F487937

General Info

Members Datasets Scaffolds Average Seq Length
1003 468 939 239

Family's Representative Sequence

Representative Sequence 3300035724|Ga0373933_0002711|Ga0373933_0002711_2419_3354
Length 280
Sequence MIKSYDEELRRLNNTITEMGGLAESQLATAIEAVNERDSDLAASVVEADVAVDQLQHELDNFAVRLLALRQPVGSDLRGIFAAVKIGSDLERICDYAANIAKRSIALNQAPPVQPIHALTRMARQAQLLVKDVIDAYVERDAEKAYDVWMRDEELDEMYASLFRVLLTYMMEDPRNIGPSTHLLFMAKNIERIGDHATNIAEDLYYLVHGTPLVQKRPKGDDTSLQAAQAVARHCAARLDAAARLRHRGLPADSPHAADPHFTRGHADGPWRRSRPGARA

Samples

Sample ID Description Type Environment
1 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
2 2547132130 Stenotrophomonas maltophilia RR-10 Isolate Unclassified
3 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
4 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
5 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
6 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
7 2643221559 Lysobacter sp. Root559 Isolate Unclassified
8 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
9 2643221573 Lysobacter sp. Root604 Isolate Unclassified
10 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
11 2643221586 Lysobacter sp. Root667 Isolate Unclassified
12 2643221593 Lysobacter sp. Root690 Isolate Unclassified
13 2643221612 Lysobacter sp. Root76 Isolate Unclassified
14 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
15 2643221695 Lysobacter sp. Root494 Isolate Unclassified
16 2643221720 Lysobacter sp. Root916 Isolate Unclassified
17 2643221727 Lysobacter sp. Root96 Isolate Unclassified
18 2643221728 Lysobacter sp. Root983 Isolate Unclassified
19 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
20 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
21 2734482264 Dyella sp. AD052 Isolate Unclassified
22 2738543009 Luteibacter sp. OK325 Isolate Unclassified
23 2739367700 Dyella sp. YR388 Isolate Unclassified
24 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
25 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
26 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
27 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
28 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
29 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
30 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
31 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
32 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
33 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
34 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
35 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
36 2884411467 Dyella sp. AD56 Isolate Rhizosphere
37 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
38 2919085039 Luteibacter sp. 1214 Isolate Unclassified
39 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
40 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
41 2919404418 Luteibacter sp. 3190 Isolate Unclassified
42 2919513703 Luteimonas sp. 3794 Isolate Unclassified
43 2919675420 Luteimonas terrae 4099 Isolate Unclassified
44 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
45 2928963466 Dyella japonica 1073 Isolate Unclassified
46 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
47 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
48 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
49 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
50 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
51 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
52 2941471342 Luteibacter sp. 621 Isolate Unclassified
53 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
54 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
55 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
56 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
57 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
58 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
59 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
60 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
61 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
62 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
63 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
64 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
65 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
66 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
67 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
68 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
69 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
70 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
71 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
72 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
73 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
74 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
75 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
76 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
77 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
78 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
79 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
80 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
81 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
82 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
83 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
84 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
85 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
86 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
87 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
88 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
89 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
90 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
91 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
92 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
93 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
94 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
95 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
96 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
97 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
98 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
99 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
100 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
101 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
102 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
103 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
104 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
105 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
106 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
107 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
108 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
109 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
110 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
111 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
112 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
113 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
114 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
115 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
116 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
117 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
118 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
119 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
120 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
121 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
122 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
123 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
124 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
125 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
126 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
127 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
128 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
129 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
130 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
131 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
132 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
133 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
134 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
135 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
136 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
137 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
138 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
139 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
140 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
141 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
142 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
143 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
144 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
145 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
146 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
147 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
148 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
149 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
150 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
151 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
152 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
153 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
154 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
155 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
156 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
157 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
158 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
159 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
160 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
161 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
162 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
163 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
164 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
165 3300009984 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG Metagenome Rhizosphere
166 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
167 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
168 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
169 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
170 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
171 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
172 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
173 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
174 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
175 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
176 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
177 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
178 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
179 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
180 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
181 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
182 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
183 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
184 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
185 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
186 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
187 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
188 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
189 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
190 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
191 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
192 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
193 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
194 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
195 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
196 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
197 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
198 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
199 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
200 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
201 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
202 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
203 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
204 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
205 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
206 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
207 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
208 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
209 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
210 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
211 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
212 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
213 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
214 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
215 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
216 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
217 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
218 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
219 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
220 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
221 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
222 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
223 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
224 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
264 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
265 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
266 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
268 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
269 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
270 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
271 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
273 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
274 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
275 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
276 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
277 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
278 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
279 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
280 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
282 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
283 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
284 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
285 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
286 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
287 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
288 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
289 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
290 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
291 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
292 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
293 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
294 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
295 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
296 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
297 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
298 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
299 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
300 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
301 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
302 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
303 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
304 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
305 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
306 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
307 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
308 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
309 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
310 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
311 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
312 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
313 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
314 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
315 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
316 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
317 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
318 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
319 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
320 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
321 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
322 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
323 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
324 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
325 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
326 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
327 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
328 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
329 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
330 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
331 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
332 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
333 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
334 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
335 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
336 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
337 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
338 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
339 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
340 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
341 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
342 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
343 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
344 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
345 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
346 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
347 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
348 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
349 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
350 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
351 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
352 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
353 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
354 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
355 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
356 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
357 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
358 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
359 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
360 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
361 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
362 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
363 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
364 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
365 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
366 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
367 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
368 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
369 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
370 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
371 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
372 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
373 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
374 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
375 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
376 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
377 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
378 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
379 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
380 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
381 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
382 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
383 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
384 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
385 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
386 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
387 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
388 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
389 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
390 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
391 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
392 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
393 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
394 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
395 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
396 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
397 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
398 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
399 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
400 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
401 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
402 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
403 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
404 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
405 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
406 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
407 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
408 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
409 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
410 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
411 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
412 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
413 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
414 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
415 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
416 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
417 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
418 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
419 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
420 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
421 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
422 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
423 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
424 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
425 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
426 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
427 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
428 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
429 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
430 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
431 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
432 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
433 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
434 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
435 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
436 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
437 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
438 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
439 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
440 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
441 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
442 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
443 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
444 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
445 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
446 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
447 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
448 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
449 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
450 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
451 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
452 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
453 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
454 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
455 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
456 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
457 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
458 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
459 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
460 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
461 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
462 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
463 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
464 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
465 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
466 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
467 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified
468 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.32
Metatranscriptomes 0.3
Isolates 6.38

Biome Distribution

Category Percentage (%)
Aerial Root 0.1
Bulb 0
Endosphere 16.15
Nodule 0.1
Rhizoplane 1.99
Rhizosphere 66.9
Stem 0
Stem Tuber 0
Unclassified 14.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10073446 3300001989 Bacteria 1061
2 JGI24737J22298_10001137 3300001990 Bacteria 9373
3 JGI24738J21930_10000182 3300002075 Bacteria 16187
4 JGI25156J39149_1002466 3300002705 Bacteria 6618
5 JGI25162J39368_1000236 3300002737 Bacteria 55248
6 JGI25162J39368_1000276 3300002737 Bacteria 48822
7 JGI25162J39368_1000425 3300002737 Bacteria 34158
8 JGI25162J39368_1001846 3300002737 Bacteria 9819
9 JGI25162J39368_1002492 3300002737 Bacteria 7069
10 JGI25154J39366_1003183 3300002738 Bacteria 3621
11 JGI25157J39369_1000352 3300002741 Bacteria 32246
12 JGI25157J39369_1001653 3300002741 Bacteria 7640
13 JGI25157J39369_1001834 3300002741 Bacteria 6689
14 JGI25163J39215_1000796 3300002771 Bacteria 7641
15 JGI25164J39214_1000113 3300002772 Bacteria 78046
16 JGI25164J39214_1000281 3300002772 Bacteria 36721
17 JGI25164J39214_1000914 3300002772 Bacteria 9819
18 JGI25164J39214_1000926 3300002772 Bacteria 9708
19 JGI25151J46595_10000183 3300003187 Bacteria 78518
20 JGI25151J46595_10032164 3300003187 Bacteria 2037
21 JGI25165J46597_1000158 3300003214 Bacteria 108257
22 JGI25165J46597_1000377 3300003214 Bacteria 48822
23 JGI25165J46597_1001709 3300003214 Bacteria 9819
24 JGI25165J46597_1004805 3300003214 Bacteria 2768
25 rootH2_10000931 3300003320 Bacteria 1893
26 Ga0006562J51391_1012556 3300003578 Bacteria 10910
27 Ga0055538_1002100 3300003751 Bacteria 3170
28 Ga0055525_1000239 3300003759 Bacteria 57171
29 Ga0055527_1000066 3300003760 Bacteria 88276
30 Ga0055527_1000136 3300003760 Bacteria 52239
31 Ga0055527_1007973 3300003760 Bacteria 1277
32 Ga0055535_1000058 3300003761 Bacteria 125370
33 Ga0055535_1000528 3300003761 Bacteria 33201
34 Ga0055535_1001090 3300003761 Bacteria 16575
35 Ga0055535_1002060 3300003761 Bacteria 8051
36 Ga0055535_1002684 3300003761 Bacteria 5798
37 Ga0055542_1000085 3300003762 Bacteria 125370
38 Ga0055542_1000199 3300003762 Bacteria 74029
39 Ga0055542_1000315 3300003762 Bacteria 52239
40 Ga0055542_1000347 3300003762 Bacteria 48822
41 Ga0055542_1002060 3300003762 Bacteria 7529
42 Ga0055542_1002563 3300003762 Bacteria 5798
43 Ga0055529_1000173 3300003763 Bacteria 88663
44 Ga0055529_1000240 3300003763 Bacteria 68255
45 Ga0055529_1000369 3300003763 Bacteria 48822
46 Ga0055529_1001027 3300003763 Bacteria 13318
47 Ga0055526_1000036 3300003771 Bacteria 135235
48 Ga0055526_1001709 3300003771 Bacteria 15305
49 Ga0055526_1011090 3300003771 Bacteria 4110
50 Ga0055537_1000083 3300003773 Bacteria 68713
51 Ga0055537_1000392 3300003773 Bacteria 29390
52 Ga0055524_1000359 3300003775 Bacteria 41002
53 Ga0055524_1006136 3300003775 Bacteria 5256
54 Ga0055536_1001429 3300003781 Bacteria 14400
55 Ga0055536_1006186 3300003781 Bacteria 5656
56 Ga0055534_1000103 3300003784 Bacteria 65838
57 Ga0055534_1000328 3300003784 Bacteria 31317
58 Ga0055528_1000004 3300003790 Bacteria 285772
59 Ga0055528_1000115 3300003790 Bacteria 64238
60 Ga0055530_10001216 3300003791 Bacteria 19856
61 Ga0055530_10001529 3300003791 Bacteria 16624
62 Ga0055530_10003425 3300003791 Bacteria 9026
63 Ga0055531_10007995 3300003794 Bacteria 5656
64 Ga0058692_1000002 3300003856 Bacteria 508401
65 Ga0065165_1000118 3300005262 Bacteria 134488
66 Ga0065165_1000947 3300005262 Bacteria 36793
67 Ga0065712_10190198 3300005290 Bacteria 1152
68 Ga0065715_10114075 3300005293 Bacteria 2453
69 Ga0070658_10019842 3300005327 Bacteria 5385
70 Ga0070658_10051561 3300005327 Bacteria 3334
71 Ga0070658_10344643 3300005327 Bacteria 1275
72 Ga0070690_100079742 3300005330 Bacteria 2140
73 Ga0070666_10000007 3300005335 Bacteria 293732
74 Ga0070666_10141499 3300005335 Bacteria 1676
75 Ga0070666_10205378 3300005335 Bacteria 1386
76 Ga0070680_100002634 3300005336 Bacteria 13295
77 Ga0070680_100089464 3300005336 Bacteria 2547
78 Ga0070680_100122671 3300005336 Bacteria 2170
79 Ga0070680_100615958 3300005336 Bacteria 932
80 Ga0070682_100038344 3300005337 Bacteria 2939
81 Ga0070682_100068133 3300005337 Bacteria 2268
82 Ga0070682_100206416 3300005337 Bacteria 1390
83 Ga0070660_100013179 3300005339 Bacteria 5924
84 Ga0070689_100191854 3300005340 Bacteria 1664
85 Ga0070661_100026497 3300005344 Bacteria 4170
86 Ga0070661_100709313 3300005344 Bacteria 820
87 Ga0070668_100102463 3300005347 Bacteria 2270
88 Ga0070675_100229927 3300005354 Bacteria 1617
89 Ga0070671_100062628 3300005355 Bacteria 3097
90 Ga0070674_100122392 3300005356 Bacteria 1928
91 Ga0070674_100236586 3300005356 Bacteria 1428
92 Ga0070659_100112934 3300005366 Bacteria 2194
93 Ga0070659_100621929 3300005366 Bacteria 929
94 Ga0070667_100116095 3300005367 Bacteria 2325
95 Ga0070709_10080067 3300005434 Bacteria 2129
96 Ga0070714_100000619 3300005435 Bacteria 25290
97 Ga0070714_100003291 3300005435 Bacteria 12042
98 Ga0070714_100036283 3300005435 Bacteria 4133
99 Ga0070713_100002067 3300005436 Bacteria 12977
100 Ga0070713_100064075 3300005436 Bacteria 3083
101 Ga0070710_10001459 3300005437 Bacteria 11139
102 Ga0070710_10066236 3300005437 Bacteria 2071
103 Ga0070711_100008805 3300005439 Bacteria 6194
104 Ga0070711_100027900 3300005439 Bacteria 3711
105 Ga0070694_100262054 3300005444 Bacteria 1311
106 Ga0070663_100032355 3300005455 Bacteria 3604
107 Ga0070678_100034725 3300005456 Bacteria 3514
108 Ga0070678_100055092 3300005456 Bacteria 2901
109 Ga0070678_100213413 3300005456 Bacteria 1601
110 Ga0070678_100255360 3300005456 Bacteria 1471
111 Ga0070662_100046265 3300005457 Bacteria 3126
112 Ga0070662_100115063 3300005457 Bacteria 2054
113 Ga0070681_10002254 3300005458 Bacteria 17604
114 Ga0070681_10006686 3300005458 Bacteria 11219
115 Ga0070681_10024298 3300005458 Bacteria 6100
116 Ga0070681_10094402 3300005458 Bacteria 2940
117 Ga0070681_10107674 3300005458 Bacteria 2727
118 Ga0070681_10641428 3300005458 Bacteria 977
119 Ga0068867_100018794 3300005459 Bacteria 4916
120 Ga0070685_10021413 3300005466 Bacteria 3514
121 Ga0070685_10212311 3300005466 Bacteria 1264
122 Ga0070706_100101382 3300005467 Bacteria 2675
123 Ga0070706_100111917 3300005467 Bacteria 2541
124 Ga0070706_100575807 3300005467 Bacteria 1047
125 Ga0070679_100024092 3300005530 Bacteria 5963
126 Ga0070679_100074170 3300005530 Bacteria 3393
127 Ga0070679_100122106 3300005530 Bacteria 2589
128 Ga0070679_100131768 3300005530 Bacteria 2481
129 Ga0070679_100612922 3300005530 Bacteria 1032
130 Ga0070679_100769526 3300005530 Bacteria 906
131 Ga0070684_100277664 3300005535 Bacteria 1535
132 Ga0070684_100466967 3300005535 Bacteria 1167
133 Ga0070697_100056569 3300005536 Bacteria 3191
134 Ga0070697_100343845 3300005536 Bacteria 1288
135 Ga0068853_100179616 3300005539 Bacteria 1919
136 Ga0068853_100308886 3300005539 Bacteria 1463
137 Ga0070672_100012526 3300005543 Bacteria 5959
138 Ga0070672_100103875 3300005543 Bacteria 2308
139 Ga0070696_100009297 3300005546 Bacteria 6579
140 Ga0070696_100011973 3300005546 Bacteria 5813
141 Ga0070696_100122328 3300005546 Bacteria 1885
142 Ga0070693_100029848 3300005547 Bacteria 2976
143 Ga0070693_100031375 3300005547 Bacteria 2911
144 Ga0070665_100002099 3300005548 Bacteria 22323
145 Ga0070665_100088723 3300005548 Bacteria 3098
146 Ga0070704_100321924 3300005549 Bacteria 1296
147 Ga0068855_100105694 3300005563 Bacteria 3236
148 Ga0068855_100207939 3300005563 Bacteria 2201
149 Ga0068857_100000255 3300005577 Bacteria 35825
150 Ga0068857_100112181 3300005577 Bacteria 2451
151 Ga0068857_100236515 3300005577 Bacteria 1671
152 Ga0068854_100267785 3300005578 Bacteria 1370
153 Ga0068856_100000192 3300005614 Bacteria 64464
154 Ga0068856_100003624 3300005614 Bacteria 15510
155 Ga0068856_100184188 3300005614 Bacteria 2101
156 Ga0068856_100380164 3300005614 Bacteria 1431
157 Ga0068856_100428607 3300005614 Bacteria 1343
158 Ga0068852_100161486 3300005616 Bacteria 2093
159 Ga0068864_100142465 3300005618 Bacteria 2164
160 Ga0068863_100162783 3300005841 Bacteria 2138
161 Ga0068863_100399062 3300005841 Bacteria 1345
162 Ga0068858_100013862 3300005842 Bacteria 7604
163 Ga0068858_100125853 3300005842 Bacteria 2400
164 Ga0068860_100076566 3300005843 Bacteria 3182
165 Ga0068860_100362659 3300005843 Bacteria 1428
166 Ga0081540_1005564 3300005983 Bacteria 9384
167 Ga0081539_10140191 3300005985 Bacteria 1176
168 Ga0070717_10000365 3300006028 Bacteria 29148
169 Ga0070717_10184496 3300006028 Bacteria 1820
170 Ga0070717_10216191 3300006028 Bacteria 1683
171 Ga0070717_10714113 3300006028 Bacteria 911
172 Ga0075365_10262357 3300006038 Bacteria 1215
173 Ga0075363_100051579 3300006048 Bacteria 2195
174 Ga0070712_100015197 3300006175 Bacteria 4951
175 Ga0070712_100106373 3300006175 Bacteria 2085
176 Ga0070712_100168872 3300006175 Bacteria 1696
177 Ga0075367_10032536 3300006178 Bacteria 3002
178 Ga0075369_10071976 3300006186 Bacteria 1523
179 Ga0075366_10049136 3300006195 Bacteria 2503
180 Ga0097621_100035600 3300006237 Bacteria 3979
181 Ga0097621_100484282 3300006237 Bacteria 1119
182 Ga0068871_100220141 3300006358 Bacteria 1644
183 Ga0075436_100095570 3300006914 Bacteria 2067
184 Ga0075435_100290990 3300007076 Bacteria 1396
185 Ga0099795_10002257 3300007788 Bacteria 4480
186 Ga0099795_10008729 3300007788 Bacteria 2907
187 Ga0105251_10009388 3300009011 Bacteria 5779
188 Ga0105244_10045735 3300009036 Bacteria 2251
189 Ga0105240_10016351 3300009093 Bacteria 10047
190 Ga0105240_10020645 3300009093 Bacteria 8779
191 Ga0105240_10022344 3300009093 Bacteria 8387
192 Ga0105240_10060335 3300009093 Bacteria 4729
193 Ga0105240_10520385 3300009093 Bacteria 1320
194 Ga0105240_10773019 3300009093 Bacteria 1042
195 Ga0105240_10818233 3300009093 Bacteria 1008
196 Ga0105247_10004235 3300009101 Bacteria 9197
197 Ga0105243_10065979 3300009148 Bacteria 2909
198 Ga0105243_10983775 3300009148 Bacteria 845
199 Ga0105241_10053273 3300009174 Bacteria 3093
200 Ga0105242_10022450 3300009176 Bacteria 4963
201 Ga0105242_10269206 3300009176 Bacteria 1542
202 Ga0105242_10360440 3300009176 Bacteria 1345
203 Ga0105248_10003878 3300009177 Bacteria 16529
204 Ga0105248_10079710 3300009177 Bacteria 3680
205 Ga0105237_10000026 3300009545 Bacteria 212619
206 Ga0105237_10000348 3300009545 Bacteria 65042
207 Ga0105237_10668727 3300009545 Bacteria 1045
208 Ga0105238_10000179 3300009551 Bacteria 69276
209 Ga0105238_10070102 3300009551 Bacteria 3506
210 Ga0105238_10149829 3300009551 Bacteria 2308
211 Ga0105238_10450542 3300009551 Bacteria 1284
212 Ga0105249_10337031 3300009553 Bacteria 1524
213 Ga0105249_10795645 3300009553 Bacteria 1009
214 Ga0105032_101927 3300009979 Bacteria 1876
215 Ga0105029_100836 3300009984 Bacteria 1764
216 Ga0099796_10001338 3300010159 Bacteria 4893
217 Ga0099796_10030637 3300010159 Bacteria 1747
218 Ga0105239_10000022 3300010375 Bacteria 257744
219 Ga0105239_10016630 3300010375 Bacteria 8132
220 Ga0105239_10037473 3300010375 Bacteria 5315
221 Ga0105239_10050694 3300010375 Bacteria 4552
222 Ga0157314_1000933 3300012500 Bacteria 2348
223 Ga0157347_1001314 3300012502 Bacteria 1923
224 Ga0157373_10001871 3300013100 Bacteria 15954
225 Ga0157373_10094802 3300013100 Bacteria 2101
226 Ga0157373_10228117 3300013100 Bacteria 1315
227 Ga0157373_10231720 3300013100 Bacteria 1304
228 Ga0157373_10249517 3300013100 Bacteria 1255
229 Ga0157371_10006739 3300013102 Bacteria 9391
230 Ga0157371_10025417 3300013102 Bacteria 4316
231 Ga0157371_10044347 3300013102 Bacteria 3166
232 Ga0157371_10294850 3300013102 Bacteria 1173
233 Ga0157371_10431386 3300013102 Bacteria 967
234 Ga0157370_10000033 3300013104 Bacteria 138137
235 Ga0157370_10025052 3300013104 Bacteria 5906
236 Ga0157370_10029713 3300013104 Bacteria 5360
237 Ga0157370_10056558 3300013104 Bacteria 3733
238 Ga0157370_10105988 3300013104 Bacteria 2631
239 Ga0157370_10125891 3300013104 Bacteria 2391
240 Ga0157370_10128685 3300013104 Bacteria 2363
241 Ga0157370_10325798 3300013104 Bacteria 1417
242 Ga0157370_10409183 3300013104 Bacteria 1248
243 Ga0157369_10003288 3300013105 Bacteria 19236
244 Ga0157369_10041103 3300013105 Bacteria 5047
245 Ga0157369_10107115 3300013105 Bacteria 2974
246 Ga0157369_10116263 3300013105 Bacteria 2840
247 Ga0157369_10154887 3300013105 Bacteria 2421
248 Ga0157369_10318256 3300013105 Bacteria 1618
249 Ga0157369_10577791 3300013105 Bacteria 1161
250 Ga0157369_10775580 3300013105 Bacteria 986
251 Ga0157374_10323017 3300013296 Bacteria 1530
252 Ga0163162_10005700 3300013306 Bacteria 12038
253 Ga0163162_10008312 3300013306 Bacteria 10126
254 Ga0163162_10256254 3300013306 Bacteria 1881
255 Ga0163162_10365594 3300013306 Bacteria 1576
256 Ga0163162_10748626 3300013306 Bacteria 1097
257 Ga0157372_10015442 3300013307 Bacteria 8184
258 Ga0157372_10055941 3300013307 Bacteria 4407
259 Ga0157372_10087113 3300013307 Bacteria 3542
260 Ga0157375_10002608 3300013308 Bacteria 15629
261 Ga0157375_10009838 3300013308 Bacteria 8409
262 Ga0157375_10026397 3300013308 Bacteria 5412
263 Ga0157375_10730390 3300013308 Bacteria 1142
264 Ga0163163_11081778 3300014325 Bacteria 865
265 Ga0182008_10002138 3300014497 Bacteria 12596
266 Ga0182008_10003328 3300014497 Bacteria 9763
267 Ga0182008_10016594 3300014497 Bacteria 3826
268 Ga0182008_10027901 3300014497 Bacteria 2856
269 Ga0182008_10036076 3300014497 Bacteria 2474
270 Ga0182008_10049628 3300014497 Bacteria 2083
271 Ga0182008_10068574 3300014497 Bacteria 1745
272 Ga0182008_10104619 3300014497 Bacteria 1400
273 Ga0157377_10498111 3300014745 Bacteria 851
274 Ga0157376_10004544 3300014969 Bacteria 9662
275 Ga0157376_10010376 3300014969 Bacteria 6810
276 Ga0157376_10779387 3300014969 Bacteria 967
277 Ga0182006_1000027 3300015261 Bacteria 252946
278 Ga0182006_1001007 3300015261 Bacteria 18434
279 Ga0182006_1012945 3300015261 Bacteria 3637
280 Ga0182007_10000184 3300015262 Bacteria 42443
281 Ga0182007_10004187 3300015262 Bacteria 6599
282 Ga0182007_10009608 3300015262 Bacteria 3885
283 Ga0182007_10015116 3300015262 Bacteria 2889
284 Ga0182007_10063842 3300015262 Bacteria 1207
285 Ga0182005_1000444 3300015265 Bacteria 21987
286 Ga0182005_1002679 3300015265 Bacteria 6260
287 Ga0182005_1076930 3300015265 Bacteria 919
288 Ga0183369_1009 3300015685 Bacteria 346348
289 Ga0183368_1004 3300015687 Bacteria 1211761
290 Ga0183360_10001 3300015689 Bacteria 3943671
291 Ga0163161_10025648 3300017792 Bacteria 4173
292 Ga0163161_10070932 3300017792 Bacteria 2548
293 Ga0163161_10094799 3300017792 Bacteria 2213
294 Ga0197907_10984330 3300020069 Bacteria 1032
295 Ga0206356_10606524 3300020070 Bacteria 3605
296 Ga0213873_10009569 3300021358 Bacteria 2017
297 Ga0213872_10052405 3300021361 Bacteria 1851
298 Ga0213875_10000091 3300021388 Bacteria 104903
299 Ga0213875_10001186 3300021388 Bacteria 17826
300 Ga0213875_10028472 3300021388 Bacteria 2652
301 Ga0213875_10196399 3300021388 Bacteria 949
302 Ga0209760_100900 3300025207 Bacteria 3739
303 Ga0209784_100158 3300025224 Bacteria 61452
304 Ga0209566_101992 3300025225 Bacteria 4353
305 Ga0209674_100016 3300025226 Bacteria 696756
306 Ga0209674_100202 3300025226 Bacteria 61028
307 Ga0209674_100348 3300025226 Bacteria 26853
308 Ga0209674_100700 3300025226 Bacteria 11650
309 Ga0209674_101957 3300025226 Bacteria 4812
310 Ga0209672_100007 3300025228 Bacteria 959482
311 Ga0209672_100018 3300025228 Bacteria 432924
312 Ga0209672_101169 3300025228 Bacteria 10718
313 Ga0209672_102255 3300025228 Bacteria 4965
314 Ga0209147_105466 3300025229 Bacteria 1897
315 Ga0209563_100071 3300025230 Bacteria 232653
316 Ga0207427_100013 3300025231 Bacteria 581419
317 Ga0207427_100036 3300025231 Bacteria 309540
318 Ga0207427_100112 3300025231 Bacteria 109224
319 Ga0207427_100287 3300025231 Bacteria 36057
320 Ga0207427_102910 3300025231 Bacteria 4040
321 Ga0209437_100015 3300025233 Bacteria 713457
322 Ga0209437_100106 3300025233 Bacteria 219071
323 Ga0209437_100127 3300025233 Bacteria 190741
324 Ga0209437_100567 3300025233 Bacteria 24126
325 Ga0209437_100650 3300025233 Bacteria 20044
326 Ga0209437_101038 3300025233 Bacteria 9335
327 Ga0209258_100017 3300025242 Bacteria 590785
328 Ga0209258_100024 3300025242 Bacteria 542096
329 Ga0209258_100035 3300025242 Bacteria 430864
330 Ga0209258_100043 3300025242 Bacteria 380685
331 Ga0209258_100256 3300025242 Bacteria 93548
332 Ga0209258_100527 3300025242 Bacteria 36553
333 Ga0209646_1000511 3300025246 Bacteria 17457
334 Ga0209646_1002363 3300025246 Bacteria 4233
335 Ga0209026_1000056 3300025250 Bacteria 236450
336 Ga0209026_1000069 3300025250 Bacteria 207574
337 Ga0209026_1000092 3300025250 Bacteria 170960
338 Ga0209026_1000162 3300025250 Bacteria 102867
339 Ga0209026_1002320 3300025250 Bacteria 7235
340 Ga0209026_1003343 3300025250 Bacteria 5327
341 Ga0209148_1000002 3300025254 Bacteria 2399500
342 Ga0209148_1000009 3300025254 Bacteria 1395625
343 Ga0209148_1000010 3300025254 Bacteria 1265567
344 Ga0209148_1000045 3300025254 Bacteria 448076
345 Ga0209148_1000048 3300025254 Bacteria 430913
346 Ga0209148_1000084 3300025254 Bacteria 268147
347 Ga0209759_1000317 3300025256 Bacteria 64752
348 Ga0209759_1000683 3300025256 Bacteria 30620
349 Ga0209759_1000906 3300025256 Bacteria 22092
350 Ga0209759_1000950 3300025256 Bacteria 20730
351 Ga0209759_1009913 3300025256 Bacteria 2840
352 Ga0209129_1000798 3300025258 Bacteria 19879
353 Ga0209233_1000009 3300025261 Bacteria 1265567
354 Ga0209233_1000020 3300025261 Bacteria 798224
355 Ga0209233_1000101 3300025261 Bacteria 286063
356 Ga0209233_1000215 3300025261 Bacteria 108939
357 Ga0209565_1000001 3300025263 Bacteria 2950419
358 Ga0209565_1000014 3300025263 Bacteria 530302
359 Ga0209565_1009641 3300025263 Bacteria 2434
360 Ga0209455_1000010 3300025272 Bacteria 959482
361 Ga0209455_1000020 3300025272 Bacteria 702259
362 Ga0209455_1000029 3300025272 Bacteria 542096
363 Ga0209455_1000035 3300025272 Bacteria 479071
364 Ga0209455_1000261 3300025272 Bacteria 60720
365 Ga0209455_1011073 3300025272 Bacteria 2244
366 Ga0209673_1000001 3300025273 Bacteria 3176258
367 Ga0209673_1000623 3300025273 Bacteria 54075
368 Ga0209130_1008302 3300025284 Bacteria 3080
369 Ga0209130_1020566 3300025284 Bacteria 1507
370 Ga0209675_1000001 3300025291 Bacteria 2950293
371 Ga0209675_1000021 3300025291 Bacteria 334833
372 Ga0209675_1000860 3300025291 Bacteria 19679
373 Ga0209675_1023823 3300025291 Bacteria 1576
374 Ga0209676_1000047 3300025292 Bacteria 408645
375 Ga0209676_1000079 3300025292 Bacteria 290447
376 Ga0209676_1000891 3300025292 Bacteria 38072
377 Ga0209676_1001198 3300025292 Bacteria 27768
378 Ga0209676_1005540 3300025292 Bacteria 6545
379 Ga0209676_1005741 3300025292 Bacteria 6365
380 Ga0209025_1000015 3300025294 Bacteria 808120
381 Ga0209025_1007720 3300025294 Bacteria 7936
382 Ga0209025_1026333 3300025294 Bacteria 2924
383 Ga0209025_1036642 3300025294 Bacteria 2192
384 Ga0209564_1000001 3300025295 Bacteria 3176258
385 Ga0209564_1000263 3300025295 Bacteria 112148
386 Ga0209758_1001731 3300025297 Bacteria 24304
387 Ga0209758_1032081 3300025297 Bacteria 2141
388 Ga0209050_1000153 3300025298 Bacteria 160851
389 Ga0209050_1001146 3300025298 Bacteria 31752
390 Ga0209050_1002199 3300025298 Bacteria 17575
391 Ga0209050_1025149 3300025298 Bacteria 2034
392 Ga0209256_1000002 3300025299 Bacteria 1906740
393 Ga0209256_1007068 3300025299 Bacteria 5679
394 Ga0209256_1009310 3300025299 Bacteria 4330
395 Ga0209256_1009918 3300025299 Bacteria 4086
396 Ga0209256_1011370 3300025299 Bacteria 3570
397 Ga0207426_1008705 3300025302 Bacteria 4068
398 Ga0207426_1072415 3300025302 Bacteria 957
399 Ga0209051_1001823 3300025303 Bacteria 16847
400 Ga0209051_1004390 3300025303 Bacteria 8720
401 Ga0209051_1047648 3300025303 Bacteria 1461
402 Ga0209257_1000081 3300025304 Bacteria 306577
403 Ga0209257_1000988 3300025304 Bacteria 38563
404 Ga0209257_1001062 3300025304 Bacteria 36333
405 Ga0209257_1001230 3300025304 Bacteria 31830
406 Ga0209257_1001483 3300025304 Bacteria 27558
407 Ga0209257_1004325 3300025304 Bacteria 11138
408 Ga0209257_1008865 3300025304 Bacteria 5553
409 Ga0207656_10004996 3300025321 Bacteria 4660
410 Ga0207655_1063565 3300025728 Bacteria 1413
411 Ga0207713_1068205 3300025735 Bacteria 1323
412 Ga0207692_10003659 3300025898 Bacteria 6022
413 Ga0207692_10079126 3300025898 Bacteria 1753
414 Ga0207692_10095615 3300025898 Bacteria 1620
415 Ga0207710_10057440 3300025900 Bacteria 1758
416 Ga0207680_10000002 3300025903 Bacteria 1018646
417 Ga0207680_10052056 3300025903 Bacteria 2451
418 Ga0207680_10228711 3300025903 Bacteria 1278
419 Ga0207680_10313996 3300025903 Bacteria 1095
420 Ga0207647_10001338 3300025904 Bacteria 18951
421 Ga0207647_10019730 3300025904 Bacteria 4529
422 Ga0207684_10631804 3300025910 Bacteria 913
423 Ga0207707_10000502 3300025912 Bacteria 40345
424 Ga0207707_10007385 3300025912 Bacteria 9572
425 Ga0207707_10007639 3300025912 Bacteria 9420
426 Ga0207707_10018458 3300025912 Bacteria 6081
427 Ga0207707_10031732 3300025912 Bacteria 4624
428 Ga0207707_10047058 3300025912 Bacteria 3757
429 Ga0207707_10120936 3300025912 Bacteria 2289
430 Ga0207707_10343981 3300025912 Bacteria 1286
431 Ga0207707_10600708 3300025912 Bacteria 931
432 Ga0207695_10000596 3300025913 Bacteria 72426
433 Ga0207695_10002223 3300025913 Bacteria 29150
434 Ga0207695_10007083 3300025913 Bacteria 14372
435 Ga0207695_10008574 3300025913 Bacteria 12773
436 Ga0207695_10112656 3300025913 Bacteria 2698
437 Ga0207695_10271656 3300025913 Bacteria 1591
438 Ga0207695_10747441 3300025913 Bacteria 858
439 Ga0207671_10000041 3300025914 Bacteria 216095
440 Ga0207671_10000167 3300025914 Bacteria 100428
441 Ga0207671_10472418 3300025914 Bacteria 999
442 Ga0207693_10000650 3300025915 Bacteria 31123
443 Ga0207693_10008637 3300025915 Bacteria 8334
444 Ga0207693_10013634 3300025915 Bacteria 6550
445 Ga0207663_10043027 3300025916 Bacteria 2763
446 Ga0207660_10004528 3300025917 Bacteria 9062
447 Ga0207660_10107874 3300025917 Bacteria 2090
448 Ga0207660_10274574 3300025917 Bacteria 1336
449 Ga0207660_10312164 3300025917 Bacteria 1254
450 Ga0207657_10039883 3300025919 Bacteria 4167
451 Ga0207649_10122565 3300025920 Bacteria 1755
452 Ga0207649_10173107 3300025920 Bacteria 1505
453 Ga0207649_10177366 3300025920 Bacteria 1489
454 Ga0207652_10008543 3300025921 Bacteria 8243
455 Ga0207652_10031863 3300025921 Bacteria 4428
456 Ga0207652_10047503 3300025921 Bacteria 3667
457 Ga0207652_10159165 3300025921 Bacteria 2024
458 Ga0207652_10165762 3300025921 Bacteria 1981
459 Ga0207652_10294165 3300025921 Bacteria 1465
460 Ga0207652_10414956 3300025921 Bacteria 1214
461 Ga0207652_10705061 3300025921 Bacteria 900
462 Ga0207681_10152810 3300025923 Bacteria 1732
463 Ga0207694_10000369 3300025924 Bacteria 42083
464 Ga0207694_10094909 3300025924 Bacteria 2357
465 Ga0207694_10102008 3300025924 Bacteria 2274
466 Ga0207694_10212050 3300025924 Bacteria 1578
467 Ga0207650_10092140 3300025925 Bacteria 2317
468 Ga0207687_10081041 3300025927 Bacteria 2344
469 Ga0207700_10004015 3300025928 Bacteria 8617
470 Ga0207700_10009227 3300025928 Bacteria 6152
471 Ga0207700_10080160 3300025928 Bacteria 2545
472 Ga0207700_10226563 3300025928 Bacteria 1587
473 Ga0207664_10000226 3300025929 Bacteria 42680
474 Ga0207664_10022281 3300025929 Bacteria 4727
475 Ga0207664_10076314 3300025929 Bacteria 2712
476 Ga0207664_10082800 3300025929 Bacteria 2614
477 Ga0207664_10184936 3300025929 Bacteria 1791
478 Ga0207664_10232170 3300025929 Bacteria 1604
479 Ga0207664_10290846 3300025929 Bacteria 1436
480 Ga0207664_10291235 3300025929 Bacteria 1435
481 Ga0207664_10662456 3300025929 Bacteria 938
482 Ga0207644_10061113 3300025931 Bacteria 2728
483 Ga0207644_10085599 3300025931 Bacteria 2339
484 Ga0207690_10001747 3300025932 Bacteria 13344
485 Ga0207690_10015946 3300025932 Bacteria 4564
486 Ga0207690_10022943 3300025932 Bacteria 3889
487 Ga0207690_10052059 3300025932 Bacteria 2741
488 Ga0207690_10083885 3300025932 Bacteria 2232
489 Ga0207706_10064405 3300025933 Bacteria 3227
490 Ga0207706_10142881 3300025933 Bacteria 2105
491 Ga0207706_10177097 3300025933 Bacteria 1873
492 Ga0207709_10000805 3300025935 Bacteria 24411
493 Ga0207709_10386036 3300025935 Bacteria 1067
494 Ga0207670_10205972 3300025936 Bacteria 1497
495 Ga0207669_10589345 3300025937 Bacteria 902
496 Ga0207704_10366593 3300025938 Bacteria 1126
497 Ga0207665_10009168 3300025939 Bacteria 6499
498 Ga0207665_10166401 3300025939 Bacteria 1590
499 Ga0207691_10013968 3300025940 Bacteria 7661
500 Ga0207691_10015575 3300025940 Bacteria 7229
501 Ga0207691_10032747 3300025940 Bacteria 4845
502 Ga0207691_10076008 3300025940 Bacteria 3027
503 Ga0207689_10105289 3300025942 Bacteria 2318
504 Ga0207661_10173590 3300025944 Bacteria 1878
505 Ga0207667_10000665 3300025949 Bacteria 44540
506 Ga0207667_10000921 3300025949 Bacteria 37520
507 Ga0207667_10111952 3300025949 Bacteria 2815
508 Ga0207667_10115210 3300025949 Bacteria 2770
509 Ga0207712_10615088 3300025961 Bacteria 941
510 Ga0207712_10851845 3300025961 Bacteria 803
511 Ga0207668_10435828 3300025972 Bacteria 1115
512 Ga0207640_10000099 3300025981 Bacteria 66535
513 Ga0207640_10003733 3300025981 Bacteria 8213
514 Ga0207640_10014359 3300025981 Bacteria 4557
515 Ga0207658_10173816 3300025986 Bacteria 1777
516 Ga0207677_10070134 3300026023 Bacteria 2468
517 Ga0207677_10323067 3300026023 Bacteria 1283
518 Ga0207677_10487032 3300026023 Bacteria 1064
519 Ga0207703_10636423 3300026035 Bacteria 1011
520 Ga0207639_10985567 3300026041 Bacteria 789
521 Ga0207678_10043497 3300026067 Bacteria 3886
522 Ga0207678_10051970 3300026067 Bacteria 3537
523 Ga0207678_10108359 3300026067 Bacteria 2370
524 Ga0207678_10195808 3300026067 Bacteria 1727
525 Ga0207678_10255547 3300026067 Bacteria 1501
526 Ga0207702_10000113 3300026078 Bacteria 94003
527 Ga0207702_10049873 3300026078 Bacteria 3533
528 Ga0207648_10213839 3300026089 Bacteria 1712
529 Ga0207676_10051350 3300026095 Bacteria 3219
530 Ga0207674_10000106 3300026116 Bacteria 95712
531 Ga0207674_10032194 3300026116 Bacteria 5501
532 Ga0207674_10144398 3300026116 Bacteria 2339
533 Ga0207683_10036568 3300026121 Bacteria 4277
534 Ga0207683_10054272 3300026121 Bacteria 3514
535 Ga0207683_10058759 3300026121 Bacteria 3377
536 Ga0207683_10336356 3300026121 Bacteria 1384
537 Ga0207698_10423621 3300026142 Bacteria 1278
538 Ga0207698_10575382 3300026142 Bacteria 1107
539 Ga0209371_1000004 3300027312 Bacteria 1098197
540 Ga0209999_1011041 3300027543 Bacteria 1633
541 Ga0209982_1002010 3300027552 Bacteria 2818
542 Ga0209970_1001697 3300027614 Bacteria 3823
543 Ga0209983_1006587 3300027665 Bacteria 2384
544 Ga0209971_1002664 3300027682 Bacteria 4273
545 Ga0209974_10018560 3300027876 Bacteria 2308
546 Ga0268266_10000004 3300028379 Bacteria 1495817
547 Ga0268266_10085465 3300028379 Bacteria 2756
548 Ga0268264_10059284 3300028381 Bacteria 3207
549 Ga0268264_10923017 3300028381 Bacteria 877
550 Ga0268256_1000005 3300030500 Bacteria 1082342
551 Ga0316176_1214082 3300030732 Bacteria 4788
552 Ga0316181_1133242 3300030744 Bacteria 3057
553 Ga0265328_10002339 3300031239 Bacteria 8544
554 Ga0265331_10000882 3300031250 Bacteria 24333
555 Ga0265331_10035844 3300031250 Bacteria 2439
556 Ga0265327_10000297 3300031251 Bacteria 96213
557 Ga0265327_10001130 3300031251 Bacteria 36700
558 Ga0265327_10112123 3300031251 Bacteria 1302
559 Ga0265316_10099774 3300031344 Bacteria 2208
560 Ga0307408_100392615 3300031548 Bacteria 1189
561 Ga0307405_10401415 3300031731 Bacteria 1073
562 Ga0307413_10176253 3300031824 Bacteria 1519
563 Ga0307406_10006263 3300031901 Bacteria 6556
564 Ga0307406_10541403 3300031901 Bacteria 951
565 Ga0307412_10007137 3300031911 Bacteria 6342
566 Ga0307412_10839911 3300031911 Bacteria 800
567 Ga0307414_10012850 3300032004 Bacteria 4968
568 Ga0307414_10079142 3300032004 Bacteria 2398
569 Ga0307414_10142831 3300032004 Bacteria 1876
570 Ga0307414_10174200 3300032004 Bacteria 1723
571 Ga0307414_10564593 3300032004 Bacteria 1016
572 Ga0307411_10124551 3300032005 Bacteria 1871
573 Ga0307510_10000813 3300033180 Bacteria 32491
574 Ga0373930_0073532 3300034816 Bacteria 780
575 Ga0373944_0015282 3300035089 Bacteria 2153
576 Ga0373923_0038556 3300035111 Bacteria 1959
577 Ga0373953_0005127 3300035117 Bacteria 4233
578 Ga0373953_0039241 3300035117 Bacteria 1876
579 Ga0373953_0039781 3300035117 Bacteria 1865
580 Ga0373954_0000639 3300035118 Bacteria 13372
581 Ga0373954_0095537 3300035118 Bacteria 1431
582 Ga0373956_0023798 3300035119 Bacteria 2632
583 Ga0373957_0040078 3300035120 Bacteria 1760
584 Ga0373943_0215690 3300035170 Bacteria 1067
585 Ga0373955_0052076 3300035172 Bacteria 2232
586 Ga0373955_0128304 3300035172 Bacteria 1479
587 Ga0373955_0174895 3300035172 Bacteria 1272
588 Ga0373942_0079753 3300035207 Bacteria 970
589 Ga0373927_0110212 3300035695 Bacteria 1793
590 Ga0373927_0357752 3300035695 Bacteria 962
591 Ga0373933_0002711 3300035724 Bacteria 9913
592 Ga0373933_0008921 3300035724 Bacteria 5468
593 Ga0373947_0045265 3300035725 Bacteria 2633
594 Ga0373947_0046670 3300035725 Bacteria 2594
595 Ga0373937_0002148 3300036401 Bacteria 16509
596 Ga0373937_0021372 3300036401 Bacteria 5809
597 Ga0395899_0000119 3300037312 Bacteria 127184
598 Ga0395899_0308669 3300037312 Bacteria 1068
599 Ga0395900_0000107 3300037418 Bacteria 149024
600 Ga0395900_0043584 3300037418 Bacteria 4624
601 Ga0395900_0153600 3300037418 Bacteria 2351
602 Ga0395900_0193265 3300037418 Bacteria 2063
603 Ga0395898_0000078 3300037466 Bacteria 244514
604 Ga0395898_0000211 3300037466 Bacteria 149301
605 Ga0395898_0032999 3300037466 Bacteria 5168
606 Ga0395905_0062301 3300037471 Bacteria 3489
607 Ga0395905_0270280 3300037471 Bacteria 1586
608 Ga0436364_0004186 3300037853 Bacteria 33279
609 Ga0436364_0259249 3300037853 Bacteria 81192
610 Ga0436364_0542842 3300037853 Bacteria 26703
611 Ga0436364_0563324 3300037853 Bacteria 1368
612 Ga0436364_1410323 3300037853 Bacteria 2933
613 Ga0395901_0033326 3300038443 Bacteria 5317
614 Ga0395901_0039218 3300038443 Bacteria 4901
615 Ga0395901_0055402 3300038443 Bacteria 4123
616 Ga0395901_0104326 3300038443 Bacteria 2975
617 Ga0395901_0221558 3300038443 Bacteria 1977
618 Ga0395901_0433976 3300038443 Bacteria 1345
619 Ga0395901_0435421 3300038443 Bacteria 1343
620 Ga0237816_01783 3300039145 Bacteria 1721
621 Ga0436365_0008782 3300039437 Bacteria 4678
622 Ga0436365_0517215 3300039437 Bacteria 1711
623 Ga0436365_1221803 3300039437 Bacteria 1898
624 Ga0436365_1298789 3300039437 Bacteria 2908
625 Ga0436365_1585383 3300039437 Bacteria 850
626 Ga0436360_0305899 3300039438 Bacteria 2158
627 Ga0436360_0471362 3300039438 Bacteria 781
628 Ga0436361_0059974 3300039447 Bacteria 5363
629 Ga0436361_0201225 3300039447 Bacteria 1296
630 Ga0436361_0297744 3300039447 Bacteria 10837
631 Ga0436361_0974234 3300039447 Bacteria 3419
632 Ga0436363_0407566 3300039450 Bacteria 2838
633 Ga0436363_1276848 3300039450 Bacteria 13012
634 Ga0436363_1679139 3300039450 Bacteria 5257
635 Ga0436362_0167405 3300039453 Bacteria 3602
636 Ga0436362_0518518 3300039453 Bacteria 1379
637 Ga0439436_0000038 3300041404 Bacteria 42088
638 Ga0439436_0047388 3300041404 Bacteria 1220
639 Ga0439436_0062279 3300041404 Bacteria 1044
640 Ga0439439_0026913 3300041406 Bacteria 1451
641 Ga0439447_008673 3300041407 Bacteria 3135
642 Ga0439465_0000102 3300041413 Bacteria 19643
643 Ga0439465_0022731 3300041413 Bacteria 1970
644 Ga0451837_1454550 3300041494 Bacteria 996
645 Ga0451841_0515478 3300041498 Bacteria 883
646 Ga0451853_2173083 3300041512 Bacteria 644
647 Ga0439432_002010 3300042006 Bacteria 7701
648 Ga0439449_0002290 3300042007 Bacteria 7503
649 Ga0439449_0086978 3300042007 Bacteria 1153
650 Ga0439449_0105554 3300042007 Bacteria 1042
651 Ga0439457_069483 3300042014 Bacteria 802
652 Ga0439462_0075022 3300042015 Bacteria 920
653 Ga0450908_000795 3300042184 Bacteria 6057
654 Ga0451577_0012429 3300042876 Bacteria 7996
655 Ga0466969_0002045 3300044656 Bacteria 10779
656 Ga0466969_0039084 3300044656 Bacteria 2385
657 Ga0466982_0000009 3300044672 Bacteria 221166
658 Ga0466982_0032234 3300044672 Bacteria 3116
659 Ga0453683_0009634 3300044673 Bacteria 6443
660 Ga0466965_0052238 3300044683 Bacteria 2029
661 Ga0466965_0230395 3300044683 Bacteria 989
662 Ga0466965_0239226 3300044683 Bacteria 971
663 Ga0466966_0002007 3300044684 Bacteria 13210
664 Ga0466966_0004172 3300044684 Bacteria 9546
665 Ga0466966_0005741 3300044684 Bacteria 8167
666 Ga0466961_0000871 3300044693 Bacteria 18794
667 Ga0466961_0016399 3300044693 Bacteria 4759
668 Ga0466961_0016587 3300044693 Bacteria 4735
669 Ga0466961_0026311 3300044693 Bacteria 3740
670 Ga0466964_0041063 3300044706 Bacteria 1869
671 Ga0466971_0030586 3300044719 Bacteria 2409
672 Ga0466971_0042914 3300044719 Bacteria 2032
673 Ga0466968_0025209 3300044735 Bacteria 2435
674 Ga0466968_0128066 3300044735 Bacteria 1153
675 Ga0466970_0035945 3300044765 Bacteria 2623
676 Ga0466970_0071623 3300044765 Bacteria 1864
677 Ga0466957_0007258 3300044842 Bacteria 6264
678 Ga0466957_0375617 3300044842 Bacteria 968
679 Ga0466960_0001857 3300044901 Bacteria 7757
680 Ga0466959_0000467 3300045049 Bacteria 23599
681 Ga0466959_0005529 3300045049 Bacteria 8670
682 Ga0451576_0000752 3300045051 Bacteria 64762
683 Ga0466958_0016257 3300045836 Bacteria 4280
684 Ga0466958_0020784 3300045836 Bacteria 3831
685 Ga0466958_0106624 3300045836 Bacteria 1747
686 Ga0466958_0425587 3300045836 Bacteria 858
687 Ga0466967_0060527 3300045976 Bacteria 3356
688 Ga0466967_0072924 3300045976 Bacteria 3079
689 Ga0466967_0611033 3300045976 Bacteria 1076
690 Ga0495617_000220 3300046452 Bacteria 34639
691 Ga0495627_017223 3300046453 Bacteria 2460
692 Ga0495592_0018927 3300046454 Bacteria 5242
693 Ga0495638_0000049 3300046460 Bacteria 206725
694 Ga0495638_0000522 3300046460 Bacteria 44904
695 Ga0495638_0001093 3300046460 Bacteria 26413
696 Ga0495638_0015032 3300046460 Bacteria 5210
697 Ga0495638_0034406 3300046460 Bacteria 3234
698 Ga0495651_0142794 3300046462 Bacteria 1734
699 Ga0495650_0000150 3300046471 Bacteria 158574
700 Ga0495650_0000250 3300046471 Bacteria 105746
701 Ga0495650_0017737 3300046471 Bacteria 3560
702 Ga0495662_0018948 3300046476 Bacteria 3331
703 Ga0495662_0043121 3300046476 Bacteria 2178
704 Ga0495585_0000019 3300046492 Bacteria 156966
705 Ga0495585_0007901 3300046492 Bacteria 6468
706 Ga0495607_0000019 3300046501 Bacteria 167319
707 Ga0495607_0000784 3300046501 Bacteria 30230
708 Ga0495583_0032674 3300046506 Bacteria 2509
709 Ga0495606_0000181 3300046507 Bacteria 111247
710 Ga0495606_0000445 3300046507 Bacteria 67615
711 Ga0495606_0000639 3300046507 Bacteria 54940
712 Ga0495606_0054946 3300046507 Bacteria 2577
713 Ga0495606_0066228 3300046507 Bacteria 2291
714 Ga0495606_0282915 3300046507 Bacteria 906
715 Ga0495610_0004869 3300046512 Bacteria 9765
716 Ga0495610_0008235 3300046512 Bacteria 6789
717 Ga0495616_0000047 3300046513 Bacteria 110592
718 Ga0495618_0033404 3300046514 Bacteria 3226
719 Ga0495620_0003425 3300046515 Bacteria 9081
720 Ga0495620_0004202 3300046515 Bacteria 8148
721 Ga0495628_0097579 3300046516 Bacteria 2270
722 Ga0495628_0129646 3300046516 Bacteria 1930
723 Ga0495631_0000330 3300046518 Bacteria 32514
724 Ga0495631_0000831 3300046518 Bacteria 19646
725 Ga0495631_0002330 3300046518 Bacteria 10811
726 Ga0495632_0000080 3300046519 Bacteria 99523
727 Ga0495632_0029601 3300046519 Bacteria 2849
728 Ga0495632_0153999 3300046519 Bacteria 1061
729 Ga0495643_0002426 3300046522 Bacteria 14817
730 Ga0495648_0002510 3300046524 Bacteria 16840
731 Ga0495648_0073091 3300046524 Bacteria 1981
732 Ga0495663_0031955 3300046525 Bacteria 1565
733 Ga0495640_0043087 3300046533 Bacteria 3145
734 Ga0495640_0206144 3300046533 Bacteria 1244
735 Ga0495586_0033390 3300046535 Bacteria 2761
736 Ga0495598_0008132 3300046537 Bacteria 2432
737 Ga0495609_0006867 3300046538 Bacteria 5749
738 Ga0495621_0051699 3300046539 Bacteria 1471
739 Ga0495633_0004234 3300046558 Bacteria 9182
740 Ga0495667_0002059 3300046559 Bacteria 13347
741 Ga0495667_0018565 3300046559 Bacteria 4697
742 Ga0495667_0181775 3300046559 Bacteria 1349
743 Ga0495656_0029117 3300046615 Bacteria 2220
744 Ga0495668_0005107 3300046616 Bacteria 9026
745 Ga0495634_0025672 3300046642 Bacteria 4116
746 Ga0495634_0025974 3300046642 Bacteria 4091
747 Ga0495611_0000001 3300046648 Bacteria 2628469
748 Ga0495611_0011433 3300046648 Bacteria 3763
749 Ga0495625_0000001 3300046660 Bacteria 1641829
750 Ga0495625_0005238 3300046660 Bacteria 11935
751 Ga0495625_0024822 3300046660 Bacteria 4554
752 Ga0495625_0134475 3300046660 Bacteria 1672
753 Ga0495635_0066916 3300046663 Bacteria 2464
754 Ga0495661_0000396 3300046665 Bacteria 46420
755 Ga0495588_0295475 3300046674 Bacteria 853
756 Ga0495599_0012302 3300046678 Bacteria 5272
757 Ga0495599_0019628 3300046678 Bacteria 4214
758 Ga0495613_0297593 3300046689 Bacteria 1118
759 Ga0495670_0016207 3300046691 Bacteria 3663
760 Ga0495670_0159804 3300046691 Bacteria 1183
761 Ga0495649_0003166 3300046694 Bacteria 11248
762 Ga0495649_0057035 3300046694 Bacteria 2107
763 Ga0495589_0000294 3300046794 Bacteria 39809
764 Ga0495600_0102800 3300046809 Bacteria 1862
765 Ga0495660_0000078 3300046810 Bacteria 104055
766 Ga0495660_0021882 3300046810 Bacteria 3656
767 Ga0495636_0000518 3300047318 Bacteria 14176
768 Ga0495636_0026184 3300047318 Bacteria 2371
769 Ga0495672_0000308 3300047320 Bacteria 65628
770 Ga0495680_0004554 3300047322 Bacteria 13243
771 Ga0495680_0034485 3300047322 Bacteria 4085
772 Ga0495683_0045015 3300047323 Bacteria 2218
773 Ga0495679_000001 3300047446 Bacteria 1607568
774 Ga0495685_010164 3300047447 Bacteria 3154
775 Ga0495673_0000001 3300047469 Bacteria 1630730
776 Ga0495673_0001155 3300047469 Bacteria 22423
777 Ga0495673_0009326 3300047469 Bacteria 5439
778 Ga0495684_0200772 3300047471 Bacteria 1470
779 Ga0495686_0000085 3300047472 Bacteria 198128
780 Ga0495686_0007770 3300047472 Bacteria 7984
781 Ga0495686_0049452 3300047472 Bacteria 2645
782 Ga0495686_0070261 3300047472 Bacteria 2157
783 Ga0496100_0001623 3300048903 Bacteria 11129
784 Ga0496100_0327337 3300048903 Bacteria 1152
785 Ga0496101_0002373 3300048904 Bacteria 11560
786 Ga0496101_0291290 3300048904 Bacteria 1277
787 Ga0496104_0110190 3300048907 Bacteria 2639
788 Ga0496104_0203191 3300048907 Bacteria 1893
789 Ga0496104_0420122 3300048907 Bacteria 1249
790 Ga0496105_0000297 3300048908 Bacteria 32702
791 Ga0496106_0019509 3300048909 Bacteria 5030
792 Ga0496106_0253285 3300048909 Bacteria 1408
793 Ga0496108_0200510 3300048911 Bacteria 1732
794 Ga0496112_0099145 3300048915 Bacteria 2883
795 Ga0496112_0602604 3300048915 Bacteria 1030
796 Ga0496113_0008338 3300048916 Bacteria 6747
797 Ga0496113_0169097 3300048916 Bacteria 1731
798 Ga0496113_0408716 3300048916 Bacteria 1090
799 Ga0496115_0000045 3300048918 Bacteria 113665
800 Ga0496115_0000360 3300048918 Bacteria 38094
801 Ga0496115_0053534 3300048918 Bacteria 3239
802 Ga0496115_0356552 3300048918 Bacteria 1192
803 Ga0496116_0003285 3300048919 Bacteria 16078
804 Ga0496116_0021446 3300048919 Bacteria 4873
805 Ga0496116_0212126 3300048919 Bacteria 1002
806 Ga0496117_0001940 3300048920 Bacteria 27595
807 Ga0496117_0002543 3300048920 Bacteria 22759
808 Ga0496117_0006419 3300048920 Bacteria 11917
809 Ga0496117_0029087 3300048920 Bacteria 4266
810 Ga0496117_0032221 3300048920 Bacteria 3985
811 Ga0496117_0112097 3300048920 Bacteria 1697
812 Ga0496117_0121292 3300048920 Bacteria 1605
813 Ga0496118_0000145 3300048921 Bacteria 123886
814 Ga0496118_0000681 3300048921 Bacteria 55339
815 Ga0496118_0006961 3300048921 Bacteria 12212
816 Ga0496118_0029186 3300048921 Bacteria 4630
817 Ga0496118_0046092 3300048921 Bacteria 3395
818 Ga0496119_0000150 3300048922 Bacteria 97299
819 Ga0496119_0018652 3300048922 Bacteria 5151
820 Ga0496119_0182866 3300048922 Bacteria 1098
821 Ga0496120_0006390 3300048923 Bacteria 9059
822 Ga0496120_0006457 3300048923 Bacteria 8993
823 Ga0496121_0000651 3300048924 Bacteria 64980
824 Ga0496121_0002293 3300048924 Bacteria 29709
825 Ga0496121_0007541 3300048924 Bacteria 13116
826 Ga0496121_0015154 3300048924 Bacteria 8107
827 Ga0496121_0049797 3300048924 Bacteria 3547
828 Ga0496121_0074355 3300048924 Bacteria 2719
829 Ga0496121_0168057 3300048924 Bacteria 1596
830 Ga0496121_0227307 3300048924 Bacteria 1309
831 Ga0496121_0337976 3300048924 Bacteria 1007
832 Ga0496122_0000220 3300048925 Bacteria 127065
833 Ga0496122_0008191 3300048925 Bacteria 11356
834 Ga0496122_0046804 3300048925 Bacteria 3345
835 Ga0496122_0072222 3300048925 Bacteria 2454
836 Ga0496122_0087977 3300048925 Bacteria 2131
837 Ga0496122_0097781 3300048925 Bacteria 1974
838 Ga0496122_0140188 3300048925 Bacteria 1514
839 Ga0496123_0000151 3300048926 Bacteria 141062
840 Ga0496123_0019168 3300048926 Bacteria 5400
841 Ga0496123_0021793 3300048926 Bacteria 4965
842 Ga0496123_0060013 3300048926 Bacteria 2454
843 Ga0496124_0001342 3300048927 Bacteria 36940
844 Ga0496124_0006439 3300048927 Bacteria 12794
845 Ga0496124_0008101 3300048927 Bacteria 11041
846 Ga0496124_0025033 3300048927 Bacteria 5412
847 Ga0496124_0034535 3300048927 Bacteria 4436
848 Ga0496124_0049688 3300048927 Bacteria 3576
849 Ga0496124_0074610 3300048927 Bacteria 2803
850 Ga0496125_0000867 3300048928 Bacteria 48475
851 Ga0496125_0004620 3300048928 Bacteria 15738
852 Ga0496125_0004794 3300048928 Bacteria 15398
853 Ga0496125_0051590 3300048928 Bacteria 3391
854 Ga0496125_0264952 3300048928 Bacteria 1074
855 Ga0496125_0334123 3300048928 Bacteria 912
856 Ga0496126_0023236 3300048929 Bacteria 6009
857 Ga0496126_0049967 3300048929 Bacteria 3815
858 Ga0496126_0193328 3300048929 Bacteria 1722
859 Ga0496126_0306207 3300048929 Bacteria 1309
860 Ga0496126_0324653 3300048929 Bacteria 1264
861 Ga0495678_000207 3300049459 Bacteria 68441
862 Ga0495682_0016606 3300049460 Bacteria 2785
863 Ga0501290_001434 3300049513 Bacteria 3267
864 Ga0501031_0050309 3300049568 Bacteria 2715
865 Ga0501032_0094368 3300049569 Bacteria 1984
866 Ga0501032_0232937 3300049569 Bacteria 1197
867 Ga0501033_0005987 3300049570 Bacteria 9539
868 Ga0501033_0251159 3300049570 Bacteria 1253
869 Ga0501034_0000822 3300049571 Bacteria 46209
870 Ga0501034_0004123 3300049571 Bacteria 16282
871 Ga0501034_0034131 3300049571 Bacteria 5158
872 Ga0501034_0041584 3300049571 Bacteria 4651
873 Ga0501034_0855826 3300049571 Bacteria 799
874 Ga0501037_0055906 3300049573 Bacteria 2884
875 Ga0501038_0019376 3300049574 Bacteria 6134
876 Ga0501038_0333182 3300049574 Bacteria 1185
877 Ga0501042_0432665 3300049578 Bacteria 954
878 Ga0501043_0018803 3300049579 Bacteria 5423
879 Ga0501043_0047144 3300049579 Bacteria 3388
880 Ga0501043_0136243 3300049579 Bacteria 1923
881 Ga0501043_0242026 3300049579 Bacteria 1391
882 Ga0501046_0122324 3300049580 Bacteria 1979
883 Ga0501046_0282345 3300049580 Bacteria 1216
884 Ga0501047_0002958 3300049581 Bacteria 16102
885 Ga0501047_0012080 3300049581 Bacteria 8174
886 Ga0501047_0026836 3300049581 Bacteria 5544
887 Ga0501047_0048587 3300049581 Bacteria 4097
888 Ga0501047_0116830 3300049581 Bacteria 2549
889 Ga0501047_0417703 3300049581 Bacteria 1173
890 Ga0501067_0003364 3300049583 Bacteria 8794
891 Ga0501068_0020417 3300049584 Bacteria 3859
892 Ga0501069_0017577 3300049585 Bacteria 3852
893 Ga0501070_0043369 3300049586 Bacteria 3743
894 Ga0501072_0042715 3300049588 Bacteria 3561
895 Ga0501073_0000441 3300049589 Bacteria 28676
896 Ga0501073_0094260 3300049589 Bacteria 2079
897 Ga0501073_0193970 3300049589 Bacteria 1405
898 Ga0501073_0283187 3300049589 Bacteria 1144
899 Ga0501074_0110056 3300049590 Bacteria 1971
900 Ga0501074_0140584 3300049590 Bacteria 1727
901 Ga0501077_0214547 3300049593 Bacteria 1223
902 Ga0501079_0056772 3300049741 Bacteria 3021
903 Ga0501080_0000627 3300049742 Bacteria 28011
904 Ga0501080_0017160 3300049742 Bacteria 6686
905 Ga0501080_0026718 3300049742 Bacteria 5365
906 Ga0501080_0094317 3300049742 Bacteria 2779
907 Ga0501080_0111848 3300049742 Bacteria 2531
908 Ga0501080_0117547 3300049742 Bacteria 2465
909 Ga0501080_0788994 3300049742 Bacteria 834
910 Ga0501083_0005730 3300049744 Bacteria 8791
911 Ga0501083_0015523 3300049744 Bacteria 5333
912 Ga0501265_001414 3300049762 Bacteria 2714
913 Ga0501275_000306 3300049772 Bacteria 5577
914 Ga0501035_0008185 3300049822 Bacteria 9744
915 Ga0501035_0017552 3300049822 Bacteria 6603
916 Ga0501035_0075758 3300049822 Bacteria 2976
917 Ga0501044_0028449 3300049823 Bacteria 5899
918 Ga0501044_0051582 3300049823 Bacteria 4241
919 Ga0501044_0092060 3300049823 Bacteria 3058
920 nmdc:mga0k408_193586_c1 3300050493 Bacteria 1213
921 nmdc:mga0n895_371751_c1 3300050512 Bacteria 1447
922 nmdc:mga0n895_471382_c1 3300050512 Bacteria 1266
923 nmdc:mga08x19_88445_c1 3300050514 Bacteria 2042
924 nmdc:mga0sz30_62511_c1 3300050516 Bacteria 1593
925 Ga0495601_0013260 3300053077 Bacteria 4955
926 Ga0495595_0015471 3300053084 Bacteria 3255
927 Ga0495619_0018952 3300053085 Bacteria 4370
928 Ga0495619_0064315 3300053085 Bacteria 2445
929 Ga0500643_000002 3300053087 Bacteria 1277657
930 Ga0500651_0000461 3300053093 Bacteria 21522
931 Ga0500555_000949 3300053103 Bacteria 10082
932 Ga0500642_0006012 3300053130 Bacteria 3962
933 Ga0500633_0142012 3300053160 Bacteria 899
934 Ga0500645_044384 3300053730 Bacteria 1307
935 Ga0501082_0040632 3300060353 Bacteria 4011
936 Ga0501082_0047113 3300060353 Bacteria 3715
937 Ga0466962_0000591 3300061719 Bacteria 15997
938 Ga0466962_0003760 3300061719 Bacteria 7249
939 Ga0466962_0090264 3300061719 Bacteria 1468

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049571 Ga0501034_0855826 Ga0501034_0855826_60_758 192
2 3300041512 Ga0451853_2173083 Ga0451853_2173083_33_632 197
3 3300026023 Ga0207677_10070134 Ga0207677_100701344 207
4 3300046539 Ga0495621_0051699 Ga0495621_0051699_18_653 210
5 3300049742 Ga0501080_0788994 Ga0501080_0788994_12_662 215
6 3300042014 Ga0439457_069483 Ga0439457_069483_13_666 216
7 3300031911 Ga0307412_10839911 Ga0307412_108399111 221
8 3300046689 Ga0495613_0297593 Ga0495613_0297593_419_1093 221
9 3300013100 Ga0157373_10094802 Ga0157373_100948022 223
10 3300013102 Ga0157371_10044347 Ga0157371_100443474 223
11 3300005367 Ga0070667_100116095 Ga0070667_1001160952 226
12 3300005539 Ga0068853_100179616 Ga0068853_1001796162 226
13 3300025986 Ga0207658_10173816 Ga0207658_101738162 226
14 3300026041 Ga0207639_10985567 Ga0207639_109855671 226
15 3300014497 Ga0182008_10068574 Ga0182008_100685742 227
16 3300015262 Ga0182007_10009608 Ga0182007_100096083 227
17 iso_pu_bacteria 2643221593 2643974389 227
18 3300005841 Ga0068863_100399062 Ga0068863_1003990622 229
19 3300037471 Ga0395905_0062301 Ga0395905_0062301_2490_3227 229
20 iso_pu_bacteria 2842757796 2842758666 229
21 iso_pu_bacteria 2919513703 2919516548 229
22 iso_pu_bacteria 2919675420 2919678568 229
23 iso_pu_bacteria 2939589442 2939590520 229
24 iso_pu_bacteria 2974307012 2974309436 229
25 iso_pu_bacteria 2977247770 2977250155 229
26 iso_pu_bacteria 2984514374 2984515353 229
27 iso_pu_bacteria 2547132130 2547501597 230
28 iso_pu_bacteria 2571042365 2572253445 230
29 iso_pu_bacteria 2576861471 2578458990 230
30 iso_pu_bacteria 2643221695 2644528790 230
31 iso_pu_bacteria 2747842428 2747948693 230
32 iso_pu_bacteria 2765235840 2765578385 230
33 iso_pu_bacteria 2816332141 2816516412 230
34 iso_pu_bacteria 2842391507 2842392877 230
35 iso_pu_bacteria 2852649853 2852651321 230
36 iso_pu_bacteria 2857442823 2857446843 230
37 iso_pu_bacteria 2874220319 2874221013 230
38 iso_pu_bacteria 2919089067 2919091224 230
39 iso_pu_bacteria 2919134579 2919136742 230
40 iso_pu_bacteria 2928496128 2928497855 230
41 iso_pu_bacteria 2931380184 2931381343 230
42 iso_pu_bacteria 2937610967 2937611834 230
43 iso_pu_bacteria 2939622612 2939622679 230
44 iso_pu_bacteria 2939626828 2939627775 230
45 iso_pu_bacteria 2941475908 2941477737 230
46 iso_pu_bacteria 2961047084 2961047778 230
47 iso_pu_bacteria 2961064222 2961067120 230
48 iso_pu_bacteria 2987605356 2987605816 230
49 3300003187 JGI25151J46595_10000183 JGI25151J46595_1000018333 231
50 3300005293 Ga0065715_10114075 Ga0065715_101140754 231
51 3300005339 Ga0070660_100013179 Ga0070660_1000131796 231
52 3300005530 Ga0070679_100769526 Ga0070679_1007695261 231
53 3300013307 Ga0157372_10015442 Ga0157372_100154426 231
54 3300015689 Ga0183360_10001 Ga0183360_100012294 231
55 3300025263 Ga0209565_1009641 Ga0209565_10096412 231
56 3300025294 Ga0209025_1000015 Ga0209025_1000015186 231
57 3300025919 Ga0207657_10039883 Ga0207657_100398836 231
58 3300027543 Ga0209999_1011041 Ga0209999_10110411 231
59 3300027552 Ga0209982_1002010 Ga0209982_10020103 231
60 3300027614 Ga0209970_1001697 Ga0209970_10016975 231
61 3300027665 Ga0209983_1006587 Ga0209983_10065873 231
62 3300027682 Ga0209971_1002664 Ga0209971_10026643 231
63 3300027876 Ga0209974_10018560 Ga0209974_100185602 231
64 3300031239 Ga0265328_10002339 Ga0265328_100023394 231
65 3300031250 Ga0265331_10000882 Ga0265331_100008824 231
66 3300031250 Ga0265331_10035844 Ga0265331_100358442 231
67 3300031251 Ga0265327_10112123 Ga0265327_101121232 231
68 3300031901 Ga0307406_10541403 Ga0307406_105414031 231
69 3300037418 Ga0395900_0193265 Ga0395900_0193265_953_1654 231
70 3300037471 Ga0395905_0270280 Ga0395905_0270280_468_1169 231
71 3300041404 Ga0439436_0062279 Ga0439436_0062279_261_959 231
72 3300041407 Ga0439447_008673 Ga0439447_008673_637_1335 231
73 3300042876 Ga0451577_0012429 Ga0451577_0012429_306_1010 231
74 3300044673 Ga0453683_0009634 Ga0453683_0009634_5175_5888 231
75 3300045051 Ga0451576_0000752 Ga0451576_0000752_47911_48624 231
76 3300046616 Ga0495668_0005107 Ga0495668_0005107_155_853 231
77 3300049513 Ga0501290_001434 Ga0501290_001434_2137_2841 231
78 3300049570 Ga0501033_0005987 Ga0501033_0005987_8708_9412 231
79 3300049762 Ga0501265_001414 Ga0501265_001414_350_1054 231
80 3300049772 Ga0501275_000306 Ga0501275_000306_4569_5273 231
81 iso_pu_bacteria 2643221559 2643818988 231
82 iso_pu_bacteria 2643221573 2643879509 231
83 iso_pu_bacteria 2643221586 2643941341 231
84 iso_pu_bacteria 2643221612 2644080414 231
85 iso_pu_bacteria 2643221720 2644662880 231
86 iso_pu_bacteria 2643221727 2644697027 231
87 iso_pu_bacteria 2643221728 2644698165 231
88 iso_pu_bacteria 2718218334 2721027997 231
89 iso_pu_bacteria 2734482264 2735836433 231
90 iso_pu_bacteria 2738543009 2739227471 231
91 iso_pu_bacteria 2842914999 2842915547 231
92 iso_pu_bacteria 2941489479 2941489599 231
93 iso_pu_bacteria 2995948881 2995950865 231
94 iso_pu_bacteria 8002869464 8002871670 231
95 3300009093 Ga0105240_10016351 Ga0105240_100163516 232
96 3300009177 Ga0105248_10003878 Ga0105248_100038786 232
97 3300009553 Ga0105249_10337031 Ga0105249_103370312 232
98 3300010375 Ga0105239_10037473 Ga0105239_100374735 232
99 3300013308 Ga0157375_10002608 Ga0157375_1000260811 232
100 3300025913 Ga0207695_10008574 Ga0207695_1000857410 232
101 3300025942 Ga0207689_10105289 Ga0207689_101052893 232
102 3300025961 Ga0207712_10851845 Ga0207712_108518451 232
103 3300026142 Ga0207698_10423621 Ga0207698_104236212 232
104 3300041494 Ga0451837_1454550 Ga0451837_1454550_143_847 232
105 3300041498 Ga0451841_0515478 Ga0451841_0515478_122_826 232
106 3300046615 Ga0495656_0029117 Ga0495656_0029117_1439_2143 232
107 3300047318 Ga0495636_0000518 Ga0495636_0000518_12806_13510 232
108 3300047447 Ga0495685_010164 Ga0495685_010164_73_777 232
109 3300049571 Ga0501034_0000822 Ga0501034_0000822_22742_23452 232
110 3300003771 Ga0055526_1001709 Ga0055526_10017099 233
111 3300003773 Ga0055537_1000392 Ga0055537_100039217 233
112 3300003775 Ga0055524_1006136 Ga0055524_10061362 233
113 3300003781 Ga0055536_1006186 Ga0055536_10061861 233
114 3300003784 Ga0055534_1000328 Ga0055534_100032823 233
115 3300003790 Ga0055528_1000115 Ga0055528_100011542 233
116 3300003791 Ga0055530_10001216 Ga0055530_1000121618 233
117 3300003791 Ga0055530_10001529 Ga0055530_100015292 233
118 3300003794 Ga0055531_10007995 Ga0055531_100079951 233
119 3300005347 Ga0070668_100102463 Ga0070668_1001024632 233
120 3300005543 Ga0070672_100012526 Ga0070672_1000125265 233
121 3300005548 Ga0070665_100088723 Ga0070665_1000887232 233
122 3300006048 Ga0075363_100051579 Ga0075363_1000515792 233
123 3300006178 Ga0075367_10032536 Ga0075367_100325363 233
124 3300009011 Ga0105251_10009388 Ga0105251_100093882 233
125 3300009979 Ga0105032_101927 Ga0105032_1019273 233
126 3300013102 Ga0157371_10025417 Ga0157371_100254173 233
127 3300013102 Ga0157371_10431386 Ga0157371_104313861 233
128 3300013104 Ga0157370_10105988 Ga0157370_101059882 233
129 3300013105 Ga0157369_10041103 Ga0157369_100411036 233
130 3300014497 Ga0182008_10016594 Ga0182008_100165944 233
131 3300017792 Ga0163161_10070932 Ga0163161_100709322 233
132 3300025263 Ga0209565_1000014 Ga0209565_1000014336 233
133 3300025273 Ga0209673_1000623 Ga0209673_100062332 233
134 3300025284 Ga0209130_1008302 Ga0209130_10083024 233
135 3300025291 Ga0209675_1000021 Ga0209675_1000021152 233
136 3300025292 Ga0209676_1000079 Ga0209676_100007922 233
137 3300025292 Ga0209676_1001198 Ga0209676_10011987 233
138 3300025295 Ga0209564_1000263 Ga0209564_100026369 233
139 3300025298 Ga0209050_1000153 Ga0209050_1000153145 233
140 3300025298 Ga0209050_1002199 Ga0209050_100219915 233
141 3300025299 Ga0209256_1009310 Ga0209256_10093106 233
142 3300025303 Ga0209051_1001823 Ga0209051_100182312 233
143 3300025304 Ga0209257_1000081 Ga0209257_100008132 233
144 3300025304 Ga0209257_1001483 Ga0209257_10014837 233
145 3300025304 Ga0209257_1004325 Ga0209257_100432510 233
146 3300025735 Ga0207713_1068205 Ga0207713_10682052 233
147 3300025927 Ga0207687_10081041 Ga0207687_100810413 233
148 3300025940 Ga0207691_10032747 Ga0207691_100327475 233
149 3300026078 Ga0207702_10049873 Ga0207702_100498731 233
150 3300028379 Ga0268266_10085465 Ga0268266_100854653 233
151 3300031251 Ga0265327_10000297 Ga0265327_1000029788 233
152 3300031548 Ga0307408_100392615 Ga0307408_1003926152 233
153 3300031824 Ga0307413_10176253 Ga0307413_101762532 233
154 3300032004 Ga0307414_10012850 Ga0307414_100128502 233
155 3300032004 Ga0307414_10079142 Ga0307414_100791423 233
156 3300032004 Ga0307414_10142831 Ga0307414_101428313 233
157 3300032004 Ga0307414_10174200 Ga0307414_101742002 233
158 3300032004 Ga0307414_10564593 Ga0307414_105645931 233
159 3300032005 Ga0307411_10124551 Ga0307411_101245512 233
160 3300041404 Ga0439436_0047388 Ga0439436_0047388_233_940 233
161 3300041406 Ga0439439_0026913 Ga0439439_0026913_69_776 233
162 3300042006 Ga0439432_002010 Ga0439432_002010_4760_5467 233
163 3300042007 Ga0439449_0002290 Ga0439449_0002290_4979_5686 233
164 3300042007 Ga0439449_0086978 Ga0439449_0086978_53_760 233
165 3300042015 Ga0439462_0075022 Ga0439462_0075022_156_863 233
166 3300046453 Ga0495627_017223 Ga0495627_017223_199_903 233
167 3300046525 Ga0495663_0031955 Ga0495663_0031955_306_1010 233
168 3300046558 Ga0495633_0004234 Ga0495633_0004234_8119_8823 233
169 3300046660 Ga0495625_0134475 Ga0495625_0134475_19_723 233
170 3300047318 Ga0495636_0026184 Ga0495636_0026184_458_1213 233
171 3300048920 Ga0496117_0029087 Ga0496117_0029087_3418_4122 233
172 3300048927 Ga0496124_0001342 Ga0496124_0001342_36040_36744 233
173 3300048927 Ga0496124_0034535 Ga0496124_0034535_227_931 233
174 3300049568 Ga0501031_0050309 Ga0501031_0050309_70_777 233
175 3300049570 Ga0501033_0251159 Ga0501033_0251159_34_741 233
176 3300049579 Ga0501043_0242026 Ga0501043_0242026_588_1295 233
177 iso_pu_bacteria 2593339238 2595445701 233
178 iso_pu_bacteria 2818991440 2819563181 233
179 iso_pu_bacteria 2904463128 2904463799 233
180 iso_pu_bacteria 2919085039 2919085837 233
181 iso_pu_bacteria 2919404418 2919405966 233
182 3300003187 JGI25151J46595_10032164 JGI25151J46595_100321642 234
183 3300003771 Ga0055526_1000036 Ga0055526_1000036119 234
184 3300003771 Ga0055526_1011090 Ga0055526_10110904 234
185 3300003773 Ga0055537_1000083 Ga0055537_10000837 234
186 3300003775 Ga0055524_1000359 Ga0055524_100035932 234
187 3300003781 Ga0055536_1001429 Ga0055536_10014292 234
188 3300003784 Ga0055534_1000103 Ga0055534_100010355 234
189 3300003790 Ga0055528_1000004 Ga0055528_1000004264 234
190 3300003791 Ga0055530_10003425 Ga0055530_100034254 234
191 3300003856 Ga0058692_1000002 Ga0058692_1000002314 234
192 3300005330 Ga0070690_100079742 Ga0070690_1000797422 234
193 3300005335 Ga0070666_10141499 Ga0070666_101414992 234
194 3300005340 Ga0070689_100191854 Ga0070689_1001918541 234
195 3300005354 Ga0070675_100229927 Ga0070675_1002299272 234
196 3300005356 Ga0070674_100236586 Ga0070674_1002365862 234
197 3300005456 Ga0070678_100034725 Ga0070678_1000347252 234
198 3300005456 Ga0070678_100055092 Ga0070678_1000550923 234
199 3300005456 Ga0070678_100213413 Ga0070678_1002134132 234
200 3300005456 Ga0070678_100255360 Ga0070678_1002553602 234
201 3300005459 Ga0068867_100018794 Ga0068867_1000187945 234
202 3300005466 Ga0070685_10212311 Ga0070685_102123111 234
203 3300005530 Ga0070679_100122106 Ga0070679_1001221062 234
204 3300005539 Ga0068853_100308886 Ga0068853_1003088862 234
205 3300005614 Ga0068856_100184188 Ga0068856_1001841881 234
206 3300005618 Ga0068864_100142465 Ga0068864_1001424652 234
207 3300005841 Ga0068863_100162783 Ga0068863_1001627831 234
208 3300005843 Ga0068860_100362659 Ga0068860_1003626592 234
209 3300005985 Ga0081539_10140191 Ga0081539_101401911 234
210 3300006038 Ga0075365_10262357 Ga0075365_102623572 234
211 3300006175 Ga0070712_100168872 Ga0070712_1001688723 234
212 3300006237 Ga0097621_100035600 Ga0097621_1000356003 234
213 3300006237 Ga0097621_100484282 Ga0097621_1004842821 234
214 3300006358 Ga0068871_100220141 Ga0068871_1002201411 234
215 3300009148 Ga0105243_10983775 Ga0105243_109837751 234
216 3300009176 Ga0105242_10022450 Ga0105242_100224504 234
217 3300009176 Ga0105242_10269206 Ga0105242_102692062 234
218 3300009177 Ga0105248_10079710 Ga0105248_100797103 234
219 3300009551 Ga0105238_10450542 Ga0105238_104505422 234
220 3300009553 Ga0105249_10795645 Ga0105249_107956451 234
221 3300009984 Ga0105029_100836 Ga0105029_1008363 234
222 3300013100 Ga0157373_10228117 Ga0157373_102281171 234
223 3300013102 Ga0157371_10006739 Ga0157371_100067392 234
224 3300013105 Ga0157369_10318256 Ga0157369_103182562 234
225 3300013296 Ga0157374_10323017 Ga0157374_103230171 234
226 3300013306 Ga0163162_10008312 Ga0163162_100083124 234
227 3300013306 Ga0163162_10748626 Ga0163162_107486261 234
228 3300013307 Ga0157372_10087113 Ga0157372_100871134 234
229 3300013308 Ga0157375_10009838 Ga0157375_100098386 234
230 3300014969 Ga0157376_10010376 Ga0157376_100103767 234
231 3300015262 Ga0182007_10000184 Ga0182007_100001845 234
232 3300015265 Ga0182005_1000444 Ga0182005_10004445 234
233 3300017792 Ga0163161_10025648 Ga0163161_100256482 234
234 3300021388 Ga0213875_10000091 Ga0213875_1000009195 234
235 3300025263 Ga0209565_1000001 Ga0209565_10000011564 234
236 3300025273 Ga0209673_1000001 Ga0209673_10000011564 234
237 3300025284 Ga0209130_1020566 Ga0209130_10205662 234
238 3300025291 Ga0209675_1000001 Ga0209675_1000001970 234
239 3300025291 Ga0209675_1000860 Ga0209675_10008606 234
240 3300025291 Ga0209675_1023823 Ga0209675_10238231 234
241 3300025292 Ga0209676_1000047 Ga0209676_1000047291 234
242 3300025292 Ga0209676_1000891 Ga0209676_100089110 234
243 3300025292 Ga0209676_1005540 Ga0209676_10055406 234
244 3300025292 Ga0209676_1005741 Ga0209676_10057413 234
245 3300025294 Ga0209025_1026333 Ga0209025_10263331 234
246 3300025294 Ga0209025_1036642 Ga0209025_10366421 234
247 3300025295 Ga0209564_1000001 Ga0209564_10000011132 234
248 3300025298 Ga0209050_1001146 Ga0209050_100114617 234
249 3300025298 Ga0209050_1025149 Ga0209050_10251492 234
250 3300025299 Ga0209256_1000002 Ga0209256_1000002422 234
251 3300025299 Ga0209256_1007068 Ga0209256_10070682 234
252 3300025299 Ga0209256_1009918 Ga0209256_10099182 234
253 3300025302 Ga0207426_1072415 Ga0207426_10724151 234
254 3300025303 Ga0209051_1047648 Ga0209051_10476482 234
255 3300025304 Ga0209257_1000988 Ga0209257_100098814 234
256 3300025304 Ga0209257_1001062 Ga0209257_100106212 234
257 3300025304 Ga0209257_1001230 Ga0209257_10012305 234
258 3300025304 Ga0209257_1008865 Ga0209257_10088651 234
259 3300025728 Ga0207655_1063565 Ga0207655_10635652 234
260 3300025903 Ga0207680_10052056 Ga0207680_100520562 234
261 3300025903 Ga0207680_10228711 Ga0207680_102287112 234
262 3300025921 Ga0207652_10165762 Ga0207652_101657622 234
263 3300025923 Ga0207681_10152810 Ga0207681_101528102 234
264 3300025931 Ga0207644_10085599 Ga0207644_100855992 234
265 3300025932 Ga0207690_10052059 Ga0207690_100520593 234
266 3300025933 Ga0207706_10177097 Ga0207706_101770972 234
267 3300025935 Ga0207709_10000805 Ga0207709_100008057 234
268 3300025936 Ga0207670_10205972 Ga0207670_102059722 234
269 3300025937 Ga0207669_10589345 Ga0207669_105893451 234
270 3300025938 Ga0207704_10366593 Ga0207704_103665931 234
271 3300025940 Ga0207691_10015575 Ga0207691_100155755 234
272 3300025961 Ga0207712_10615088 Ga0207712_106150881 234
273 3300026023 Ga0207677_10323067 Ga0207677_103230672 234
274 3300026095 Ga0207676_10051350 Ga0207676_100513502 234
275 3300026121 Ga0207683_10036568 Ga0207683_100365682 234
276 3300026121 Ga0207683_10054272 Ga0207683_100542725 234
277 3300026121 Ga0207683_10058759 Ga0207683_100587593 234
278 3300026121 Ga0207683_10336356 Ga0207683_103363562 234
279 3300027312 Ga0209371_1000004 Ga0209371_1000004522 234
280 3300030500 Ga0268256_1000005 Ga0268256_1000005524 234
281 3300030732 Ga0316176_1214082 Ga0316176_12140822 234
282 3300030744 Ga0316181_1133242 Ga0316181_11332423 234
283 3300031901 Ga0307406_10006263 Ga0307406_100062633 234
284 3300037853 Ga0436364_0542842 Ga0436364_0542842_20659_21384 234
285 3300039145 Ga0237816_01783 Ga0237816_01783_921_1631 234
286 3300041413 Ga0439465_0022731 Ga0439465_0022731_889_1599 234
287 3300042007 Ga0439449_0105554 Ga0439449_0105554_106_816 234
288 3300046460 Ga0495638_0015032 Ga0495638_0015032_471_1178 234
289 3300046512 Ga0495610_0004869 Ga0495610_0004869_406_1113 234
290 3300046518 Ga0495631_0002330 Ga0495631_0002330_9707_10414 234
291 3300046522 Ga0495643_0002426 Ga0495643_0002426_12111_12863 234
292 3300047320 Ga0495672_0000308 Ga0495672_0000308_61485_62237 234
293 3300048919 Ga0496116_0003285 Ga0496116_0003285_570_1277 234
294 3300048919 Ga0496116_0021446 Ga0496116_0021446_3956_4663 234
295 3300048920 Ga0496117_0002543 Ga0496117_0002543_2048_2755 234
296 3300048920 Ga0496117_0006419 Ga0496117_0006419_10687_11433 234
297 3300048921 Ga0496118_0000681 Ga0496118_0000681_2051_2758 234
298 3300048924 Ga0496121_0007541 Ga0496121_0007541_12214_12921 234
299 3300048924 Ga0496121_0074355 Ga0496121_0074355_335_1045 234
300 3300048924 Ga0496121_0227307 Ga0496121_0227307_218_925 234
301 3300048925 Ga0496122_0000220 Ga0496122_0000220_91682_92389 234
302 3300048925 Ga0496122_0008191 Ga0496122_0008191_366_1073 234
303 3300048925 Ga0496122_0072222 Ga0496122_0072222_138_845 234
304 3300048926 Ga0496123_0000151 Ga0496123_0000151_34666_35373 234
305 3300048926 Ga0496123_0060013 Ga0496123_0060013_138_845 234
306 3300048927 Ga0496124_0025033 Ga0496124_0025033_245_952 234
307 3300048927 Ga0496124_0049688 Ga0496124_0049688_1214_1921 234
308 3300048927 Ga0496124_0074610 Ga0496124_0074610_1214_1921 234
309 3300048928 Ga0496125_0004620 Ga0496125_0004620_575_1282 234
310 3300048928 Ga0496125_0004794 Ga0496125_0004794_14175_14882 234
311 3300048928 Ga0496125_0264952 Ga0496125_0264952_196_903 234
312 3300048929 Ga0496126_0306207 Ga0496126_0306207_442_1149 234
313 3300049579 Ga0501043_0018803 Ga0501043_0018803_785_1495 234
314 iso_pu_bacteria 2593339239 2595449450 234
315 iso_pu_bacteria 2842918807 2842921827 234
316 iso_pu_bacteria 2953994433 2953997831 234
317 3300005327 Ga0070658_10344643 Ga0070658_103446431 235
318 3300005434 Ga0070709_10080067 Ga0070709_100800674 235
319 3300005458 Ga0070681_10641428 Ga0070681_106414282 235
320 3300009036 Ga0105244_10045735 Ga0105244_100457353 235
321 3300009148 Ga0105243_10065979 Ga0105243_100659791 235
322 3300010375 Ga0105239_10050694 Ga0105239_100506944 235
323 3300013104 Ga0157370_10029713 Ga0157370_100297137 235
324 3300014497 Ga0182008_10002138 Ga0182008_100021386 235
325 3300025294 Ga0209025_1007720 Ga0209025_10077207 235
326 3300025920 Ga0207649_10173107 Ga0207649_101731071 235
327 3300025935 Ga0207709_10386036 Ga0207709_103860361 235
328 3300031251 Ga0265327_10001130 Ga0265327_1000113010 235
329 3300035111 Ga0373923_0038556 Ga0373923_0038556_216_932 235
330 3300035117 Ga0373953_0039781 Ga0373953_0039781_1114_1839 235
331 3300035120 Ga0373957_0040078 Ga0373957_0040078_192_917 235
332 3300035724 Ga0373933_0002711 Ga0373933_0002711_2419_3354 235
333 3300039438 Ga0436360_0471362 Ga0436360_0471362_16_738 235
334 3300044735 Ga0466968_0128066 Ga0466968_0128066_423_1130 235
335 3300046452 Ga0495617_000220 Ga0495617_000220_2791_3498 235
336 3300046460 Ga0495638_0000522 Ga0495638_0000522_35014_35721 235
337 3300046460 Ga0495638_0034406 Ga0495638_0034406_2288_2995 235
338 3300046462 Ga0495651_0142794 Ga0495651_0142794_974_1699 235
339 3300046471 Ga0495650_0017737 Ga0495650_0017737_49_756 235
340 3300046476 Ga0495662_0018948 Ga0495662_0018948_1134_1859 235
341 3300046492 Ga0495585_0000019 Ga0495585_0000019_123198_123905 235
342 3300046492 Ga0495585_0007901 Ga0495585_0007901_4532_5239 235
343 3300046501 Ga0495607_0000784 Ga0495607_0000784_26987_27694 235
344 3300046506 Ga0495583_0032674 Ga0495583_0032674_1694_2401 235
345 3300046507 Ga0495606_0000181 Ga0495606_0000181_65489_66196 235
346 3300046507 Ga0495606_0000445 Ga0495606_0000445_64134_64841 235
347 3300046507 Ga0495606_0066228 Ga0495606_0066228_894_1601 235
348 3300046513 Ga0495616_0000047 Ga0495616_0000047_85830_86537 235
349 3300046514 Ga0495618_0033404 Ga0495618_0033404_436_1161 235
350 3300046515 Ga0495620_0003425 Ga0495620_0003425_5822_6529 235
351 3300046515 Ga0495620_0004202 Ga0495620_0004202_6670_7377 235
352 3300046516 Ga0495628_0129646 Ga0495628_0129646_178_903 235
353 3300046518 Ga0495631_0000330 Ga0495631_0000330_2830_3537 235
354 3300046518 Ga0495631_0000831 Ga0495631_0000831_15851_16558 235
355 3300046519 Ga0495632_0029601 Ga0495632_0029601_2065_2772 235
356 3300046519 Ga0495632_0153999 Ga0495632_0153999_211_918 235
357 3300046524 Ga0495648_0002510 Ga0495648_0002510_16043_16750 235
358 3300046524 Ga0495648_0073091 Ga0495648_0073091_701_1408 235
359 3300046533 Ga0495640_0206144 Ga0495640_0206144_96_821 235
360 3300046535 Ga0495586_0033390 Ga0495586_0033390_260_985 235
361 3300046538 Ga0495609_0006867 Ga0495609_0006867_4943_5650 235
362 3300046559 Ga0495667_0018565 Ga0495667_0018565_2884_3609 235
363 3300046642 Ga0495634_0025974 Ga0495634_0025974_118_843 235
364 3300046648 Ga0495611_0000001 Ga0495611_0000001_548218_548925 235
365 3300046648 Ga0495611_0011433 Ga0495611_0011433_263_970 235
366 3300046660 Ga0495625_0000001 Ga0495625_0000001_1367122_1367829 235
367 3300046660 Ga0495625_0024822 Ga0495625_0024822_925_1632 235
368 3300046665 Ga0495661_0000396 Ga0495661_0000396_25_732 235
369 3300046678 Ga0495599_0019628 Ga0495599_0019628_1140_1865 235
370 3300046691 Ga0495670_0016207 Ga0495670_0016207_153_860 235
371 3300046691 Ga0495670_0159804 Ga0495670_0159804_169_876 235
372 3300046794 Ga0495589_0000294 Ga0495589_0000294_2047_2754 235
373 3300046809 Ga0495600_0102800 Ga0495600_0102800_149_874 235
374 3300046810 Ga0495660_0021882 Ga0495660_0021882_99_806 235
375 3300047322 Ga0495680_0034485 Ga0495680_0034485_1952_2677 235
376 3300047323 Ga0495683_0045015 Ga0495683_0045015_104_811 235
377 3300047446 Ga0495679_000001 Ga0495679_000001_1039671_1040378 235
378 3300047469 Ga0495673_0001155 Ga0495673_0001155_148_855 235
379 3300047469 Ga0495673_0009326 Ga0495673_0009326_304_1011 235
380 3300047471 Ga0495684_0200772 Ga0495684_0200772_27_752 235
381 3300047472 Ga0495686_0007770 Ga0495686_0007770_4437_5144 235
382 3300047472 Ga0495686_0049452 Ga0495686_0049452_249_956 235
383 3300047472 Ga0495686_0070261 Ga0495686_0070261_1355_2062 235
384 3300048909 Ga0496106_0019509 Ga0496106_0019509_497_1204 235
385 3300048920 Ga0496117_0001940 Ga0496117_0001940_26417_27139 235
386 3300048921 Ga0496118_0000145 Ga0496118_0000145_104817_105539 235
387 3300048924 Ga0496121_0049797 Ga0496121_0049797_70_777 235
388 3300048924 Ga0496121_0168057 Ga0496121_0168057_322_1029 235
389 3300048925 Ga0496122_0087977 Ga0496122_0087977_1287_2009 235
390 3300048925 Ga0496122_0097781 Ga0496122_0097781_732_1439 235
391 3300048926 Ga0496123_0019168 Ga0496123_0019168_328_1035 235
392 3300048926 Ga0496123_0021793 Ga0496123_0021793_3851_4573 235
393 3300048927 Ga0496124_0006439 Ga0496124_0006439_11604_12311 235
394 3300048927 Ga0496124_0008101 Ga0496124_0008101_4851_5558 235
395 3300049459 Ga0495678_000207 Ga0495678_000207_67624_68331 235
396 3300049460 Ga0495682_0016606 Ga0495682_0016606_1680_2387 235
397 3300049581 Ga0501047_0116830 Ga0501047_0116830_783_1493 235
398 3300049823 Ga0501044_0051582 Ga0501044_0051582_1133_1855 235
399 3300050512 nmdc:mga0n895_471382_c1 nmdc:mga0n895_471382_c1_292_1005 235
400 3300053085 Ga0495619_0018952 Ga0495619_0018952_2564_3289 235
401 3300053087 Ga0500643_000002 Ga0500643_000002_1276858_1277565 235
402 3300053103 Ga0500555_000949 Ga0500555_000949_70_777 235
403 3300053160 Ga0500633_0142012 Ga0500633_0142012_155_862 235
404 3300053730 Ga0500645_044384 Ga0500645_044384_531_1238 235
405 iso_pu_bacteria 8003014200 8003014724 235
406 3300005356 Ga0070674_100122392 Ga0070674_1001223922 236
407 3300005543 Ga0070672_100103875 Ga0070672_1001038752 236
408 3300005546 Ga0070696_100122328 Ga0070696_1001223282 236
409 3300005549 Ga0070704_100321924 Ga0070704_1003219242 236
410 3300009176 Ga0105242_10360440 Ga0105242_103604401 236
411 3300013104 Ga0157370_10125891 Ga0157370_101258913 236
412 3300013308 Ga0157375_10026397 Ga0157375_100263976 236
413 3300014497 Ga0182008_10027901 Ga0182008_100279013 236
414 3300015261 Ga0182006_1012945 Ga0182006_10129454 236
415 3300015262 Ga0182007_10015116 Ga0182007_100151163 236
416 3300025925 Ga0207650_10092140 Ga0207650_100921403 236
417 3300025929 Ga0207664_10076314 Ga0207664_100763141 236
418 3300025940 Ga0207691_10013968 Ga0207691_100139688 236
419 3300025940 Ga0207691_10076008 Ga0207691_100760083 236
420 3300026089 Ga0207648_10213839 Ga0207648_102138392 236
421 3300046537 Ga0495598_0008132 Ga0495598_0008132_1584_2303 236
422 3300049742 Ga0501080_0026718 Ga0501080_0026718_2003_2731 236
423 iso_pu_bacteria 2537561836 2538834545 236
424 iso_pu_bacteria 2643221562 2643829949 236
425 iso_pu_bacteria 2687453130 2687582415 236
426 iso_pu_bacteria 2884338543 2884340077 236
427 iso_pu_bacteria 2939611941 2939612144 236
428 iso_pu_bacteria 2941471342 2941475174 236
429 3300003320 rootH2_10000931 rootH2_100009312 237
430 3300006175 Ga0070712_100106373 Ga0070712_1001063732 237
431 3300006186 Ga0075369_10071976 Ga0075369_100719762 237
432 3300006195 Ga0075366_10049136 Ga0075366_100491363 237
433 3300009551 Ga0105238_10149829 Ga0105238_101498291 237
434 3300013104 Ga0157370_10000033 Ga0157370_1000003321 237
435 3300015265 Ga0182005_1002679 Ga0182005_10026796 237
436 3300021358 Ga0213873_10009569 Ga0213873_100095692 237
437 3300025226 Ga0209674_100348 Ga0209674_10034821 237
438 3300025233 Ga0209437_101038 Ga0209437_1010389 237
439 3300025898 Ga0207692_10095615 Ga0207692_100956152 237
440 3300025915 Ga0207693_10013634 Ga0207693_100136342 237
441 3300025924 Ga0207694_10102008 Ga0207694_101020081 237
442 3300025929 Ga0207664_10662456 Ga0207664_106624562 237
443 3300039437 Ga0436365_1298789 Ga0436365_1298789_2042_2764 237
444 3300039438 Ga0436360_0305899 Ga0436360_0305899_1403_2122 237
445 3300039447 Ga0436361_0059974 Ga0436361_0059974_2235_2954 237
446 3300039453 Ga0436362_0167405 Ga0436362_0167405_952_1671 237
447 3300042184 Ga0450908_000795 Ga0450908_000795_5068_5781 237
448 3300046501 Ga0495607_0000019 Ga0495607_0000019_105313_106026 237
449 3300046519 Ga0495632_0000080 Ga0495632_0000080_605_1318 237
450 3300048920 Ga0496117_0112097 Ga0496117_0112097_331_1044 237
451 3300050516 nmdc:mga0sz30_62511_c1 nmdc:mga0sz30_62511_c1_206_919 237
452 3300002075 JGI24738J21930_10000182 JGI24738J21930_100001825 238
453 3300005262 Ga0065165_1000118 Ga0065165_100011873 238
454 3300005327 Ga0070658_10051561 Ga0070658_100515612 238
455 3300005336 Ga0070680_100615958 Ga0070680_1006159582 238
456 3300005344 Ga0070661_100709313 Ga0070661_1007093131 238
457 3300005435 Ga0070714_100003291 Ga0070714_10000329111 238
458 3300005436 Ga0070713_100064075 Ga0070713_1000640753 238
459 3300005437 Ga0070710_10001459 Ga0070710_100014593 238
460 3300005439 Ga0070711_100008805 Ga0070711_1000088058 238
461 3300005458 Ga0070681_10006686 Ga0070681_100066866 238
462 3300005467 Ga0070706_100111917 Ga0070706_1001119173 238
463 3300005467 Ga0070706_100575807 Ga0070706_1005758071 238
464 3300005536 Ga0070697_100056569 Ga0070697_1000565694 238
465 3300005983 Ga0081540_1005564 Ga0081540_10055648 238
466 3300006028 Ga0070717_10000365 Ga0070717_100003657 238
467 3300006028 Ga0070717_10184496 Ga0070717_101844962 238
468 3300006028 Ga0070717_10714113 Ga0070717_107141132 238
469 3300006175 Ga0070712_100015197 Ga0070712_1000151976 238
470 3300009101 Ga0105247_10004235 Ga0105247_1000423510 238
471 3300014497 Ga0182008_10003328 Ga0182008_100033285 238
472 3300015261 Ga0182006_1000027 Ga0182006_100002786 238
473 3300015261 Ga0182006_1001007 Ga0182006_10010075 238
474 3300015262 Ga0182007_10004187 Ga0182007_100041872 238
475 3300015265 Ga0182005_1076930 Ga0182005_10769302 238
476 3300017792 Ga0163161_10094799 Ga0163161_100947994 238
477 3300021388 Ga0213875_10196399 Ga0213875_101963991 238
478 3300025229 Ga0209147_105466 Ga0209147_1054662 238
479 3300025258 Ga0209129_1000798 Ga0209129_100079813 238
480 3300025297 Ga0209758_1032081 Ga0209758_10320814 238
481 3300025299 Ga0209256_1011370 Ga0209256_10113702 238
482 3300025302 Ga0207426_1008705 Ga0207426_10087054 238
483 3300025303 Ga0209051_1004390 Ga0209051_10043906 238
484 3300025898 Ga0207692_10003659 Ga0207692_100036597 238
485 3300025900 Ga0207710_10057440 Ga0207710_100574402 238
486 3300025910 Ga0207684_10631804 Ga0207684_106318041 238
487 3300025912 Ga0207707_10018458 Ga0207707_100184584 238
488 3300025915 Ga0207693_10000650 Ga0207693_1000065031 238
489 3300025916 Ga0207663_10043027 Ga0207663_100430273 238
490 3300025917 Ga0207660_10312164 Ga0207660_103121642 238
491 3300025921 Ga0207652_10414956 Ga0207652_104149561 238
492 3300025928 Ga0207700_10009227 Ga0207700_100092276 238
493 3300025929 Ga0207664_10082800 Ga0207664_100828003 238
494 3300031731 Ga0307405_10401415 Ga0307405_104014152 238
495 3300031911 Ga0307412_10007137 Ga0307412_100071372 238
496 3300037853 Ga0436364_0563324 Ga0436364_0563324_469_1191 238
497 3300038443 Ga0395901_0435421 Ga0395901_0435421_439_1170 238
498 3300039437 Ga0436365_1221803 Ga0436365_1221803_113_835 238
499 3300039450 Ga0436363_0407566 Ga0436363_0407566_602_1324 238
500 3300039450 Ga0436363_1276848 Ga0436363_1276848_7656_8378 238
501 3300041404 Ga0439436_0000038 Ga0439436_0000038_9834_10550 238
502 3300041413 Ga0439465_0000102 Ga0439465_0000102_771_1487 238
503 3300044672 Ga0466982_0032234 Ga0466982_0032234_1944_2660 238
504 3300046507 Ga0495606_0282915 Ga0495606_0282915_111_827 238
505 3300046512 Ga0495610_0008235 Ga0495610_0008235_6024_6740 238
506 3300046694 Ga0495649_0057035 Ga0495649_0057035_51_767 238
507 3300046810 Ga0495660_0000078 Ga0495660_0000078_269_985 238
508 3300047469 Ga0495673_0000001 Ga0495673_0000001_1437476_1438192 238
509 3300048903 Ga0496100_0001623 Ga0496100_0001623_952_1668 238
510 3300048904 Ga0496101_0002373 Ga0496101_0002373_6861_7577 238
511 3300048922 Ga0496119_0182866 Ga0496119_0182866_322_1038 238
512 3300048924 Ga0496121_0015154 Ga0496121_0015154_4453_5169 238
513 3300048925 Ga0496122_0140188 Ga0496122_0140188_781_1497 238
514 3300049571 Ga0501034_0004123 Ga0501034_0004123_2649_3365 238
515 3300049571 Ga0501034_0041584 Ga0501034_0041584_608_1324 238
516 3300049574 Ga0501038_0019376 Ga0501038_0019376_453_1169 238
517 3300049579 Ga0501043_0047144 Ga0501043_0047144_2405_3121 238
518 3300049581 Ga0501047_0002958 Ga0501047_0002958_14137_14853 238
519 3300049581 Ga0501047_0012080 Ga0501047_0012080_5415_6131 238
520 3300049581 Ga0501047_0417703 Ga0501047_0417703_124_840 238
521 3300049583 Ga0501067_0003364 Ga0501067_0003364_2816_3532 238
522 3300049584 Ga0501068_0020417 Ga0501068_0020417_1281_1997 238
523 3300049585 Ga0501069_0017577 Ga0501069_0017577_2676_3392 238
524 3300049586 Ga0501070_0043369 Ga0501070_0043369_1505_2221 238
525 3300049588 Ga0501072_0042715 Ga0501072_0042715_203_919 238
526 3300049589 Ga0501073_0000441 Ga0501073_0000441_10397_11113 238
527 3300049589 Ga0501073_0094260 Ga0501073_0094260_1335_2051 238
528 3300049589 Ga0501073_0193970 Ga0501073_0193970_331_1047 238
529 3300049589 Ga0501073_0283187 Ga0501073_0283187_392_1111 238
530 3300049590 Ga0501074_0110056 Ga0501074_0110056_1012_1728 238
531 3300049590 Ga0501074_0140584 Ga0501074_0140584_361_1080 238
532 3300049741 Ga0501079_0056772 Ga0501079_0056772_1765_2481 238
533 3300049742 Ga0501080_0000627 Ga0501080_0000627_20765_21481 238
534 3300049742 Ga0501080_0017160 Ga0501080_0017160_2874_3590 238
535 3300049742 Ga0501080_0111848 Ga0501080_0111848_250_966 238
536 3300049742 Ga0501080_0117547 Ga0501080_0117547_218_937 238
537 3300049744 Ga0501083_0005730 Ga0501083_0005730_5385_6101 238
538 3300049744 Ga0501083_0015523 Ga0501083_0015523_1076_1795 238
539 3300049822 Ga0501035_0075758 Ga0501035_0075758_1813_2529 238
540 3300049823 Ga0501044_0028449 Ga0501044_0028449_2713_3429 238
541 3300049823 Ga0501044_0092060 Ga0501044_0092060_993_1709 238
542 3300050493 nmdc:mga0k408_193586_c1 nmdc:mga0k408_193586_c1_165_890 238
543 3300053093 Ga0500651_0000461 Ga0500651_0000461_2323_3045 238
544 3300060353 Ga0501082_0040632 Ga0501082_0040632_158_877 238
545 3300060353 Ga0501082_0047113 Ga0501082_0047113_609_1325 238
546 iso_pu_bacteria 2643221577 2643894172 238
547 iso_pu_bacteria 2643221685 2644476374 238
548 3300005290 Ga0065712_10190198 Ga0065712_101901981 239
549 3300005327 Ga0070658_10019842 Ga0070658_100198425 239
550 3300005335 Ga0070666_10000007 Ga0070666_10000007232 239
551 3300005336 Ga0070680_100002634 Ga0070680_1000026342 239
552 3300005336 Ga0070680_100089464 Ga0070680_1000894642 239
553 3300005336 Ga0070680_100122671 Ga0070680_1001226713 239
554 3300005344 Ga0070661_100026497 Ga0070661_1000264975 239
555 3300005366 Ga0070659_100621929 Ga0070659_1006219292 239
556 3300005437 Ga0070710_10066236 Ga0070710_100662362 239
557 3300005439 Ga0070711_100027900 Ga0070711_1000279004 239
558 3300005458 Ga0070681_10002254 Ga0070681_100022547 239
559 3300005458 Ga0070681_10024298 Ga0070681_100242982 239
560 3300005458 Ga0070681_10094402 Ga0070681_100944023 239
561 3300005467 Ga0070706_100101382 Ga0070706_1001013824 239
562 3300005530 Ga0070679_100024092 Ga0070679_1000240922 239
563 3300005535 Ga0070684_100466967 Ga0070684_1004669672 239
564 3300005548 Ga0070665_100002099 Ga0070665_10000209913 239
565 3300005563 Ga0068855_100207939 Ga0068855_1002079392 239
566 3300005614 Ga0068856_100428607 Ga0068856_1004286072 239
567 3300005843 Ga0068860_100076566 Ga0068860_1000765664 239
568 3300006028 Ga0070717_10216191 Ga0070717_102161912 239
569 3300006914 Ga0075436_100095570 Ga0075436_1000955704 239
570 3300007076 Ga0075435_100290990 Ga0075435_1002909902 239
571 3300007788 Ga0099795_10002257 Ga0099795_100022574 239
572 3300007788 Ga0099795_10008729 Ga0099795_100087294 239
573 3300009093 Ga0105240_10818233 Ga0105240_108182332 239
574 3300009551 Ga0105238_10000179 Ga0105238_1000017937 239
575 3300010159 Ga0099796_10001338 Ga0099796_100013383 239
576 3300010159 Ga0099796_10030637 Ga0099796_100306372 239
577 3300013100 Ga0157373_10231720 Ga0157373_102317201 239
578 3300013100 Ga0157373_10249517 Ga0157373_102495172 239
579 3300013104 Ga0157370_10409183 Ga0157370_104091831 239
580 3300013105 Ga0157369_10116263 Ga0157369_101162633 239
581 3300013105 Ga0157369_10577791 Ga0157369_105777912 239
582 3300013105 Ga0157369_10775580 Ga0157369_107755802 239
583 3300013306 Ga0163162_10005700 Ga0163162_100057005 239
584 3300014497 Ga0182008_10036076 Ga0182008_100360764 239
585 3300014497 Ga0182008_10049628 Ga0182008_100496282 239
586 3300014969 Ga0157376_10779387 Ga0157376_107793871 239
587 3300015685 Ga0183369_1009 Ga0183369_1009223 239
588 3300021388 Ga0213875_10001186 Ga0213875_100011864 239
589 3300021388 Ga0213875_10028472 Ga0213875_100284723 239
590 3300025898 Ga0207692_10079126 Ga0207692_100791262 239
591 3300025903 Ga0207680_10000002 Ga0207680_10000002594 239
592 3300025912 Ga0207707_10000502 Ga0207707_1000050210 239
593 3300025912 Ga0207707_10047058 Ga0207707_100470584 239
594 3300025912 Ga0207707_10120936 Ga0207707_101209363 239
595 3300025912 Ga0207707_10343981 Ga0207707_103439812 239
596 3300025912 Ga0207707_10600708 Ga0207707_106007082 239
597 3300025913 Ga0207695_10271656 Ga0207695_102716562 239
598 3300025913 Ga0207695_10747441 Ga0207695_107474411 239
599 3300025915 Ga0207693_10008637 Ga0207693_100086377 239
600 3300025917 Ga0207660_10004528 Ga0207660_100045285 239
601 3300025917 Ga0207660_10107874 Ga0207660_101078741 239
602 3300025917 Ga0207660_10274574 Ga0207660_102745742 239
603 3300025920 Ga0207649_10122565 Ga0207649_101225652 239
604 3300025921 Ga0207652_10008543 Ga0207652_100085438 239
605 3300025921 Ga0207652_10159165 Ga0207652_101591653 239
606 3300025921 Ga0207652_10294165 Ga0207652_102941652 239
607 3300025924 Ga0207694_10000369 Ga0207694_1000036930 239
608 3300025928 Ga0207700_10080160 Ga0207700_100801602 239
609 3300025928 Ga0207700_10226563 Ga0207700_102265632 239
610 3300025929 Ga0207664_10022281 Ga0207664_100222812 239
611 3300025929 Ga0207664_10290846 Ga0207664_102908462 239
612 3300025939 Ga0207665_10009168 Ga0207665_100091685 239
613 3300025944 Ga0207661_10173590 Ga0207661_101735902 239
614 3300025972 Ga0207668_10435828 Ga0207668_104358282 239
615 3300026035 Ga0207703_10636423 Ga0207703_106364232 239
616 3300026067 Ga0207678_10108359 Ga0207678_101083592 239
617 3300028379 Ga0268266_10000004 Ga0268266_10000004590 239
618 3300028381 Ga0268264_10059284 Ga0268264_100592844 239
619 3300033180 Ga0307510_10000813 Ga0307510_1000081317 239
620 3300034816 Ga0373930_0073532 Ga0373930_0073532_15_740 239
621 3300035089 Ga0373944_0015282 Ga0373944_0015282_71_796 239
622 3300035170 Ga0373943_0215690 Ga0373943_0215690_241_966 239
623 3300035172 Ga0373955_0128304 Ga0373955_0128304_716_1450 239
624 3300035172 Ga0373955_0174895 Ga0373955_0174895_52_777 239
625 3300035207 Ga0373942_0079753 Ga0373942_0079753_84_809 239
626 3300035695 Ga0373927_0110212 Ga0373927_0110212_437_1162 239
627 3300035695 Ga0373927_0357752 Ga0373927_0357752_40_765 239
628 3300035724 Ga0373933_0008921 Ga0373933_0008921_1385_2119 239
629 3300035725 Ga0373947_0046670 Ga0373947_0046670_1858_2583 239
630 3300036401 Ga0373937_0002148 Ga0373937_0002148_13069_13803 239
631 3300037853 Ga0436364_0004186 Ga0436364_0004186_16494_17225 239
632 3300037853 Ga0436364_0259249 Ga0436364_0259249_40410_41147 239
633 3300039437 Ga0436365_0517215 Ga0436365_0517215_553_1278 239
634 3300039447 Ga0436361_0297744 Ga0436361_0297744_8596_9345 239
635 3300039450 Ga0436363_1679139 Ga0436363_1679139_2027_2752 239
636 3300039453 Ga0436362_0518518 Ga0436362_0518518_260_988 239
637 3300045976 Ga0466967_0060527 Ga0466967_0060527_2196_2921 239
638 3300045976 Ga0466967_0072924 Ga0466967_0072924_1213_1947 239
639 3300046471 Ga0495650_0000250 Ga0495650_0000250_95621_96340 239
640 3300046507 Ga0495606_0054946 Ga0495606_0054946_252_971 239
641 3300046660 Ga0495625_0005238 Ga0495625_0005238_440_1159 239
642 3300048907 Ga0496104_0203191 Ga0496104_0203191_907_1632 239
643 3300048911 Ga0496108_0200510 Ga0496108_0200510_635_1360 239
644 3300048915 Ga0496112_0099145 Ga0496112_0099145_1537_2262 239
645 3300048916 Ga0496113_0169097 Ga0496113_0169097_91_816 239
646 3300048918 Ga0496115_0053534 Ga0496115_0053534_1334_2068 239
647 3300048921 Ga0496118_0006961 Ga0496118_0006961_3391_4110 239
648 3300048928 Ga0496125_0334123 Ga0496125_0334123_153_872 239
649 3300048929 Ga0496126_0193328 Ga0496126_0193328_184_903 239
650 3300049569 Ga0501032_0094368 Ga0501032_0094368_239_958 239
651 3300049574 Ga0501038_0333182 Ga0501038_0333182_328_1047 239
652 3300049578 Ga0501042_0432665 Ga0501042_0432665_61_780 239
653 3300049580 Ga0501046_0282345 Ga0501046_0282345_457_1176 239
654 3300049581 Ga0501047_0026836 Ga0501047_0026836_680_1399 239
655 3300049822 Ga0501035_0017552 Ga0501035_0017552_4611_5330 239
656 3300050512 nmdc:mga0n895_371751_c1 nmdc:mga0n895_371751_c1_397_1122 239
657 3300050514 nmdc:mga08x19_88445_c1 nmdc:mga08x19_88445_c1_1168_1893 239
658 iso_pu_bacteria 2739367700 2739730632 239
659 iso_pu_bacteria 2884411467 2884415128 239
660 iso_pu_bacteria 2928963466 2928964306 239
661 3300005335 Ga0070666_10205378 Ga0070666_102053782 240
662 3300005337 Ga0070682_100038344 Ga0070682_1000383442 240
663 3300005337 Ga0070682_100068133 Ga0070682_1000681332 240
664 3300005355 Ga0070671_100062628 Ga0070671_1000626282 240
665 3300005366 Ga0070659_100112934 Ga0070659_1001129342 240
666 3300005435 Ga0070714_100000619 Ga0070714_1000006195 240
667 3300005444 Ga0070694_100262054 Ga0070694_1002620542 240
668 3300005458 Ga0070681_10107674 Ga0070681_101076742 240
669 3300005530 Ga0070679_100074170 Ga0070679_1000741704 240
670 3300005530 Ga0070679_100612922 Ga0070679_1006129221 240
671 3300005535 Ga0070684_100277664 Ga0070684_1002776642 240
672 3300005536 Ga0070697_100343845 Ga0070697_1003438452 240
673 3300005546 Ga0070696_100011973 Ga0070696_1000119735 240
674 3300005547 Ga0070693_100031375 Ga0070693_1000313754 240
675 3300005577 Ga0068857_100112181 Ga0068857_1001121812 240
676 3300005614 Ga0068856_100380164 Ga0068856_1003801642 240
677 3300005842 Ga0068858_100125853 Ga0068858_1001258532 240
678 3300009093 Ga0105240_10520385 Ga0105240_105203851 240
679 3300009093 Ga0105240_10773019 Ga0105240_107730192 240
680 3300009174 Ga0105241_10053273 Ga0105241_100532734 240
681 3300009545 Ga0105237_10668727 Ga0105237_106687271 240
682 3300013104 Ga0157370_10025052 Ga0157370_100250523 240
683 3300013105 Ga0157369_10003288 Ga0157369_1000328810 240
684 3300013306 Ga0163162_10256254 Ga0163162_102562542 240
685 3300013307 Ga0157372_10055941 Ga0157372_100559414 240
686 3300013308 Ga0157375_10730390 Ga0157375_107303902 240
687 3300014325 Ga0163163_11081778 Ga0163163_110817781 240
688 3300014497 Ga0182008_10104619 Ga0182008_101046192 240
689 3300014745 Ga0157377_10498111 Ga0157377_104981111 240
690 3300015262 Ga0182007_10063842 Ga0182007_100638422 240
691 3300021361 Ga0213872_10052405 Ga0213872_100524052 240
692 3300025903 Ga0207680_10313996 Ga0207680_103139962 240
693 3300025904 Ga0207647_10001338 Ga0207647_1000133814 240
694 3300025912 Ga0207707_10007639 Ga0207707_100076395 240
695 3300025912 Ga0207707_10031732 Ga0207707_100317324 240
696 3300025914 Ga0207671_10472418 Ga0207671_104724181 240
697 3300025921 Ga0207652_10047503 Ga0207652_100475033 240
698 3300025921 Ga0207652_10705061 Ga0207652_107050611 240
699 3300025929 Ga0207664_10000226 Ga0207664_1000022640 240
700 3300025929 Ga0207664_10232170 Ga0207664_102321702 240
701 3300025929 Ga0207664_10291235 Ga0207664_102912352 240
702 3300025931 Ga0207644_10061113 Ga0207644_100611132 240
703 3300025932 Ga0207690_10001747 Ga0207690_100017473 240
704 3300025932 Ga0207690_10015946 Ga0207690_100159465 240
705 3300025932 Ga0207690_10022943 Ga0207690_100229433 240
706 3300025932 Ga0207690_10083885 Ga0207690_100838851 240
707 3300025933 Ga0207706_10064405 Ga0207706_100644054 240
708 3300025933 Ga0207706_10142881 Ga0207706_101428813 240
709 3300025939 Ga0207665_10166401 Ga0207665_101664012 240
710 3300025949 Ga0207667_10115210 Ga0207667_101152103 240
711 3300026023 Ga0207677_10487032 Ga0207677_104870322 240
712 3300026116 Ga0207674_10032194 Ga0207674_100321945 240
713 3300026116 Ga0207674_10144398 Ga0207674_101443983 240
714 3300031344 Ga0265316_10099774 Ga0265316_100997742 240
715 3300035117 Ga0373953_0005127 Ga0373953_0005127_568_1299 240
716 3300035117 Ga0373953_0039241 Ga0373953_0039241_94_825 240
717 3300035118 Ga0373954_0000639 Ga0373954_0000639_6693_7424 240
718 3300035118 Ga0373954_0095537 Ga0373954_0095537_543_1274 240
719 3300035119 Ga0373956_0023798 Ga0373956_0023798_897_1628 240
720 3300035172 Ga0373955_0052076 Ga0373955_0052076_1104_1835 240
721 3300035725 Ga0373947_0045265 Ga0373947_0045265_928_1668 240
722 3300036401 Ga0373937_0021372 Ga0373937_0021372_1212_1943 240
723 3300037312 Ga0395899_0308669 Ga0395899_0308669_166_888 240
724 3300037418 Ga0395900_0043584 Ga0395900_0043584_2089_2811 240
725 3300037418 Ga0395900_0153600 Ga0395900_0153600_1303_2025 240
726 3300037466 Ga0395898_0032999 Ga0395898_0032999_3693_4415 240
727 3300037853 Ga0436364_1410323 Ga0436364_1410323_321_1058 240
728 3300038443 Ga0395901_0033326 Ga0395901_0033326_1460_2182 240
729 3300038443 Ga0395901_0039218 Ga0395901_0039218_4007_4729 240
730 3300038443 Ga0395901_0055402 Ga0395901_0055402_2337_3059 240
731 3300038443 Ga0395901_0104326 Ga0395901_0104326_891_1613 240
732 3300038443 Ga0395901_0221558 Ga0395901_0221558_191_913 240
733 3300039437 Ga0436365_0008782 Ga0436365_0008782_576_1313 240
734 3300039437 Ga0436365_1585383 Ga0436365_1585383_15_752 240
735 3300039447 Ga0436361_0201225 Ga0436361_0201225_399_1148 240
736 3300039447 Ga0436361_0974234 Ga0436361_0974234_1522_2274 240
737 3300046454 Ga0495592_0018927 Ga0495592_0018927_2353_3084 240
738 3300046476 Ga0495662_0043121 Ga0495662_0043121_508_1239 240
739 3300046516 Ga0495628_0097579 Ga0495628_0097579_1037_1768 240
740 3300046533 Ga0495640_0043087 Ga0495640_0043087_1520_2251 240
741 3300046559 Ga0495667_0002059 Ga0495667_0002059_8021_8752 240
742 3300046559 Ga0495667_0181775 Ga0495667_0181775_37_768 240
743 3300046642 Ga0495634_0025672 Ga0495634_0025672_895_1626 240
744 3300046663 Ga0495635_0066916 Ga0495635_0066916_426_1157 240
745 3300046678 Ga0495599_0012302 Ga0495599_0012302_941_1672 240
746 3300047322 Ga0495680_0004554 Ga0495680_0004554_6116_6847 240
747 3300047472 Ga0495686_0000085 Ga0495686_0000085_36579_37301 240
748 3300048916 Ga0496113_0408716 Ga0496113_0408716_272_994 240
749 3300048920 Ga0496117_0121292 Ga0496117_0121292_337_1059 240
750 3300048924 Ga0496121_0002293 Ga0496121_0002293_19513_20235 240
751 3300048925 Ga0496122_0046804 Ga0496122_0046804_82_804 240
752 3300048928 Ga0496125_0051590 Ga0496125_0051590_530_1252 240
753 3300049571 Ga0501034_0034131 Ga0501034_0034131_4162_4893 240
754 3300049573 Ga0501037_0055906 Ga0501037_0055906_1321_2052 240
755 3300049579 Ga0501043_0136243 Ga0501043_0136243_109_840 240
756 3300049581 Ga0501047_0048587 Ga0501047_0048587_1577_2299 240
757 3300049822 Ga0501035_0008185 Ga0501035_0008185_321_1052 240
758 3300053077 Ga0495601_0013260 Ga0495601_0013260_3410_4141 240
759 3300053084 Ga0495595_0015471 Ga0495595_0015471_1479_2210 240
760 3300053085 Ga0495619_0064315 Ga0495619_0064315_1504_2235 240
761 3300053130 Ga0500642_0006012 Ga0500642_0006012_2360_3088 240
762 3300005457 Ga0070662_100115063 Ga0070662_1001150633 241
763 3300005577 Ga0068857_100236515 Ga0068857_1002365152 241
764 3300044656 Ga0466969_0039084 Ga0466969_0039084_1533_2258 241
765 3300044672 Ga0466982_0000009 Ga0466982_0000009_173185_173910 241
766 3300044683 Ga0466965_0239226 Ga0466965_0239226_187_912 241
767 3300044684 Ga0466966_0002007 Ga0466966_0002007_9888_10613 241
768 3300044706 Ga0466964_0041063 Ga0466964_0041063_558_1283 241
769 3300044735 Ga0466968_0025209 Ga0466968_0025209_13_738 241
770 3300044765 Ga0466970_0071623 Ga0466970_0071623_614_1339 241
771 3300044901 Ga0466960_0001857 Ga0466960_0001857_5011_5736 241
772 3300045836 Ga0466958_0106624 Ga0466958_0106624_316_1041 241
773 3300048909 Ga0496106_0253285 Ga0496106_0253285_161_886 241
774 3300049569 Ga0501032_0232937 Ga0501032_0232937_51_776 241
775 3300049580 Ga0501046_0122324 Ga0501046_0122324_940_1665 241
776 3300049742 Ga0501080_0094317 Ga0501080_0094317_2026_2751 241
777 3300061719 Ga0466962_0003760 Ga0466962_0003760_455_1180 241
778 3300002705 JGI25156J39149_1002466 JGI25156J39149_10024664 242
779 3300002737 JGI25162J39368_1001846 JGI25162J39368_10018466 242
780 3300002737 JGI25162J39368_1002492 JGI25162J39368_10024924 242
781 3300002741 JGI25157J39369_1000352 JGI25157J39369_100035217 242
782 3300002772 JGI25164J39214_1000914 JGI25164J39214_10009146 242
783 3300002772 JGI25164J39214_1000926 JGI25164J39214_10009265 242
784 3300003214 JGI25165J46597_1001709 JGI25165J46597_10017095 242
785 3300003214 JGI25165J46597_1004805 JGI25165J46597_10048054 242
786 3300005337 Ga0070682_100206416 Ga0070682_1002064162 242
787 3300005435 Ga0070714_100036283 Ga0070714_1000362831 242
788 3300005436 Ga0070713_100002067 Ga0070713_10000206713 242
789 3300005455 Ga0070663_100032355 Ga0070663_1000323554 242
790 3300005530 Ga0070679_100131768 Ga0070679_1001317683 242
791 3300005546 Ga0070696_100009297 Ga0070696_1000092972 242
792 3300005547 Ga0070693_100029848 Ga0070693_1000298483 242
793 3300005563 Ga0068855_100105694 Ga0068855_1001056943 242
794 3300005578 Ga0068854_100267785 Ga0068854_1002677853 242
795 3300005614 Ga0068856_100000192 Ga0068856_10000019247 242
796 3300009545 Ga0105237_10000348 Ga0105237_1000034816 242
797 3300009551 Ga0105238_10070102 Ga0105238_100701022 242
798 3300013100 Ga0157373_10001871 Ga0157373_100018711 242
799 3300013102 Ga0157371_10294850 Ga0157371_102948502 242
800 3300013104 Ga0157370_10056558 Ga0157370_100565582 242
801 3300013104 Ga0157370_10128685 Ga0157370_101286852 242
802 3300013104 Ga0157370_10325798 Ga0157370_103257982 242
803 3300020069 Ga0197907_10984330 Ga0197907_109843302 242
804 3300020070 Ga0206356_10606524 Ga0206356_106065242 242
805 3300025226 Ga0209674_101957 Ga0209674_1019572 242
806 3300025231 Ga0207427_100112 Ga0207427_10011211 242
807 3300025231 Ga0207427_100287 Ga0207427_10028724 242
808 3300025233 Ga0209437_100567 Ga0209437_1005678 242
809 3300025233 Ga0209437_100650 Ga0209437_1006507 242
810 3300025250 Ga0209026_1000069 Ga0209026_1000069172 242
811 3300025250 Ga0209026_1000162 Ga0209026_100016273 242
812 3300025256 Ga0209759_1000906 Ga0209759_10009068 242
813 3300025256 Ga0209759_1009913 Ga0209759_10099134 242
814 3300025261 Ga0209233_1000020 Ga0209233_1000020632 242
815 3300025261 Ga0209233_1000215 Ga0209233_100021512 242
816 3300025272 Ga0209455_1000261 Ga0209455_100026138 242
817 3300025912 Ga0207707_10007385 Ga0207707_100073852 242
818 3300025913 Ga0207695_10112656 Ga0207695_101126562 242
819 3300025914 Ga0207671_10000167 Ga0207671_1000016749 242
820 3300025921 Ga0207652_10031863 Ga0207652_100318635 242
821 3300025924 Ga0207694_10094909 Ga0207694_100949092 242
822 3300025924 Ga0207694_10212050 Ga0207694_102120503 242
823 3300025928 Ga0207700_10004015 Ga0207700_100040154 242
824 3300025929 Ga0207664_10184936 Ga0207664_101849363 242
825 3300025949 Ga0207667_10111952 Ga0207667_101119523 242
826 3300025981 Ga0207640_10014359 Ga0207640_100143593 242
827 3300026067 Ga0207678_10043497 Ga0207678_100434974 242
828 3300026067 Ga0207678_10255547 Ga0207678_102555471 242
829 3300026078 Ga0207702_10000113 Ga0207702_1000011343 242
830 3300046674 Ga0495588_0295475 Ga0495588_0295475_38_769 242
831 3300049593 Ga0501077_0214547 Ga0501077_0214547_313_1059 242
832 3300001989 JGI24739J22299_10073446 JGI24739J22299_100734462 243
833 3300001990 JGI24737J22298_10001137 JGI24737J22298_100011379 243
834 3300002737 JGI25162J39368_1000236 JGI25162J39368_100023651 243
835 3300002737 JGI25162J39368_1000276 JGI25162J39368_100027625 243
836 3300002737 JGI25162J39368_1000425 JGI25162J39368_100042515 243
837 3300002738 JGI25154J39366_1003183 JGI25154J39366_10031834 243
838 3300002741 JGI25157J39369_1001653 JGI25157J39369_10016534 243
839 3300002741 JGI25157J39369_1001834 JGI25157J39369_10018341 243
840 3300002771 JGI25163J39215_1000796 JGI25163J39215_10007961 243
841 3300002772 JGI25164J39214_1000113 JGI25164J39214_10001134 243
842 3300002772 JGI25164J39214_1000281 JGI25164J39214_100028124 243
843 3300003214 JGI25165J46597_1000158 JGI25165J46597_100015831 243
844 3300003214 JGI25165J46597_1000377 JGI25165J46597_100037725 243
845 3300003578 Ga0006562J51391_1012556 Ga0006562J51391_10125567 243
846 3300003751 Ga0055538_1002100 Ga0055538_10021003 243
847 3300003759 Ga0055525_1000239 Ga0055525_100023944 243
848 3300003760 Ga0055527_1000066 Ga0055527_100006683 243
849 3300003760 Ga0055527_1000136 Ga0055527_100013643 243
850 3300003760 Ga0055527_1007973 Ga0055527_10079731 243
851 3300003761 Ga0055535_1000058 Ga0055535_10000586 243
852 3300003761 Ga0055535_1000528 Ga0055535_100052825 243
853 3300003761 Ga0055535_1001090 Ga0055535_100109010 243
854 3300003761 Ga0055535_1002060 Ga0055535_10020607 243
855 3300003761 Ga0055535_1002684 Ga0055535_10026842 243
856 3300003762 Ga0055542_1000085 Ga0055542_10000856 243
857 3300003762 Ga0055542_1000199 Ga0055542_100019943 243
858 3300003762 Ga0055542_1000315 Ga0055542_10003157 243
859 3300003762 Ga0055542_1000347 Ga0055542_100034725 243
860 3300003762 Ga0055542_1002060 Ga0055542_10020605 243
861 3300003762 Ga0055542_1002563 Ga0055542_10025632 243
862 3300003763 Ga0055529_1000173 Ga0055529_100017373 243
863 3300003763 Ga0055529_1000240 Ga0055529_100024062 243
864 3300003763 Ga0055529_1000369 Ga0055529_100036924 243
865 3300003763 Ga0055529_1001027 Ga0055529_10010278 243
866 3300005262 Ga0065165_1000947 Ga0065165_100094717 243
867 3300005457 Ga0070662_100046265 Ga0070662_1000462654 243
868 3300005466 Ga0070685_10021413 Ga0070685_100214132 243
869 3300005577 Ga0068857_100000255 Ga0068857_10000025532 243
870 3300005614 Ga0068856_100003624 Ga0068856_1000036249 243
871 3300005616 Ga0068852_100161486 Ga0068852_1001614861 243
872 3300005842 Ga0068858_100013862 Ga0068858_1000138629 243
873 3300009093 Ga0105240_10020645 Ga0105240_100206455 243
874 3300009093 Ga0105240_10022344 Ga0105240_100223445 243
875 3300009093 Ga0105240_10060335 Ga0105240_100603352 243
876 3300009545 Ga0105237_10000026 Ga0105237_1000002670 243
877 3300010375 Ga0105239_10000022 Ga0105239_10000022200 243
878 3300010375 Ga0105239_10016630 Ga0105239_100166303 243
879 3300012500 Ga0157314_1000933 Ga0157314_10009333 243
880 3300012502 Ga0157347_1001314 Ga0157347_10013141 243
881 3300013105 Ga0157369_10107115 Ga0157369_101071151 243
882 3300013105 Ga0157369_10154887 Ga0157369_101548874 243
883 3300013306 Ga0163162_10365594 Ga0163162_103655942 243
884 3300014969 Ga0157376_10004544 Ga0157376_100045442 243
885 3300015687 Ga0183368_1004 Ga0183368_100488 243
886 3300025207 Ga0209760_100900 Ga0209760_1009004 243
887 3300025224 Ga0209784_100158 Ga0209784_10015837 243
888 3300025225 Ga0209566_101992 Ga0209566_1019925 243
889 3300025226 Ga0209674_100016 Ga0209674_100016541 243
890 3300025226 Ga0209674_100202 Ga0209674_10020235 243
891 3300025226 Ga0209674_100700 Ga0209674_10070011 243
892 3300025228 Ga0209672_100007 Ga0209672_100007421 243
893 3300025228 Ga0209672_100018 Ga0209672_100018225 243
894 3300025228 Ga0209672_101169 Ga0209672_1011695 243
895 3300025228 Ga0209672_102255 Ga0209672_1022554 243
896 3300025230 Ga0209563_100071 Ga0209563_10007198 243
897 3300025231 Ga0207427_100013 Ga0207427_100013150 243
898 3300025231 Ga0207427_100036 Ga0207427_100036204 243
899 3300025231 Ga0207427_102910 Ga0207427_1029101 243
900 3300025233 Ga0209437_100015 Ga0209437_100015387 243
901 3300025233 Ga0209437_100106 Ga0209437_100106129 243
902 3300025233 Ga0209437_100127 Ga0209437_100127147 243
903 3300025242 Ga0209258_100017 Ga0209258_100017397 243
904 3300025242 Ga0209258_100024 Ga0209258_100024331 243
905 3300025242 Ga0209258_100035 Ga0209258_100035156 243
906 3300025242 Ga0209258_100043 Ga0209258_100043247 243
907 3300025242 Ga0209258_100256 Ga0209258_10025631 243
908 3300025242 Ga0209258_100527 Ga0209258_10052735 243
909 3300025246 Ga0209646_1000511 Ga0209646_10005113 243
910 3300025246 Ga0209646_1002363 Ga0209646_10023634 243
911 3300025250 Ga0209026_1000056 Ga0209026_1000056111 243
912 3300025250 Ga0209026_1000092 Ga0209026_1000092133 243
913 3300025250 Ga0209026_1002320 Ga0209026_10023206 243
914 3300025250 Ga0209026_1003343 Ga0209026_10033431 243
915 3300025254 Ga0209148_1000002 Ga0209148_10000021801 243
916 3300025254 Ga0209148_1000009 Ga0209148_1000009659 243
917 3300025254 Ga0209148_1000010 Ga0209148_1000010527 243
918 3300025254 Ga0209148_1000045 Ga0209148_100004586 243
919 3300025254 Ga0209148_1000048 Ga0209148_1000048205 243
920 3300025254 Ga0209148_1000084 Ga0209148_1000084214 243
921 3300025256 Ga0209759_1000317 Ga0209759_100031750 243
922 3300025256 Ga0209759_1000683 Ga0209759_100068310 243
923 3300025256 Ga0209759_1000950 Ga0209759_10009504 243
924 3300025261 Ga0209233_1000009 Ga0209233_1000009644 243
925 3300025261 Ga0209233_1000101 Ga0209233_1000101204 243
926 3300025272 Ga0209455_1000010 Ga0209455_1000010421 243
927 3300025272 Ga0209455_1000020 Ga0209455_100002077 243
928 3300025272 Ga0209455_1000029 Ga0209455_1000029331 243
929 3300025272 Ga0209455_1000035 Ga0209455_100003586 243
930 3300025272 Ga0209455_1011073 Ga0209455_10110732 243
931 3300025297 Ga0209758_1001731 Ga0209758_100173125 243
932 3300025321 Ga0207656_10004996 Ga0207656_100049964 243
933 3300025904 Ga0207647_10019730 Ga0207647_100197306 243
934 3300025913 Ga0207695_10000596 Ga0207695_100005965 243
935 3300025913 Ga0207695_10002223 Ga0207695_100022237 243
936 3300025913 Ga0207695_10007083 Ga0207695_100070835 243
937 3300025914 Ga0207671_10000041 Ga0207671_10000041118 243
938 3300025920 Ga0207649_10177366 Ga0207649_101773662 243
939 3300025949 Ga0207667_10000665 Ga0207667_1000066526 243
940 3300025949 Ga0207667_10000921 Ga0207667_1000092114 243
941 3300025981 Ga0207640_10000099 Ga0207640_100000997 243
942 3300025981 Ga0207640_10003733 Ga0207640_100037339 243
943 3300026067 Ga0207678_10051970 Ga0207678_100519702 243
944 3300026067 Ga0207678_10195808 Ga0207678_101958082 243
945 3300026116 Ga0207674_10000106 Ga0207674_100001066 243
946 3300026142 Ga0207698_10575382 Ga0207698_105753822 243
947 3300028381 Ga0268264_10923017 Ga0268264_109230171 243
948 3300037312 Ga0395899_0000119 Ga0395899_0000119_93159_93893 243
949 3300037418 Ga0395900_0000107 Ga0395900_0000107_126305_127039 243
950 3300037466 Ga0395898_0000078 Ga0395898_0000078_87796_88530 243
951 3300037466 Ga0395898_0000211 Ga0395898_0000211_71802_72536 243
952 3300038443 Ga0395901_0433976 Ga0395901_0433976_122_856 243
953 3300044656 Ga0466969_0002045 Ga0466969_0002045_1255_1989 243
954 3300044683 Ga0466965_0052238 Ga0466965_0052238_494_1228 243
955 3300044683 Ga0466965_0230395 Ga0466965_0230395_133_867 243
956 3300044684 Ga0466966_0004172 Ga0466966_0004172_6364_7098 243
957 3300044684 Ga0466966_0005741 Ga0466966_0005741_2960_3694 243
958 3300044693 Ga0466961_0000871 Ga0466961_0000871_13084_13818 243
959 3300044693 Ga0466961_0016399 Ga0466961_0016399_369_1103 243
960 3300044693 Ga0466961_0016587 Ga0466961_0016587_326_1060 243
961 3300044693 Ga0466961_0026311 Ga0466961_0026311_2039_2773 243
962 3300044719 Ga0466971_0030586 Ga0466971_0030586_1478_2212 243
963 3300044719 Ga0466971_0042914 Ga0466971_0042914_605_1339 243
964 3300044765 Ga0466970_0035945 Ga0466970_0035945_1375_2109 243
965 3300044842 Ga0466957_0007258 Ga0466957_0007258_4526_5260 243
966 3300044842 Ga0466957_0375617 Ga0466957_0375617_67_801 243
967 3300045049 Ga0466959_0000467 Ga0466959_0000467_6772_7506 243
968 3300045049 Ga0466959_0005529 Ga0466959_0005529_4707_5441 243
969 3300045836 Ga0466958_0016257 Ga0466958_0016257_928_1662 243
970 3300045836 Ga0466958_0020784 Ga0466958_0020784_1353_2087 243
971 3300045836 Ga0466958_0425587 Ga0466958_0425587_25_759 243
972 3300045976 Ga0466967_0611033 Ga0466967_0611033_142_876 243
973 3300046460 Ga0495638_0000049 Ga0495638_0000049_163614_164348 243
974 3300046460 Ga0495638_0001093 Ga0495638_0001093_25456_26190 243
975 3300046471 Ga0495650_0000150 Ga0495650_0000150_103189_103923 243
976 3300046507 Ga0495606_0000639 Ga0495606_0000639_51108_51842 243
977 3300046694 Ga0495649_0003166 Ga0495649_0003166_8888_9622 243
978 3300048903 Ga0496100_0327337 Ga0496100_0327337_283_1014 243
979 3300048904 Ga0496101_0291290 Ga0496101_0291290_78_809 243
980 3300048907 Ga0496104_0110190 Ga0496104_0110190_404_1135 243
981 3300048907 Ga0496104_0420122 Ga0496104_0420122_292_1026 243
982 3300048908 Ga0496105_0000297 Ga0496105_0000297_212_943 243
983 3300048915 Ga0496112_0602604 Ga0496112_0602604_246_980 243
984 3300048916 Ga0496113_0008338 Ga0496113_0008338_2692_3426 243
985 3300048918 Ga0496115_0000045 Ga0496115_0000045_94437_95171 243
986 3300048918 Ga0496115_0000360 Ga0496115_0000360_751_1485 243
987 3300048918 Ga0496115_0356552 Ga0496115_0356552_381_1112 243
988 3300048919 Ga0496116_0212126 Ga0496116_0212126_149_880 243
989 3300048920 Ga0496117_0032221 Ga0496117_0032221_1554_2285 243
990 3300048921 Ga0496118_0029186 Ga0496118_0029186_3361_4092 243
991 3300048921 Ga0496118_0046092 Ga0496118_0046092_1862_2593 243
992 3300048922 Ga0496119_0000150 Ga0496119_0000150_58600_59331 243
993 3300048922 Ga0496119_0018652 Ga0496119_0018652_116_847 243
994 3300048923 Ga0496120_0006390 Ga0496120_0006390_4402_5133 243
995 3300048923 Ga0496120_0006457 Ga0496120_0006457_4333_5064 243
996 3300048924 Ga0496121_0000651 Ga0496121_0000651_57442_58173 243
997 3300048924 Ga0496121_0337976 Ga0496121_0337976_255_986 243
998 3300048928 Ga0496125_0000867 Ga0496125_0000867_95_829 243
999 3300048929 Ga0496126_0023236 Ga0496126_0023236_327_1058 243
1000 3300048929 Ga0496126_0049967 Ga0496126_0049967_1504_2235 243
1001 3300048929 Ga0496126_0324653 Ga0496126_0324653_495_1229 243
1002 3300061719 Ga0466962_0000591 Ga0466962_0000591_3810_4544 243
1003 3300061719 Ga0466962_0090264 Ga0466962_0090264_56_790 243

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01895

PhoU

PhoU domain

16

104

0.98

PF01895

PhoU

PhoU domain

119

204

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1t72-assembly1.cif.gz_A crystal structure of phosphate transport system protein phou from aquifex aeolicus 0.9649 11 219
1sum-assembly1.cif.gz_B crystal structure of a hypothetical protein at 2.0 a resolution 0.9551 11 220
4q25-assembly1.cif.gz_B crystal structure of phou from pseudomonas aeruginosa 0.9499 13 219
2i0m-assembly1.cif.gz_A crystal structure of the phosphate transport system regulatory protein phou from streptococcus pneumoniae 0.9372 13 223
4q25-assembly1.cif.gz_B crystal structure of phou from pseudomonas aeruginosa 0.9368 13 219
ID Description Score Start End Superfamily
af_P0A9K7_118_229_1.20.58.220 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphate transport system protein phou homolog 2; domain 2 0.9864 123 220 1.20.58.220
af_Q58415_114_232_1.20.58.220 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphate transport system protein phou homolog 2; domain 2 0.9772 125 221 1.20.58.220
4q25A02 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphate transport system protein phou homolog 2; domain 2 0.9712 122 219 1.20.58.220
1t8bA01 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphate transport system protein phou homolog 2; domain 2 0.9634 12 121 1.20.58.220
2i0mA01 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphate transport system protein phou homolog 2; domain 2 0.9626 13 114 1.20.58.220
ID Description Score Start End GO Terms
AF-A0A1D2UIS5-F1-model_v4 Phosphate transport system regulatory protein PhoU 0.9967 5 201 GO:0006817
GO:0030643
GO:0045936
AF-T1C6E3-F1-model_v4 Phosphate transport system regulatory protein PhoU 0.9924 5 211 GO:0030643
GO:0045936
AF-A0A4Q3X2Z1-F1-model_v4 Phosphate signaling complex protein PhoU 0.9829 5 221 GO:0030643
GO:0045936
AF-A0A3L7Y1T1-F1-model_v4 Phosphate-specific transport system accessory protein PhoU 0.9829 12 221 GO:0005737
GO:0006817
GO:0030643
GO:0045936
AF-A0A7C2K6D2-F1-model_v4 Phosphate signaling complex protein PhoU 0.9821 1 157 GO:0006817
GO:0030643
GO:0045936

Feature Viewer

pLDDT pTM Quality
90.05 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map