | Ga0058861_10086516 | Ga0058861_100865162 | 276 |
| 505 | 3300004800 | Ga0058861_11829308 | Ga0058861_118293082 | 276 |
| 506 | 3300005329 | Ga0070683_100052814 | Ga0070683_1000528143 | 276 |
| 507 | 3300005329 | Ga0070683_100535648 | Ga0070683_1005356481 | 276 |
| 508 | 3300005334 | Ga0068869_100017957 | Ga0068869_1000179572 | 276 |
| 509 | 3300005336 | Ga0070680_100086833 | Ga0070680_1000868332 | 276 |
| 510 | 3300005338 | Ga0068868_100003817 | Ga0068868_1000038178 | 276 |
| 511 | 3300005338 | Ga0068868_100592220 | Ga0068868_1005922201 | 276 |
| 512 | 3300005344 | Ga0070661_100014688 | Ga0070661_1000146882 | 276 |
| 513 | 3300005345 | Ga0070692_10035997 | Ga0070692_100359972 | 276 |
| 514 | 3300005347 | Ga0070668_100003728 | Ga0070668_10000372811 | 276 |
| 515 | 3300005353 | Ga0070669_100158882 | Ga0070669_1001588822 | 276 |
| 516 | 3300005354 | Ga0070675_100002879 | Ga0070675_1000028793 | 276 |
| 517 | 3300005364 | Ga0070673_100442063 | Ga0070673_1004420632 | 276 |
| 518 | 3300005366 | Ga0070659_100018803 | Ga0070659_1000188031 | 276 |
| 519 | 3300005367 | Ga0070667_100020043 | Ga0070667_1000200432 | 276 |
| 520 | 3300005441 | Ga0070700_100112453 | Ga0070700_1001124532 | 276 |
| 521 | 3300005456 | Ga0070678_100125947 | Ga0070678_1001259472 | 276 |
| 522 | 3300005457 | Ga0070662_100106712 | Ga0070662_1001067123 | 276 |
| 523 | 3300005459 | Ga0068867_100329808 | Ga0068867_1003298082 | 276 |
| 524 | 3300005530 | Ga0070679_100069137 | Ga0070679_1000691373 | 276 |
| 525 | 3300005535 | Ga0070684_100006940 | Ga0070684_1000069406 | 276 |
| 526 | 3300005543 | Ga0070672_100259579 | Ga0070672_1002595792 | 276 |
| 527 | 3300005548 | Ga0070665_100209382 | Ga0070665_1002093822 | 276 |
| 528 | 3300005564 | Ga0070664_100000709 | Ga0070664_10000070919 | 276 |
| 529 | 3300005577 | Ga0068857_100018243 | Ga0068857_1000182432 | 276 |
| 530 | 3300005578 | Ga0068854_100076440 | Ga0068854_1000764402 | 276 |
| 531 | 3300005616 | Ga0068852_100046213 | Ga0068852_1000462133 | 276 |
| 532 | 3300005719 | Ga0068861_100019822 | Ga0068861_1000198226 | 276 |
| 533 | 3300005842 | Ga0068858_100209104 | Ga0068858_1002091042 | 276 |
| 534 | 3300005844 | Ga0068862_100072262 | Ga0068862_1000722623 | 276 |
| 535 | 3300005981 | Ga0081538_10007006 | Ga0081538_100070066 | 276 |
| 536 | 3300005985 | Ga0081539_10000424 | Ga0081539_1000042466 | 276 |
| 537 | 3300005985 | Ga0081539_10002011 | Ga0081539_1000201115 | 276 |
| 538 | 3300005985 | Ga0081539_10010650 | Ga0081539_100106507 | 276 |
| 539 | 3300006058 | Ga0075432_10067546 | Ga0075432_100675462 | 276 |
| 540 | 3300006237 | Ga0097621_100550660 | Ga0097621_1005506602 | 276 |
| 541 | 3300009094 | Ga0111539_10001616 | Ga0111539_100016163 | 276 |
| 542 | 3300009094 | Ga0111539_10458410 | Ga0111539_104584102 | 276 |
| 543 | 3300009098 | Ga0105245_10084748 | Ga0105245_100847483 | 276 |
| 544 | 3300009148 | Ga0105243_10566692 | Ga0105243_105666922 | 276 |
| 545 | 3300009551 | Ga0105238_10345085 | Ga0105238_103450852 | 276 |
| 546 | 3300009553 | Ga0105249_10634440 | Ga0105249_106344402 | 276 |
| 547 | 3300010375 | Ga0105239_10367611 | Ga0105239_103676112 | 276 |
| 548 | 3300011119 | Ga0105246_10364338 | Ga0105246_103643382 | 276 |
| 549 | 3300013104 | Ga0157370_10285810 | Ga0157370_102858102 | 276 |
| 550 | 3300014497 | Ga0182008_10162084 | Ga0182008_101620841 | 276 |
| 551 | 3300014745 | Ga0157377_10060232 | Ga0157377_100602322 | 276 |
| 552 | 3300020070 | Ga0206356_10784647 | Ga0206356_107846472 | 276 |
| 553 | 3300020078 | Ga0206352_10462433 | Ga0206352_104624332 | 276 |
| 554 | 3300020078 | Ga0206352_10839311 | Ga0206352_108393112 | 276 |
| 555 | 3300020080 | Ga0206350_11454667 | Ga0206350_114546672 | 276 |
| 556 | 3300020082 | Ga0206353_10025707 | Ga0206353_100257072 | 276 |
| 557 | 3300020082 | Ga0206353_10985316 | Ga0206353_109853162 | 276 |
| 558 | 3300020610 | Ga0154015_1204111 | Ga0154015_12041112 | 276 |
| 559 | 3300020610 | Ga0154015_1334133 | Ga0154015_13341332 | 276 |
| 560 | 3300022467 | Ga0224712_10004633 | Ga0224712_100046333 | 276 |
| 561 | 3300025908 | Ga0207643_10162419 | Ga0207643_101624192 | 276 |
| 562 | 3300025912 | Ga0207707_10090182 | Ga0207707_100901822 | 276 |
| 563 | 3300025918 | Ga0207662_10097511 | Ga0207662_100975112 | 276 |
| 564 | 3300025919 | Ga0207657_10034090 | Ga0207657_100340903 | 276 |
| 565 | 3300025920 | Ga0207649_10031520 | Ga0207649_100315202 | 276 |
| 566 | 3300025921 | Ga0207652_10314055 | Ga0207652_103140552 | 276 |
| 567 | 3300025923 | Ga0207681_10217496 | Ga0207681_102174962 | 276 |
| 568 | 3300025924 | Ga0207694_10245281 | Ga0207694_102452812 | 276 |
| 569 | 3300025926 | Ga0207659_10010045 | Ga0207659_100100454 | 276 |
| 570 | 3300025927 | Ga0207687_10123981 | Ga0207687_101239812 | 276 |
| 571 | 3300025932 | Ga0207690_10034524 | Ga0207690_100345242 | 276 |
| 572 | 3300025933 | Ga0207706_10129417 | Ga0207706_101294172 | 276 |
| 573 | 3300025933 | Ga0207706_10422822 | Ga0207706_104228222 | 276 |
| 574 | 3300025935 | Ga0207709_10132174 | Ga0207709_101321742 | 276 |
| 575 | 3300025937 | Ga0207669_10148192 | Ga0207669_101481922 | 276 |
| 576 | 3300025939 | Ga0207665_10038269 | Ga0207665_100382692 | 276 |
| 577 | 3300025940 | Ga0207691_10335222 | Ga0207691_103352222 | 276 |
| 578 | 3300025942 | Ga0207689_10002494 | Ga0207689_100024944 | 276 |
| 579 | 3300025944 | Ga0207661_10042838 | Ga0207661_100428383 | 276 |
| 580 | 3300025944 | Ga0207661_10250697 | Ga0207661_102506972 | 276 |
| 581 | 3300025945 | Ga0207679_10051683 | Ga0207679_100516833 | 276 |
| 582 | 3300025972 | Ga0207668_10000408 | Ga0207668_1000040816 | 276 |
| 583 | 3300025972 | Ga0207668_10014418 | Ga0207668_100144182 | 276 |
| 584 | 3300025986 | Ga0207658_10292970 | Ga0207658_102929702 | 276 |
| 585 | 3300026023 | Ga0207677_10006496 | Ga0207677_100064962 | 276 |
| 586 | 3300026035 | Ga0207703_10082485 | Ga0207703_100824854 | 276 |
| 587 | 3300026067 | Ga0207678_10019979 | Ga0207678_100199792 | 276 |
| 588 | 3300026067 | Ga0207678_10027774 | Ga0207678_100277742 | 276 |
| 589 | 3300026067 | Ga0207678_10128426 | Ga0207678_101284262 | 276 |
| 590 | 3300026075 | Ga0207708_10012670 | Ga0207708_100126706 | 276 |
| 591 | 3300026089 | Ga0207648_10210479 | Ga0207648_102104792 | 276 |
| 592 | 3300026095 | Ga0207676_10311038 | Ga0207676_103110382 | 276 |
| 593 | 3300026116 | Ga0207674_10005413 | Ga0207674_100054136 | 276 |
| 594 | 3300026116 | Ga0207674_10086919 | Ga0207674_100869192 | 276 |
| 595 | 3300026118 | Ga0207675_100122167 | Ga0207675_1001221672 | 276 |
| 596 | 3300026121 | Ga0207683_10238610 | Ga0207683_102386101 | 276 |
| 597 | 3300026121 | Ga0207683_10275097 | Ga0207683_102750972 | 276 |
| 598 | 3300026142 | Ga0207698_10030924 | Ga0207698_100309242 | 276 |
| 599 | 3300026142 | Ga0207698_10586865 | Ga0207698_105868652 | 276 |
| 600 | 3300027907 | Ga0207428_10018411 | Ga0207428_100184112 | 276 |
| 601 | 3300028380 | Ga0268265_10031124 | Ga0268265_100311243 | 276 |
| 602 | 3300028380 | Ga0268265_10145402 | Ga0268265_101454022 | 276 |
| 603 | 3300028381 | Ga0268264_10070656 | Ga0268264_100706564 | 276 |
| 604 | 3300028794 | Ga0307515_10000883 | Ga0307515_1000088315 | 276 |
| 605 | 3300031649 | Ga0307514_10007338 | Ga0307514_100073384 | 276 |
| 606 | 3300031730 | Ga0307516_10005181 | Ga0307516_1000518117 | 276 |
| 607 | 3300031730 | Ga0307516_10007141 | Ga0307516_1000714110 | 276 |
| 608 | 3300031824 | Ga0307413_10310879 | Ga0307413_103108792 | 276 |
| 609 | 3300031889 | Ga0326468_10001396 | Ga0326468_100013961 | 276 |
| 610 | 3300031901 | Ga0307406_10208689 | Ga0307406_102086892 | 276 |
| 611 | 3300031995 | Ga0307409_100179070 | Ga0307409_1001790702 | 276 |
| 612 | 3300032002 | Ga0307416_100195112 | Ga0307416_1001951122 | 276 |
| 613 | 3300032004 | Ga0307414_10186247 | Ga0307414_101862472 | 276 |
| 614 | 3300032126 | Ga0307415_100042696 | Ga0307415_1000426963 | 276 |
| 615 | 3300032126 | Ga0307415_100100587 | Ga0307415_1001005872 | 276 |
| 616 | 3300033179 | Ga0307507_10019583 | Ga0307507_100195832 | 276 |
| 617 | 3300035112 | Ga0373932_0103668 | Ga0373932_0103668_73_906 | 276 |
| 618 | 3300035692 | Ga0373935_0017067 | Ga0373935_0017067_2134_2967 | 276 |
| 619 | 3300044694 | Ga0466963_0087432 | Ga0466963_0087432_342_1232 | 276 |
| 620 | 3300044765 | Ga0466970_0304445 | Ga0466970_0304445_30_863 | 276 |
| 621 | 3300045976 | Ga0466967_0272725 | Ga0466967_0272725_671_1561 | 276 |
| 622 | 3300048929 | Ga0496126_0070611 | Ga0496126_0070611_1192_2079 | 276 |
| 623 | 3300050511 | nmdc:mga08y16_443365_c1 | nmdc:mga08y16_443365_c1_173_1006 | 276 |
| 624 | 3300050511 | nmdc:mga08y16_56429_c1 | nmdc:mga08y16_56429_c1_121_954 | 276 |
| 625 | 3300059477 | Ga0587084_001810 | Ga0587084_001810_44_877 | 276 |
| 626 | 3300059492 | Ga0587073_0008309 | Ga0587073_0008309_688_1521 | 276 |
| 627 | 3300059492 | Ga0587073_0010568 | Ga0587073_0010568_147_980 | 276 |
| 628 | 3300059492 | Ga0587073_0013845 | Ga0587073_0013845_426_1259 | 276 |
| 629 | 3300059503 | Ga0587080_011864 | Ga0587080_011864_148_981 | 276 |
| 630 | 3300059504 | Ga0587082_005904 | Ga0587082_005904_52_885 | 276 |
| 631 | 3300059504 | Ga0587082_010618 | Ga0587082_010618_59_892 | 276 |
| 632 | 3300059505 | Ga0587083_0010943 | Ga0587083_0010943_86_919 | 276 |
| 633 | 3300059506 | Ga0587085_025560 | Ga0587085_025560_13_846 | 276 |
| 634 | 3300059507 | Ga0587086_003814 | Ga0587086_003814_73_906 | 276 |
| 635 | 3300059510 | Ga0587090_003745 | Ga0587090_003745_133_1023 | 276 |
| 636 | 3300059511 | Ga0587091_007502 | Ga0587091_007502_10_843 | 276 |
| 637 | 3300059512 | Ga0587092_001127 | Ga0587092_001127_696_1529 | 276 |
| 638 | 3300059512 | Ga0587092_026856 | Ga0587092_026856_41_874 | 276 |
| 639 | 3300059605 | Ga0587106_012546 | Ga0587106_012546_31_921 | 276 |
| 640 | 3300059642 | Ga0587069_003210 | Ga0587069_003210_659_1492 | 276 |
| 641 | 3300059642 | Ga0587069_006862 | Ga0587069_006862_534_1367 | 276 |
| 642 | 3300059643 | Ga0587072_002898 | Ga0587072_002898_656_1546 | 276 |
| 643 | 3300059643 | Ga0587072_017759 | Ga0587072_017759_315_1148 | 276 |
| 644 | 3300059644 | Ga0587075_001707 | Ga0587075_001707_247_1080 | 276 |
| 645 | 3300059645 | Ga0587076_024948 | Ga0587076_024948_11_844 | 276 |
| 646 | 3300059647 | Ga0587079_001388 | Ga0587079_001388_73_906 | 276 |
| 647 | 3300059647 | Ga0587079_002060 | Ga0587079_002060_398_1231 | 276 |
| 648 | 3300059647 | Ga0587079_028021 | Ga0587079_028021_102_935 | 276 |
| 649 | 3300059652 | Ga0587107_003893 | Ga0587107_003893_438_1271 | 276 |
| 650 | 3300059654 | Ga0587110_005765 | Ga0587110_005765_55_945 | 276 |
| 651 | 3300059655 | Ga0587114_000619 | Ga0587114_000619_835_1722 | 276 |
| 652 | 3300059658 | Ga0587119_004446 | Ga0587119_004446_423_1313 | 276 |
| 653 | 3300060344 | Ga0587071_011764 | Ga0587071_011764_620_1453 | 276 |
| 654 | 3300060346 | Ga0587111_0013723 | Ga0587111_0013723_394_1284 | 276 |
| 655 | 3300060346 | Ga0587111_0014910 | Ga0587111_0014910_147_980 | 276 |
| 656 | 3300060346 | Ga0587111_0038637 | Ga0587111_0038637_136_969 | 276 |
| 657 | 3300005436 | Ga0070713_100341387 | Ga0070713_1003413872 | 277 |
| 658 | 3300006038 | Ga0075365_10009152 | Ga0075365_100091525 | 277 |
| 659 | 3300006048 | Ga0075363_100000960 | Ga0075363_1000009604 | 277 |
| 660 | 3300006051 | Ga0075364_10051397 | Ga0075364_100513972 | 277 |
| 661 | 3300006186 | Ga0075369_10058207 | Ga0075369_100582072 | 277 |
| 662 | 3300025904 | Ga0207647_10135487 | Ga0207647_101354872 | 277 |
| 663 | 3300026078 | Ga0207702_10082105 | Ga0207702_100821053 | 277 |
| 664 | 3300039437 | Ga0436365_1544123 | Ga0436365_1544123_7006_7902 | 277 |
| 665 | 3300050490 | nmdc:mga03n38_36974_c1 | nmdc:mga03n38_36974_c1_536_1369 | 277 |
| 666 | 3300050492 | nmdc:mga0yw44_96066_c1 | nmdc:mga0yw44_96066_c1_59_892 | 277 |
| 667 | 3300050494 | nmdc:mga06z11_185690_c1 | nmdc:mga06z11_185690_c1_58_891 | 277 |
| 668 | 3300050495 | nmdc:mga04h51_5144_c1 | nmdc:mga04h51_5144_c1_1883_2716 | 277 |
| 669 | 3300050516 | nmdc:mga0sz30_41671_c1 | nmdc:mga0sz30_41671_c1_655_1488 | 277 |
| 670 | 3300000546 | LJNas_1001603 | LJNas_10016033 | 278 |
| 671 | 3300001977 | JGI24746J21847_1001314 | JGI24746J21847_10013141 | 278 |
| 672 | 3300001978 | JGI24747J21853_1002149 | JGI24747J21853_10021492 | 278 |
| 673 | 3300002067 | JGI24735J21928_10058516 | JGI24735J21928_100585161 | 278 |
| 674 | 3300002073 | JGI24745J21846_1005536 | JGI24745J21846_10055362 | 278 |
| 675 | 3300002076 | JGI24749J21850_1004653 | JGI24749J21850_10046532 | 278 |
| 676 | 3300002077 | JGI24744J21845_10004230 | JGI24744J21845_100042301 | 278 |
| 677 | 3300002077 | JGI24744J21845_10016379 | JGI24744J21845_100163791 | 278 |
| 678 | 3300002239 | JGI24034J26672_10001767 | JGI24034J26672_100017672 | 278 |
| 679 | 3300002239 | JGI24034J26672_10014301 | JGI24034J26672_100143012 | 278 |
| 680 | 3300002244 | JGI24742J22300_10005722 | JGI24742J22300_100057221 | 278 |
| 681 | 3300003792 | Ga0055540_1000052 | Ga0055540_100005214 | 278 |
| 682 | 3300005328 | Ga0070676_10010720 | Ga0070676_100107206 | 278 |
| 683 | 3300005330 | Ga0070690_100062101 | Ga0070690_1000621012 | 278 |
| 684 | 3300005334 | Ga0068869_100161527 | Ga0068869_1001615272 | 278 |
| 685 | 3300005335 | Ga0070666_10047885 | Ga0070666_100478852 | 278 |
| 686 | 3300005337 | Ga0070682_100101197 | Ga0070682_1001011972 | 278 |
| 687 | 3300005338 | Ga0068868_100001568 | Ga0068868_10000156813 | 278 |
| 688 | 3300005340 | Ga0070689_100020006 | Ga0070689_1000200065 | 278 |
| 689 | 3300005341 | Ga0070691_10002308 | Ga0070691_100023087 | 278 |
| 690 | 3300005343 | Ga0070687_100041581 | Ga0070687_1000415812 | 278 |
| 691 | 3300005347 | Ga0070668_100002116 | Ga0070668_10000211611 | 278 |
| 692 | 3300005353 | Ga0070669_100043351 | Ga0070669_1000433513 | 278 |
| 693 | 3300005354 | Ga0070675_100468630 | Ga0070675_1004686302 | 278 |
| 694 | 3300005356 | Ga0070674_100002080 | Ga0070674_1000020805 | 278 |
| 695 | 3300005356 | Ga0070674_100285704 | Ga0070674_1002857042 | 278 |
| 696 | 3300005364 | Ga0070673_100175871 | Ga0070673_1001758712 | 278 |
| 697 | 3300005366 | Ga0070659_100007023 | Ga0070659_1000070233 | 278 |
| 698 | 3300005367 | Ga0070667_100014491 | Ga0070667_1000144914 | 278 |
| 699 | 3300005367 | Ga0070667_100646209 | Ga0070667_1006462091 | 278 |
| 700 | 3300005435 | Ga0070714_100083352 | Ga0070714_1000833522 | 278 |
| 701 | 3300005437 | Ga0070710_10001629 | Ga0070710_100016295 | 278 |
| 702 | 3300005437 | Ga0070710_10085938 | Ga0070710_100859382 | 278 |
| 703 | 3300005438 | Ga0070701_10000238 | Ga0070701_1000023813 | 278 |
| 704 | 3300005439 | Ga0070711_100000410 | Ga0070711_10000041020 | 278 |
| 705 | 3300005439 | Ga0070711_100007257 | Ga0070711_1000072573 | 278 |
| 706 | 3300005441 | Ga0070700_100051409 | Ga0070700_1000514093 | 278 |
| 707 | 3300005444 | Ga0070694_100044717 | Ga0070694_1000447172 | 278 |
| 708 | 3300005456 | Ga0070678_100036033 | Ga0070678_1000360332 | 278 |
| 709 | 3300005456 | Ga0070678_100078483 | Ga0070678_1000784831 | 278 |
| 710 | 3300005457 | Ga0070662_100062646 | Ga0070662_1000626462 | 278 |
| 711 | 3300005459 | Ga0068867_100040433 | Ga0068867_1000404333 | 278 |
| 712 | 3300005459 | Ga0068867_100406644 | Ga0068867_1004066442 | 278 |
| 713 | 3300005536 | Ga0070697_100218563 | Ga0070697_1002185632 | 278 |
| 714 | 3300005545 | Ga0070695_100018514 | Ga0070695_1000185144 | 278 |
| 715 | 3300005547 | Ga0070693_100009709 | Ga0070693_1000097092 | 278 |
| 716 | 3300005547 | Ga0070693_100058231 | Ga0070693_1000582313 | 278 |
| 717 | 3300005548 | Ga0070665_100042854 | Ga0070665_1000428544 | 278 |
| 718 | 3300005548 | Ga0070665_100244513 | Ga0070665_1002445132 | 278 |
| 719 | 3300005549 | Ga0070704_100000737 | Ga0070704_1000007374 | 278 |
| 720 | 3300005563 | Ga0068855_100392201 | Ga0068855_1003922012 | 278 |
| 721 | 3300005615 | Ga0070702_100008329 | Ga0070702_1000083295 | 278 |
| 722 | 3300005615 | Ga0070702_100039920 | Ga0070702_1000399202 | 278 |
| 723 | 3300005616 | Ga0068852_100624212 | Ga0068852_1006242121 | 278 |
| 724 | 3300005617 | Ga0068859_100002049 | Ga0068859_10000204910 | 278 |
| 725 | 3300005617 | Ga0068859_100501126 | Ga0068859_1005011262 | 278 |
| 726 | 3300005618 | Ga0068864_100362156 | Ga0068864_1003621562 | 278 |
| 727 | 3300005718 | Ga0068866_10000579 | Ga0068866_100005795 | 278 |
| 728 | 3300005718 | Ga0068866_10023252 | Ga0068866_100232522 | 278 |
| 729 | 3300005719 | Ga0068861_100000671 | Ga0068861_10000067114 | 278 |
| 730 | 3300005719 | Ga0068861_100429810 | Ga0068861_1004298102 | 278 |
| 731 | 3300005840 | Ga0068870_10095922 | Ga0068870_100959222 | 278 |
| 732 | 3300005841 | Ga0068863_100000833 | Ga0068863_1000008338 | 278 |
| 733 | 3300005842 | Ga0068858_100009472 | Ga0068858_1000094725 | 278 |
| 734 | 3300005842 | Ga0068858_100223656 | Ga0068858_1002236562 | 278 |
| 735 | 3300005842 | Ga0068858_100272920 | Ga0068858_1002729202 | 278 |
| 736 | 3300005843 | Ga0068860_100000174 | Ga0068860_10000017426 | 278 |
| 737 | 3300005843 | Ga0068860_100001236 | Ga0068860_10000123619 | 278 |
| 738 | 3300005843 | Ga0068860_100209743 | Ga0068860_1002097432 | 278 |
| 739 | 3300005844 | Ga0068862_100000019 | Ga0068862_100000019193 | 278 |
| 740 | 3300005844 | Ga0068862_100008993 | Ga0068862_1000089936 | 278 |
| 741 | 3300005844 | Ga0068862_100162505 | Ga0068862_1001625053 | 278 |
| 742 | 3300005983 | Ga0081540_1058775 | Ga0081540_10587752 | 278 |
| 743 | 3300006038 | Ga0075365_10162947 | Ga0075365_101629471 | 278 |
| 744 | 3300006048 | Ga0075363_100001005 | Ga0075363_1000010057 | 278 |
| 745 | 3300006048 | Ga0075363_100116335 | Ga0075363_1001163351 | 278 |
| 746 | 3300006048 | Ga0075363_100165068 | Ga0075363_1001650682 | 278 |
| 747 | 3300006051 | Ga0075364_10006557 | Ga0075364_100065575 | 278 |
| 748 | 3300006051 | Ga0075364_10020556 | Ga0075364_100205564 | 278 |
| 749 | 3300006173 | Ga0070716_100008409 | Ga0070716_1000084095 | 278 |
| 750 | 3300006175 | Ga0070712_100001020 | Ga0070712_1000010203 | 278 |
| 751 | 3300006175 | Ga0070712_100064076 | Ga0070712_1000640762 | 278 |
| 752 | 3300006186 | Ga0075369_10002320 | Ga0075369_100023205 | 278 |
| 753 | 3300006186 | Ga0075369_10005620 | Ga0075369_100056203 | 278 |
| 754 | 3300006186 | Ga0075369_10018741 | Ga0075369_100187413 | 278 |
| 755 | 3300006186 | Ga0075369_10056399 | Ga0075369_100563992 | 278 |
| 756 | 3300006186 | Ga0075369_10150251 | Ga0075369_101502512 | 278 |
| 757 | 3300006237 | Ga0097621_100136590 | Ga0097621_1001365902 | 278 |
| 758 | 3300006353 | Ga0075370_10022826 | Ga0075370_100228263 | 278 |
| 759 | 3300006353 | Ga0075370_10035285 | Ga0075370_100352853 | 278 |
| 760 | 3300006353 | Ga0075370_10071153 | Ga0075370_100711532 | 278 |
| 761 | 3300006353 | Ga0075370_10212847 | Ga0075370_102128472 | 278 |
| 762 | 3300006358 | Ga0068871_100126997 | Ga0068871_1001269972 | 278 |
| 763 | 3300006881 | Ga0068865_100013059 | Ga0068865_1000130592 | 278 |
| 764 | 3300006931 | Ga0097620_100002049 | Ga0097620_10000204912 | 278 |
| 765 | 3300006931 | Ga0097620_100501108 | Ga0097620_1005011082 | 278 |
| 766 | 3300009098 | Ga0105245_10006195 | Ga0105245_1000619511 | 278 |
| 767 | 3300009098 | Ga0105245_10149004 | Ga0105245_101490042 | 278 |
| 768 | 3300009101 | Ga0105247_10000023 | Ga0105247_1000002325 | 278 |
| 769 | 3300009101 | Ga0105247_10001279 | Ga0105247_1000127913 | 278 |
| 770 | 3300009101 | Ga0105247_10208866 | Ga0105247_102088661 | 278 |
| 771 | 3300009148 | Ga0105243_10003250 | Ga0105243_1000325011 | 278 |
| 772 | 3300009174 | Ga0105241_10011583 | Ga0105241_100115836 | 278 |
| 773 | 3300009176 | Ga0105242_10003744 | Ga0105242_1000374411 | 278 |
| 774 | 3300009176 | Ga0105242_10055349 | Ga0105242_100553491 | 278 |
| 775 | 3300009177 | Ga0105248_10000557 | Ga0105248_1000055716 | 278 |
| 776 | 3300009177 | Ga0105248_10221983 | Ga0105248_102219832 | 278 |
| 777 | 3300009545 | Ga0105237_10023752 | Ga0105237_100237525 | 278 |
| 778 | 3300009545 | Ga0105237_10056472 | Ga0105237_100564723 | 278 |
| 779 | 3300009553 | Ga0105249_10000033 | Ga0105249_10000033172 | 278 |
| 780 | 3300009553 | Ga0105249_10006292 | Ga0105249_1000629210 | 278 |
| 781 | 3300009553 | Ga0105249_10639138 | Ga0105249_106391382 | 278 |
| 782 | 3300010159 | Ga0099796_10019399 | Ga0099796_100193992 | 278 |
| 783 | 3300010375 | Ga0105239_10009697 | Ga0105239_1000969710 | 278 |
| 784 | 3300011119 | Ga0105246_10094339 | Ga0105246_100943393 | 278 |
| 785 | 3300013105 | Ga0157369_10248916 | Ga0157369_102489162 | 278 |
| 786 | 3300013296 | Ga0157374_10063104 | Ga0157374_100631042 | 278 |
| 787 | 3300013296 | Ga0157374_10158206 | Ga0157374_101582062 | 278 |
| 788 | 3300013297 | Ga0157378_10008995 | Ga0157378_100089955 | 278 |
| 789 | 3300013306 | Ga0163162_10043832 | Ga0163162_100438324 | 278 |
| 790 | 3300013306 | Ga0163162_10064518 | Ga0163162_100645183 | 278 |
| 791 | 3300013306 | Ga0163162_10153933 | Ga0163162_101539332 | 278 |
| 792 | 3300013307 | Ga0157372_10530889 | Ga0157372_105308892 | 278 |
| 793 | 3300014325 | Ga0163163_10016062 | Ga0163163_100160624 | 278 |
| 794 | 3300014325 | Ga0163163_10119081 | Ga0163163_101190812 | 278 |
| 795 | 3300014326 | Ga0157380_10001016 | Ga0157380_1000101613 | 278 |
| 796 | 3300014326 | Ga0157380_10095822 | Ga0157380_100958222 | 278 |
| 797 | 3300014745 | Ga0157377_10015911 | Ga0157377_100159113 | 278 |
| 798 | 3300014968 | Ga0157379_10040777 | Ga0157379_100407772 | 278 |
| 799 | 3300014968 | Ga0157379_10800662 | Ga0157379_108006621 | 278 |
| 800 | 3300017792 | Ga0163161_10002273 | Ga0163161_100022735 | 278 |
| 801 | 3300021384 | Ga0213876_10002715 | Ga0213876_100027158 | 278 |
| 802 | 3300021388 | Ga0213875_10015787 | Ga0213875_100157873 | 278 |
| 803 | 3300025303 | Ga0209051_1000057 | Ga0209051_1000057136 | 278 |
| 804 | 3300025303 | Ga0209051_1000840 | Ga0209051_100084029 | 278 |
| 805 | 3300025885 | Ga0207653_10039748 | Ga0207653_100397482 | 278 |
| 806 | 3300025899 | Ga0207642_10000950 | Ga0207642_100009503 | 278 |
| 807 | 3300025900 | Ga0207710_10000010 | Ga0207710_10000010418 | 278 |
| 808 | 3300025900 | Ga0207710_10000027 | Ga0207710_10000027282 | 278 |
| 809 | 3300025900 | Ga0207710_10005078 | Ga0207710_100050785 | 278 |
| 810 | 3300025900 | Ga0207710_10033045 | Ga0207710_100330452 | 278 |
| 811 | 3300025901 | Ga0207688_10000298 | Ga0207688_100002989 | 278 |
| 812 | 3300025901 | Ga0207688_10001099 | Ga0207688_1000109911 | 278 |
| 813 | 3300025903 | Ga0207680_10018611 | Ga0207680_100186113 | 278 |
| 814 | 3300025904 | Ga0207647_10030802 | Ga0207647_100308023 | 278 |
| 815 | 3300025905 | Ga0207685_10040604 | Ga0207685_100406041 | 278 |
| 816 | 3300025907 | Ga0207645_10002891 | Ga0207645_100028915 | 278 |
| 817 | 3300025908 | Ga0207643_10108777 | Ga0207643_101087772 | 278 |
| 818 | 3300025911 | Ga0207654_10150448 | Ga0207654_101504481 | 278 |
| 819 | 3300025915 | Ga0207693_10009544 | Ga0207693_100095449 | 278 |
| 820 | 3300025915 | Ga0207693_10299375 | Ga0207693_102993751 | 278 |
| 821 | 3300025916 | Ga0207663_10010760 | Ga0207663_100107602 | 278 |
| 822 | 3300025916 | Ga0207663_10012044 | Ga0207663_100120443 | 278 |
| 823 | 3300025917 | Ga0207660_10128317 | Ga0207660_101283172 | 278 |
| 824 | 3300025923 | Ga0207681_10079897 | Ga0207681_100798973 | 278 |
| 825 | 3300025926 | Ga0207659_10172390 | Ga0207659_101723902 | 278 |
| 826 | 3300025927 | Ga0207687_10006588 | Ga0207687_100065885 | 278 |
| 827 | 3300025929 | Ga0207664_10240465 | Ga0207664_102404652 | 278 |
| 828 | 3300025931 | Ga0207644_10005414 | Ga0207644_100054143 | 278 |
| 829 | 3300025931 | Ga0207644_10199132 | Ga0207644_101991322 | 278 |
| 830 | 3300025933 | Ga0207706_10030955 | Ga0207706_100309551 | 278 |
| 831 | 3300025933 | Ga0207706_10331279 | Ga0207706_103312792 | 278 |
| 832 | 3300025935 | Ga0207709_10004200 | Ga0207709_100042008 | 278 |
| 833 | 3300025936 | Ga0207670_10007082 | Ga0207670_100070825 | 278 |
| 834 | 3300025937 | Ga0207669_10003926 | Ga0207669_100039265 | 278 |
| 835 | 3300025938 | Ga0207704_10000259 | Ga0207704_100002596 | 278 |
| 836 | 3300025939 | Ga0207665_10171719 | Ga0207665_101717192 | 278 |
| 837 | 3300025941 | Ga0207711_10000089 | Ga0207711_1000008979 | 278 |
| 838 | 3300025941 | Ga0207711_10006034 | Ga0207711_100060343 | 278 |
| 839 | 3300025941 | Ga0207711_10093462 | Ga0207711_100934623 | 278 |
| 840 | 3300025944 | Ga0207661_10578585 | Ga0207661_105785852 | 278 |
| 841 | 3300025949 | Ga0207667_10076811 | Ga0207667_100768112 | 278 |
| 842 | 3300025961 | Ga0207712_10000031 | Ga0207712_1000003126 | 278 |
| 843 | 3300025961 | Ga0207712_10220291 | Ga0207712_102202912 | 278 |
| 844 | 3300025972 | Ga0207668_10033738 | Ga0207668_100337382 | 278 |
| 845 | 3300025972 | Ga0207668_10289736 | Ga0207668_102897362 | 278 |
| 846 | 3300025986 | Ga0207658_10002658 | Ga0207658_100026582 | 278 |
| 847 | 3300025986 | Ga0207658_10008494 | Ga0207658_100084946 | 278 |
| 848 | 3300025986 | Ga0207658_10033165 | Ga0207658_100331653 | 278 |
| 849 | 3300026023 | Ga0207677_10023533 | Ga0207677_100235333 | 278 |
| 850 | 3300026023 | Ga0207677_10073088 | Ga0207677_100730882 | 278 |
| 851 | 3300026035 | Ga0207703_10005856 | Ga0207703_1000585610 | 278 |
| 852 | 3300026035 | Ga0207703_10012404 | Ga0207703_100124045 | 278 |
| 853 | 3300026035 | Ga0207703_10490280 | Ga0207703_104902801 | 278 |
| 854 | 3300026041 | Ga0207639_10002094 | Ga0207639_1000209411 | 278 |
| 855 | 3300026067 | Ga0207678_10010534 | Ga0207678_100105341 | 278 |
| 856 | 3300026075 | Ga0207708_10016979 | Ga0207708_100169792 | 278 |
| 857 | 3300026075 | Ga0207708_10085568 | Ga0207708_100855683 | 278 |
| 858 | 3300026088 | Ga0207641_10001166 | Ga0207641_1000116621 | 278 |
| 859 | 3300026088 | Ga0207641_10009378 | Ga0207641_100093785 | 278 |
| 860 | 3300026088 | Ga0207641_10188505 | Ga0207641_101885052 | 278 |
| 861 | 3300026089 | Ga0207648_10005843 | Ga0207648_100058431 | 278 |
| 862 | 3300026089 | Ga0207648_10053292 | Ga0207648_100532921 | 278 |
| 863 | 3300026118 | Ga0207675_100001181 | Ga0207675_10000118129 | 278 |
| 864 | 3300026121 | Ga0207683_10001691 | Ga0207683_1000169122 | 278 |
| 865 | 3300026121 | Ga0207683_10030388 | Ga0207683_100303881 | 278 |
| 866 | 3300026142 | Ga0207698_10616809 | Ga0207698_106168091 | 278 |
| 867 | 3300028379 | Ga0268266_10090810 | Ga0268266_100908102 | 278 |
| 868 | 3300028379 | Ga0268266_10124476 | Ga0268266_101244762 | 278 |
| 869 | 3300028379 | Ga0268266_10230640 | Ga0268266_102306402 | 278 |
| 870 | 3300028380 | Ga0268265_10000029 | Ga0268265_10000029190 | 278 |
| 871 | 3300028380 | Ga0268265_10023069 | Ga0268265_100230693 | 278 |
| 872 | 3300028381 | Ga0268264_10000236 | Ga0268264_1000023666 | 278 |
| 873 | 3300028381 | Ga0268264_10014360 | Ga0268264_100143603 | 278 |
| 874 | 3300028381 | Ga0268264_10211079 | Ga0268264_102110792 | 278 |
| 875 | 3300031251 | Ga0265327_10002217 | Ga0265327_1000221710 | 278 |
| 876 | 3300031731 | Ga0307405_10081833 | Ga0307405_100818332 | 278 |
| 877 | 3300031824 | Ga0307413_10010833 | Ga0307413_100108333 | 278 |
| 878 | 3300031995 | Ga0307409_100001399 | Ga0307409_1000013996 | 278 |
| 879 | 3300032126 | Ga0307415_100056453 | Ga0307415_1000564533 | 278 |
| 880 | 3300037853 | Ga0436364_0032767 | Ga0436364_0032767_890_1729 | 278 |
| 881 | 3300037853 | Ga0436364_0177961 | Ga0436364_0177961_33431_34267 | 278 |
| 882 | 3300038443 | Ga0395901_0651256 | Ga0395901_0651256_68_907 | 278 |
| 883 | 3300039437 | Ga0436365_1083994 | Ga0436365_1083994_15320_16159 | 278 |
| 884 | 3300039437 | Ga0436365_1211143 | Ga0436365_1211143_5932_6768 | 278 |
| 885 | 3300041410 | Ga0439461_0000759 | Ga0439461_0000759_3326_4165 | 278 |
| 886 | 3300041411 | Ga0439466_0001646 | Ga0439466_0001646_3777_4616 | 278 |
| 887 | 3300041411 | Ga0439466_0046696 | Ga0439466_0046696_326_1162 | 278 |
| 888 | 3300041413 | Ga0439465_0002076 | Ga0439465_0002076_1834_2673 | 278 |
| 889 | 3300042002 | Ga0439442_009028 | Ga0439442_009028_521_1360 | 278 |
| 890 | 3300042004 | Ga0439445_0008638 | Ga0439445_0008638_1266_2102 | 278 |
| 891 | 3300044658 | Ga0466972_0119010 | Ga0466972_0119010_94_933 | 278 |
| 892 | 3300044683 | Ga0466965_0042151 | Ga0466965_0042151_614_1450 | 278 |
| 893 | 3300044719 | Ga0466971_0036263 | Ga0466971_0036263_498_1337 | 278 |
| 894 | 3300044735 | Ga0466968_0105304 | Ga0466968_0105304_346_1185 | 278 |
| 895 | 3300044765 | Ga0466970_0046140 | Ga0466970_0046140_960_1799 | 278 |
| 896 | 3300044842 | Ga0466957_0042147 | Ga0466957_0042147_478_1335 | 278 |
| 897 | 3300044901 | Ga0466960_0002025 | Ga0466960_0002025_5036_5893 | 278 |
| 898 | 3300044901 | Ga0466960_0045500 | Ga0466960_0045500_1059_1895 | 278 |
| 899 | 3300045836 | Ga0466958_0032757 | Ga0466958_0032757_1736_2593 | 278 |
| 900 | 3300045976 | Ga0466967_0077041 | Ga0466967_0077041_1367_2203 | 278 |
| 901 | 3300045976 | Ga0466967_0562572 | Ga0466967_0562572_72_908 | 278 |
| 902 | 3300046460 | Ga0495638_0013732 | Ga0495638_0013732_4082_4918 | 278 |
| 903 | 3300046694 | Ga0495649_0246127 | Ga0495649_0246127_22_861 | 278 |
| 904 | 3300047320 | Ga0495672_0016422 | Ga0495672_0016422_2428_3264 | 278 |
| 905 | 3300048903 | Ga0496100_0000077 | Ga0496100_0000077_6260_7096 | 278 |
| 906 | 3300048903 | Ga0496100_0018315 | Ga0496100_0018315_3076_3912 | 278 |
| 907 | 3300048903 | Ga0496100_0029147 | Ga0496100_0029147_2113_2958 | 278 |
| 908 | 3300048903 | Ga0496100_0098789 | Ga0496100_0098789_984_1820 | 278 |
| 909 | 3300048904 | Ga0496101_0000042 | Ga0496101_0000042_115496_116332 | 278 |
| 910 | 3300048904 | Ga0496101_0004926 | Ga0496101_0004926_7537_8373 | 278 |
| 911 | 3300048904 | Ga0496101_0040473 | Ga0496101_0040473_2307_3143 | 278 |
| 912 | 3300048904 | Ga0496101_0356773 | Ga0496101_0356773_73_909 | 278 |
| 913 | 3300048905 | Ga0496102_0000205 | Ga0496102_0000205_23006_23842 | 278 |
| 914 | 3300048905 | Ga0496102_0002438 | Ga0496102_0002438_1709_2545 | 278 |
| 915 | 3300048905 | Ga0496102_0003855 | Ga0496102_0003855_8628_9464 | 278 |
| 916 | 3300048905 | Ga0496102_0032380 | Ga0496102_0032380_2005_2847 | 278 |
| 917 | 3300048905 | Ga0496102_0258876 | Ga0496102_0258876_394_1230 | 278 |
| 918 | 3300048906 | Ga0496103_0000315 | Ga0496103_0000315_13913_14749 | 278 |
| 919 | 3300048906 | Ga0496103_0000751 | Ga0496103_0000751_8298_9134 | 278 |
| 920 | 3300048906 | Ga0496103_0001957 | Ga0496103_0001957_4497_5333 | 278 |
| 921 | 3300048906 | Ga0496103_0026574 | Ga0496103_0026574_2405_3241 | 278 |
| 922 | 3300048906 | Ga0496103_0150061 | Ga0496103_0150061_459_1304 | 278 |
| 923 | 3300048907 | Ga0496104_0048840 | Ga0496104_0048840_1101_1943 | 278 |
| 924 | 3300048908 | Ga0496105_0161901 | Ga0496105_0161901_248_1090 | 278 |
| 925 | 3300048908 | Ga0496105_0240028 | Ga0496105_0240028_407_1252 | 278 |
| 926 | 3300048909 | Ga0496106_0000103 | Ga0496106_0000103_38400_39236 | 278 |
| 927 | 3300048909 | Ga0496106_0003070 | Ga0496106_0003070_3239_4075 | 278 |
| 928 | 3300048910 | Ga0496107_0000558 | Ga0496107_0000558_6714_7550 | 278 |
| 929 | 3300048910 | Ga0496107_0016029 | Ga0496107_0016029_3348_4184 | 278 |
| 930 | 3300048910 | Ga0496107_0077432 | Ga0496107_0077432_444_1280 | 278 |
| 931 | 3300048910 | Ga0496107_0086828 | Ga0496107_0086828_1301_2146 | 278 |
| 932 | 3300048911 | Ga0496108_0000916 | Ga0496108_0000916_17709_18545 | 278 |
| 933 | 3300048912 | Ga0496109_0000312 | Ga0496109_0000312_42171_43007 | 278 |
| 934 | 3300048912 | Ga0496109_0021301 | Ga0496109_0021301_725_1561 | 278 |
| 935 | 3300048912 | Ga0496109_0033108 | Ga0496109_0033108_3235_4077 | 278 |
| 936 | 3300048913 | Ga0496110_0013273 | Ga0496110_0013273_3620_4456 | 278 |
| 937 | 3300048913 | Ga0496110_0191579 | Ga0496110_0191579_911_1747 | 278 |
| 938 | 3300048914 | Ga0496111_0002512 | Ga0496111_0002512_2404_3240 | 278 |
| 939 | 3300048914 | Ga0496111_0084517 | Ga0496111_0084517_767_1603 | 278 |
| 940 | 3300048915 | Ga0496112_0040858 | Ga0496112_0040858_431_1267 | 278 |
| 941 | 3300048915 | Ga0496112_0193900 | Ga0496112_0193900_420_1256 | 278 |
| 942 | 3300048916 | Ga0496113_0068985 | Ga0496113_0068985_266_1102 | 278 |
| 943 | 3300048917 | Ga0496114_0000309 | Ga0496114_0000309_4961_5797 | 278 |
| 944 | 3300048917 | Ga0496114_0001352 | Ga0496114_0001352_15906_16742 | 278 |
| 945 | 3300048917 | Ga0496114_0152444 | Ga0496114_0152444_393_1238 | 278 |
| 946 | 3300048918 | Ga0496115_0001893 | Ga0496115_0001893_2756_3592 | 278 |
| 947 | 3300048919 | Ga0496116_0032191 | Ga0496116_0032191_1609_2445 | 278 |
| 948 | 3300048920 | Ga0496117_0000725 | Ga0496117_0000725_27942_28778 | 278 |
| 949 | 3300048921 | Ga0496118_0002778 | Ga0496118_0002778_17406_18242 | 278 |
| 950 | 3300048921 | Ga0496118_0108323 | Ga0496118_0108323_825_1661 | 278 |
| 951 | 3300048922 | Ga0496119_0001488 | Ga0496119_0001488_17014_17850 | 278 |
| 952 | 3300048923 | Ga0496120_0020465 | Ga0496120_0020465_2423_3259 | 278 |
| 953 | 3300048924 | Ga0496121_0000139 | Ga0496121_0000139_115496_116332 | 278 |
| 954 | 3300048924 | Ga0496121_0071666 | Ga0496121_0071666_925_1761 | 278 |
| 955 | 3300048925 | Ga0496122_0000149 | Ga0496122_0000149_115724_116560 | 278 |
| 956 | 3300048925 | Ga0496122_0209722 | Ga0496122_0209722_123_959 | 278 |
| 957 | 3300048926 | Ga0496123_0011118 | Ga0496123_0011118_4340_5176 | 278 |
| 958 | 3300048927 | Ga0496124_0000114 | Ga0496124_0000114_117535_118371 | 278 |
| 959 | 3300048927 | Ga0496124_0099753 | Ga0496124_0099753_1165_2001 | 278 |
| 960 | 3300048928 | Ga0496125_0000130 | Ga0496125_0000130_115496_116332 | 278 |
| 961 | 3300048928 | Ga0496125_0039006 | Ga0496125_0039006_2367_3203 | 278 |
| 962 | 3300048928 | Ga0496125_0087033 | Ga0496125_0087033_1407_2243 | 278 |
| 963 | 3300048929 | Ga0496126_0000149 | Ga0496126_0000149_46845_47681 | 278 |
| 964 | 3300048929 | Ga0496126_0014251 | Ga0496126_0014251_6026_6865 | 278 |
| 965 | 3300048929 | Ga0496126_0040663 | Ga0496126_0040663_788_1624 | 278 |
| 966 | 3300049569 | Ga0501032_0000730 | Ga0501032_0000730_22791_23642 | 278 |
| 967 | 3300049569 | Ga0501032_0027441 | Ga0501032_0027441_772_1617 | 278 |
| 968 | 3300049570 | Ga0501033_0055422 | Ga0501033_0055422_1137_1988 | 278 |
| 969 | 3300049571 | Ga0501034_0001381 | Ga0501034_0001381_10197_11048 | 278 |
| 970 | 3300049572 | Ga0501036_0038054 | Ga0501036_0038054_3151_4002 | 278 |
| 971 | 3300049572 | Ga0501036_0115889 | Ga0501036_0115889_1133_1978 | 278 |
| 972 | 3300049573 | Ga0501037_0007301 | Ga0501037_0007301_314_1165 | 278 |
| 973 | 3300049573 | Ga0501037_0009763 | Ga0501037_0009763_2080_2925 | 278 |
| 974 | 3300049574 | Ga0501038_0035146 | Ga0501038_0035146_1218_2063 | 278 |
| 975 | 3300049575 | Ga0501039_0002246 | Ga0501039_0002246_10096_10941 | 278 |
| 976 | 3300049579 | Ga0501043_0000567 | Ga0501043_0000567_10373_11218 | 278 |
| 977 | 3300049580 | Ga0501046_0001102 | Ga0501046_0001102_24521_25372 | 278 |
| 978 | 3300049581 | Ga0501047_0012357 | Ga0501047_0012357_5483_6334 | 278 |
| 979 | 3300049581 | Ga0501047_0041303 | Ga0501047_0041303_2465_3304 | 278 |
| 980 | 3300049581 | Ga0501047_0323044 | Ga0501047_0323044_328_1167 | 278 |
| 981 | 3300049582 | Ga0501048_0037170 | Ga0501048_0037170_589_1440 | 278 |
| 982 | 3300049584 | Ga0501068_0206065 | Ga0501068_0206065_286_1131 | 278 |
| 983 | 3300049585 | Ga0501069_0092886 | Ga0501069_0092886_682_1533 | 278 |
| 984 | 3300049586 | Ga0501070_0007150 | Ga0501070_0007150_1315_2166 | 278 |
| 985 | 3300049822 | Ga0501035_0000407 | Ga0501035_0000407_15117_15968 | 278 |
| 986 | 3300049822 | Ga0501035_0001095 | Ga0501035_0001095_7715_8554 | 278 |
| 987 | 3300049823 | Ga0501044_0000554 | Ga0501044_0000554_40754_41593 | 278 |
| 988 | 3300049823 | Ga0501044_0000771 | Ga0501044_0000771_7208_8059 | 278 |
| 989 | 3300049823 | Ga0501044_0036089 | Ga0501044_0036089_1003_1839 | 278 |
| 990 | 3300050489 | nmdc:mga03683_99144_c1 | nmdc:mga03683_99144_c1_280_1119 | 278 |
| 991 | 3300050490 | nmdc:mga03n38_2328_c1 | nmdc:mga03n38_2328_c1_4139_4975 | 278 |
| 992 | 3300050491 | nmdc:mga00v17_16530_c1 | nmdc:mga00v17_16530_c1_2860_3696 | 278 |
| 993 | 3300050491 | nmdc:mga00v17_33236_c1 | nmdc:mga00v17_33236_c1_1928_2764 | 278 |
| 994 | 3300050491 | nmdc:mga00v17_82760_c1 | nmdc:mga00v17_82760_c1_891_1727 | 278 |
| 995 | 3300050492 | nmdc:mga0yw44_18180_c1 | nmdc:mga0yw44_18180_c1_413_1249 | 278 |
| 996 | 3300050492 | nmdc:mga0yw44_245778_c1 | nmdc:mga0yw44_245778_c1_84_920 | 278 |
| 997 | 3300050492 | nmdc:mga0yw44_64485_c1 | nmdc:mga0yw44_64485_c1_39_875 | 278 |
| 998 | 3300050494 | nmdc:mga06z11_44352_c1 | nmdc:mga06z11_44352_c1_1250_2101 | 278 |
| 999 | 3300050496 | nmdc:mga07m45_27403_c1 | nmdc:mga07m45_27403_c1_773_1609 | 278 |
| 1000 | 3300050516 | nmdc:mga0sz30_19838_c1 | nmdc:mga0sz30_19838_c1_895_1731 | 278 |
| 1001 | 3300050516 | nmdc:mga0sz30_86992_c1 | nmdc:mga0sz30_86992_c1_354_1193 | 278 |
| 1002 | 3300053131 | Ga0500652_006864 | Ga0500652_006864_1463_2299 | 278 |
| 1003 | 3300053136 | Ga0500559_0177131 | Ga0500559_0177131_73_909 | 278 |
| 1004 | 3300053153 | Ga0500616_0006180 | Ga0500616_0006180_4811_5647 | 278 |
| 1005 | 3300053730 | Ga0500645_000027 | Ga0500645_000027_22654_23490 | 278 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
PF00528
BPD_transp_1
Binding-protein-dependent transport system inner membrane component
115
304
0.92
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7cad-assembly1.cif.gz_B | mycobacterium smegmatis sugabc complex | 0.9037 | 7 | 278 |
| 8hpn-assembly1.cif.gz_B | lpqy-sugabc in state 3 | 0.9014 | 7 | 270 |
| 7cad-assembly1.cif.gz_B | mycobacterium smegmatis sugabc complex | 0.8975 | 7 | 278 |
| 8ja7-assembly1.cif.gz_B | cryo-em structure of mycobacterium tuberculosis lpqy-sugabc in complex with trehalose | 0.8953 | 7 | 276 |
| 8hpn-assembly1.cif.gz_B | lpqy-sugabc in state 3 | 0.8951 | 7 | 270 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WG01_5_265_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9461 | 10 | 268 | 1.10.3720.10 |
| af_P9WG01_5_265_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9357 | 10 | 268 | 1.10.3720.10 |
| af_Q2G1E7_1_266_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8897 | 1 | 264 | 1.10.3720.10 |
| af_O53483_6_271_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8841 | 1 | 268 | 1.10.3720.10 |
| af_P77716_1_267_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8835 | 1 | 264 | 1.10.3720.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3R8P5L0-F1-model_v4 | Carbohydrate ABC transporter permease | 0.9625 | 11 | 278 |
GO:0005886
GO:0055085 |
| AF-A0A2G5II45-F1-model_v4 | Sugar ABC transporter permease | 0.9503 | 17 | 274 |
GO:0005886
GO:0055085 |
| AF-A0A1Q7BRX3-F1-model_v4 | Sugar ABC transporter permease | 0.9496 | 10 | 276 |
GO:0005886
GO:0055085 |
| AF-Q49977-F1-model_v4 | Malg | 0.9494 | 7 | 278 |
GO:0005886
GO:0055085 |
| AF-A0A3R8P5L0-F1-model_v4 | Carbohydrate ABC transporter permease | 0.9487 | 11 | 278 |
GO:0005886
GO:0055085 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar