F487741
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 995 | 491 | 896 | 226 |
Family's Representative Sequence
| Representative Sequence | 3300020082|Ga0206353_10205279|Ga0206353_102052791 |
| Length | 255 |
| Sequence | VDNDVLRQSPLFSALDDEAATALRASMSETRLRRGEVLFHEGDEGDKLYIVTEGKVKLGRTSSDGRENLLAIQGPGQMFGELSLFDPGPRSATVTAVTDATFSSLSHEDLLRWLDGRPAVARGLLAQLAGRLRRANDVVADLVFSDVPGRVAKALLDLADRFGRTAEDGIHVHHDLTQEELAQLVGASRETVNKALADFAHRGWLRLEGKSVLILDPERLARRVVETVYADVDPVLWGAAELSVRAQIEYLRGQG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2515154155 | Actinopolymorpha alba DSM 45243 | Isolate | Rhizosphere |
| 2 | 2554235005 | Streptomyces violaceusniger SPC6 | Isolate | Rhizosphere |
| 3 | 2558860280 | Kutzneria sp. 744 | Isolate | Unclassified |
| 4 | 2565956761 | Rhodococcus qingshengii BKS 20-40 | Isolate | Rhizosphere |
| 5 | 2582580736 | Prauserella sp. Am3 | Isolate | Unclassified |
| 6 | 2582581312 | Streptomyces atratus OK008 | Isolate | Rhizosphere |
| 7 | 2582581314 | Streptomyces mirabilis YR139 | Isolate | Rhizosphere |
| 8 | 2585427649 | Amycolatopsis japonica MG417-CF17, DSM 44213 | Isolate | Unclassified |
| 9 | 2616644814 | Streptomyces mirabilis OK461 | Isolate | Rhizosphere |
| 10 | 2616644941 | Streptomyces atratus OK807 | Isolate | Rhizosphere |
| 11 | 2643221548 | Streptomyces sp. Root55 | Isolate | Unclassified |
| 12 | 2643221567 | Phycicoccus sp. Root563 | Isolate | Unclassified |
| 13 | 2643221578 | Streptomyces sp. Root63 | Isolate | Unclassified |
| 14 | 2643221613 | Oerskovia sp. Root22 | Isolate | Unclassified |
| 15 | 2643221624 | Phycicoccus sp. Root101 | Isolate | Unclassified |
| 16 | 2643221641 | Nocardioides sp. Root122 | Isolate | Unclassified |
| 17 | 2643221673 | Streptomyces sp. Root1295 | Isolate | Unclassified |
| 18 | 2643221682 | Streptomyces sp. Root1319 | Isolate | Unclassified |
| 19 | 2643221690 | Cellulomonas sp. Root485 | Isolate | Unclassified |
| 20 | 2643221694 | Cellulomonas sp. Root137 | Isolate | Unclassified |
| 21 | 2643221721 | Oerskovia sp. Root918 | Isolate | Unclassified |
| 22 | 2643221722 | Cellulomonas sp. Root930 | Isolate | Unclassified |
| 23 | 2675903058 | Actinopolymorpha cephalotaxi CPCC 202808 | Isolate | Rhizosphere |
| 24 | 2728369276 | Kineococcus rhizosphaerae DSM 19711 | Isolate | Rhizosphere |
| 25 | 2738541308 | Rhodococcus sp. OK551 | Isolate | Unclassified |
| 26 | 2738543005 | Rhodococcus sp. OK519 | Isolate | Unclassified |
| 27 | 2738543011 | Rhodococcus sp. OK611 | Isolate | Unclassified |
| 28 | 2738543027 | Promicromonospora sp. CF082 | Isolate | Unclassified |
| 29 | 2738543034 | Rhodococcus sp. OK269 | Isolate | Unclassified |
| 30 | 2739367654 | Promicromonospora sp. YR516 | Isolate | Unclassified |
| 31 | 2739367898 | Nocardioides sp. CF479 | Isolate | Unclassified |
| 32 | 2744054611 | Aldersonia kunmingensis DSM 45001 | Isolate | Rhizosphere |
| 33 | 2758568522 | Promicromonospora thailandica SAI-039 | Isolate | Unclassified |
| 34 | 2758568621 | Promicromonospora sukumoe SAI-064 | Isolate | Unclassified |
| 35 | 2775506925 | Saccharopolyspora phatthalungensis NRRL B-24798 | Isolate | Rhizosphere |
| 36 | 2784132109 | Dermacoccus sp. DS28 SAI-028 | Isolate | Unclassified |
| 37 | 2791354901 | Actinophytocola xanthii 11-183 | Isolate | Rhizosphere |
| 38 | 2795385472 | Herbihabitans rhizosphaerae DSM 101727 | Isolate | Rhizosphere |
| 39 | 2808606365 | Phycicoccus sp. SLBN-51 | Isolate | Unclassified |
| 40 | 2808606394 | Promicromonospora sp. C35 | Isolate | Unclassified |
| 41 | 2808606522 | Amycolatopsis sp. BJA-103 | Isolate | Unclassified |
| 42 | 2811994880 | Cellulomonas sp. SLBN-39 | Isolate | Unclassified |
| 43 | 2816332139 | Pseudonocardia kunmingensis DSM 45301 | Isolate | Unclassified |
| 44 | 2818991463 | Streptomyces argenteolus 3259 | Isolate | Rhizosphere |
| 45 | 2827628540 | Actinopolymorpha cephalotaxi DSM 45117 | Isolate | Rhizosphere |
| 46 | 2835188231 | Isoptericola variabilis JZ7 | Isolate | Unclassified |
| 47 | 2839986021 | Cellulosimicrobium cellulans JZ5 | Isolate | Unclassified |
| 48 | 2842888712 | Tsukamurella sp. R-71941 | Isolate | Unclassified |
| 49 | 2857479173 | Micrococcus sp. R-74225 | Isolate | Unclassified |
| 50 | 2857481737 | Nocardioides sp. R-74106 | Isolate | Unclassified |
| 51 | 2857632687 | Micrococcus sp. R-73081 | Isolate | Unclassified |
| 52 | 2862290372 | Streptomyces triticagri NEAU-YY421 | Isolate | Rhizosphere |
| 53 | 2862574272 | Streptomyces sp. AcE210 | Isolate | Nodule |
| 54 | 2863067949 | Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) | Isolate | Rhizosphere |
| 55 | 2866552031 | Saccharopolyspora rhizosphaerae H219 | Isolate | Unclassified |
| 56 | 2866612099 | Amycolatopsis suaedae 8-3EHSu | Isolate | Unclassified |
| 57 | 2867346516 | Streptomyces radicis AZ1-7 | Isolate | Unclassified |
| 58 | 2868088558 | Phytoactinopolyspora endophytica EGI 60009 | Isolate | Unclassified |
| 59 | 2870801768 | Micrococcus endophyticus DSM 17945 | Isolate | Unclassified |
| 60 | 2870804320 | Micrococcus yunnanensis DSM 21948 | Isolate | Unclassified |
| 61 | 2873151551 | Streptomyces silaceus ACCC40021 | Isolate | Rhizosphere |
| 62 | 2875391855 | Streptomyces cavourensis 1AS2a | Isolate | Rhizosphere |
| 63 | 2884994152 | Cellulomonas sp. H30R-01 | Isolate | Rhizosphere |
| 64 | 2889300758 | Rhodococcus sp. PvR099 | Isolate | Rhizosphere |
| 65 | 2891326441 | Actinokineospora pegani TRM65233 | Isolate | Unclassified |
| 66 | 2899359706 | Amycolatopsis anabasis EGI 650086 | Isolate | Unclassified |
| 67 | 2899370129 | Amycolatopsis alkalitolerans SYSUP0005 | Isolate | Stem Tuber |
| 68 | 2904535858 | Rhodococcus erythropolis 2017 | Isolate | Unclassified |
| 69 | 2904765812 | Rhodococcus fascians 1590 | Isolate | Rhizosphere |
| 70 | 2904770941 | Rhodococcus fascians 1339 | Isolate | Rhizosphere |
| 71 | 2908811453 | Rhodococcus sp. 1R11 | Isolate | Unclassified |
| 72 | 2915358134 | Pseudonocardia pini CAP47R | Isolate | Unclassified |
| 73 | 2915768154 | Amycolatopsis pittospori PIP199 | Isolate | Unclassified |
| 74 | 2917736166 | Amycolatopsis dendrobii DR6-1 | Isolate | Unclassified |
| 75 | 2919420072 | Rhodococcus fascians 3241 | Isolate | Rhizosphere |
| 76 | 2919432681 | Rhodococcus sp. 3258 | Isolate | Rhizosphere |
| 77 | 2919446982 | Phycicoccus sp. 3266 | Isolate | Rhizosphere |
| 78 | 2922554459 | Rhodococcus sp. 66b | Isolate | Unclassified |
| 79 | 2928142448 | Prescottella equi DPS 2018 | Isolate | Unclassified |
| 80 | 2932431166 | Cellulosimicrobium sp. 4261 | Isolate | Rhizosphere |
| 81 | 2935890801 | Oerskovia enterophila 3230 | Isolate | Rhizosphere |
| 82 | 2939743619 | Rhodococcus sp. PvR044 | Isolate | Rhizosphere |
| 83 | 2946045630 | Streptomyces sp. W4I9-2 | Isolate | Rhizosphere |
| 84 | 2954002825 | Streptomyces turgidiscabies W2I16 | Isolate | Rhizosphere |
| 85 | 2956939328 | Lolliginicoccus suaedae LNNU 331112 | Isolate | Rhizosphere |
| 86 | 2966598605 | Kitasatospora papulosa SLBN-177 | Isolate | Rhizosphere |
| 87 | 2974315732 | Rhodococcus sp. SORGH_AS 301 | Isolate | Unclassified |
| 88 | 2984523437 | Rhodococcus sp. SORGH_AS303 | Isolate | Aerial Root |
| 89 | 2984576629 | Nocardioides zeae SORGH_AS913 | Isolate | Aerial Root |
| 90 | 2990256926 | Nocardioides zeae SORGH_AS885 | Isolate | Aerial Root |
| 91 | 3001119090 | Lolliginicoccus lacisalsi G463 | Isolate | Rhizosphere |
| 92 | 3001889506 | Janibacter sp. YIM B02568 | Isolate | Unclassified |
| 93 | 3006321560 | Actinacidiphila epipremni PRB2-1 | Isolate | Unclassified |
| 94 | 3006425503 | Streptomyces zingiberis PLAI1-29 | Isolate | Unclassified |
| 95 | 3006486233 | Streptomyces sp. BR123 | Isolate | Rhizosphere |
| 96 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 97 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 98 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 99 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 100 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 103 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 104 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 105 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 106 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 107 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 108 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 109 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 110 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 111 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 112 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 113 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 114 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 115 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 116 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 117 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 118 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 119 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 120 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 121 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 122 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 123 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 124 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 125 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 126 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 127 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 128 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 129 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 130 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 131 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 132 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 133 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 134 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 135 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 136 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 137 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 138 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 139 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 140 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 141 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 142 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 143 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 144 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 145 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 146 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 147 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 148 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 149 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 150 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 151 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 152 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 153 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 154 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 155 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 156 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 157 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 158 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 160 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 162 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 164 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 165 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 166 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 167 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 168 | 3300009988 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG | Metagenome | Rhizosphere |
| 169 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 170 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 171 | 3300012492 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 | Metagenome | Rhizosphere |
| 172 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 173 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 174 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 175 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 176 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 177 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 178 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 179 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 180 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 181 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 182 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 183 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 184 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 185 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 186 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 187 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 188 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 189 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 190 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 191 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 192 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 242 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 246 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 247 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 248 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 249 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 250 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 251 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 252 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 253 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 254 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 255 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 256 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 257 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 258 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 259 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 260 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 261 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 262 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 263 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 264 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 265 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 266 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 267 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 268 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 269 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 270 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 271 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 272 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 273 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 274 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 275 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 276 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 277 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 278 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 279 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 280 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 281 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 282 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 283 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 284 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 285 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 286 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 287 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 288 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 289 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 290 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 291 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 292 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 293 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 294 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 295 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 296 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 297 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 298 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 299 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 300 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 301 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 302 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 303 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 304 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 305 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 306 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 307 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 308 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 309 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 310 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 311 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 312 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 313 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 314 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 315 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 316 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 317 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 318 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 319 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 320 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 321 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 322 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 409 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 410 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 411 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 412 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 413 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 414 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 415 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 416 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 417 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 418 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 419 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 420 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 421 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 422 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 423 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 424 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 425 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 426 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 427 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 428 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 429 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 431 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 432 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 433 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 434 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 435 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 436 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 437 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 438 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 439 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 440 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 441 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 442 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 443 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 444 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 445 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 446 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 447 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 448 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 449 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 450 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 451 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 452 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 453 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 454 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 455 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 456 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 457 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 458 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 459 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 460 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 461 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 462 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 463 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 464 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 465 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 466 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 467 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 468 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 469 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 470 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 471 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 472 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 473 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 474 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 475 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 476 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 477 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 478 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 479 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 480 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 481 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 482 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 483 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 484 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 485 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 486 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 487 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 488 | 8003314358 | Amycolatopsis sp. MtRt-6 | Isolate | Unclassified |
| 489 | 8054609563 | Nocardioides astragali CGMCC 4.7327 | Isolate | Nodule |
| 490 | 8056207758 | Saccharopolyspora indica KCTC 29208 | Isolate | Rhizosphere |
| 491 | 8056579771 | Promicromonospora iranensis UTMC 00792 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 88.44 |
| Metatranscriptomes | 1.61 |
| Isolates | 9.95 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.3 |
| Bulb | 0 |
| Endosphere | 1.91 |
| Nodule | 0.2 |
| Rhizoplane | 6.43 |
| Rhizosphere | 80.1 |
| Stem | 0 |
| Stem Tuber | 0.1 |
| Unclassified | 10.95 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10015616 | 3300001989 | Bacteria | 2759 |
| 2 | JGI24735J21928_10045086 | 3300002067 | Bacteria | 1281 |
| 3 | JGI24735J21928_10070776 | 3300002067 | Bacteria | 999 |
| 4 | JGI25160J50197_1042269 | 3300003354 | Bacteria | 1038 |
| 5 | Ga0006562J51391_1046570 | 3300003578 | Bacteria | 2413 |
| 6 | Ga0070658_10005717 | 3300005327 | Bacteria | 10086 |
| 7 | Ga0070658_10059768 | 3300005327 | Bacteria | 3104 |
| 8 | Ga0070658_10160210 | 3300005327 | Bacteria | 1887 |
| 9 | Ga0070658_10304334 | 3300005327 | Bacteria | 1359 |
| 10 | Ga0070676_10343869 | 3300005328 | Bacteria | 1024 |
| 11 | Ga0070683_100129855 | 3300005329 | Bacteria | 2384 |
| 12 | Ga0070683_100489581 | 3300005329 | Bacteria | 1174 |
| 13 | Ga0068869_100087253 | 3300005334 | Bacteria | 2340 |
| 14 | Ga0070680_100001364 | 3300005336 | Bacteria | 17666 |
| 15 | Ga0070680_100036721 | 3300005336 | Bacteria | 3959 |
| 16 | Ga0070680_100040970 | 3300005336 | Bacteria | 3754 |
| 17 | Ga0070680_100058618 | 3300005336 | Bacteria | 3149 |
| 18 | Ga0070682_100073395 | 3300005337 | Bacteria | 2195 |
| 19 | Ga0070682_100113663 | 3300005337 | Bacteria | 1808 |
| 20 | Ga0070682_100178411 | 3300005337 | Bacteria | 1481 |
| 21 | Ga0070682_100246469 | 3300005337 | Bacteria | 1285 |
| 22 | Ga0068868_100057799 | 3300005338 | Bacteria | 3065 |
| 23 | Ga0068868_100162580 | 3300005338 | Bacteria | 1844 |
| 24 | Ga0070660_100110009 | 3300005339 | Bacteria | 2191 |
| 25 | Ga0070689_100200667 | 3300005340 | Bacteria | 1628 |
| 26 | Ga0070691_10045962 | 3300005341 | Bacteria | 2073 |
| 27 | Ga0070668_100000514 | 3300005347 | Bacteria | 25634 |
| 28 | Ga0070668_100049408 | 3300005347 | Bacteria | 3236 |
| 29 | Ga0070668_100172248 | 3300005347 | Bacteria | 1763 |
| 30 | Ga0070668_100315528 | 3300005347 | Bacteria | 1315 |
| 31 | Ga0070668_100415862 | 3300005347 | Bacteria | 1150 |
| 32 | Ga0070675_100227892 | 3300005354 | Bacteria | 1624 |
| 33 | Ga0070674_100039819 | 3300005356 | Bacteria | 3176 |
| 34 | Ga0070659_100278770 | 3300005366 | Bacteria | 1390 |
| 35 | Ga0070714_100011321 | 3300005435 | Bacteria | 7074 |
| 36 | Ga0070714_100189816 | 3300005435 | Bacteria | 1874 |
| 37 | Ga0070713_100094562 | 3300005436 | Bacteria | 2577 |
| 38 | Ga0070713_100103618 | 3300005436 | Bacteria | 2469 |
| 39 | Ga0070713_100267186 | 3300005436 | Bacteria | 1565 |
| 40 | Ga0070713_100291284 | 3300005436 | Bacteria | 1500 |
| 41 | Ga0070710_10016542 | 3300005437 | Bacteria | 3756 |
| 42 | Ga0070705_100096864 | 3300005440 | Bacteria | 1853 |
| 43 | Ga0070700_100103323 | 3300005441 | Bacteria | 1881 |
| 44 | Ga0070700_100241432 | 3300005441 | Bacteria | 1291 |
| 45 | Ga0070708_100064689 | 3300005445 | Bacteria | 3277 |
| 46 | Ga0070708_100205495 | 3300005445 | Bacteria | 1845 |
| 47 | Ga0070663_100002651 | 3300005455 | Bacteria | 10128 |
| 48 | Ga0070663_100080066 | 3300005455 | Bacteria | 2398 |
| 49 | Ga0070663_100146243 | 3300005455 | Bacteria | 1808 |
| 50 | Ga0070678_100129245 | 3300005456 | Bacteria | 2004 |
| 51 | Ga0070678_100304768 | 3300005456 | Bacteria | 1355 |
| 52 | Ga0070678_100791199 | 3300005456 | Bacteria | 860 |
| 53 | Ga0070681_10000699 | 3300005458 | Bacteria | 27854 |
| 54 | Ga0070681_10002094 | 3300005458 | Bacteria | 18131 |
| 55 | Ga0070681_10270654 | 3300005458 | Bacteria | 1610 |
| 56 | Ga0070685_10132433 | 3300005466 | Bacteria | 1560 |
| 57 | Ga0070706_100131294 | 3300005467 | Bacteria | 2337 |
| 58 | Ga0070706_100211198 | 3300005467 | Bacteria | 1812 |
| 59 | Ga0070707_100439745 | 3300005468 | Bacteria | 1265 |
| 60 | Ga0070707_100853998 | 3300005468 | Bacteria | 874 |
| 61 | Ga0070698_100000708 | 3300005471 | Bacteria | 35672 |
| 62 | Ga0070698_100000817 | 3300005471 | Bacteria | 33998 |
| 63 | Ga0070679_100000016 | 3300005530 | Bacteria | 139454 |
| 64 | Ga0070679_100005127 | 3300005530 | Bacteria | 12108 |
| 65 | Ga0070679_100217893 | 3300005530 | Bacteria | 1871 |
| 66 | Ga0070679_100277455 | 3300005530 | Bacteria | 1629 |
| 67 | Ga0070679_100558662 | 3300005530 | Bacteria | 1088 |
| 68 | Ga0070684_100003966 | 3300005535 | Bacteria | 11211 |
| 69 | Ga0070684_100119100 | 3300005535 | Bacteria | 2374 |
| 70 | Ga0070684_100141500 | 3300005535 | Bacteria | 2175 |
| 71 | Ga0070684_100305937 | 3300005535 | Bacteria | 1459 |
| 72 | Ga0068853_100025230 | 3300005539 | Bacteria | 4988 |
| 73 | Ga0070672_100307549 | 3300005543 | Bacteria | 1345 |
| 74 | Ga0070672_100372232 | 3300005543 | Bacteria | 1221 |
| 75 | Ga0070672_100373031 | 3300005543 | Bacteria | 1219 |
| 76 | Ga0070693_100309479 | 3300005547 | Bacteria | 1068 |
| 77 | Ga0070665_100134978 | 3300005548 | Bacteria | 2469 |
| 78 | Ga0070665_100234266 | 3300005548 | Bacteria | 1836 |
| 79 | Ga0070665_100312848 | 3300005548 | Bacteria | 1574 |
| 80 | Ga0070665_101288685 | 3300005548 | Bacteria | 741 |
| 81 | Ga0068855_100119246 | 3300005563 | Bacteria | 3021 |
| 82 | Ga0070664_100141426 | 3300005564 | Bacteria | 2119 |
| 83 | Ga0070664_100375235 | 3300005564 | Bacteria | 1297 |
| 84 | Ga0068857_100023807 | 3300005577 | Bacteria | 5392 |
| 85 | Ga0068857_100040943 | 3300005577 | Bacteria | 4107 |
| 86 | Ga0068857_100140524 | 3300005577 | Bacteria | 2182 |
| 87 | Ga0068857_100192116 | 3300005577 | Bacteria | 1859 |
| 88 | Ga0068854_100164222 | 3300005578 | Bacteria | 1722 |
| 89 | Ga0068856_100087885 | 3300005614 | Bacteria | 3090 |
| 90 | Ga0068856_100484710 | 3300005614 | Bacteria | 1257 |
| 91 | Ga0070702_100035872 | 3300005615 | Bacteria | 2742 |
| 92 | Ga0070702_100167662 | 3300005615 | Bacteria | 1425 |
| 93 | Ga0068852_100121073 | 3300005616 | Bacteria | 2396 |
| 94 | Ga0068852_100227264 | 3300005616 | Bacteria | 1778 |
| 95 | Ga0068852_100262894 | 3300005616 | Bacteria | 1657 |
| 96 | Ga0068859_100210674 | 3300005617 | Bacteria | 2030 |
| 97 | Ga0068864_100352644 | 3300005618 | Bacteria | 1388 |
| 98 | Ga0068864_101004052 | 3300005618 | Bacteria | 828 |
| 99 | Ga0068866_10072522 | 3300005718 | Bacteria | 1825 |
| 100 | Ga0068861_100053493 | 3300005719 | Bacteria | 3072 |
| 101 | Ga0068870_10042549 | 3300005840 | Bacteria | 2365 |
| 102 | Ga0068863_100249115 | 3300005841 | Bacteria | 1716 |
| 103 | Ga0068858_100590881 | 3300005842 | Bacteria | 1076 |
| 104 | Ga0081455_10007035 | 3300005937 | Bacteria | 11945 |
| 105 | Ga0081455_10433117 | 3300005937 | Bacteria | 903 |
| 106 | Ga0081538_10000417 | 3300005981 | Bacteria | 47830 |
| 107 | Ga0081538_10031451 | 3300005981 | Bacteria | 3579 |
| 108 | Ga0081539_10000027 | 3300005985 | Bacteria | 328691 |
| 109 | Ga0075365_10340947 | 3300006038 | Bacteria | 1056 |
| 110 | Ga0070712_100055849 | 3300006175 | Bacteria | 2767 |
| 111 | Ga0075367_10134435 | 3300006178 | Bacteria | 1529 |
| 112 | Ga0068871_100002346 | 3300006358 | Bacteria | 12901 |
| 113 | Ga0075430_100001802 | 3300006846 | Bacteria | 17520 |
| 114 | Ga0075430_100006192 | 3300006846 | Bacteria | 10087 |
| 115 | Ga0075431_100001725 | 3300006847 | Bacteria | 20568 |
| 116 | Ga0075431_100001755 | 3300006847 | Bacteria | 20403 |
| 117 | Ga0075434_100222303 | 3300006871 | Bacteria | 1908 |
| 118 | Ga0075429_100001988 | 3300006880 | Bacteria | 16983 |
| 119 | Ga0075429_100016094 | 3300006880 | Bacteria | 6478 |
| 120 | Ga0097620_100210674 | 3300006931 | Bacteria | 2030 |
| 121 | Ga0105240_10615507 | 3300009093 | Bacteria | 1194 |
| 122 | Ga0111539_10018001 | 3300009094 | Bacteria | 8750 |
| 123 | Ga0111539_10360620 | 3300009094 | Bacteria | 1692 |
| 124 | Ga0111539_10589772 | 3300009094 | Bacteria | 1294 |
| 125 | Ga0105245_10020841 | 3300009098 | Bacteria | 5746 |
| 126 | Ga0105245_10198585 | 3300009098 | Bacteria | 1925 |
| 127 | Ga0105245_10237514 | 3300009098 | Bacteria | 1765 |
| 128 | Ga0105245_10334667 | 3300009098 | Bacteria | 1495 |
| 129 | Ga0105245_10874753 | 3300009098 | Bacteria | 939 |
| 130 | Ga0114129_10016875 | 3300009147 | Bacteria | 10395 |
| 131 | Ga0114129_10065489 | 3300009147 | Bacteria | 5071 |
| 132 | Ga0114129_11714457 | 3300009147 | Bacteria | 766 |
| 133 | Ga0105243_10001133 | 3300009148 | Bacteria | 24160 |
| 134 | Ga0105243_10075374 | 3300009148 | Bacteria | 2738 |
| 135 | Ga0105243_10168242 | 3300009148 | Bacteria | 1896 |
| 136 | Ga0105243_10459206 | 3300009148 | Bacteria | 1197 |
| 137 | Ga0105243_10625379 | 3300009148 | Bacteria | 1040 |
| 138 | Ga0105243_10771183 | 3300009148 | Bacteria | 945 |
| 139 | Ga0105243_10870028 | 3300009148 | Bacteria | 894 |
| 140 | Ga0105242_10012950 | 3300009176 | Bacteria | 6431 |
| 141 | Ga0105242_10056290 | 3300009176 | Bacteria | 3218 |
| 142 | Ga0105242_10192426 | 3300009176 | Bacteria | 1807 |
| 143 | Ga0105248_10127328 | 3300009177 | Bacteria | 2873 |
| 144 | Ga0105248_10361691 | 3300009177 | Bacteria | 1634 |
| 145 | Ga0105248_10784886 | 3300009177 | Bacteria | 1075 |
| 146 | Ga0105237_10087968 | 3300009545 | Bacteria | 3096 |
| 147 | Ga0105237_10108868 | 3300009545 | Bacteria | 2762 |
| 148 | Ga0105237_10520597 | 3300009545 | Bacteria | 1196 |
| 149 | Ga0105249_10319660 | 3300009553 | Bacteria | 1563 |
| 150 | Ga0105035_101768 | 3300009988 | Bacteria | 1533 |
| 151 | Ga0105239_10280250 | 3300010375 | Bacteria | 1877 |
| 152 | Ga0105239_10448571 | 3300010375 | Bacteria | 1463 |
| 153 | Ga0105239_10477382 | 3300010375 | Bacteria | 1416 |
| 154 | Ga0105246_10037244 | 3300011119 | Bacteria | 3264 |
| 155 | Ga0157335_1004266 | 3300012492 | Bacteria | 955 |
| 156 | Ga0157371_10206178 | 3300013102 | Bacteria | 1410 |
| 157 | Ga0157371_10305073 | 3300013102 | Bacteria | 1153 |
| 158 | Ga0157369_10067886 | 3300013105 | Bacteria | 3832 |
| 159 | Ga0157369_10266986 | 3300013105 | Bacteria | 1784 |
| 160 | Ga0157369_10467648 | 3300013105 | Bacteria | 1305 |
| 161 | Ga0157369_10840698 | 3300013105 | Bacteria | 943 |
| 162 | Ga0157369_10858617 | 3300013105 | Bacteria | 931 |
| 163 | Ga0157374_10009898 | 3300013296 | Bacteria | 8182 |
| 164 | Ga0157374_10332018 | 3300013296 | Bacteria | 1508 |
| 165 | Ga0157374_10553504 | 3300013296 | Bacteria | 1158 |
| 166 | Ga0157378_10041806 | 3300013297 | Bacteria | 4067 |
| 167 | Ga0163162_10145893 | 3300013306 | Bacteria | 2483 |
| 168 | Ga0163162_10246253 | 3300013306 | Bacteria | 1919 |
| 169 | Ga0163162_10256364 | 3300013306 | Bacteria | 1881 |
| 170 | Ga0157372_10067228 | 3300013307 | Bacteria | 4027 |
| 171 | Ga0157372_10286793 | 3300013307 | Bacteria | 1915 |
| 172 | Ga0157372_10351097 | 3300013307 | Bacteria | 1718 |
| 173 | Ga0157375_10028637 | 3300013308 | Bacteria | 5226 |
| 174 | Ga0157375_10154215 | 3300013308 | Bacteria | 2435 |
| 175 | Ga0157375_10226188 | 3300013308 | Bacteria | 2030 |
| 176 | Ga0157375_10548643 | 3300013308 | Bacteria | 1318 |
| 177 | Ga0157375_11037269 | 3300013308 | Bacteria | 958 |
| 178 | Ga0157375_11203268 | 3300013308 | Bacteria | 889 |
| 179 | Ga0163163_10003442 | 3300014325 | Bacteria | 13446 |
| 180 | Ga0163163_10419864 | 3300014325 | Bacteria | 1396 |
| 181 | Ga0157380_10101500 | 3300014326 | Bacteria | 2397 |
| 182 | Ga0157380_10272461 | 3300014326 | Bacteria | 1544 |
| 183 | Ga0157380_10444440 | 3300014326 | Bacteria | 1243 |
| 184 | Ga0157377_10023060 | 3300014745 | Bacteria | 3294 |
| 185 | Ga0157379_10002390 | 3300014968 | Bacteria | 15680 |
| 186 | Ga0157379_10180503 | 3300014968 | Bacteria | 1907 |
| 187 | Ga0157376_10007343 | 3300014969 | Bacteria | 7856 |
| 188 | Ga0163161_10049749 | 3300017792 | Bacteria | 3030 |
| 189 | Ga0163161_10148043 | 3300017792 | Bacteria | 1782 |
| 190 | Ga0163161_10258361 | 3300017792 | Bacteria | 1360 |
| 191 | Ga0206356_10146858 | 3300020070 | Bacteria | 1224 |
| 192 | Ga0206356_10640822 | 3300020070 | Bacteria | 1519 |
| 193 | Ga0206356_10804711 | 3300020070 | Bacteria | 1192 |
| 194 | Ga0206356_11268019 | 3300020070 | Bacteria | 1551 |
| 195 | Ga0206351_10683577 | 3300020077 | Bacteria | 1074 |
| 196 | Ga0206353_10205279 | 3300020082 | Bacteria | 1812 |
| 197 | Ga0206353_10235487 | 3300020082 | Bacteria | 1060 |
| 198 | Ga0206353_10607554 | 3300020082 | Bacteria | 2956 |
| 199 | Ga0206353_10786672 | 3300020082 | Bacteria | 5745 |
| 200 | Ga0206353_11891632 | 3300020082 | Bacteria | 802 |
| 201 | Ga0213876_10001520 | 3300021384 | Bacteria | 14348 |
| 202 | Ga0213876_10017812 | 3300021384 | Bacteria | 3748 |
| 203 | Ga0213875_10000221 | 3300021388 | Bacteria | 57905 |
| 204 | Ga0213875_10009789 | 3300021388 | Bacteria | 4837 |
| 205 | Ga0213875_10014027 | 3300021388 | Bacteria | 3919 |
| 206 | Ga0224712_10035499 | 3300022467 | Bacteria | 1841 |
| 207 | Ga0224712_10071847 | 3300022467 | Bacteria | 1407 |
| 208 | Ga0224712_10116778 | 3300022467 | Bacteria | 1151 |
| 209 | Ga0224712_10262238 | 3300022467 | Bacteria | 801 |
| 210 | Ga0209758_1010962 | 3300025297 | Bacteria | 5327 |
| 211 | Ga0207656_10019393 | 3300025321 | Bacteria | 2690 |
| 212 | Ga0207692_10065526 | 3300025898 | Bacteria | 1895 |
| 213 | Ga0207642_10420788 | 3300025899 | Bacteria | 803 |
| 214 | Ga0207710_10012332 | 3300025900 | Bacteria | 3596 |
| 215 | Ga0207688_10004602 | 3300025901 | Bacteria | 7512 |
| 216 | Ga0207688_10085157 | 3300025901 | Bacteria | 1810 |
| 217 | Ga0207647_10007385 | 3300025904 | Bacteria | 7946 |
| 218 | Ga0207647_10171646 | 3300025904 | Bacteria | 1262 |
| 219 | Ga0207645_10014867 | 3300025907 | Bacteria | 5193 |
| 220 | Ga0207643_10013050 | 3300025908 | Bacteria | 4492 |
| 221 | Ga0207705_10000470 | 3300025909 | Bacteria | 34558 |
| 222 | Ga0207705_10291805 | 3300025909 | Bacteria | 1249 |
| 223 | Ga0207705_10539733 | 3300025909 | Bacteria | 906 |
| 224 | Ga0207684_10001496 | 3300025910 | Bacteria | 25101 |
| 225 | Ga0207684_10161486 | 3300025910 | Bacteria | 1930 |
| 226 | Ga0207707_10000185 | 3300025912 | Bacteria | 65663 |
| 227 | Ga0207707_10572160 | 3300025912 | Bacteria | 958 |
| 228 | Ga0207671_10125517 | 3300025914 | Bacteria | 1965 |
| 229 | Ga0207671_10176266 | 3300025914 | Bacteria | 1662 |
| 230 | Ga0207671_10345493 | 3300025914 | Bacteria | 1179 |
| 231 | Ga0207693_10046808 | 3300025915 | Bacteria | 3398 |
| 232 | Ga0207663_10430692 | 3300025916 | Bacteria | 1014 |
| 233 | Ga0207660_10007057 | 3300025917 | Bacteria | 7278 |
| 234 | Ga0207660_10043218 | 3300025917 | Bacteria | 3166 |
| 235 | Ga0207660_10073494 | 3300025917 | Bacteria | 2493 |
| 236 | Ga0207657_10188967 | 3300025919 | Bacteria | 1663 |
| 237 | Ga0207657_10195134 | 3300025919 | Bacteria | 1631 |
| 238 | Ga0207657_10253310 | 3300025919 | Bacteria | 1403 |
| 239 | Ga0207652_10001048 | 3300025921 | Bacteria | 25276 |
| 240 | Ga0207652_10025309 | 3300025921 | Bacteria | 4932 |
| 241 | Ga0207652_10081336 | 3300025921 | Bacteria | 2833 |
| 242 | Ga0207652_10209407 | 3300025921 | Bacteria | 1755 |
| 243 | Ga0207652_10252126 | 3300025921 | Bacteria | 1592 |
| 244 | Ga0207652_10564922 | 3300025921 | Bacteria | 1022 |
| 245 | Ga0207646_10001862 | 3300025922 | Bacteria | 25443 |
| 246 | Ga0207646_10380867 | 3300025922 | Bacteria | 1274 |
| 247 | Ga0207687_10133549 | 3300025927 | Bacteria | 1874 |
| 248 | Ga0207700_10077540 | 3300025928 | Bacteria | 2582 |
| 249 | Ga0207700_10178372 | 3300025928 | Bacteria | 1777 |
| 250 | Ga0207700_10328821 | 3300025928 | Bacteria | 1326 |
| 251 | Ga0207664_10008962 | 3300025929 | Bacteria | 7005 |
| 252 | Ga0207664_10097820 | 3300025929 | Bacteria | 2418 |
| 253 | Ga0207664_10113260 | 3300025929 | Bacteria | 2259 |
| 254 | Ga0207706_10070653 | 3300025933 | Bacteria | 3071 |
| 255 | Ga0207686_10094902 | 3300025934 | Bacteria | 1978 |
| 256 | Ga0207709_10000356 | 3300025935 | Bacteria | 46632 |
| 257 | Ga0207709_10326808 | 3300025935 | Bacteria | 1150 |
| 258 | Ga0207709_10826752 | 3300025935 | Bacteria | 749 |
| 259 | Ga0207669_10158319 | 3300025937 | Bacteria | 1596 |
| 260 | Ga0207704_10502727 | 3300025938 | Bacteria | 977 |
| 261 | Ga0207665_10082543 | 3300025939 | Bacteria | 2215 |
| 262 | Ga0207691_10081078 | 3300025940 | Bacteria | 2917 |
| 263 | Ga0207691_10271255 | 3300025940 | Bacteria | 1461 |
| 264 | Ga0207711_10307629 | 3300025941 | Bacteria | 1463 |
| 265 | Ga0207689_10065444 | 3300025942 | Bacteria | 2989 |
| 266 | Ga0207689_10385003 | 3300025942 | Bacteria | 1168 |
| 267 | Ga0207661_10068915 | 3300025944 | Bacteria | 2882 |
| 268 | Ga0207661_10409640 | 3300025944 | Bacteria | 1230 |
| 269 | Ga0207661_10653496 | 3300025944 | Bacteria | 966 |
| 270 | Ga0207661_10774322 | 3300025944 | Bacteria | 883 |
| 271 | Ga0207679_10347461 | 3300025945 | Bacteria | 1292 |
| 272 | Ga0207679_11013228 | 3300025945 | Bacteria | 761 |
| 273 | Ga0207651_10048409 | 3300025960 | Bacteria | 2874 |
| 274 | Ga0207712_10015125 | 3300025961 | Bacteria | 4973 |
| 275 | Ga0207712_10281668 | 3300025961 | Bacteria | 1357 |
| 276 | Ga0207668_10012757 | 3300025972 | Bacteria | 5152 |
| 277 | Ga0207668_10072336 | 3300025972 | Bacteria | 2467 |
| 278 | Ga0207668_10102057 | 3300025972 | Bacteria | 2133 |
| 279 | Ga0207668_10274803 | 3300025972 | Bacteria | 1379 |
| 280 | Ga0207658_10197826 | 3300025986 | Bacteria | 1676 |
| 281 | Ga0207658_10456665 | 3300025986 | Bacteria | 1132 |
| 282 | Ga0207658_10688098 | 3300025986 | Bacteria | 924 |
| 283 | Ga0207677_10034460 | 3300026023 | Bacteria | 3279 |
| 284 | Ga0207703_10186182 | 3300026035 | Bacteria | 1835 |
| 285 | Ga0207639_10846743 | 3300026041 | Bacteria | 853 |
| 286 | Ga0207678_10000054 | 3300026067 | Bacteria | 87616 |
| 287 | Ga0207678_10023227 | 3300026067 | Bacteria | 5424 |
| 288 | Ga0207678_10273051 | 3300026067 | Bacteria | 1450 |
| 289 | Ga0207708_10227548 | 3300026075 | Bacteria | 1496 |
| 290 | Ga0207708_10800105 | 3300026075 | Bacteria | 811 |
| 291 | Ga0207708_10832099 | 3300026075 | Bacteria | 796 |
| 292 | Ga0207702_10040822 | 3300026078 | Bacteria | 3890 |
| 293 | Ga0207702_10537269 | 3300026078 | Bacteria | 1142 |
| 294 | Ga0207702_11303495 | 3300026078 | Bacteria | 720 |
| 295 | Ga0207641_10165730 | 3300026088 | Bacteria | 2012 |
| 296 | Ga0207648_10269220 | 3300026089 | Bacteria | 1521 |
| 297 | Ga0207676_10334276 | 3300026095 | Bacteria | 1395 |
| 298 | Ga0207676_10824493 | 3300026095 | Bacteria | 906 |
| 299 | Ga0207674_10055991 | 3300026116 | Bacteria | 4006 |
| 300 | Ga0207674_10069016 | 3300026116 | Bacteria | 3555 |
| 301 | Ga0207674_10081024 | 3300026116 | Bacteria | 3248 |
| 302 | Ga0207674_10154769 | 3300026116 | Bacteria | 2248 |
| 303 | Ga0207674_10458407 | 3300026116 | Bacteria | 1232 |
| 304 | Ga0207675_100007887 | 3300026118 | Bacteria | 10041 |
| 305 | Ga0207675_100049410 | 3300026118 | Bacteria | 3926 |
| 306 | Ga0207683_10033184 | 3300026121 | Bacteria | 4483 |
| 307 | Ga0207683_10309154 | 3300026121 | Bacteria | 1447 |
| 308 | Ga0207683_10631126 | 3300026121 | Bacteria | 992 |
| 309 | Ga0207698_10098800 | 3300026142 | Bacteria | 2413 |
| 310 | Ga0207698_10247702 | 3300026142 | Bacteria | 1628 |
| 311 | Ga0207428_10119860 | 3300027907 | Bacteria | 2018 |
| 312 | Ga0268266_10074264 | 3300028379 | Bacteria | 2952 |
| 313 | Ga0268266_10278754 | 3300028379 | Bacteria | 1554 |
| 314 | Ga0268265_10044138 | 3300028380 | Bacteria | 3318 |
| 315 | Ga0268265_10469893 | 3300028380 | Bacteria | 1179 |
| 316 | Ga0268264_10154211 | 3300028381 | Bacteria | 2062 |
| 317 | Ga0307517_10026479 | 3300028786 | Bacteria | 7025 |
| 318 | Ga0307515_10017159 | 3300028794 | Bacteria | 13209 |
| 319 | Ga0307515_10045822 | 3300028794 | Bacteria | 6704 |
| 320 | Ga0307515_10160461 | 3300028794 | Bacteria | 2296 |
| 321 | Ga0307515_10222639 | 3300028794 | Bacteria | 1700 |
| 322 | Ga0307515_10271020 | 3300028794 | Bacteria | 1418 |
| 323 | Ga0307511_10060505 | 3300030521 | Bacteria | 2898 |
| 324 | Ga0307511_10161577 | 3300030521 | Bacteria | 1256 |
| 325 | Ga0307512_10008082 | 3300030522 | Bacteria | 10305 |
| 326 | Ga0307512_10013770 | 3300030522 | Bacteria | 7563 |
| 327 | Ga0307512_10216102 | 3300030522 | Bacteria | 1010 |
| 328 | Ga0307512_10230096 | 3300030522 | Bacteria | 954 |
| 329 | Ga0265327_10175228 | 3300031251 | Bacteria | 983 |
| 330 | Ga0307513_10033014 | 3300031456 | Bacteria | 5825 |
| 331 | Ga0307513_10239286 | 3300031456 | Bacteria | 1621 |
| 332 | Ga0307513_10380257 | 3300031456 | Bacteria | 1151 |
| 333 | Ga0307509_10029556 | 3300031507 | Bacteria | 6080 |
| 334 | Ga0307408_100082526 | 3300031548 | Bacteria | 2406 |
| 335 | Ga0307408_100162721 | 3300031548 | Bacteria | 1774 |
| 336 | Ga0307408_100264284 | 3300031548 | Bacteria | 1426 |
| 337 | Ga0307408_100474409 | 3300031548 | Bacteria | 1090 |
| 338 | Ga0307508_10212388 | 3300031616 | Bacteria | 1535 |
| 339 | Ga0307514_10008147 | 3300031649 | Bacteria | 8953 |
| 340 | Ga0307514_10059712 | 3300031649 | Bacteria | 2912 |
| 341 | Ga0307514_10168104 | 3300031649 | Bacteria | 1438 |
| 342 | Ga0307514_10176509 | 3300031649 | Bacteria | 1385 |
| 343 | Ga0316575_10003903 | 3300031665 | Bacteria | 5209 |
| 344 | Ga0316579_10002822 | 3300031691 | Bacteria | 6648 |
| 345 | Ga0316579_10149533 | 3300031691 | Bacteria | 1126 |
| 346 | Ga0316576_10000951 | 3300031727 | Bacteria | 14821 |
| 347 | Ga0316576_10012619 | 3300031727 | Bacteria | 5589 |
| 348 | Ga0316576_10016994 | 3300031727 | Bacteria | 4933 |
| 349 | Ga0316576_10018918 | 3300031727 | Bacteria | 4712 |
| 350 | Ga0316576_10039027 | 3300031727 | Bacteria | 3407 |
| 351 | Ga0316576_10053604 | 3300031727 | Bacteria | 2939 |
| 352 | Ga0316576_10065340 | 3300031727 | Bacteria | 2673 |
| 353 | Ga0316576_10117887 | 3300031727 | Bacteria | 1992 |
| 354 | Ga0316578_10000741 | 3300031728 | Bacteria | 11879 |
| 355 | Ga0316578_10014913 | 3300031728 | Bacteria | 4167 |
| 356 | Ga0316578_10015115 | 3300031728 | Bacteria | 4143 |
| 357 | Ga0316578_10017710 | 3300031728 | Bacteria | 3884 |
| 358 | Ga0316578_10069819 | 3300031728 | Bacteria | 2079 |
| 359 | Ga0316578_10172700 | 3300031728 | Bacteria | 1303 |
| 360 | Ga0307516_10019954 | 3300031730 | Bacteria | 6929 |
| 361 | Ga0307405_10132287 | 3300031731 | Bacteria | 1726 |
| 362 | Ga0307405_10147862 | 3300031731 | Bacteria | 1648 |
| 363 | Ga0307405_10308844 | 3300031731 | Bacteria | 1203 |
| 364 | Ga0316577_10025018 | 3300031733 | Bacteria | 3321 |
| 365 | Ga0316577_10032277 | 3300031733 | Bacteria | 2925 |
| 366 | Ga0316577_10055135 | 3300031733 | Bacteria | 2218 |
| 367 | Ga0307413_10003445 | 3300031824 | Bacteria | 6658 |
| 368 | Ga0307413_10482587 | 3300031824 | Bacteria | 991 |
| 369 | Ga0307518_10000115 | 3300031838 | Bacteria | 56725 |
| 370 | Ga0307518_10184982 | 3300031838 | Bacteria | 1403 |
| 371 | Ga0307410_10015971 | 3300031852 | Bacteria | 4464 |
| 372 | Ga0307410_10035741 | 3300031852 | Bacteria | 3230 |
| 373 | Ga0307410_10130493 | 3300031852 | Bacteria | 1845 |
| 374 | Ga0307410_10371469 | 3300031852 | Bacteria | 1148 |
| 375 | Ga0307410_10391707 | 3300031852 | Bacteria | 1120 |
| 376 | Ga0307406_10074511 | 3300031901 | Bacteria | 2235 |
| 377 | Ga0307407_10061635 | 3300031903 | Bacteria | 2193 |
| 378 | Ga0307412_10005135 | 3300031911 | Bacteria | 7334 |
| 379 | Ga0307412_10038452 | 3300031911 | Bacteria | 3082 |
| 380 | Ga0307409_100003830 | 3300031995 | Bacteria | 8303 |
| 381 | Ga0307409_100007897 | 3300031995 | Bacteria | 6408 |
| 382 | Ga0307409_100116980 | 3300031995 | Bacteria | 2248 |
| 383 | Ga0307409_100183397 | 3300031995 | Bacteria | 1855 |
| 384 | Ga0307409_100449052 | 3300031995 | Bacteria | 1244 |
| 385 | Ga0307409_100461832 | 3300031995 | Bacteria | 1228 |
| 386 | Ga0307416_100075345 | 3300032002 | Bacteria | 2823 |
| 387 | Ga0307416_100121070 | 3300032002 | Bacteria | 2332 |
| 388 | Ga0307416_100321509 | 3300032002 | Bacteria | 1550 |
| 389 | Ga0307416_100442747 | 3300032002 | Bacteria | 1350 |
| 390 | Ga0307416_100463040 | 3300032002 | Bacteria | 1323 |
| 391 | Ga0307416_100634019 | 3300032002 | Bacteria | 1152 |
| 392 | Ga0307414_10109738 | 3300032004 | Bacteria | 2097 |
| 393 | Ga0307411_10087017 | 3300032005 | Bacteria | 2169 |
| 394 | Ga0307411_10138703 | 3300032005 | Bacteria | 1790 |
| 395 | Ga0307411_10204950 | 3300032005 | Bacteria | 1518 |
| 396 | Ga0307411_10738936 | 3300032005 | Bacteria | 861 |
| 397 | Ga0307415_100042790 | 3300032126 | Bacteria | 3017 |
| 398 | Ga0307415_100225227 | 3300032126 | Bacteria | 1506 |
| 399 | Ga0307415_100290226 | 3300032126 | Bacteria | 1350 |
| 400 | Ga0316583_10037593 | 3300032133 | Bacteria | 1716 |
| 401 | Ga0316585_10009368 | 3300032137 | Bacteria | 2855 |
| 402 | Ga0316580_10016251 | 3300032139 | Bacteria | 2282 |
| 403 | Ga0316580_10023382 | 3300032139 | Bacteria | 1908 |
| 404 | Ga0316580_10084267 | 3300032139 | Bacteria | 972 |
| 405 | Ga0307507_10038539 | 3300033179 | Bacteria | 4842 |
| 406 | Ga0307507_10105891 | 3300033179 | Bacteria | 2326 |
| 407 | Ga0307507_10280581 | 3300033179 | Bacteria | 1042 |
| 408 | Ga0307507_10323070 | 3300033179 | Bacteria | 927 |
| 409 | Ga0307510_10066364 | 3300033180 | Bacteria | 3644 |
| 410 | Ga0307510_10080849 | 3300033180 | Bacteria | 3157 |
| 411 | Ga0307510_10295030 | 3300033180 | Bacteria | 1085 |
| 412 | Ga0373928_0048578 | 3300035084 | Bacteria | 996 |
| 413 | Ga0373934_0000421 | 3300035086 | Bacteria | 14827 |
| 414 | Ga0373936_0145746 | 3300035113 | Bacteria | 1024 |
| 415 | Ga0373953_0000116 | 3300035117 | Bacteria | 19418 |
| 416 | Ga0373954_0001000 | 3300035118 | Bacteria | 11155 |
| 417 | Ga0373956_0005182 | 3300035119 | Bacteria | 5218 |
| 418 | Ga0373957_0000035 | 3300035120 | Bacteria | 34674 |
| 419 | Ga0373955_0000072 | 3300035172 | Bacteria | 40814 |
| 420 | Ga0373955_0045548 | 3300035172 | Bacteria | 2367 |
| 421 | Ga0316574_0010580 | 3300035398 | Bacteria | 5218 |
| 422 | Ga0316574_0029239 | 3300035398 | Bacteria | 3328 |
| 423 | Ga0316574_0034798 | 3300035398 | Bacteria | 3074 |
| 424 | Ga0316574_0035275 | 3300035398 | Bacteria | 3055 |
| 425 | Ga0316574_0068145 | 3300035398 | Bacteria | 2244 |
| 426 | Ga0316574_0146970 | 3300035398 | Bacteria | 1519 |
| 427 | Ga0373924_0001000 | 3300035410 | Bacteria | 8959 |
| 428 | Ga0373933_0000327 | 3300035724 | Bacteria | 30644 |
| 429 | Ga0373947_0498313 | 3300035725 | Bacteria | 827 |
| 430 | Ga0373937_0000010 | 3300036401 | Bacteria | 163001 |
| 431 | Ga0373937_0440067 | 3300036401 | Bacteria | 1237 |
| 432 | Ga0373937_1045922 | 3300036401 | Bacteria | 765 |
| 433 | Ga0316582_0011735 | 3300036647 | Bacteria | 4858 |
| 434 | Ga0316582_0023777 | 3300036647 | Bacteria | 3655 |
| 435 | Ga0316582_0175809 | 3300036647 | Bacteria | 1455 |
| 436 | Ga0316584_0000926 | 3300036712 | Bacteria | 16714 |
| 437 | Ga0316584_0006199 | 3300036712 | Bacteria | 8094 |
| 438 | Ga0316584_0043795 | 3300036712 | Bacteria | 3338 |
| 439 | Ga0316584_0104946 | 3300036712 | Bacteria | 2114 |
| 440 | Ga0316584_0157346 | 3300036712 | Bacteria | 1689 |
| 441 | Ga0316584_0422655 | 3300036712 | Bacteria | 946 |
| 442 | Ga0373925_0047160 | 3300037068 | Bacteria | 3206 |
| 443 | Ga0395900_0538878 | 3300037418 | Bacteria | 1113 |
| 444 | Ga0395898_0556308 | 3300037466 | Bacteria | 1089 |
| 445 | Ga0436364_0109597 | 3300037853 | Bacteria | 56310 |
| 446 | Ga0436364_0480718 | 3300037853 | Bacteria | 6731 |
| 447 | Ga0436364_1145828 | 3300037853 | Bacteria | 21168 |
| 448 | Ga0395901_0011144 | 3300038443 | Bacteria | 9110 |
| 449 | Ga0395901_0059400 | 3300038443 | Bacteria | 3978 |
| 450 | Ga0395901_0065266 | 3300038443 | Bacteria | 3790 |
| 451 | Ga0395901_0251763 | 3300038443 | Bacteria | 1840 |
| 452 | Ga0436365_0351909 | 3300039437 | Bacteria | 6223 |
| 453 | Ga0436365_0398569 | 3300039437 | Bacteria | 109705 |
| 454 | Ga0436365_1406538 | 3300039437 | Bacteria | 977 |
| 455 | Ga0436362_1280188 | 3300039453 | Bacteria | 53853 |
| 456 | Ga0439447_063540 | 3300041407 | Bacteria | 865 |
| 457 | Ga0451800_1017266 | 3300041459 | Bacteria | 954 |
| 458 | Ga0451837_1298356 | 3300041494 | Bacteria | 1989 |
| 459 | Ga0451853_3707206 | 3300041512 | Bacteria | 889 |
| 460 | Ga0451853_3939996 | 3300041512 | Bacteria | 1114 |
| 461 | Ga0439457_007559 | 3300042014 | Bacteria | 2603 |
| 462 | Ga0450900_004422 | 3300042136 | Bacteria | 1614 |
| 463 | Ga0450901_006636 | 3300042533 | Bacteria | 1191 |
| 464 | Ga0466969_0043284 | 3300044656 | Bacteria | 2244 |
| 465 | Ga0466969_0069180 | 3300044656 | Bacteria | 1700 |
| 466 | Ga0466969_0069417 | 3300044656 | Bacteria | 1697 |
| 467 | Ga0466972_0177323 | 3300044658 | Bacteria | 999 |
| 468 | Ga0466965_0027672 | 3300044683 | Bacteria | 2753 |
| 469 | Ga0466965_0131860 | 3300044683 | Bacteria | 1296 |
| 470 | Ga0466966_0039876 | 3300044684 | Bacteria | 3023 |
| 471 | Ga0466966_0070708 | 3300044684 | Bacteria | 2187 |
| 472 | Ga0466966_0311640 | 3300044684 | Bacteria | 946 |
| 473 | Ga0466961_0004439 | 3300044693 | Bacteria | 8785 |
| 474 | Ga0466961_0096107 | 3300044693 | Bacteria | 1868 |
| 475 | Ga0466961_0160398 | 3300044693 | Bacteria | 1402 |
| 476 | Ga0466961_0325729 | 3300044693 | Bacteria | 937 |
| 477 | Ga0466963_0004210 | 3300044694 | Bacteria | 8339 |
| 478 | Ga0466963_0006354 | 3300044694 | Bacteria | 6988 |
| 479 | Ga0466963_0076727 | 3300044694 | Bacteria | 2257 |
| 480 | Ga0466963_0213874 | 3300044694 | Bacteria | 1349 |
| 481 | Ga0466964_0102390 | 3300044706 | Bacteria | 1264 |
| 482 | Ga0466971_0006249 | 3300044719 | Bacteria | 5177 |
| 483 | Ga0466971_0037606 | 3300044719 | Bacteria | 2170 |
| 484 | Ga0466971_0099501 | 3300044719 | Bacteria | 1335 |
| 485 | Ga0466968_0000536 | 3300044735 | Bacteria | 12902 |
| 486 | Ga0466970_0084586 | 3300044765 | Bacteria | 1717 |
| 487 | Ga0466970_0138849 | 3300044765 | Bacteria | 1338 |
| 488 | Ga0466957_0002180 | 3300044842 | Bacteria | 10488 |
| 489 | Ga0466957_0040748 | 3300044842 | Bacteria | 2806 |
| 490 | Ga0466960_0117462 | 3300044901 | Bacteria | 1389 |
| 491 | Ga0466960_0130960 | 3300044901 | Bacteria | 1323 |
| 492 | Ga0466959_0104176 | 3300045049 | Bacteria | 2029 |
| 493 | Ga0466959_0263705 | 3300045049 | Bacteria | 1185 |
| 494 | Ga0466958_0000222 | 3300045836 | Bacteria | 21572 |
| 495 | Ga0466958_0001933 | 3300045836 | Bacteria | 10158 |
| 496 | Ga0466958_0033828 | 3300045836 | Bacteria | 3047 |
| 497 | Ga0466958_0043886 | 3300045836 | Bacteria | 2694 |
| 498 | Ga0466958_0079108 | 3300045836 | Bacteria | 2021 |
| 499 | Ga0466967_0000897 | 3300045976 | Bacteria | 15920 |
| 500 | Ga0466967_0055133 | 3300045976 | Bacteria | 3501 |
| 501 | Ga0466967_0514987 | 3300045976 | Bacteria | 1175 |
| 502 | Ga0466967_0707106 | 3300045976 | Bacteria | 998 |
| 503 | Ga0466967_1220170 | 3300045976 | Bacteria | 749 |
| 504 | Ga0495617_012215 | 3300046452 | Bacteria | 2925 |
| 505 | Ga0495627_010238 | 3300046453 | Bacteria | 3416 |
| 506 | Ga0495627_032214 | 3300046453 | Bacteria | 1650 |
| 507 | Ga0495592_0000136 | 3300046454 | Bacteria | 65571 |
| 508 | Ga0495592_0003591 | 3300046454 | Bacteria | 11152 |
| 509 | Ga0495592_0011391 | 3300046454 | Bacteria | 6728 |
| 510 | Ga0495592_0019127 | 3300046454 | Bacteria | 5211 |
| 511 | Ga0495592_0153561 | 3300046454 | Bacteria | 1590 |
| 512 | Ga0495603_0045735 | 3300046455 | Bacteria | 2609 |
| 513 | Ga0495629_0131568 | 3300046459 | Bacteria | 1743 |
| 514 | Ga0495638_0041549 | 3300046460 | Bacteria | 2908 |
| 515 | Ga0495638_0118612 | 3300046460 | Bacteria | 1565 |
| 516 | Ga0495638_0317540 | 3300046460 | Bacteria | 833 |
| 517 | Ga0495641_0031386 | 3300046461 | Bacteria | 2539 |
| 518 | Ga0495641_0233784 | 3300046461 | Bacteria | 825 |
| 519 | Ga0495651_0000047 | 3300046462 | Bacteria | 89551 |
| 520 | Ga0495651_0003035 | 3300046462 | Bacteria | 12947 |
| 521 | Ga0495651_0023678 | 3300046462 | Bacteria | 4775 |
| 522 | Ga0495651_0033457 | 3300046462 | Bacteria | 4009 |
| 523 | Ga0495653_0000753 | 3300046463 | Bacteria | 24762 |
| 524 | Ga0495653_0034862 | 3300046463 | Bacteria | 3974 |
| 525 | Ga0495653_0036225 | 3300046463 | Bacteria | 3888 |
| 526 | Ga0495650_0172958 | 3300046471 | Bacteria | 764 |
| 527 | Ga0495580_0332498 | 3300046472 | Bacteria | 1031 |
| 528 | Ga0495582_0019152 | 3300046473 | Bacteria | 3745 |
| 529 | Ga0495582_0115194 | 3300046473 | Bacteria | 1511 |
| 530 | Ga0495605_0013624 | 3300046474 | Bacteria | 4473 |
| 531 | Ga0495639_0129388 | 3300046475 | Bacteria | 1208 |
| 532 | Ga0495639_0137583 | 3300046475 | Bacteria | 1172 |
| 533 | Ga0495662_0001288 | 3300046476 | Bacteria | 12402 |
| 534 | Ga0495662_0003663 | 3300046476 | Bacteria | 7748 |
| 535 | Ga0495662_0017546 | 3300046476 | Bacteria | 3464 |
| 536 | Ga0495662_0063549 | 3300046476 | Bacteria | 1783 |
| 537 | Ga0495664_0001242 | 3300046477 | Bacteria | 13340 |
| 538 | Ga0495585_0141256 | 3300046492 | Bacteria | 1261 |
| 539 | Ga0495594_0040796 | 3300046499 | Bacteria | 2541 |
| 540 | Ga0495594_0299281 | 3300046499 | Bacteria | 916 |
| 541 | Ga0495594_0434283 | 3300046499 | Bacteria | 746 |
| 542 | Ga0495607_0066932 | 3300046501 | Bacteria | 2019 |
| 543 | Ga0495583_0145757 | 3300046506 | Bacteria | 983 |
| 544 | Ga0495606_0008611 | 3300046507 | Bacteria | 8817 |
| 545 | Ga0495608_0000089 | 3300046511 | Bacteria | 65189 |
| 546 | Ga0495610_0061513 | 3300046512 | Bacteria | 1783 |
| 547 | Ga0495616_0005356 | 3300046513 | Bacteria | 7914 |
| 548 | Ga0495618_0163263 | 3300046514 | Bacteria | 1419 |
| 549 | Ga0495628_0000325 | 3300046516 | Bacteria | 43145 |
| 550 | Ga0495628_0008019 | 3300046516 | Bacteria | 9093 |
| 551 | Ga0495628_0039995 | 3300046516 | Bacteria | 3749 |
| 552 | Ga0495628_0054388 | 3300046516 | Bacteria | 3156 |
| 553 | Ga0495630_0080247 | 3300046517 | Bacteria | 2461 |
| 554 | Ga0495630_0090222 | 3300046517 | Bacteria | 2315 |
| 555 | Ga0495631_0030817 | 3300046518 | Bacteria | 2430 |
| 556 | Ga0495637_0016491 | 3300046520 | Bacteria | 3452 |
| 557 | Ga0495643_0017243 | 3300046522 | Bacteria | 4225 |
| 558 | Ga0495644_0069083 | 3300046523 | Bacteria | 1327 |
| 559 | Ga0495648_0084247 | 3300046524 | Bacteria | 1799 |
| 560 | Ga0495666_0007706 | 3300046526 | Bacteria | 5386 |
| 561 | Ga0495642_0023733 | 3300046528 | Bacteria | 2423 |
| 562 | Ga0495652_0000982 | 3300046529 | Bacteria | 32624 |
| 563 | Ga0495652_0001869 | 3300046529 | Bacteria | 22391 |
| 564 | Ga0495652_0005996 | 3300046529 | Bacteria | 11367 |
| 565 | Ga0495652_0010249 | 3300046529 | Bacteria | 8498 |
| 566 | Ga0495652_0049229 | 3300046529 | Bacteria | 3608 |
| 567 | Ga0495654_0005236 | 3300046530 | Bacteria | 7567 |
| 568 | Ga0495665_0096586 | 3300046531 | Bacteria | 1552 |
| 569 | Ga0495640_0031330 | 3300046533 | Bacteria | 3796 |
| 570 | Ga0495640_0036682 | 3300046533 | Bacteria | 3462 |
| 571 | Ga0495586_0070901 | 3300046535 | Bacteria | 1903 |
| 572 | Ga0495586_0072381 | 3300046535 | Bacteria | 1884 |
| 573 | Ga0495586_0472641 | 3300046535 | Bacteria | 723 |
| 574 | Ga0495587_0000074 | 3300046536 | Bacteria | 78796 |
| 575 | Ga0495587_0007885 | 3300046536 | Bacteria | 6880 |
| 576 | Ga0495587_0185004 | 3300046536 | Bacteria | 1180 |
| 577 | Ga0495587_0193746 | 3300046536 | Bacteria | 1150 |
| 578 | Ga0495609_0009374 | 3300046538 | Bacteria | 4739 |
| 579 | Ga0495597_0032612 | 3300046542 | Bacteria | 2363 |
| 580 | Ga0495645_0007753 | 3300046543 | Bacteria | 7466 |
| 581 | Ga0495645_0033616 | 3300046543 | Bacteria | 3741 |
| 582 | Ga0495645_0172993 | 3300046543 | Bacteria | 1485 |
| 583 | Ga0495645_0301023 | 3300046543 | Bacteria | 1047 |
| 584 | Ga0495622_0003753 | 3300046557 | Bacteria | 7107 |
| 585 | Ga0495622_0020000 | 3300046557 | Bacteria | 3116 |
| 586 | Ga0495622_0089249 | 3300046557 | Bacteria | 1416 |
| 587 | Ga0495633_0004412 | 3300046558 | Bacteria | 8956 |
| 588 | Ga0495633_0022209 | 3300046558 | Bacteria | 3163 |
| 589 | Ga0495667_0000064 | 3300046559 | Bacteria | 89628 |
| 590 | Ga0495667_0013616 | 3300046559 | Bacteria | 5499 |
| 591 | Ga0495667_0104907 | 3300046559 | Bacteria | 1827 |
| 592 | Ga0495668_0027050 | 3300046616 | Bacteria | 3250 |
| 593 | Ga0495634_0004615 | 3300046642 | Bacteria | 10755 |
| 594 | Ga0495634_0066300 | 3300046642 | Bacteria | 2390 |
| 595 | Ga0495634_0126419 | 3300046642 | Bacteria | 1633 |
| 596 | Ga0495611_0007737 | 3300046648 | Bacteria | 4564 |
| 597 | Ga0495611_0017328 | 3300046648 | Bacteria | 3081 |
| 598 | Ga0495611_0034487 | 3300046648 | Bacteria | 2237 |
| 599 | Ga0495625_0024361 | 3300046660 | Bacteria | 4608 |
| 600 | Ga0495635_0000630 | 3300046663 | Bacteria | 22652 |
| 601 | Ga0495635_0090831 | 3300046663 | Bacteria | 2089 |
| 602 | Ga0495635_0239138 | 3300046663 | Bacteria | 1225 |
| 603 | Ga0495635_0530005 | 3300046663 | Bacteria | 773 |
| 604 | Ga0495661_0054646 | 3300046665 | Bacteria | 2396 |
| 605 | Ga0495588_0001717 | 3300046674 | Bacteria | 9330 |
| 606 | Ga0495588_0036196 | 3300046674 | Bacteria | 2503 |
| 607 | Ga0495588_0049795 | 3300046674 | Bacteria | 2155 |
| 608 | Ga0495588_0094696 | 3300046674 | Bacteria | 1566 |
| 609 | Ga0495657_0000009 | 3300046675 | Bacteria | 217555 |
| 610 | Ga0495657_0002765 | 3300046675 | Bacteria | 14612 |
| 611 | Ga0495657_0042959 | 3300046675 | Bacteria | 3083 |
| 612 | Ga0495657_0125148 | 3300046675 | Bacteria | 1615 |
| 613 | Ga0495657_0155911 | 3300046675 | Bacteria | 1415 |
| 614 | Ga0495657_0424292 | 3300046675 | Bacteria | 780 |
| 615 | Ga0495599_0000084 | 3300046678 | Bacteria | 65440 |
| 616 | Ga0495599_0003486 | 3300046678 | Bacteria | 9206 |
| 617 | Ga0495599_0104641 | 3300046678 | Bacteria | 1763 |
| 618 | Ga0495623_0000168 | 3300046679 | Bacteria | 40826 |
| 619 | Ga0495623_0214693 | 3300046679 | Bacteria | 1099 |
| 620 | Ga0495646_0000669 | 3300046680 | Bacteria | 18793 |
| 621 | Ga0495646_0001071 | 3300046680 | Bacteria | 15889 |
| 622 | Ga0495646_0048936 | 3300046680 | Bacteria | 2567 |
| 623 | Ga0495647_0205450 | 3300046681 | Bacteria | 865 |
| 624 | Ga0495658_0018437 | 3300046683 | Bacteria | 3629 |
| 625 | Ga0495658_0328326 | 3300046683 | Bacteria | 970 |
| 626 | Ga0495613_0005024 | 3300046689 | Bacteria | 9931 |
| 627 | Ga0495613_0005879 | 3300046689 | Bacteria | 9182 |
| 628 | Ga0495613_0045585 | 3300046689 | Bacteria | 3242 |
| 629 | Ga0495613_0311478 | 3300046689 | Bacteria | 1088 |
| 630 | Ga0495613_0459646 | 3300046689 | Bacteria | 861 |
| 631 | Ga0495624_0085021 | 3300046690 | Bacteria | 1954 |
| 632 | Ga0495670_0019746 | 3300046691 | Bacteria | 3321 |
| 633 | Ga0495670_0026594 | 3300046691 | Bacteria | 2865 |
| 634 | Ga0495671_0002799 | 3300046692 | Bacteria | 10913 |
| 635 | Ga0495649_0089699 | 3300046694 | Bacteria | 1639 |
| 636 | Ga0495589_0020293 | 3300046794 | Bacteria | 3399 |
| 637 | Ga0495600_0002372 | 3300046809 | Bacteria | 10766 |
| 638 | Ga0495600_0007557 | 3300046809 | Bacteria | 6655 |
| 639 | Ga0495600_0012433 | 3300046809 | Bacteria | 5322 |
| 640 | Ga0495600_0290851 | 3300046809 | Bacteria | 1032 |
| 641 | Ga0495660_0044528 | 3300046810 | Bacteria | 2440 |
| 642 | Ga0495581_0149944 | 3300047315 | Bacteria | 1361 |
| 643 | Ga0495581_0242232 | 3300047315 | Bacteria | 1054 |
| 644 | Ga0495604_0000070 | 3300047317 | Bacteria | 89500 |
| 645 | Ga0495604_0000597 | 3300047317 | Bacteria | 31188 |
| 646 | Ga0495604_0009513 | 3300047317 | Bacteria | 7682 |
| 647 | Ga0495636_0015296 | 3300047318 | Bacteria | 3058 |
| 648 | Ga0495636_0018570 | 3300047318 | Bacteria | 2791 |
| 649 | Ga0495636_0039887 | 3300047318 | Bacteria | 1946 |
| 650 | Ga0495674_0015461 | 3300047319 | Bacteria | 7132 |
| 651 | Ga0495674_0238463 | 3300047319 | Bacteria | 1499 |
| 652 | Ga0495674_0342338 | 3300047319 | Bacteria | 1215 |
| 653 | Ga0495672_0078790 | 3300047320 | Bacteria | 1842 |
| 654 | Ga0495676_0018161 | 3300047321 | Bacteria | 6203 |
| 655 | Ga0495676_0019814 | 3300047321 | Bacteria | 5912 |
| 656 | Ga0495676_0040776 | 3300047321 | Bacteria | 3828 |
| 657 | Ga0495676_0128210 | 3300047321 | Bacteria | 1835 |
| 658 | Ga0495680_0000195 | 3300047322 | Bacteria | 65440 |
| 659 | Ga0495680_0045706 | 3300047322 | Bacteria | 3456 |
| 660 | Ga0495680_0053938 | 3300047322 | Bacteria | 3124 |
| 661 | Ga0495680_0236023 | 3300047322 | Bacteria | 1300 |
| 662 | Ga0495683_0169752 | 3300047323 | Bacteria | 1003 |
| 663 | Ga0495687_003104 | 3300047443 | Bacteria | 12436 |
| 664 | Ga0495687_003604 | 3300047443 | Bacteria | 11080 |
| 665 | Ga0495687_073098 | 3300047443 | Bacteria | 1367 |
| 666 | Ga0495675_0001537 | 3300047444 | Bacteria | 13918 |
| 667 | Ga0495675_0009811 | 3300047444 | Bacteria | 5970 |
| 668 | Ga0495675_0019818 | 3300047444 | Bacteria | 4273 |
| 669 | Ga0495675_0040590 | 3300047444 | Bacteria | 2965 |
| 670 | Ga0495675_0182016 | 3300047444 | Bacteria | 1286 |
| 671 | Ga0495675_0213267 | 3300047444 | Bacteria | 1171 |
| 672 | Ga0495677_0100213 | 3300047445 | Bacteria | 1096 |
| 673 | Ga0495679_056473 | 3300047446 | Bacteria | 1163 |
| 674 | Ga0495685_017784 | 3300047447 | Bacteria | 2436 |
| 675 | Ga0495681_0011323 | 3300047470 | Bacteria | 5319 |
| 676 | Ga0495681_0022268 | 3300047470 | Bacteria | 3396 |
| 677 | Ga0495684_0017015 | 3300047471 | Bacteria | 5601 |
| 678 | Ga0495684_0034517 | 3300047471 | Bacteria | 3881 |
| 679 | Ga0495684_0121735 | 3300047471 | Bacteria | 1965 |
| 680 | Ga0495684_0425487 | 3300047471 | Bacteria | 927 |
| 681 | Ga0495686_0010043 | 3300047472 | Bacteria | 6762 |
| 682 | Ga0495686_0292582 | 3300047472 | Bacteria | 901 |
| 683 | Ga0495593_0000502 | 3300047673 | Bacteria | 22126 |
| 684 | Ga0495593_0266855 | 3300047673 | Bacteria | 857 |
| 685 | Ga0495593_0383662 | 3300047673 | Bacteria | 703 |
| 686 | Ga0495602_0000122 | 3300048088 | Bacteria | 73031 |
| 687 | Ga0495602_0004911 | 3300048088 | Bacteria | 14001 |
| 688 | Ga0495602_0057291 | 3300048088 | Bacteria | 3419 |
| 689 | Ga0495602_0371960 | 3300048088 | Bacteria | 1026 |
| 690 | Ga0495614_0003948 | 3300048089 | Bacteria | 6657 |
| 691 | Ga0495614_0035603 | 3300048089 | Bacteria | 2138 |
| 692 | Ga0495614_0199190 | 3300048089 | Bacteria | 905 |
| 693 | Ga0496100_0014426 | 3300048903 | Bacteria | 4587 |
| 694 | Ga0496100_0253288 | 3300048903 | Bacteria | 1303 |
| 695 | Ga0496100_0287766 | 3300048903 | Bacteria | 1227 |
| 696 | Ga0496100_0360466 | 3300048903 | Bacteria | 1100 |
| 697 | Ga0496100_0525331 | 3300048903 | Bacteria | 914 |
| 698 | Ga0496100_0719996 | 3300048903 | Bacteria | 779 |
| 699 | Ga0496101_0080889 | 3300048904 | Bacteria | 2401 |
| 700 | Ga0496101_0467164 | 3300048904 | Bacteria | 996 |
| 701 | Ga0496102_0006584 | 3300048905 | Bacteria | 9922 |
| 702 | Ga0496102_0018232 | 3300048905 | Bacteria | 6164 |
| 703 | Ga0496102_0060479 | 3300048905 | Bacteria | 3464 |
| 704 | Ga0496102_0127560 | 3300048905 | Bacteria | 2379 |
| 705 | Ga0496102_0144484 | 3300048905 | Bacteria | 2232 |
| 706 | Ga0496103_0090114 | 3300048906 | Bacteria | 1935 |
| 707 | Ga0496104_0002900 | 3300048907 | Bacteria | 14772 |
| 708 | Ga0496104_0196757 | 3300048907 | Bacteria | 1928 |
| 709 | Ga0496104_0235405 | 3300048907 | Bacteria | 1743 |
| 710 | Ga0496104_0255440 | 3300048907 | Bacteria | 1665 |
| 711 | Ga0496105_0022958 | 3300048908 | Bacteria | 5058 |
| 712 | Ga0496105_0053757 | 3300048908 | Bacteria | 3326 |
| 713 | Ga0496105_0174319 | 3300048908 | Bacteria | 1762 |
| 714 | Ga0496105_0230839 | 3300048908 | Bacteria | 1504 |
| 715 | Ga0496106_0098630 | 3300048909 | Bacteria | 2264 |
| 716 | Ga0496106_0279844 | 3300048909 | Bacteria | 1336 |
| 717 | Ga0496107_0039192 | 3300048910 | Bacteria | 3399 |
| 718 | Ga0496107_0125469 | 3300048910 | Bacteria | 1893 |
| 719 | Ga0496107_0350441 | 3300048910 | Bacteria | 1099 |
| 720 | Ga0496108_0001829 | 3300048911 | Bacteria | 16995 |
| 721 | Ga0496108_0160244 | 3300048911 | Bacteria | 1944 |
| 722 | Ga0496108_0169104 | 3300048911 | Bacteria | 1891 |
| 723 | Ga0496108_0591079 | 3300048911 | Bacteria | 967 |
| 724 | Ga0496109_0005390 | 3300048912 | Bacteria | 10696 |
| 725 | Ga0496109_0021188 | 3300048912 | Bacteria | 5746 |
| 726 | Ga0496109_0161070 | 3300048912 | Bacteria | 2102 |
| 727 | Ga0496109_0209303 | 3300048912 | Bacteria | 1834 |
| 728 | Ga0496109_0279195 | 3300048912 | Bacteria | 1574 |
| 729 | Ga0496109_0371042 | 3300048912 | Bacteria | 1352 |
| 730 | Ga0496109_0404815 | 3300048912 | Bacteria | 1289 |
| 731 | Ga0496110_0002280 | 3300048913 | Bacteria | 14327 |
| 732 | Ga0496110_0042628 | 3300048913 | Bacteria | 3961 |
| 733 | Ga0496110_0059109 | 3300048913 | Bacteria | 3378 |
| 734 | Ga0496110_0077325 | 3300048913 | Bacteria | 2960 |
| 735 | Ga0496110_0143092 | 3300048913 | Bacteria | 2162 |
| 736 | Ga0496110_0444023 | 3300048913 | Bacteria | 1182 |
| 737 | Ga0496111_0029689 | 3300048914 | Bacteria | 3884 |
| 738 | Ga0496111_0068214 | 3300048914 | Bacteria | 2584 |
| 739 | Ga0496111_0110152 | 3300048914 | Bacteria | 2028 |
| 740 | Ga0496111_0342579 | 3300048914 | Bacteria | 1106 |
| 741 | Ga0496112_0015530 | 3300048915 | Bacteria | 7111 |
| 742 | Ga0496112_0192418 | 3300048915 | Bacteria | 2001 |
| 743 | Ga0496114_0002623 | 3300048917 | Bacteria | 13721 |
| 744 | Ga0496114_0039618 | 3300048917 | Bacteria | 3899 |
| 745 | Ga0496114_0061330 | 3300048917 | Bacteria | 3145 |
| 746 | Ga0496114_0104067 | 3300048917 | Bacteria | 2427 |
| 747 | Ga0496114_0137371 | 3300048917 | Bacteria | 2114 |
| 748 | Ga0496114_0271830 | 3300048917 | Bacteria | 1493 |
| 749 | Ga0496114_0304162 | 3300048917 | Bacteria | 1408 |
| 750 | Ga0496114_0382720 | 3300048917 | Bacteria | 1246 |
| 751 | Ga0496114_0735411 | 3300048917 | Bacteria | 863 |
| 752 | Ga0496114_0752771 | 3300048917 | Bacteria | 852 |
| 753 | Ga0496115_0034174 | 3300048918 | Bacteria | 4018 |
| 754 | Ga0496115_0126115 | 3300048918 | Bacteria | 2109 |
| 755 | Ga0496115_0173083 | 3300048918 | Bacteria | 1785 |
| 756 | Ga0496119_0014576 | 3300048922 | Bacteria | 6134 |
| 757 | Ga0496122_0000427 | 3300048925 | Bacteria | 88913 |
| 758 | Ga0496122_0001313 | 3300048925 | Bacteria | 40783 |
| 759 | Ga0496123_0001011 | 3300048926 | Bacteria | 42966 |
| 760 | Ga0496124_0002673 | 3300048927 | Bacteria | 22841 |
| 761 | Ga0496125_0000224 | 3300048928 | Bacteria | 115811 |
| 762 | Ga0496126_0018319 | 3300048929 | Bacteria | 6944 |
| 763 | Ga0495682_0007362 | 3300049460 | Bacteria | 4387 |
| 764 | Ga0501311_037554 | 3300049527 | Bacteria | 724 |
| 765 | Ga0501031_0001184 | 3300049568 | Bacteria | 15874 |
| 766 | Ga0501031_0035365 | 3300049568 | Bacteria | 3258 |
| 767 | Ga0501031_0038291 | 3300049568 | Bacteria | 3130 |
| 768 | Ga0501031_0167370 | 3300049568 | Bacteria | 1436 |
| 769 | Ga0501032_0009955 | 3300049569 | Bacteria | 6865 |
| 770 | Ga0501032_0029677 | 3300049569 | Bacteria | 3751 |
| 771 | Ga0501032_0045823 | 3300049569 | Bacteria | 2956 |
| 772 | Ga0501033_0037030 | 3300049570 | Bacteria | 3653 |
| 773 | Ga0501033_0040853 | 3300049570 | Bacteria | 3462 |
| 774 | Ga0501033_0467233 | 3300049570 | Bacteria | 875 |
| 775 | Ga0501034_0017666 | 3300049571 | Bacteria | 7314 |
| 776 | Ga0501034_0025134 | 3300049571 | Bacteria | 6062 |
| 777 | Ga0501034_0974355 | 3300049571 | Bacteria | 733 |
| 778 | Ga0501036_0003151 | 3300049572 | Bacteria | 13156 |
| 779 | Ga0501036_0016460 | 3300049572 | Bacteria | 6176 |
| 780 | Ga0501036_0072511 | 3300049572 | Bacteria | 2911 |
| 781 | Ga0501036_0573998 | 3300049572 | Bacteria | 937 |
| 782 | Ga0501036_0738665 | 3300049572 | Bacteria | 812 |
| 783 | Ga0501037_0001542 | 3300049573 | Bacteria | 16807 |
| 784 | Ga0501037_0077424 | 3300049573 | Bacteria | 2413 |
| 785 | Ga0501037_0311926 | 3300049573 | Bacteria | 1090 |
| 786 | Ga0501038_0006359 | 3300049574 | Bacteria | 10933 |
| 787 | Ga0501038_0013850 | 3300049574 | Bacteria | 7349 |
| 788 | Ga0501038_0027453 | 3300049574 | Bacteria | 5064 |
| 789 | Ga0501038_0060824 | 3300049574 | Bacteria | 3232 |
| 790 | Ga0501038_0296849 | 3300049574 | Bacteria | 1269 |
| 791 | Ga0501038_0631517 | 3300049574 | Bacteria | 808 |
| 792 | Ga0501039_0060759 | 3300049575 | Bacteria | 2926 |
| 793 | Ga0501039_0066115 | 3300049575 | Bacteria | 2806 |
| 794 | Ga0501039_0095713 | 3300049575 | Bacteria | 2315 |
| 795 | Ga0501039_0119059 | 3300049575 | Bacteria | 2068 |
| 796 | Ga0501039_0197241 | 3300049575 | Bacteria | 1583 |
| 797 | Ga0501039_0264249 | 3300049575 | Bacteria | 1352 |
| 798 | Ga0501039_0325856 | 3300049575 | Bacteria | 1207 |
| 799 | Ga0501040_0001769 | 3300049576 | Bacteria | 13881 |
| 800 | Ga0501040_0373067 | 3300049576 | Bacteria | 1023 |
| 801 | Ga0501041_0033268 | 3300049577 | Bacteria | 3118 |
| 802 | Ga0501041_0116836 | 3300049577 | Bacteria | 1657 |
| 803 | Ga0501041_0199410 | 3300049577 | Bacteria | 1254 |
| 804 | Ga0501042_0002229 | 3300049578 | Bacteria | 11834 |
| 805 | Ga0501042_0022572 | 3300049578 | Bacteria | 4397 |
| 806 | Ga0501042_0025478 | 3300049578 | Bacteria | 4155 |
| 807 | Ga0501042_0199680 | 3300049578 | Bacteria | 1442 |
| 808 | Ga0501043_0186935 | 3300049579 | Bacteria | 1612 |
| 809 | Ga0501043_0621674 | 3300049579 | Bacteria | 796 |
| 810 | Ga0501046_0008898 | 3300049580 | Bacteria | 8715 |
| 811 | Ga0501046_0096852 | 3300049580 | Bacteria | 2266 |
| 812 | Ga0501047_0067949 | 3300049581 | Bacteria | 3433 |
| 813 | Ga0501047_0180795 | 3300049581 | Bacteria | 1975 |
| 814 | Ga0501047_0633149 | 3300049581 | Bacteria | 890 |
| 815 | Ga0501048_0002457 | 3300049582 | Bacteria | 14135 |
| 816 | Ga0501048_0013393 | 3300049582 | Bacteria | 6086 |
| 817 | Ga0501048_0459223 | 3300049582 | Bacteria | 912 |
| 818 | Ga0501048_0479940 | 3300049582 | Bacteria | 891 |
| 819 | Ga0501067_0011575 | 3300049583 | Bacteria | 4887 |
| 820 | Ga0501067_0013348 | 3300049583 | Bacteria | 4549 |
| 821 | Ga0501067_0037804 | 3300049583 | Bacteria | 2681 |
| 822 | Ga0501067_0271487 | 3300049583 | Bacteria | 944 |
| 823 | Ga0501068_0017893 | 3300049584 | Bacteria | 4103 |
| 824 | Ga0501069_0002848 | 3300049585 | Bacteria | 8858 |
| 825 | Ga0501069_0069242 | 3300049585 | Bacteria | 1976 |
| 826 | Ga0501069_0100181 | 3300049585 | Bacteria | 1644 |
| 827 | Ga0501070_0001688 | 3300049586 | Bacteria | 19572 |
| 828 | Ga0501070_0002568 | 3300049586 | Bacteria | 15892 |
| 829 | Ga0501070_0294168 | 3300049586 | Bacteria | 1323 |
| 830 | Ga0501071_0000242 | 3300049587 | Bacteria | 25216 |
| 831 | Ga0501071_0049006 | 3300049587 | Bacteria | 3040 |
| 832 | Ga0501071_0290036 | 3300049587 | Bacteria | 1239 |
| 833 | Ga0501072_0139940 | 3300049588 | Bacteria | 1929 |
| 834 | Ga0501073_0040926 | 3300049589 | Bacteria | 3276 |
| 835 | Ga0501074_0000467 | 3300049590 | Bacteria | 24425 |
| 836 | Ga0501074_0006376 | 3300049590 | Bacteria | 8517 |
| 837 | Ga0501075_0001324 | 3300049591 | Bacteria | 16072 |
| 838 | Ga0501076_0003324 | 3300049592 | Bacteria | 11279 |
| 839 | Ga0501076_0385447 | 3300049592 | Bacteria | 1152 |
| 840 | Ga0501076_0657676 | 3300049592 | Bacteria | 865 |
| 841 | Ga0501077_0016615 | 3300049593 | Bacteria | 4638 |
| 842 | Ga0501077_0284487 | 3300049593 | Bacteria | 1053 |
| 843 | Ga0501077_0324691 | 3300049593 | Bacteria | 981 |
| 844 | Ga0501079_0000775 | 3300049741 | Bacteria | 21903 |
| 845 | Ga0501079_0001427 | 3300049741 | Bacteria | 16880 |
| 846 | Ga0501079_0261470 | 3300049741 | Bacteria | 1353 |
| 847 | Ga0501080_0000216 | 3300049742 | Bacteria | 42846 |
| 848 | Ga0501080_0001308 | 3300049742 | Bacteria | 20742 |
| 849 | Ga0501080_0012152 | 3300049742 | Bacteria | 7890 |
| 850 | Ga0501080_0177105 | 3300049742 | Bacteria | 1964 |
| 851 | Ga0501282_006660 | 3300049778 | Bacteria | 1235 |
| 852 | Ga0501035_0014210 | 3300049822 | Bacteria | 7348 |
| 853 | Ga0501035_0062968 | 3300049822 | Bacteria | 3299 |
| 854 | Ga0501044_0024328 | 3300049823 | Bacteria | 6432 |
| 855 | Ga0501044_0025847 | 3300049823 | Bacteria | 6224 |
| 856 | Ga0501044_0042064 | 3300049823 | Bacteria | 4755 |
| 857 | Ga0501044_0061626 | 3300049823 | Bacteria | 3837 |
| 858 | Ga0501044_0364985 | 3300049823 | Bacteria | 1361 |
| 859 | Ga0501045_0120494 | 3300049824 | Bacteria | 1948 |
| 860 | Ga0501045_0600989 | 3300049824 | Bacteria | 814 |
| 861 | nmdc:mga00v17_109896_c1 | 3300050491 | Bacteria | 1748 |
| 862 | nmdc:mga04h51_13427_c1 | 3300050495 | Bacteria | 2318 |
| 863 | nmdc:mga05p37_2183_c1 | 3300050507 | Bacteria | 20557 |
| 864 | nmdc:mga05p37_573_c1 | 3300050507 | Bacteria | 40363 |
| 865 | nmdc:mga09592_115689_c1 | 3300050508 | Bacteria | 2302 |
| 866 | nmdc:mga09592_227_c1 | 3300050508 | Bacteria | 40641 |
| 867 | nmdc:mga0qj67_14713_c1 | 3300050509 | Bacteria | 5916 |
| 868 | nmdc:mga0qj67_22215_c1 | 3300050509 | Bacteria | 4873 |
| 869 | nmdc:mga06r32_6575_c1 | 3300050510 | Bacteria | 10443 |
| 870 | nmdc:mga06r32_83_c1 | 3300050510 | Bacteria | 64174 |
| 871 | nmdc:mga08y16_1700_c1 | 3300050511 | Bacteria | 22309 |
| 872 | nmdc:mga08y16_289193_c1 | 3300050511 | Bacteria | 1690 |
| 873 | nmdc:mga0n895_337582_c1 | 3300050512 | Bacteria | 1526 |
| 874 | nmdc:mga0n895_679369_c1 | 3300050512 | Bacteria | 1027 |
| 875 | Ga0495601_0010947 | 3300053077 | Bacteria | 5415 |
| 876 | Ga0495595_0000288 | 3300053084 | Bacteria | 19645 |
| 877 | Ga0495619_0132905 | 3300053085 | Bacteria | 1710 |
| 878 | Ga0500644_0074958 | 3300053088 | Bacteria | 1229 |
| 879 | Ga0500644_0106263 | 3300053088 | Bacteria | 1074 |
| 880 | Ga0500644_0244546 | 3300053088 | Bacteria | 755 |
| 881 | Ga0500583_0124604 | 3300053092 | Bacteria | 1276 |
| 882 | Ga0500640_004946 | 3300053095 | Bacteria | 4904 |
| 883 | Ga0500650_0288150 | 3300053098 | Bacteria | 729 |
| 884 | Ga0500593_006236 | 3300053117 | Bacteria | 4759 |
| 885 | Ga0500628_090127 | 3300053129 | Bacteria | 798 |
| 886 | Ga0500577_0051165 | 3300053142 | Bacteria | 1552 |
| 887 | Ga0500577_0085207 | 3300053142 | Bacteria | 1267 |
| 888 | Ga0500586_126805 | 3300053145 | Bacteria | 886 |
| 889 | Ga0500600_0096129 | 3300053149 | Bacteria | 1572 |
| 890 | Ga0500624_002937 | 3300053157 | Bacteria | 2253 |
| 891 | Ga0501084_0008293 | 3300054114 | Bacteria | 8572 |
| 892 | Ga0501084_0259444 | 3300054114 | Bacteria | 1467 |
| 893 | Ga0501082_0008844 | 3300060353 | Bacteria | 8686 |
| 894 | Ga0466962_0006460 | 3300061719 | Bacteria | 5627 |
| 895 | Ga0466962_0024932 | 3300061719 | Bacteria | 2871 |
| 896 | Ga0530510_0001746 | 3300061734 | Bacteria | 14819 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009148 | Ga0105243_10771183 | Ga0105243_107711831 | 207 |
| 2 | 3300017792 | Ga0163161_10148043 | Ga0163161_101480432 | 207 |
| 3 | iso_pu_bacteria | 2775506925 | 2776370631 | 209 |
| 4 | 3300044658 | Ga0466972_0177323 | Ga0466972_0177323_12_647 | 210 |
| 5 | 3300045976 | Ga0466967_0707106 | Ga0466967_0707106_339_974 | 210 |
| 6 | 3300046453 | Ga0495627_032214 | Ga0495627_032214_944_1579 | 211 |
| 7 | 3300049823 | Ga0501044_0025847 | Ga0501044_0025847_485_1186 | 214 |
| 8 | 3300049578 | Ga0501042_0199680 | Ga0501042_0199680_777_1424 | 215 |
| 9 | iso_pu_bacteria | 2643221567 | 2643851560 | 216 |
| 10 | iso_pu_bacteria | 2643221624 | 2644137850 | 216 |
| 11 | iso_pu_bacteria | 2643221690 | 2644505476 | 216 |
| 12 | iso_pu_bacteria | 2643221694 | 2644524725 | 216 |
| 13 | iso_pu_bacteria | 2643221722 | 2644668813 | 216 |
| 14 | 3300039437 | Ga0436365_0351909 | Ga0436365_0351909_709_1365 | 217 |
| 15 | 3300039453 | Ga0436362_1280188 | Ga0436362_1280188_40154_40810 | 217 |
| 16 | iso_pu_bacteria | 2808606365 | 2808872634 | 217 |
| 17 | 3300031727 | Ga0316576_10012619 | Ga0316576_100126193 | 219 |
| 18 | 3300031727 | Ga0316576_10016994 | Ga0316576_100169943 | 219 |
| 19 | 3300031728 | Ga0316578_10014913 | Ga0316578_100149136 | 219 |
| 20 | 3300031728 | Ga0316578_10172700 | Ga0316578_101727001 | 219 |
| 21 | 3300041407 | Ga0439447_063540 | Ga0439447_063540_94_771 | 219 |
| 22 | iso_pu_bacteria | 2558860280 | 2559427661 | 219 |
| 23 | iso_pu_bacteria | 2565956761 | 2566994951 | 219 |
| 24 | iso_pu_bacteria | 2582580736 | 2583151914 | 219 |
| 25 | iso_pu_bacteria | 2585427649 | 2586065217 | 219 |
| 26 | iso_pu_bacteria | 2738541308 | 2738890883 | 219 |
| 27 | iso_pu_bacteria | 2738543005 | 2739206952 | 219 |
| 28 | iso_pu_bacteria | 2738543011 | 2739238882 | 219 |
| 29 | iso_pu_bacteria | 2738543034 | 2739362645 | 219 |
| 30 | iso_pu_bacteria | 2744054611 | 2744955530 | 219 |
| 31 | iso_pu_bacteria | 2791354901 | 2791913765 | 219 |
| 32 | iso_pu_bacteria | 2795385472 | 2795793891 | 219 |
| 33 | iso_pu_bacteria | 2808606522 | 2809593612 | 219 |
| 34 | iso_pu_bacteria | 2816332139 | 2816506091 | 219 |
| 35 | iso_pu_bacteria | 2842888712 | 2842889637 | 219 |
| 36 | iso_pu_bacteria | 2863067949 | 2863069530 | 219 |
| 37 | iso_pu_bacteria | 2866552031 | 2866553301 | 219 |
| 38 | iso_pu_bacteria | 2866612099 | 2866612439 | 219 |
| 39 | iso_pu_bacteria | 2889300758 | 2889303992 | 219 |
| 40 | iso_pu_bacteria | 2891326441 | 2891328384 | 219 |
| 41 | iso_pu_bacteria | 2899359706 | 2899362328 | 219 |
| 42 | iso_pu_bacteria | 2899370129 | 2899373033 | 219 |
| 43 | iso_pu_bacteria | 2904535858 | 2904535900 | 219 |
| 44 | iso_pu_bacteria | 2904765812 | 2904768033 | 219 |
| 45 | iso_pu_bacteria | 2904770941 | 2904774131 | 219 |
| 46 | iso_pu_bacteria | 2908811453 | 2908815334 | 219 |
| 47 | iso_pu_bacteria | 2915358134 | 2915363887 | 219 |
| 48 | iso_pu_bacteria | 2915768154 | 2915776006 | 219 |
| 49 | iso_pu_bacteria | 2917736166 | 2917739187 | 219 |
| 50 | iso_pu_bacteria | 2919420072 | 2919423536 | 219 |
| 51 | iso_pu_bacteria | 2919432681 | 2919436144 | 219 |
| 52 | iso_pu_bacteria | 2922554459 | 2922556064 | 219 |
| 53 | iso_pu_bacteria | 2928142448 | 2928146682 | 219 |
| 54 | iso_pu_bacteria | 2939743619 | 2939745614 | 219 |
| 55 | iso_pu_bacteria | 2956939328 | 2956940797 | 219 |
| 56 | iso_pu_bacteria | 2974315732 | 2974319512 | 219 |
| 57 | iso_pu_bacteria | 2984523437 | 2984527718 | 219 |
| 58 | iso_pu_bacteria | 3001119090 | 3001120487 | 219 |
| 59 | iso_pu_bacteria | 8003314358 | 8003315287 | 219 |
| 60 | iso_pu_bacteria | 8056207758 | 8056214954 | 219 |
| 61 | 3300005347 | Ga0070668_100415862 | Ga0070668_1004158622 | 220 |
| 62 | 3300005456 | Ga0070678_100791199 | Ga0070678_1007911991 | 220 |
| 63 | 3300005543 | Ga0070672_100373031 | Ga0070672_1003730312 | 220 |
| 64 | 3300006038 | Ga0075365_10340947 | Ga0075365_103409472 | 220 |
| 65 | 3300025972 | Ga0207668_10274803 | Ga0207668_102748032 | 220 |
| 66 | 3300026089 | Ga0207648_10269220 | Ga0207648_102692202 | 220 |
| 67 | 3300031995 | Ga0307409_100461832 | Ga0307409_1004618322 | 220 |
| 68 | iso_pu_bacteria | 2515154155 | 2515855460 | 220 |
| 69 | iso_pu_bacteria | 2554235005 | 2554257133 | 220 |
| 70 | iso_pu_bacteria | 2582581312 | 2585297952 | 220 |
| 71 | iso_pu_bacteria | 2582581314 | 2585312995 | 220 |
| 72 | iso_pu_bacteria | 2616644814 | 2616702948 | 220 |
| 73 | iso_pu_bacteria | 2616644941 | 2616903703 | 220 |
| 74 | iso_pu_bacteria | 2643221548 | 2643763414 | 220 |
| 75 | iso_pu_bacteria | 2643221578 | 2643900607 | 220 |
| 76 | iso_pu_bacteria | 2643221673 | 2644405172 | 220 |
| 77 | iso_pu_bacteria | 2643221682 | 2644463716 | 220 |
| 78 | iso_pu_bacteria | 2675903058 | 2676474303 | 220 |
| 79 | iso_pu_bacteria | 2818991463 | 2819698202 | 220 |
| 80 | iso_pu_bacteria | 2827628540 | 2827633228 | 220 |
| 81 | iso_pu_bacteria | 2862290372 | 2862294538 | 220 |
| 82 | iso_pu_bacteria | 2867346516 | 2867348658 | 220 |
| 83 | iso_pu_bacteria | 2873151551 | 2873155053 | 220 |
| 84 | iso_pu_bacteria | 2875391855 | 2875394762 | 220 |
| 85 | iso_pu_bacteria | 2946045630 | 2946049084 | 220 |
| 86 | iso_pu_bacteria | 2954002825 | 2954006230 | 220 |
| 87 | iso_pu_bacteria | 2966598605 | 2966602396 | 220 |
| 88 | iso_pu_bacteria | 3006321560 | 3006325266 | 220 |
| 89 | iso_pu_bacteria | 3006425503 | 3006425597 | 220 |
| 90 | iso_pu_bacteria | 3006486233 | 3006492749 | 220 |
| 91 | 3300002067 | JGI24735J21928_10045086 | JGI24735J21928_100450861 | 221 |
| 92 | 3300005535 | Ga0070684_100305937 | Ga0070684_1003059371 | 221 |
| 93 | 3300005577 | Ga0068857_100040943 | Ga0068857_1000409432 | 221 |
| 94 | 3300020070 | Ga0206356_11268019 | Ga0206356_112680192 | 221 |
| 95 | 3300020082 | Ga0206353_10607554 | Ga0206353_106075542 | 221 |
| 96 | 3300025921 | Ga0207652_10209407 | Ga0207652_102094071 | 221 |
| 97 | 3300026116 | Ga0207674_10154769 | Ga0207674_101547692 | 221 |
| 98 | 3300031548 | Ga0307408_100082526 | Ga0307408_1000825263 | 221 |
| 99 | 3300031665 | Ga0316575_10003903 | Ga0316575_100039034 | 221 |
| 100 | 3300031691 | Ga0316579_10002822 | Ga0316579_100028225 | 221 |
| 101 | 3300031691 | Ga0316579_10149533 | Ga0316579_101495331 | 221 |
| 102 | 3300031727 | Ga0316576_10039027 | Ga0316576_100390273 | 221 |
| 103 | 3300031727 | Ga0316576_10065340 | Ga0316576_100653403 | 221 |
| 104 | 3300031728 | Ga0316578_10000741 | Ga0316578_100007419 | 221 |
| 105 | 3300031728 | Ga0316578_10015115 | Ga0316578_100151154 | 221 |
| 106 | 3300031731 | Ga0307405_10147862 | Ga0307405_101478622 | 221 |
| 107 | 3300031733 | Ga0316577_10032277 | Ga0316577_100322773 | 221 |
| 108 | 3300031733 | Ga0316577_10055135 | Ga0316577_100551352 | 221 |
| 109 | 3300031901 | Ga0307406_10074511 | Ga0307406_100745113 | 221 |
| 110 | 3300031903 | Ga0307407_10061635 | Ga0307407_100616352 | 221 |
| 111 | 3300031911 | Ga0307412_10005135 | Ga0307412_100051352 | 221 |
| 112 | 3300031995 | Ga0307409_100003830 | Ga0307409_1000038308 | 221 |
| 113 | 3300032002 | Ga0307416_100075345 | Ga0307416_1000753453 | 221 |
| 114 | 3300032005 | Ga0307411_10087017 | Ga0307411_100870173 | 221 |
| 115 | 3300032133 | Ga0316583_10037593 | Ga0316583_100375932 | 221 |
| 116 | 3300032137 | Ga0316585_10009368 | Ga0316585_100093683 | 221 |
| 117 | 3300032139 | Ga0316580_10016251 | Ga0316580_100162512 | 221 |
| 118 | 3300032139 | Ga0316580_10023382 | Ga0316580_100233822 | 221 |
| 119 | iso_pu_bacteria | 2643221613 | 2644080956 | 221 |
| 120 | iso_pu_bacteria | 2643221641 | 2644232095 | 221 |
| 121 | iso_pu_bacteria | 2643221721 | 2644663727 | 221 |
| 122 | iso_pu_bacteria | 2738543027 | 2739325721 | 221 |
| 123 | iso_pu_bacteria | 2739367654 | 2739608422 | 221 |
| 124 | iso_pu_bacteria | 2739367898 | 2740168540 | 221 |
| 125 | iso_pu_bacteria | 2758568522 | 2760305775 | 221 |
| 126 | iso_pu_bacteria | 2758568621 | 2760625715 | 221 |
| 127 | iso_pu_bacteria | 2784132109 | 2784473277 | 221 |
| 128 | iso_pu_bacteria | 2808606394 | 2809030746 | 221 |
| 129 | iso_pu_bacteria | 2811994880 | 2812363819 | 221 |
| 130 | iso_pu_bacteria | 2839986021 | 2839986682 | 221 |
| 131 | iso_pu_bacteria | 2857479173 | 2857480702 | 221 |
| 132 | iso_pu_bacteria | 2857481737 | 2857484936 | 221 |
| 133 | iso_pu_bacteria | 2857632687 | 2857634016 | 221 |
| 134 | iso_pu_bacteria | 2868088558 | 2868091495 | 221 |
| 135 | iso_pu_bacteria | 2870801768 | 2870801806 | 221 |
| 136 | iso_pu_bacteria | 2870804320 | 2870806199 | 221 |
| 137 | iso_pu_bacteria | 2884994152 | 2884997031 | 221 |
| 138 | iso_pu_bacteria | 2919446982 | 2919448945 | 221 |
| 139 | iso_pu_bacteria | 2932431166 | 2932434554 | 221 |
| 140 | iso_pu_bacteria | 2935890801 | 2935892454 | 221 |
| 141 | iso_pu_bacteria | 2984576629 | 2984577735 | 221 |
| 142 | iso_pu_bacteria | 2990256926 | 2990260566 | 221 |
| 143 | iso_pu_bacteria | 8054609563 | 8054614037 | 221 |
| 144 | iso_pu_bacteria | 8056579771 | 8056584674 | 221 |
| 145 | iso_pu_bacteria | 2835188231 | 2835189873 | 222 |
| 146 | 3300005327 | Ga0070658_10160210 | Ga0070658_101602103 | 223 |
| 147 | 3300005327 | Ga0070658_10304334 | Ga0070658_103043342 | 223 |
| 148 | 3300005328 | Ga0070676_10343869 | Ga0070676_103438691 | 223 |
| 149 | 3300005329 | Ga0070683_100129855 | Ga0070683_1001298552 | 223 |
| 150 | 3300005329 | Ga0070683_100489581 | Ga0070683_1004895812 | 223 |
| 151 | 3300005334 | Ga0068869_100087253 | Ga0068869_1000872532 | 223 |
| 152 | 3300005337 | Ga0070682_100073395 | Ga0070682_1000733954 | 223 |
| 153 | 3300005337 | Ga0070682_100113663 | Ga0070682_1001136632 | 223 |
| 154 | 3300005337 | Ga0070682_100178411 | Ga0070682_1001784111 | 223 |
| 155 | 3300005337 | Ga0070682_100246469 | Ga0070682_1002464691 | 223 |
| 156 | 3300005338 | Ga0068868_100162580 | Ga0068868_1001625802 | 223 |
| 157 | 3300005339 | Ga0070660_100110009 | Ga0070660_1001100092 | 223 |
| 158 | 3300005340 | Ga0070689_100200667 | Ga0070689_1002006672 | 223 |
| 159 | 3300005347 | Ga0070668_100000514 | Ga0070668_10000051425 | 223 |
| 160 | 3300005347 | Ga0070668_100049408 | Ga0070668_1000494083 | 223 |
| 161 | 3300005347 | Ga0070668_100172248 | Ga0070668_1001722482 | 223 |
| 162 | 3300005354 | Ga0070675_100227892 | Ga0070675_1002278922 | 223 |
| 163 | 3300005356 | Ga0070674_100039819 | Ga0070674_1000398193 | 223 |
| 164 | 3300005366 | Ga0070659_100278770 | Ga0070659_1002787702 | 223 |
| 165 | 3300005435 | Ga0070714_100011321 | Ga0070714_1000113216 | 223 |
| 166 | 3300005436 | Ga0070713_100094562 | Ga0070713_1000945622 | 223 |
| 167 | 3300005441 | Ga0070700_100103323 | Ga0070700_1001033232 | 223 |
| 168 | 3300005455 | Ga0070663_100002651 | Ga0070663_10000265111 | 223 |
| 169 | 3300005455 | Ga0070663_100080066 | Ga0070663_1000800662 | 223 |
| 170 | 3300005455 | Ga0070663_100146243 | Ga0070663_1001462431 | 223 |
| 171 | 3300005456 | Ga0070678_100129245 | Ga0070678_1001292453 | 223 |
| 172 | 3300005456 | Ga0070678_100304768 | Ga0070678_1003047682 | 223 |
| 173 | 3300005466 | Ga0070685_10132433 | Ga0070685_101324332 | 223 |
| 174 | 3300005543 | Ga0070672_100372232 | Ga0070672_1003722322 | 223 |
| 175 | 3300005548 | Ga0070665_100134978 | Ga0070665_1001349782 | 223 |
| 176 | 3300005548 | Ga0070665_100234266 | Ga0070665_1002342662 | 223 |
| 177 | 3300005548 | Ga0070665_100312848 | Ga0070665_1003128483 | 223 |
| 178 | 3300005564 | Ga0070664_100141426 | Ga0070664_1001414262 | 223 |
| 179 | 3300005564 | Ga0070664_100375235 | Ga0070664_1003752352 | 223 |
| 180 | 3300005577 | Ga0068857_100140524 | Ga0068857_1001405242 | 223 |
| 181 | 3300005577 | Ga0068857_100192116 | Ga0068857_1001921162 | 223 |
| 182 | 3300005578 | Ga0068854_100164222 | Ga0068854_1001642222 | 223 |
| 183 | 3300005614 | Ga0068856_100484710 | Ga0068856_1004847102 | 223 |
| 184 | 3300005615 | Ga0070702_100167662 | Ga0070702_1001676621 | 223 |
| 185 | 3300005616 | Ga0068852_100227264 | Ga0068852_1002272643 | 223 |
| 186 | 3300005616 | Ga0068852_100262894 | Ga0068852_1002628942 | 223 |
| 187 | 3300005617 | Ga0068859_100210674 | Ga0068859_1002106742 | 223 |
| 188 | 3300005618 | Ga0068864_100352644 | Ga0068864_1003526442 | 223 |
| 189 | 3300005719 | Ga0068861_100053493 | Ga0068861_1000534933 | 223 |
| 190 | 3300005840 | Ga0068870_10042549 | Ga0068870_100425492 | 223 |
| 191 | 3300005841 | Ga0068863_100249115 | Ga0068863_1002491153 | 223 |
| 192 | 3300005842 | Ga0068858_100590881 | Ga0068858_1005908812 | 223 |
| 193 | 3300005985 | Ga0081539_10000027 | Ga0081539_10000027283 | 223 |
| 194 | 3300006931 | Ga0097620_100210674 | Ga0097620_1002106742 | 223 |
| 195 | 3300009094 | Ga0111539_10360620 | Ga0111539_103606202 | 223 |
| 196 | 3300009094 | Ga0111539_10589772 | Ga0111539_105897721 | 223 |
| 197 | 3300009098 | Ga0105245_10198585 | Ga0105245_101985852 | 223 |
| 198 | 3300009098 | Ga0105245_10334667 | Ga0105245_103346672 | 223 |
| 199 | 3300009148 | Ga0105243_10001133 | Ga0105243_100011338 | 223 |
| 200 | 3300009148 | Ga0105243_10168242 | Ga0105243_101682421 | 223 |
| 201 | 3300009148 | Ga0105243_10625379 | Ga0105243_106253791 | 223 |
| 202 | 3300009545 | Ga0105237_10520597 | Ga0105237_105205971 | 223 |
| 203 | 3300009988 | Ga0105035_101768 | Ga0105035_1017681 | 223 |
| 204 | 3300010375 | Ga0105239_10477382 | Ga0105239_104773821 | 223 |
| 205 | 3300012492 | Ga0157335_1004266 | Ga0157335_10042662 | 223 |
| 206 | 3300013102 | Ga0157371_10206178 | Ga0157371_102061782 | 223 |
| 207 | 3300013296 | Ga0157374_10332018 | Ga0157374_103320183 | 223 |
| 208 | 3300013306 | Ga0163162_10145893 | Ga0163162_101458932 | 223 |
| 209 | 3300013307 | Ga0157372_10286793 | Ga0157372_102867932 | 223 |
| 210 | 3300013308 | Ga0157375_10548643 | Ga0157375_105486432 | 223 |
| 211 | 3300014325 | Ga0163163_10419864 | Ga0163163_104198642 | 223 |
| 212 | 3300014745 | Ga0157377_10023060 | Ga0157377_100230602 | 223 |
| 213 | 3300014968 | Ga0157379_10180503 | Ga0157379_101805032 | 223 |
| 214 | 3300020070 | Ga0206356_10804711 | Ga0206356_108047111 | 223 |
| 215 | 3300020082 | Ga0206353_10235487 | Ga0206353_102354871 | 223 |
| 216 | 3300021384 | Ga0213876_10017812 | Ga0213876_100178126 | 223 |
| 217 | 3300021388 | Ga0213875_10000221 | Ga0213875_1000022125 | 223 |
| 218 | 3300021388 | Ga0213875_10014027 | Ga0213875_100140274 | 223 |
| 219 | 3300022467 | Ga0224712_10071847 | Ga0224712_100718472 | 223 |
| 220 | 3300022467 | Ga0224712_10116778 | Ga0224712_101167782 | 223 |
| 221 | 3300022467 | Ga0224712_10262238 | Ga0224712_102622381 | 223 |
| 222 | 3300025321 | Ga0207656_10019393 | Ga0207656_100193934 | 223 |
| 223 | 3300025899 | Ga0207642_10420788 | Ga0207642_104207881 | 223 |
| 224 | 3300025900 | Ga0207710_10012332 | Ga0207710_100123324 | 223 |
| 225 | 3300025901 | Ga0207688_10004602 | Ga0207688_100046025 | 223 |
| 226 | 3300025901 | Ga0207688_10085157 | Ga0207688_100851572 | 223 |
| 227 | 3300025904 | Ga0207647_10171646 | Ga0207647_101716462 | 223 |
| 228 | 3300025907 | Ga0207645_10014867 | Ga0207645_100148675 | 223 |
| 229 | 3300025908 | Ga0207643_10013050 | Ga0207643_100130502 | 223 |
| 230 | 3300025909 | Ga0207705_10291805 | Ga0207705_102918052 | 223 |
| 231 | 3300025914 | Ga0207671_10176266 | Ga0207671_101762663 | 223 |
| 232 | 3300025916 | Ga0207663_10430692 | Ga0207663_104306922 | 223 |
| 233 | 3300025919 | Ga0207657_10188967 | Ga0207657_101889672 | 223 |
| 234 | 3300025919 | Ga0207657_10253310 | Ga0207657_102533101 | 223 |
| 235 | 3300025928 | Ga0207700_10077540 | Ga0207700_100775403 | 223 |
| 236 | 3300025929 | Ga0207664_10008962 | Ga0207664_100089623 | 223 |
| 237 | 3300025933 | Ga0207706_10070653 | Ga0207706_100706532 | 223 |
| 238 | 3300025935 | Ga0207709_10000356 | Ga0207709_1000035642 | 223 |
| 239 | 3300025935 | Ga0207709_10326808 | Ga0207709_103268082 | 223 |
| 240 | 3300025937 | Ga0207669_10158319 | Ga0207669_101583192 | 223 |
| 241 | 3300025938 | Ga0207704_10502727 | Ga0207704_105027271 | 223 |
| 242 | 3300025940 | Ga0207691_10271255 | Ga0207691_102712552 | 223 |
| 243 | 3300025942 | Ga0207689_10065444 | Ga0207689_100654443 | 223 |
| 244 | 3300025942 | Ga0207689_10385003 | Ga0207689_103850032 | 223 |
| 245 | 3300025944 | Ga0207661_10068915 | Ga0207661_100689153 | 223 |
| 246 | 3300025944 | Ga0207661_10409640 | Ga0207661_104096402 | 223 |
| 247 | 3300025944 | Ga0207661_10653496 | Ga0207661_106534961 | 223 |
| 248 | 3300025945 | Ga0207679_11013228 | Ga0207679_110132281 | 223 |
| 249 | 3300025960 | Ga0207651_10048409 | Ga0207651_100484093 | 223 |
| 250 | 3300025972 | Ga0207668_10012757 | Ga0207668_100127571 | 223 |
| 251 | 3300025972 | Ga0207668_10072336 | Ga0207668_100723362 | 223 |
| 252 | 3300025972 | Ga0207668_10102057 | Ga0207668_101020571 | 223 |
| 253 | 3300025986 | Ga0207658_10456665 | Ga0207658_104566652 | 223 |
| 254 | 3300026035 | Ga0207703_10186182 | Ga0207703_101861822 | 223 |
| 255 | 3300026067 | Ga0207678_10000054 | Ga0207678_1000005436 | 223 |
| 256 | 3300026067 | Ga0207678_10023227 | Ga0207678_100232276 | 223 |
| 257 | 3300026067 | Ga0207678_10273051 | Ga0207678_102730512 | 223 |
| 258 | 3300026075 | Ga0207708_10227548 | Ga0207708_102275482 | 223 |
| 259 | 3300026078 | Ga0207702_11303495 | Ga0207702_113034951 | 223 |
| 260 | 3300026095 | Ga0207676_10334276 | Ga0207676_103342762 | 223 |
| 261 | 3300026116 | Ga0207674_10081024 | Ga0207674_100810242 | 223 |
| 262 | 3300026116 | Ga0207674_10458407 | Ga0207674_104584072 | 223 |
| 263 | 3300026118 | Ga0207675_100007887 | Ga0207675_10000788710 | 223 |
| 264 | 3300026118 | Ga0207675_100049410 | Ga0207675_1000494103 | 223 |
| 265 | 3300026121 | Ga0207683_10033184 | Ga0207683_100331843 | 223 |
| 266 | 3300026121 | Ga0207683_10309154 | Ga0207683_103091541 | 223 |
| 267 | 3300026142 | Ga0207698_10247702 | Ga0207698_102477022 | 223 |
| 268 | 3300028379 | Ga0268266_10074264 | Ga0268266_100742642 | 223 |
| 269 | 3300028379 | Ga0268266_10278754 | Ga0268266_102787542 | 223 |
| 270 | 3300028380 | Ga0268265_10044138 | Ga0268265_100441383 | 223 |
| 271 | 3300028380 | Ga0268265_10469893 | Ga0268265_104698931 | 223 |
| 272 | 3300028381 | Ga0268264_10154211 | Ga0268264_101542113 | 223 |
| 273 | 3300028794 | Ga0307515_10045822 | Ga0307515_100458226 | 223 |
| 274 | 3300028794 | Ga0307515_10271020 | Ga0307515_102710202 | 223 |
| 275 | 3300030521 | Ga0307511_10161577 | Ga0307511_101615772 | 223 |
| 276 | 3300030522 | Ga0307512_10013770 | Ga0307512_100137703 | 223 |
| 277 | 3300031456 | Ga0307513_10239286 | Ga0307513_102392862 | 223 |
| 278 | 3300031824 | Ga0307413_10003445 | Ga0307413_100034457 | 223 |
| 279 | 3300031838 | Ga0307518_10000115 | Ga0307518_1000011525 | 223 |
| 280 | 3300031838 | Ga0307518_10184982 | Ga0307518_101849822 | 223 |
| 281 | 3300031852 | Ga0307410_10035741 | Ga0307410_100357413 | 223 |
| 282 | 3300032002 | Ga0307416_100442747 | Ga0307416_1004427471 | 223 |
| 283 | 3300032005 | Ga0307411_10738936 | Ga0307411_107389361 | 223 |
| 284 | 3300032126 | Ga0307415_100042790 | Ga0307415_1000427902 | 223 |
| 285 | 3300033179 | Ga0307507_10038539 | Ga0307507_100385396 | 223 |
| 286 | 3300033180 | Ga0307510_10066364 | Ga0307510_100663641 | 223 |
| 287 | 3300036401 | Ga0373937_1045922 | Ga0373937_1045922_74_748 | 223 |
| 288 | 3300037853 | Ga0436364_0109597 | Ga0436364_0109597_28107_28781 | 223 |
| 289 | 3300037853 | Ga0436364_1145828 | Ga0436364_1145828_7698_8372 | 223 |
| 290 | 3300044684 | Ga0466966_0039876 | Ga0466966_0039876_2003_2677 | 223 |
| 291 | 3300044693 | Ga0466961_0160398 | Ga0466961_0160398_49_723 | 223 |
| 292 | 3300044719 | Ga0466971_0099501 | Ga0466971_0099501_593_1267 | 223 |
| 293 | 3300044735 | Ga0466968_0000536 | Ga0466968_0000536_3770_4444 | 223 |
| 294 | 3300044842 | Ga0466957_0040748 | Ga0466957_0040748_49_723 | 223 |
| 295 | 3300045049 | Ga0466959_0263705 | Ga0466959_0263705_80_754 | 223 |
| 296 | 3300045836 | Ga0466958_0001933 | Ga0466958_0001933_7469_8143 | 223 |
| 297 | 3300045976 | Ga0466967_0000897 | Ga0466967_0000897_9900_10574 | 223 |
| 298 | 3300045976 | Ga0466967_1220170 | Ga0466967_1220170_11_685 | 223 |
| 299 | 3300048903 | Ga0496100_0287766 | Ga0496100_0287766_431_1105 | 223 |
| 300 | 3300048907 | Ga0496104_0196757 | Ga0496104_0196757_245_919 | 223 |
| 301 | 3300048911 | Ga0496108_0169104 | Ga0496108_0169104_351_1025 | 223 |
| 302 | 3300048911 | Ga0496108_0591079 | Ga0496108_0591079_29_703 | 223 |
| 303 | 3300048913 | Ga0496110_0059109 | Ga0496110_0059109_479_1153 | 223 |
| 304 | 3300048913 | Ga0496110_0143092 | Ga0496110_0143092_1262_1936 | 223 |
| 305 | 3300048914 | Ga0496111_0110152 | Ga0496111_0110152_1135_1809 | 223 |
| 306 | 3300049571 | Ga0501034_0974355 | Ga0501034_0974355_42_716 | 223 |
| 307 | 3300049581 | Ga0501047_0633149 | Ga0501047_0633149_172_846 | 223 |
| 308 | 3300050511 | nmdc:mga08y16_289193_c1 | nmdc:mga08y16_289193_c1_607_1281 | 223 |
| 309 | 3300053088 | Ga0500644_0074958 | Ga0500644_0074958_351_1025 | 223 |
| 310 | 3300053088 | Ga0500644_0244546 | Ga0500644_0244546_39_713 | 223 |
| 311 | 3300053142 | Ga0500577_0051165 | Ga0500577_0051165_586_1260 | 223 |
| 312 | 3300003354 | JGI25160J50197_1042269 | JGI25160J50197_10422691 | 224 |
| 313 | 3300003578 | Ga0006562J51391_1046570 | Ga0006562J51391_10465701 | 224 |
| 314 | 3300005327 | Ga0070658_10005717 | Ga0070658_100057173 | 224 |
| 315 | 3300005327 | Ga0070658_10059768 | Ga0070658_100597682 | 224 |
| 316 | 3300005336 | Ga0070680_100001364 | Ga0070680_1000013646 | 224 |
| 317 | 3300005336 | Ga0070680_100036721 | Ga0070680_1000367212 | 224 |
| 318 | 3300005336 | Ga0070680_100040970 | Ga0070680_1000409702 | 224 |
| 319 | 3300005336 | Ga0070680_100058618 | Ga0070680_1000586184 | 224 |
| 320 | 3300005458 | Ga0070681_10000699 | Ga0070681_100006997 | 224 |
| 321 | 3300005458 | Ga0070681_10002094 | Ga0070681_100020942 | 224 |
| 322 | 3300005458 | Ga0070681_10270654 | Ga0070681_102706542 | 224 |
| 323 | 3300005530 | Ga0070679_100000016 | Ga0070679_10000001626 | 224 |
| 324 | 3300005530 | Ga0070679_100005127 | Ga0070679_1000051272 | 224 |
| 325 | 3300005530 | Ga0070679_100217893 | Ga0070679_1002178932 | 224 |
| 326 | 3300005530 | Ga0070679_100277455 | Ga0070679_1002774552 | 224 |
| 327 | 3300005535 | Ga0070684_100003966 | Ga0070684_10000396614 | 224 |
| 328 | 3300005539 | Ga0068853_100025230 | Ga0068853_1000252304 | 224 |
| 329 | 3300005548 | Ga0070665_101288685 | Ga0070665_1012886851 | 224 |
| 330 | 3300005616 | Ga0068852_100121073 | Ga0068852_1001210732 | 224 |
| 331 | 3300006178 | Ga0075367_10134435 | Ga0075367_101344352 | 224 |
| 332 | 3300009093 | Ga0105240_10615507 | Ga0105240_106155072 | 224 |
| 333 | 3300009176 | Ga0105242_10056290 | Ga0105242_100562904 | 224 |
| 334 | 3300009177 | Ga0105248_10361691 | Ga0105248_103616912 | 224 |
| 335 | 3300009545 | Ga0105237_10087968 | Ga0105237_100879683 | 224 |
| 336 | 3300011119 | Ga0105246_10037244 | Ga0105246_100372444 | 224 |
| 337 | 3300013105 | Ga0157369_10266986 | Ga0157369_102669862 | 224 |
| 338 | 3300014326 | Ga0157380_10444440 | Ga0157380_104444402 | 224 |
| 339 | 3300020070 | Ga0206356_10146858 | Ga0206356_101468582 | 224 |
| 340 | 3300021384 | Ga0213876_10001520 | Ga0213876_100015205 | 224 |
| 341 | 3300021388 | Ga0213875_10009789 | Ga0213875_100097894 | 224 |
| 342 | 3300025297 | Ga0209758_1010962 | Ga0209758_10109622 | 224 |
| 343 | 3300025909 | Ga0207705_10000470 | Ga0207705_1000047028 | 224 |
| 344 | 3300025909 | Ga0207705_10539733 | Ga0207705_105397331 | 224 |
| 345 | 3300025912 | Ga0207707_10000185 | Ga0207707_100001857 | 224 |
| 346 | 3300025912 | Ga0207707_10572160 | Ga0207707_105721601 | 224 |
| 347 | 3300025914 | Ga0207671_10345493 | Ga0207671_103454932 | 224 |
| 348 | 3300025917 | Ga0207660_10007057 | Ga0207660_100070576 | 224 |
| 349 | 3300025917 | Ga0207660_10043218 | Ga0207660_100432184 | 224 |
| 350 | 3300025917 | Ga0207660_10073494 | Ga0207660_100734942 | 224 |
| 351 | 3300025919 | Ga0207657_10195134 | Ga0207657_101951342 | 224 |
| 352 | 3300025921 | Ga0207652_10001048 | Ga0207652_1000104810 | 224 |
| 353 | 3300025921 | Ga0207652_10025309 | Ga0207652_100253092 | 224 |
| 354 | 3300025921 | Ga0207652_10081336 | Ga0207652_100813363 | 224 |
| 355 | 3300025921 | Ga0207652_10252126 | Ga0207652_102521263 | 224 |
| 356 | 3300025921 | Ga0207652_10564922 | Ga0207652_105649221 | 224 |
| 357 | 3300025927 | Ga0207687_10133549 | Ga0207687_101335491 | 224 |
| 358 | 3300025986 | Ga0207658_10688098 | Ga0207658_106880981 | 224 |
| 359 | 3300026041 | Ga0207639_10846743 | Ga0207639_108467431 | 224 |
| 360 | 3300026095 | Ga0207676_10824493 | Ga0207676_108244931 | 224 |
| 361 | 3300028786 | Ga0307517_10026479 | Ga0307517_100264792 | 224 |
| 362 | 3300028794 | Ga0307515_10017159 | Ga0307515_1001715910 | 224 |
| 363 | 3300028794 | Ga0307515_10160461 | Ga0307515_101604612 | 224 |
| 364 | 3300028794 | Ga0307515_10222639 | Ga0307515_102226392 | 224 |
| 365 | 3300030521 | Ga0307511_10060505 | Ga0307511_100605051 | 224 |
| 366 | 3300030522 | Ga0307512_10008082 | Ga0307512_100080828 | 224 |
| 367 | 3300030522 | Ga0307512_10216102 | Ga0307512_102161021 | 224 |
| 368 | 3300031456 | Ga0307513_10033014 | Ga0307513_100330143 | 224 |
| 369 | 3300031456 | Ga0307513_10380257 | Ga0307513_103802573 | 224 |
| 370 | 3300031507 | Ga0307509_10029556 | Ga0307509_100295566 | 224 |
| 371 | 3300031616 | Ga0307508_10212388 | Ga0307508_102123882 | 224 |
| 372 | 3300031649 | Ga0307514_10008147 | Ga0307514_100081472 | 224 |
| 373 | 3300031649 | Ga0307514_10059712 | Ga0307514_100597122 | 224 |
| 374 | 3300031649 | Ga0307514_10168104 | Ga0307514_101681041 | 224 |
| 375 | 3300031649 | Ga0307514_10176509 | Ga0307514_101765091 | 224 |
| 376 | 3300031727 | Ga0316576_10018918 | Ga0316576_100189185 | 224 |
| 377 | 3300031727 | Ga0316576_10053604 | Ga0316576_100536045 | 224 |
| 378 | 3300031727 | Ga0316576_10117887 | Ga0316576_101178872 | 224 |
| 379 | 3300031728 | Ga0316578_10017710 | Ga0316578_100177105 | 224 |
| 380 | 3300031728 | Ga0316578_10069819 | Ga0316578_100698194 | 224 |
| 381 | 3300031730 | Ga0307516_10019954 | Ga0307516_100199546 | 224 |
| 382 | 3300031731 | Ga0307405_10308844 | Ga0307405_103088442 | 224 |
| 383 | 3300031733 | Ga0316577_10025018 | Ga0316577_100250181 | 224 |
| 384 | 3300031852 | Ga0307410_10130493 | Ga0307410_101304932 | 224 |
| 385 | 3300031852 | Ga0307410_10371469 | Ga0307410_103714692 | 224 |
| 386 | 3300032002 | Ga0307416_100463040 | Ga0307416_1004630401 | 224 |
| 387 | 3300032005 | Ga0307411_10138703 | Ga0307411_101387031 | 224 |
| 388 | 3300032005 | Ga0307411_10204950 | Ga0307411_102049502 | 224 |
| 389 | 3300033179 | Ga0307507_10105891 | Ga0307507_101058912 | 224 |
| 390 | 3300033179 | Ga0307507_10280581 | Ga0307507_102805811 | 224 |
| 391 | 3300033179 | Ga0307507_10323070 | Ga0307507_103230702 | 224 |
| 392 | 3300033180 | Ga0307510_10080849 | Ga0307510_100808494 | 224 |
| 393 | 3300033180 | Ga0307510_10295030 | Ga0307510_102950302 | 224 |
| 394 | 3300035398 | Ga0316574_0029239 | Ga0316574_0029239_2525_3199 | 224 |
| 395 | 3300035398 | Ga0316574_0034798 | Ga0316574_0034798_333_1007 | 224 |
| 396 | 3300036647 | Ga0316582_0175809 | Ga0316582_0175809_696_1370 | 224 |
| 397 | 3300036712 | Ga0316584_0006199 | Ga0316584_0006199_1730_2404 | 224 |
| 398 | 3300036712 | Ga0316584_0043795 | Ga0316584_0043795_138_812 | 224 |
| 399 | 3300036712 | Ga0316584_0157346 | Ga0316584_0157346_828_1511 | 224 |
| 400 | 3300037418 | Ga0395900_0538878 | Ga0395900_0538878_342_1016 | 224 |
| 401 | 3300037853 | Ga0436364_0480718 | Ga0436364_0480718_3961_4635 | 224 |
| 402 | 3300039437 | Ga0436365_0398569 | Ga0436365_0398569_24381_25055 | 224 |
| 403 | 3300041494 | Ga0451837_1298356 | Ga0451837_1298356_728_1402 | 224 |
| 404 | 3300044656 | Ga0466969_0069180 | Ga0466969_0069180_1003_1677 | 224 |
| 405 | 3300044656 | Ga0466969_0069417 | Ga0466969_0069417_531_1205 | 224 |
| 406 | 3300044683 | Ga0466965_0027672 | Ga0466965_0027672_1061_1741 | 224 |
| 407 | 3300044684 | Ga0466966_0311640 | Ga0466966_0311640_51_725 | 224 |
| 408 | 3300044693 | Ga0466961_0096107 | Ga0466961_0096107_363_1037 | 224 |
| 409 | 3300044693 | Ga0466961_0325729 | Ga0466961_0325729_97_771 | 224 |
| 410 | 3300044694 | Ga0466963_0004210 | Ga0466963_0004210_2399_3073 | 224 |
| 411 | 3300044694 | Ga0466963_0076727 | Ga0466963_0076727_785_1465 | 224 |
| 412 | 3300044694 | Ga0466963_0213874 | Ga0466963_0213874_549_1223 | 224 |
| 413 | 3300044706 | Ga0466964_0102390 | Ga0466964_0102390_30_710 | 224 |
| 414 | 3300044719 | Ga0466971_0006249 | Ga0466971_0006249_166_846 | 224 |
| 415 | 3300044842 | Ga0466957_0002180 | Ga0466957_0002180_5492_6175 | 224 |
| 416 | 3300045836 | Ga0466958_0000222 | Ga0466958_0000222_3369_4049 | 224 |
| 417 | 3300045836 | Ga0466958_0033828 | Ga0466958_0033828_822_1505 | 224 |
| 418 | 3300045836 | Ga0466958_0043886 | Ga0466958_0043886_729_1403 | 224 |
| 419 | 3300045836 | Ga0466958_0079108 | Ga0466958_0079108_1262_1936 | 224 |
| 420 | 3300046452 | Ga0495617_012215 | Ga0495617_012215_1927_2601 | 224 |
| 421 | 3300046453 | Ga0495627_010238 | Ga0495627_010238_2049_2723 | 224 |
| 422 | 3300046454 | Ga0495592_0003591 | Ga0495592_0003591_1772_2446 | 224 |
| 423 | 3300046454 | Ga0495592_0011391 | Ga0495592_0011391_398_1072 | 224 |
| 424 | 3300046454 | Ga0495592_0153561 | Ga0495592_0153561_221_895 | 224 |
| 425 | 3300046455 | Ga0495603_0045735 | Ga0495603_0045735_33_707 | 224 |
| 426 | 3300046460 | Ga0495638_0041549 | Ga0495638_0041549_1525_2199 | 224 |
| 427 | 3300046460 | Ga0495638_0118612 | Ga0495638_0118612_818_1519 | 224 |
| 428 | 3300046460 | Ga0495638_0317540 | Ga0495638_0317540_98_772 | 224 |
| 429 | 3300046461 | Ga0495641_0031386 | Ga0495641_0031386_520_1200 | 224 |
| 430 | 3300046461 | Ga0495641_0233784 | Ga0495641_0233784_73_753 | 224 |
| 431 | 3300046462 | Ga0495651_0003035 | Ga0495651_0003035_3376_4050 | 224 |
| 432 | 3300046462 | Ga0495651_0023678 | Ga0495651_0023678_2050_2724 | 224 |
| 433 | 3300046463 | Ga0495653_0034862 | Ga0495653_0034862_2517_3230 | 224 |
| 434 | 3300046471 | Ga0495650_0172958 | Ga0495650_0172958_25_699 | 224 |
| 435 | 3300046472 | Ga0495580_0332498 | Ga0495580_0332498_264_938 | 224 |
| 436 | 3300046473 | Ga0495582_0019152 | Ga0495582_0019152_510_1184 | 224 |
| 437 | 3300046473 | Ga0495582_0115194 | Ga0495582_0115194_20_694 | 224 |
| 438 | 3300046474 | Ga0495605_0013624 | Ga0495605_0013624_1239_1913 | 224 |
| 439 | 3300046475 | Ga0495639_0129388 | Ga0495639_0129388_436_1110 | 224 |
| 440 | 3300046476 | Ga0495662_0001288 | Ga0495662_0001288_9913_10587 | 224 |
| 441 | 3300046476 | Ga0495662_0003663 | Ga0495662_0003663_6861_7535 | 224 |
| 442 | 3300046476 | Ga0495662_0017546 | Ga0495662_0017546_90_764 | 224 |
| 443 | 3300046477 | Ga0495664_0001242 | Ga0495664_0001242_9533_10207 | 224 |
| 444 | 3300046492 | Ga0495585_0141256 | Ga0495585_0141256_545_1219 | 224 |
| 445 | 3300046499 | Ga0495594_0040796 | Ga0495594_0040796_1809_2483 | 224 |
| 446 | 3300046499 | Ga0495594_0299281 | Ga0495594_0299281_106_780 | 224 |
| 447 | 3300046499 | Ga0495594_0434283 | Ga0495594_0434283_56_730 | 224 |
| 448 | 3300046501 | Ga0495607_0066932 | Ga0495607_0066932_1089_1763 | 224 |
| 449 | 3300046506 | Ga0495583_0145757 | Ga0495583_0145757_289_963 | 224 |
| 450 | 3300046507 | Ga0495606_0008611 | Ga0495606_0008611_7211_7885 | 224 |
| 451 | 3300046512 | Ga0495610_0061513 | Ga0495610_0061513_59_733 | 224 |
| 452 | 3300046513 | Ga0495616_0005356 | Ga0495616_0005356_1884_2558 | 224 |
| 453 | 3300046516 | Ga0495628_0008019 | Ga0495628_0008019_3657_4331 | 224 |
| 454 | 3300046516 | Ga0495628_0039995 | Ga0495628_0039995_68_742 | 224 |
| 455 | 3300046517 | Ga0495630_0080247 | Ga0495630_0080247_594_1268 | 224 |
| 456 | 3300046517 | Ga0495630_0090222 | Ga0495630_0090222_1568_2242 | 224 |
| 457 | 3300046518 | Ga0495631_0030817 | Ga0495631_0030817_952_1626 | 224 |
| 458 | 3300046520 | Ga0495637_0016491 | Ga0495637_0016491_1249_1923 | 224 |
| 459 | 3300046522 | Ga0495643_0017243 | Ga0495643_0017243_2771_3445 | 224 |
| 460 | 3300046523 | Ga0495644_0069083 | Ga0495644_0069083_403_1077 | 224 |
| 461 | 3300046524 | Ga0495648_0084247 | Ga0495648_0084247_905_1579 | 224 |
| 462 | 3300046526 | Ga0495666_0007706 | Ga0495666_0007706_3987_4661 | 224 |
| 463 | 3300046528 | Ga0495642_0023733 | Ga0495642_0023733_198_872 | 224 |
| 464 | 3300046529 | Ga0495652_0001869 | Ga0495652_0001869_18392_19066 | 224 |
| 465 | 3300046529 | Ga0495652_0010249 | Ga0495652_0010249_6660_7334 | 224 |
| 466 | 3300046529 | Ga0495652_0049229 | Ga0495652_0049229_2884_3558 | 224 |
| 467 | 3300046530 | Ga0495654_0005236 | Ga0495654_0005236_1564_2238 | 224 |
| 468 | 3300046531 | Ga0495665_0096586 | Ga0495665_0096586_73_747 | 224 |
| 469 | 3300046533 | Ga0495640_0036682 | Ga0495640_0036682_422_1096 | 224 |
| 470 | 3300046535 | Ga0495586_0072381 | Ga0495586_0072381_1129_1803 | 224 |
| 471 | 3300046536 | Ga0495587_0185004 | Ga0495587_0185004_231_905 | 224 |
| 472 | 3300046536 | Ga0495587_0193746 | Ga0495587_0193746_219_893 | 224 |
| 473 | 3300046538 | Ga0495609_0009374 | Ga0495609_0009374_1903_2577 | 224 |
| 474 | 3300046542 | Ga0495597_0032612 | Ga0495597_0032612_1632_2306 | 224 |
| 475 | 3300046543 | Ga0495645_0007753 | Ga0495645_0007753_6171_6845 | 224 |
| 476 | 3300046543 | Ga0495645_0033616 | Ga0495645_0033616_951_1625 | 224 |
| 477 | 3300046543 | Ga0495645_0172993 | Ga0495645_0172993_123_797 | 224 |
| 478 | 3300046557 | Ga0495622_0003753 | Ga0495622_0003753_3462_4136 | 224 |
| 479 | 3300046557 | Ga0495622_0020000 | Ga0495622_0020000_360_1034 | 224 |
| 480 | 3300046557 | Ga0495622_0089249 | Ga0495622_0089249_17_691 | 224 |
| 481 | 3300046558 | Ga0495633_0004412 | Ga0495633_0004412_7666_8340 | 224 |
| 482 | 3300046558 | Ga0495633_0022209 | Ga0495633_0022209_1747_2421 | 224 |
| 483 | 3300046559 | Ga0495667_0104907 | Ga0495667_0104907_266_940 | 224 |
| 484 | 3300046616 | Ga0495668_0027050 | Ga0495668_0027050_1772_2446 | 224 |
| 485 | 3300046642 | Ga0495634_0004615 | Ga0495634_0004615_2292_2966 | 224 |
| 486 | 3300046642 | Ga0495634_0126419 | Ga0495634_0126419_571_1245 | 224 |
| 487 | 3300046648 | Ga0495611_0007737 | Ga0495611_0007737_1867_2568 | 224 |
| 488 | 3300046648 | Ga0495611_0017328 | Ga0495611_0017328_969_1643 | 224 |
| 489 | 3300046648 | Ga0495611_0034487 | Ga0495611_0034487_481_1155 | 224 |
| 490 | 3300046660 | Ga0495625_0024361 | Ga0495625_0024361_912_1586 | 224 |
| 491 | 3300046663 | Ga0495635_0000630 | Ga0495635_0000630_2164_2838 | 224 |
| 492 | 3300046663 | Ga0495635_0239138 | Ga0495635_0239138_131_805 | 224 |
| 493 | 3300046663 | Ga0495635_0530005 | Ga0495635_0530005_33_707 | 224 |
| 494 | 3300046665 | Ga0495661_0054646 | Ga0495661_0054646_325_999 | 224 |
| 495 | 3300046674 | Ga0495588_0001717 | Ga0495588_0001717_2817_3491 | 224 |
| 496 | 3300046674 | Ga0495588_0036196 | Ga0495588_0036196_720_1394 | 224 |
| 497 | 3300046674 | Ga0495588_0049795 | Ga0495588_0049795_1449_2123 | 224 |
| 498 | 3300046675 | Ga0495657_0002765 | Ga0495657_0002765_2959_3633 | 224 |
| 499 | 3300046675 | Ga0495657_0042959 | Ga0495657_0042959_2213_2887 | 224 |
| 500 | 3300046675 | Ga0495657_0125148 | Ga0495657_0125148_283_957 | 224 |
| 501 | 3300046675 | Ga0495657_0155911 | Ga0495657_0155911_451_1125 | 224 |
| 502 | 3300046675 | Ga0495657_0424292 | Ga0495657_0424292_74_748 | 224 |
| 503 | 3300046678 | Ga0495599_0104641 | Ga0495599_0104641_919_1593 | 224 |
| 504 | 3300046679 | Ga0495623_0214693 | Ga0495623_0214693_208_882 | 224 |
| 505 | 3300046680 | Ga0495646_0000669 | Ga0495646_0000669_10856_11530 | 224 |
| 506 | 3300046680 | Ga0495646_0048936 | Ga0495646_0048936_309_983 | 224 |
| 507 | 3300046683 | Ga0495658_0018437 | Ga0495658_0018437_1720_2394 | 224 |
| 508 | 3300046689 | Ga0495613_0005024 | Ga0495613_0005024_8648_9322 | 224 |
| 509 | 3300046689 | Ga0495613_0005879 | Ga0495613_0005879_6925_7599 | 224 |
| 510 | 3300046689 | Ga0495613_0045585 | Ga0495613_0045585_33_707 | 224 |
| 511 | 3300046689 | Ga0495613_0459646 | Ga0495613_0459646_25_699 | 224 |
| 512 | 3300046691 | Ga0495670_0019746 | Ga0495670_0019746_1208_1882 | 224 |
| 513 | 3300046691 | Ga0495670_0026594 | Ga0495670_0026594_1072_1773 | 224 |
| 514 | 3300046692 | Ga0495671_0002799 | Ga0495671_0002799_2783_3457 | 224 |
| 515 | 3300046694 | Ga0495649_0089699 | Ga0495649_0089699_189_863 | 224 |
| 516 | 3300046794 | Ga0495589_0020293 | Ga0495589_0020293_2268_2942 | 224 |
| 517 | 3300046809 | Ga0495600_0002372 | Ga0495600_0002372_1417_2091 | 224 |
| 518 | 3300046809 | Ga0495600_0012433 | Ga0495600_0012433_2015_2689 | 224 |
| 519 | 3300046809 | Ga0495600_0290851 | Ga0495600_0290851_48_722 | 224 |
| 520 | 3300046810 | Ga0495660_0044528 | Ga0495660_0044528_294_968 | 224 |
| 521 | 3300047315 | Ga0495581_0149944 | Ga0495581_0149944_347_1021 | 224 |
| 522 | 3300047315 | Ga0495581_0242232 | Ga0495581_0242232_215_889 | 224 |
| 523 | 3300047317 | Ga0495604_0000597 | Ga0495604_0000597_12143_12817 | 224 |
| 524 | 3300047317 | Ga0495604_0009513 | Ga0495604_0009513_6011_6685 | 224 |
| 525 | 3300047318 | Ga0495636_0015296 | Ga0495636_0015296_1855_2529 | 224 |
| 526 | 3300047318 | Ga0495636_0018570 | Ga0495636_0018570_138_839 | 224 |
| 527 | 3300047318 | Ga0495636_0039887 | Ga0495636_0039887_479_1153 | 224 |
| 528 | 3300047319 | Ga0495674_0015461 | Ga0495674_0015461_1898_2572 | 224 |
| 529 | 3300047319 | Ga0495674_0238463 | Ga0495674_0238463_463_1137 | 224 |
| 530 | 3300047319 | Ga0495674_0342338 | Ga0495674_0342338_272_946 | 224 |
| 531 | 3300047320 | Ga0495672_0078790 | Ga0495672_0078790_486_1160 | 224 |
| 532 | 3300047321 | Ga0495676_0018161 | Ga0495676_0018161_805_1479 | 224 |
| 533 | 3300047321 | Ga0495676_0019814 | Ga0495676_0019814_1748_2422 | 224 |
| 534 | 3300047321 | Ga0495676_0040776 | Ga0495676_0040776_2194_2895 | 224 |
| 535 | 3300047322 | Ga0495680_0053938 | Ga0495680_0053938_64_738 | 224 |
| 536 | 3300047323 | Ga0495683_0169752 | Ga0495683_0169752_309_983 | 224 |
| 537 | 3300047443 | Ga0495687_003104 | Ga0495687_003104_6382_7056 | 224 |
| 538 | 3300047443 | Ga0495687_003604 | Ga0495687_003604_8924_9598 | 224 |
| 539 | 3300047443 | Ga0495687_073098 | Ga0495687_073098_31_705 | 224 |
| 540 | 3300047444 | Ga0495675_0009811 | Ga0495675_0009811_4703_5377 | 224 |
| 541 | 3300047444 | Ga0495675_0019818 | Ga0495675_0019818_73_747 | 224 |
| 542 | 3300047444 | Ga0495675_0182016 | Ga0495675_0182016_495_1169 | 224 |
| 543 | 3300047445 | Ga0495677_0100213 | Ga0495677_0100213_73_747 | 224 |
| 544 | 3300047446 | Ga0495679_056473 | Ga0495679_056473_292_966 | 224 |
| 545 | 3300047447 | Ga0495685_017784 | Ga0495685_017784_35_709 | 224 |
| 546 | 3300047470 | Ga0495681_0011323 | Ga0495681_0011323_339_1013 | 224 |
| 547 | 3300047470 | Ga0495681_0022268 | Ga0495681_0022268_2588_3262 | 224 |
| 548 | 3300047471 | Ga0495684_0034517 | Ga0495684_0034517_1863_2537 | 224 |
| 549 | 3300047471 | Ga0495684_0425487 | Ga0495684_0425487_219_893 | 224 |
| 550 | 3300047472 | Ga0495686_0010043 | Ga0495686_0010043_5406_6080 | 224 |
| 551 | 3300047472 | Ga0495686_0292582 | Ga0495686_0292582_49_723 | 224 |
| 552 | 3300047673 | Ga0495593_0000502 | Ga0495593_0000502_1882_2556 | 224 |
| 553 | 3300048088 | Ga0495602_0004911 | Ga0495602_0004911_3271_3945 | 224 |
| 554 | 3300048089 | Ga0495614_0003948 | Ga0495614_0003948_192_866 | 224 |
| 555 | 3300048089 | Ga0495614_0035603 | Ga0495614_0035603_1128_1802 | 224 |
| 556 | 3300048089 | Ga0495614_0199190 | Ga0495614_0199190_78_779 | 224 |
| 557 | 3300048903 | Ga0496100_0360466 | Ga0496100_0360466_16_690 | 224 |
| 558 | 3300048907 | Ga0496104_0235405 | Ga0496104_0235405_540_1220 | 224 |
| 559 | 3300048909 | Ga0496106_0279844 | Ga0496106_0279844_214_888 | 224 |
| 560 | 3300048913 | Ga0496110_0042628 | Ga0496110_0042628_1116_1796 | 224 |
| 561 | 3300048917 | Ga0496114_0304162 | Ga0496114_0304162_249_929 | 224 |
| 562 | 3300048917 | Ga0496114_0382720 | Ga0496114_0382720_507_1181 | 224 |
| 563 | 3300049460 | Ga0495682_0007362 | Ga0495682_0007362_3397_4071 | 224 |
| 564 | 3300049527 | Ga0501311_037554 | Ga0501311_037554_26_700 | 224 |
| 565 | 3300049568 | Ga0501031_0035365 | Ga0501031_0035365_2012_2686 | 224 |
| 566 | 3300049569 | Ga0501032_0009955 | Ga0501032_0009955_5441_6115 | 224 |
| 567 | 3300049569 | Ga0501032_0029677 | Ga0501032_0029677_863_1537 | 224 |
| 568 | 3300049569 | Ga0501032_0045823 | Ga0501032_0045823_1385_2059 | 224 |
| 569 | 3300049570 | Ga0501033_0037030 | Ga0501033_0037030_368_1042 | 224 |
| 570 | 3300049571 | Ga0501034_0017666 | Ga0501034_0017666_5443_6117 | 224 |
| 571 | 3300049571 | Ga0501034_0025134 | Ga0501034_0025134_4220_4894 | 224 |
| 572 | 3300049572 | Ga0501036_0016460 | Ga0501036_0016460_3525_4199 | 224 |
| 573 | 3300049573 | Ga0501037_0001542 | Ga0501037_0001542_5498_6172 | 224 |
| 574 | 3300049573 | Ga0501037_0311926 | Ga0501037_0311926_203_877 | 224 |
| 575 | 3300049574 | Ga0501038_0013850 | Ga0501038_0013850_5394_6068 | 224 |
| 576 | 3300049574 | Ga0501038_0027453 | Ga0501038_0027453_4360_5034 | 224 |
| 577 | 3300049574 | Ga0501038_0631517 | Ga0501038_0631517_121_795 | 224 |
| 578 | 3300049575 | Ga0501039_0066115 | Ga0501039_0066115_1615_2289 | 224 |
| 579 | 3300049575 | Ga0501039_0325856 | Ga0501039_0325856_504_1178 | 224 |
| 580 | 3300049578 | Ga0501042_0025478 | Ga0501042_0025478_1994_2668 | 224 |
| 581 | 3300049579 | Ga0501043_0186935 | Ga0501043_0186935_379_1053 | 224 |
| 582 | 3300049580 | Ga0501046_0096852 | Ga0501046_0096852_1133_1807 | 224 |
| 583 | 3300049581 | Ga0501047_0067949 | Ga0501047_0067949_795_1469 | 224 |
| 584 | 3300049581 | Ga0501047_0180795 | Ga0501047_0180795_405_1079 | 224 |
| 585 | 3300049582 | Ga0501048_0013393 | Ga0501048_0013393_2451_3125 | 224 |
| 586 | 3300049585 | Ga0501069_0002848 | Ga0501069_0002848_6467_7141 | 224 |
| 587 | 3300049586 | Ga0501070_0001688 | Ga0501070_0001688_172_903 | 224 |
| 588 | 3300049586 | Ga0501070_0002568 | Ga0501070_0002568_6635_7309 | 224 |
| 589 | 3300049586 | Ga0501070_0294168 | Ga0501070_0294168_356_1030 | 224 |
| 590 | 3300049589 | Ga0501073_0040926 | Ga0501073_0040926_1515_2246 | 224 |
| 591 | 3300049590 | Ga0501074_0000467 | Ga0501074_0000467_19992_20723 | 224 |
| 592 | 3300049593 | Ga0501077_0284487 | Ga0501077_0284487_13_687 | 224 |
| 593 | 3300049741 | Ga0501079_0000775 | Ga0501079_0000775_20292_21023 | 224 |
| 594 | 3300049742 | Ga0501080_0000216 | Ga0501080_0000216_30814_31488 | 224 |
| 595 | 3300049742 | Ga0501080_0001308 | Ga0501080_0001308_17747_18478 | 224 |
| 596 | 3300049742 | Ga0501080_0177105 | Ga0501080_0177105_1159_1833 | 224 |
| 597 | 3300049778 | Ga0501282_006660 | Ga0501282_006660_241_915 | 224 |
| 598 | 3300049822 | Ga0501035_0014210 | Ga0501035_0014210_3718_4392 | 224 |
| 599 | 3300049822 | Ga0501035_0062968 | Ga0501035_0062968_1007_1681 | 224 |
| 600 | 3300049823 | Ga0501044_0024328 | Ga0501044_0024328_4790_5464 | 224 |
| 601 | 3300049823 | Ga0501044_0042064 | Ga0501044_0042064_3398_4072 | 224 |
| 602 | 3300049823 | Ga0501044_0364985 | Ga0501044_0364985_136_810 | 224 |
| 603 | 3300049824 | Ga0501045_0600989 | Ga0501045_0600989_50_724 | 224 |
| 604 | 3300053088 | Ga0500644_0106263 | Ga0500644_0106263_104_778 | 224 |
| 605 | 3300053092 | Ga0500583_0124604 | Ga0500583_0124604_18_692 | 224 |
| 606 | 3300053095 | Ga0500640_004946 | Ga0500640_004946_1793_2467 | 224 |
| 607 | 3300053098 | Ga0500650_0288150 | Ga0500650_0288150_20_694 | 224 |
| 608 | 3300053142 | Ga0500577_0085207 | Ga0500577_0085207_437_1111 | 224 |
| 609 | 3300053145 | Ga0500586_126805 | Ga0500586_126805_58_732 | 224 |
| 610 | 3300053149 | Ga0500600_0096129 | Ga0500600_0096129_52_726 | 224 |
| 611 | 3300053157 | Ga0500624_002937 | Ga0500624_002937_1177_1851 | 224 |
| 612 | 3300054114 | Ga0501084_0259444 | Ga0501084_0259444_765_1457 | 224 |
| 613 | 3300061719 | Ga0466962_0006460 | Ga0466962_0006460_1840_2520 | 224 |
| 614 | iso_pu_bacteria | 2862574272 | 2862578519 | 224 |
| 615 | 3300001989 | JGI24739J22299_10015616 | JGI24739J22299_100156162 | 225 |
| 616 | 3300002067 | JGI24735J21928_10070776 | JGI24735J21928_100707762 | 225 |
| 617 | 3300005338 | Ga0068868_100057799 | Ga0068868_1000577992 | 225 |
| 618 | 3300005341 | Ga0070691_10045962 | Ga0070691_100459623 | 225 |
| 619 | 3300005347 | Ga0070668_100315528 | Ga0070668_1003155282 | 225 |
| 620 | 3300005435 | Ga0070714_100189816 | Ga0070714_1001898162 | 225 |
| 621 | 3300005436 | Ga0070713_100103618 | Ga0070713_1001036183 | 225 |
| 622 | 3300005436 | Ga0070713_100267186 | Ga0070713_1002671862 | 225 |
| 623 | 3300005436 | Ga0070713_100291284 | Ga0070713_1002912842 | 225 |
| 624 | 3300005437 | Ga0070710_10016542 | Ga0070710_100165423 | 225 |
| 625 | 3300005440 | Ga0070705_100096864 | Ga0070705_1000968642 | 225 |
| 626 | 3300005441 | Ga0070700_100241432 | Ga0070700_1002414322 | 225 |
| 627 | 3300005445 | Ga0070708_100064689 | Ga0070708_1000646891 | 225 |
| 628 | 3300005445 | Ga0070708_100205495 | Ga0070708_1002054952 | 225 |
| 629 | 3300005467 | Ga0070706_100131294 | Ga0070706_1001312941 | 225 |
| 630 | 3300005467 | Ga0070706_100211198 | Ga0070706_1002111982 | 225 |
| 631 | 3300005468 | Ga0070707_100439745 | Ga0070707_1004397452 | 225 |
| 632 | 3300005468 | Ga0070707_100853998 | Ga0070707_1008539982 | 225 |
| 633 | 3300005471 | Ga0070698_100000708 | Ga0070698_1000007087 | 225 |
| 634 | 3300005471 | Ga0070698_100000817 | Ga0070698_10000081713 | 225 |
| 635 | 3300005530 | Ga0070679_100558662 | Ga0070679_1005586622 | 225 |
| 636 | 3300005535 | Ga0070684_100119100 | Ga0070684_1001191002 | 225 |
| 637 | 3300005535 | Ga0070684_100141500 | Ga0070684_1001415002 | 225 |
| 638 | 3300005543 | Ga0070672_100307549 | Ga0070672_1003075492 | 225 |
| 639 | 3300005547 | Ga0070693_100309479 | Ga0070693_1003094792 | 225 |
| 640 | 3300005563 | Ga0068855_100119246 | Ga0068855_1001192463 | 225 |
| 641 | 3300005577 | Ga0068857_100023807 | Ga0068857_1000238072 | 225 |
| 642 | 3300005614 | Ga0068856_100087885 | Ga0068856_1000878852 | 225 |
| 643 | 3300005615 | Ga0070702_100035872 | Ga0070702_1000358723 | 225 |
| 644 | 3300005618 | Ga0068864_101004052 | Ga0068864_1010040521 | 225 |
| 645 | 3300005718 | Ga0068866_10072522 | Ga0068866_100725222 | 225 |
| 646 | 3300005937 | Ga0081455_10007035 | Ga0081455_1000703516 | 225 |
| 647 | 3300005937 | Ga0081455_10433117 | Ga0081455_104331171 | 225 |
| 648 | 3300005981 | Ga0081538_10000417 | Ga0081538_100004178 | 225 |
| 649 | 3300005981 | Ga0081538_10031451 | Ga0081538_100314513 | 225 |
| 650 | 3300006175 | Ga0070712_100055849 | Ga0070712_1000558493 | 225 |
| 651 | 3300006358 | Ga0068871_100002346 | Ga0068871_1000023464 | 225 |
| 652 | 3300006846 | Ga0075430_100001802 | Ga0075430_10000180219 | 225 |
| 653 | 3300006846 | Ga0075430_100006192 | Ga0075430_10000619212 | 225 |
| 654 | 3300006847 | Ga0075431_100001725 | Ga0075431_1000017256 | 225 |
| 655 | 3300006847 | Ga0075431_100001755 | Ga0075431_10000175514 | 225 |
| 656 | 3300006871 | Ga0075434_100222303 | Ga0075434_1002223031 | 225 |
| 657 | 3300006880 | Ga0075429_100001988 | Ga0075429_10000198813 | 225 |
| 658 | 3300006880 | Ga0075429_100016094 | Ga0075429_1000160946 | 225 |
| 659 | 3300009094 | Ga0111539_10018001 | Ga0111539_100180019 | 225 |
| 660 | 3300009098 | Ga0105245_10020841 | Ga0105245_100208417 | 225 |
| 661 | 3300009098 | Ga0105245_10237514 | Ga0105245_102375142 | 225 |
| 662 | 3300009098 | Ga0105245_10874753 | Ga0105245_108747531 | 225 |
| 663 | 3300009147 | Ga0114129_10016875 | Ga0114129_1001687510 | 225 |
| 664 | 3300009147 | Ga0114129_10065489 | Ga0114129_100654896 | 225 |
| 665 | 3300009147 | Ga0114129_11714457 | Ga0114129_117144571 | 225 |
| 666 | 3300009148 | Ga0105243_10075374 | Ga0105243_100753744 | 225 |
| 667 | 3300009148 | Ga0105243_10459206 | Ga0105243_104592062 | 225 |
| 668 | 3300009148 | Ga0105243_10870028 | Ga0105243_108700281 | 225 |
| 669 | 3300009176 | Ga0105242_10012950 | Ga0105242_100129507 | 225 |
| 670 | 3300009176 | Ga0105242_10192426 | Ga0105242_101924262 | 225 |
| 671 | 3300009177 | Ga0105248_10127328 | Ga0105248_101273282 | 225 |
| 672 | 3300009177 | Ga0105248_10784886 | Ga0105248_107848861 | 225 |
| 673 | 3300009545 | Ga0105237_10108868 | Ga0105237_101088682 | 225 |
| 674 | 3300009553 | Ga0105249_10319660 | Ga0105249_103196602 | 225 |
| 675 | 3300010375 | Ga0105239_10280250 | Ga0105239_102802503 | 225 |
| 676 | 3300010375 | Ga0105239_10448571 | Ga0105239_104485712 | 225 |
| 677 | 3300013102 | Ga0157371_10305073 | Ga0157371_103050732 | 225 |
| 678 | 3300013105 | Ga0157369_10067886 | Ga0157369_100678863 | 225 |
| 679 | 3300013105 | Ga0157369_10467648 | Ga0157369_104676482 | 225 |
| 680 | 3300013105 | Ga0157369_10840698 | Ga0157369_108406982 | 225 |
| 681 | 3300013105 | Ga0157369_10858617 | Ga0157369_108586172 | 225 |
| 682 | 3300013296 | Ga0157374_10009898 | Ga0157374_100098987 | 225 |
| 683 | 3300013296 | Ga0157374_10553504 | Ga0157374_105535041 | 225 |
| 684 | 3300013297 | Ga0157378_10041806 | Ga0157378_100418064 | 225 |
| 685 | 3300013306 | Ga0163162_10246253 | Ga0163162_102462532 | 225 |
| 686 | 3300013306 | Ga0163162_10256364 | Ga0163162_102563641 | 225 |
| 687 | 3300013307 | Ga0157372_10067228 | Ga0157372_100672285 | 225 |
| 688 | 3300013307 | Ga0157372_10351097 | Ga0157372_103510972 | 225 |
| 689 | 3300013308 | Ga0157375_10028637 | Ga0157375_100286373 | 225 |
| 690 | 3300013308 | Ga0157375_10154215 | Ga0157375_101542152 | 225 |
| 691 | 3300013308 | Ga0157375_10226188 | Ga0157375_102261881 | 225 |
| 692 | 3300013308 | Ga0157375_11037269 | Ga0157375_110372691 | 225 |
| 693 | 3300013308 | Ga0157375_11203268 | Ga0157375_112032681 | 225 |
| 694 | 3300014325 | Ga0163163_10003442 | Ga0163163_100034429 | 225 |
| 695 | 3300014326 | Ga0157380_10101500 | Ga0157380_101015003 | 225 |
| 696 | 3300014326 | Ga0157380_10272461 | Ga0157380_102724611 | 225 |
| 697 | 3300014968 | Ga0157379_10002390 | Ga0157379_1000239010 | 225 |
| 698 | 3300014969 | Ga0157376_10007343 | Ga0157376_100073437 | 225 |
| 699 | 3300017792 | Ga0163161_10049749 | Ga0163161_100497492 | 225 |
| 700 | 3300017792 | Ga0163161_10258361 | Ga0163161_102583611 | 225 |
| 701 | 3300020070 | Ga0206356_10640822 | Ga0206356_106408222 | 225 |
| 702 | 3300020077 | Ga0206351_10683577 | Ga0206351_106835772 | 225 |
| 703 | 3300020082 | Ga0206353_10205279 | Ga0206353_102052791 | 225 |
| 704 | 3300020082 | Ga0206353_10786672 | Ga0206353_107866722 | 225 |
| 705 | 3300020082 | Ga0206353_11891632 | Ga0206353_118916321 | 225 |
| 706 | 3300022467 | Ga0224712_10035499 | Ga0224712_100354992 | 225 |
| 707 | 3300025898 | Ga0207692_10065526 | Ga0207692_100655262 | 225 |
| 708 | 3300025904 | Ga0207647_10007385 | Ga0207647_100073853 | 225 |
| 709 | 3300025910 | Ga0207684_10001496 | Ga0207684_1000149615 | 225 |
| 710 | 3300025910 | Ga0207684_10161486 | Ga0207684_101614862 | 225 |
| 711 | 3300025914 | Ga0207671_10125517 | Ga0207671_101255172 | 225 |
| 712 | 3300025915 | Ga0207693_10046808 | Ga0207693_100468083 | 225 |
| 713 | 3300025922 | Ga0207646_10001862 | Ga0207646_1000186214 | 225 |
| 714 | 3300025922 | Ga0207646_10380867 | Ga0207646_103808671 | 225 |
| 715 | 3300025928 | Ga0207700_10178372 | Ga0207700_101783722 | 225 |
| 716 | 3300025928 | Ga0207700_10328821 | Ga0207700_103288212 | 225 |
| 717 | 3300025929 | Ga0207664_10097820 | Ga0207664_100978202 | 225 |
| 718 | 3300025929 | Ga0207664_10113260 | Ga0207664_101132603 | 225 |
| 719 | 3300025934 | Ga0207686_10094902 | Ga0207686_100949022 | 225 |
| 720 | 3300025935 | Ga0207709_10826752 | Ga0207709_108267521 | 225 |
| 721 | 3300025939 | Ga0207665_10082543 | Ga0207665_100825432 | 225 |
| 722 | 3300025940 | Ga0207691_10081078 | Ga0207691_100810783 | 225 |
| 723 | 3300025941 | Ga0207711_10307629 | Ga0207711_103076292 | 225 |
| 724 | 3300025944 | Ga0207661_10774322 | Ga0207661_107743221 | 225 |
| 725 | 3300025945 | Ga0207679_10347461 | Ga0207679_103474612 | 225 |
| 726 | 3300025961 | Ga0207712_10015125 | Ga0207712_100151254 | 225 |
| 727 | 3300025961 | Ga0207712_10281668 | Ga0207712_102816682 | 225 |
| 728 | 3300025986 | Ga0207658_10197826 | Ga0207658_101978262 | 225 |
| 729 | 3300026023 | Ga0207677_10034460 | Ga0207677_100344603 | 225 |
| 730 | 3300026075 | Ga0207708_10800105 | Ga0207708_108001051 | 225 |
| 731 | 3300026075 | Ga0207708_10832099 | Ga0207708_108320991 | 225 |
| 732 | 3300026078 | Ga0207702_10040822 | Ga0207702_100408224 | 225 |
| 733 | 3300026078 | Ga0207702_10537269 | Ga0207702_105372691 | 225 |
| 734 | 3300026088 | Ga0207641_10165730 | Ga0207641_101657302 | 225 |
| 735 | 3300026116 | Ga0207674_10055991 | Ga0207674_100559915 | 225 |
| 736 | 3300026116 | Ga0207674_10069016 | Ga0207674_100690162 | 225 |
| 737 | 3300026121 | Ga0207683_10631126 | Ga0207683_106311262 | 225 |
| 738 | 3300026142 | Ga0207698_10098800 | Ga0207698_100988001 | 225 |
| 739 | 3300027907 | Ga0207428_10119860 | Ga0207428_101198602 | 225 |
| 740 | 3300030522 | Ga0307512_10230096 | Ga0307512_102300961 | 225 |
| 741 | 3300031251 | Ga0265327_10175228 | Ga0265327_101752281 | 225 |
| 742 | 3300031548 | Ga0307408_100162721 | Ga0307408_1001627212 | 225 |
| 743 | 3300031548 | Ga0307408_100264284 | Ga0307408_1002642842 | 225 |
| 744 | 3300031548 | Ga0307408_100474409 | Ga0307408_1004744091 | 225 |
| 745 | 3300031727 | Ga0316576_10000951 | Ga0316576_100009514 | 225 |
| 746 | 3300031731 | Ga0307405_10132287 | Ga0307405_101322872 | 225 |
| 747 | 3300031824 | Ga0307413_10482587 | Ga0307413_104825872 | 225 |
| 748 | 3300031852 | Ga0307410_10015971 | Ga0307410_100159715 | 225 |
| 749 | 3300031852 | Ga0307410_10391707 | Ga0307410_103917072 | 225 |
| 750 | 3300031911 | Ga0307412_10038452 | Ga0307412_100384522 | 225 |
| 751 | 3300031995 | Ga0307409_100007897 | Ga0307409_1000078971 | 225 |
| 752 | 3300031995 | Ga0307409_100116980 | Ga0307409_1001169803 | 225 |
| 753 | 3300031995 | Ga0307409_100183397 | Ga0307409_1001833973 | 225 |
| 754 | 3300031995 | Ga0307409_100449052 | Ga0307409_1004490521 | 225 |
| 755 | 3300032002 | Ga0307416_100121070 | Ga0307416_1001210703 | 225 |
| 756 | 3300032002 | Ga0307416_100321509 | Ga0307416_1003215092 | 225 |
| 757 | 3300032002 | Ga0307416_100634019 | Ga0307416_1006340191 | 225 |
| 758 | 3300032004 | Ga0307414_10109738 | Ga0307414_101097382 | 225 |
| 759 | 3300032126 | Ga0307415_100225227 | Ga0307415_1002252272 | 225 |
| 760 | 3300032126 | Ga0307415_100290226 | Ga0307415_1002902262 | 225 |
| 761 | 3300032139 | Ga0316580_10084267 | Ga0316580_100842671 | 225 |
| 762 | 3300035084 | Ga0373928_0048578 | Ga0373928_0048578_203_892 | 225 |
| 763 | 3300035086 | Ga0373934_0000421 | Ga0373934_0000421_2647_3372 | 225 |
| 764 | 3300035113 | Ga0373936_0145746 | Ga0373936_0145746_154_837 | 225 |
| 765 | 3300035117 | Ga0373953_0000116 | Ga0373953_0000116_14567_15292 | 225 |
| 766 | 3300035118 | Ga0373954_0001000 | Ga0373954_0001000_8595_9320 | 225 |
| 767 | 3300035119 | Ga0373956_0005182 | Ga0373956_0005182_3965_4690 | 225 |
| 768 | 3300035120 | Ga0373957_0000035 | Ga0373957_0000035_4777_5502 | 225 |
| 769 | 3300035172 | Ga0373955_0000072 | Ga0373955_0000072_10917_11642 | 225 |
| 770 | 3300035172 | Ga0373955_0045548 | Ga0373955_0045548_1212_1937 | 225 |
| 771 | 3300035398 | Ga0316574_0010580 | Ga0316574_0010580_517_1194 | 225 |
| 772 | 3300035398 | Ga0316574_0035275 | Ga0316574_0035275_1989_2666 | 225 |
| 773 | 3300035398 | Ga0316574_0068145 | Ga0316574_0068145_462_1139 | 225 |
| 774 | 3300035398 | Ga0316574_0146970 | Ga0316574_0146970_36_713 | 225 |
| 775 | 3300035410 | Ga0373924_0001000 | Ga0373924_0001000_5297_6022 | 225 |
| 776 | 3300035724 | Ga0373933_0000327 | Ga0373933_0000327_18988_19713 | 225 |
| 777 | 3300035725 | Ga0373947_0498313 | Ga0373947_0498313_50_775 | 225 |
| 778 | 3300036401 | Ga0373937_0000010 | Ga0373937_0000010_77896_78621 | 225 |
| 779 | 3300036401 | Ga0373937_0440067 | Ga0373937_0440067_51_776 | 225 |
| 780 | 3300036647 | Ga0316582_0011735 | Ga0316582_0011735_4155_4832 | 225 |
| 781 | 3300036647 | Ga0316582_0023777 | Ga0316582_0023777_1421_2098 | 225 |
| 782 | 3300036712 | Ga0316584_0000926 | Ga0316584_0000926_1930_2607 | 225 |
| 783 | 3300036712 | Ga0316584_0104946 | Ga0316584_0104946_51_728 | 225 |
| 784 | 3300036712 | Ga0316584_0422655 | Ga0316584_0422655_101_778 | 225 |
| 785 | 3300037068 | Ga0373925_0047160 | Ga0373925_0047160_1766_2449 | 225 |
| 786 | 3300037466 | Ga0395898_0556308 | Ga0395898_0556308_195_872 | 225 |
| 787 | 3300038443 | Ga0395901_0011144 | Ga0395901_0011144_3773_4450 | 225 |
| 788 | 3300038443 | Ga0395901_0059400 | Ga0395901_0059400_1299_1976 | 225 |
| 789 | 3300038443 | Ga0395901_0065266 | Ga0395901_0065266_931_1608 | 225 |
| 790 | 3300038443 | Ga0395901_0251763 | Ga0395901_0251763_488_1165 | 225 |
| 791 | 3300039437 | Ga0436365_1406538 | Ga0436365_1406538_51_728 | 225 |
| 792 | 3300041459 | Ga0451800_1017266 | Ga0451800_1017266_165_842 | 225 |
| 793 | 3300041512 | Ga0451853_3707206 | Ga0451853_3707206_41_718 | 225 |
| 794 | 3300041512 | Ga0451853_3939996 | Ga0451853_3939996_221_898 | 225 |
| 795 | 3300042014 | Ga0439457_007559 | Ga0439457_007559_959_1636 | 225 |
| 796 | 3300042136 | Ga0450900_004422 | Ga0450900_004422_183_860 | 225 |
| 797 | 3300042533 | Ga0450901_006636 | Ga0450901_006636_458_1135 | 225 |
| 798 | 3300044656 | Ga0466969_0043284 | Ga0466969_0043284_1115_1792 | 225 |
| 799 | 3300044683 | Ga0466965_0131860 | Ga0466965_0131860_101_781 | 225 |
| 800 | 3300044684 | Ga0466966_0070708 | Ga0466966_0070708_991_1668 | 225 |
| 801 | 3300044693 | Ga0466961_0004439 | Ga0466961_0004439_6384_7061 | 225 |
| 802 | 3300044694 | Ga0466963_0006354 | Ga0466963_0006354_3051_3728 | 225 |
| 803 | 3300044719 | Ga0466971_0037606 | Ga0466971_0037606_19_696 | 225 |
| 804 | 3300044765 | Ga0466970_0084586 | Ga0466970_0084586_242_919 | 225 |
| 805 | 3300044765 | Ga0466970_0138849 | Ga0466970_0138849_612_1289 | 225 |
| 806 | 3300044901 | Ga0466960_0117462 | Ga0466960_0117462_607_1284 | 225 |
| 807 | 3300044901 | Ga0466960_0130960 | Ga0466960_0130960_41_718 | 225 |
| 808 | 3300045049 | Ga0466959_0104176 | Ga0466959_0104176_1336_2013 | 225 |
| 809 | 3300045976 | Ga0466967_0055133 | Ga0466967_0055133_1949_2626 | 225 |
| 810 | 3300045976 | Ga0466967_0514987 | Ga0466967_0514987_435_1112 | 225 |
| 811 | 3300046454 | Ga0495592_0000136 | Ga0495592_0000136_35548_36273 | 225 |
| 812 | 3300046454 | Ga0495592_0019127 | Ga0495592_0019127_3928_4653 | 225 |
| 813 | 3300046459 | Ga0495629_0131568 | Ga0495629_0131568_52_729 | 225 |
| 814 | 3300046462 | Ga0495651_0000047 | Ga0495651_0000047_77896_78621 | 225 |
| 815 | 3300046462 | Ga0495651_0033457 | Ga0495651_0033457_1143_1868 | 225 |
| 816 | 3300046463 | Ga0495653_0000753 | Ga0495653_0000753_7270_7995 | 225 |
| 817 | 3300046463 | Ga0495653_0036225 | Ga0495653_0036225_498_1223 | 225 |
| 818 | 3300046475 | Ga0495639_0137583 | Ga0495639_0137583_279_1004 | 225 |
| 819 | 3300046476 | Ga0495662_0063549 | Ga0495662_0063549_1074_1757 | 225 |
| 820 | 3300046511 | Ga0495608_0000089 | Ga0495608_0000089_28921_29646 | 225 |
| 821 | 3300046514 | Ga0495618_0163263 | Ga0495618_0163263_302_1027 | 225 |
| 822 | 3300046516 | Ga0495628_0000325 | Ga0495628_0000325_31499_32224 | 225 |
| 823 | 3300046516 | Ga0495628_0054388 | Ga0495628_0054388_429_1154 | 225 |
| 824 | 3300046529 | Ga0495652_0000982 | Ga0495652_0000982_10918_11643 | 225 |
| 825 | 3300046529 | Ga0495652_0005996 | Ga0495652_0005996_9625_10350 | 225 |
| 826 | 3300046533 | Ga0495640_0031330 | Ga0495640_0031330_1064_1789 | 225 |
| 827 | 3300046535 | Ga0495586_0070901 | Ga0495586_0070901_369_1094 | 225 |
| 828 | 3300046535 | Ga0495586_0472641 | Ga0495586_0472641_25_702 | 225 |
| 829 | 3300046536 | Ga0495587_0000074 | Ga0495587_0000074_29171_29896 | 225 |
| 830 | 3300046536 | Ga0495587_0007885 | Ga0495587_0007885_3309_4034 | 225 |
| 831 | 3300046543 | Ga0495645_0301023 | Ga0495645_0301023_42_767 | 225 |
| 832 | 3300046559 | Ga0495667_0000064 | Ga0495667_0000064_59757_60482 | 225 |
| 833 | 3300046559 | Ga0495667_0013616 | Ga0495667_0013616_3861_4586 | 225 |
| 834 | 3300046642 | Ga0495634_0066300 | Ga0495634_0066300_1153_1878 | 225 |
| 835 | 3300046663 | Ga0495635_0090831 | Ga0495635_0090831_888_1565 | 225 |
| 836 | 3300046674 | Ga0495588_0094696 | Ga0495588_0094696_77_802 | 225 |
| 837 | 3300046675 | Ga0495657_0000009 | Ga0495657_0000009_187658_188383 | 225 |
| 838 | 3300046678 | Ga0495599_0000084 | Ga0495599_0000084_35543_36268 | 225 |
| 839 | 3300046678 | Ga0495599_0003486 | Ga0495599_0003486_6502_7227 | 225 |
| 840 | 3300046679 | Ga0495623_0000168 | Ga0495623_0000168_10930_11655 | 225 |
| 841 | 3300046680 | Ga0495646_0001071 | Ga0495646_0001071_4237_4962 | 225 |
| 842 | 3300046681 | Ga0495647_0205450 | Ga0495647_0205450_49_774 | 225 |
| 843 | 3300046683 | Ga0495658_0328326 | Ga0495658_0328326_187_864 | 225 |
| 844 | 3300046689 | Ga0495613_0311478 | Ga0495613_0311478_346_1071 | 225 |
| 845 | 3300046690 | Ga0495624_0085021 | Ga0495624_0085021_466_1191 | 225 |
| 846 | 3300046809 | Ga0495600_0007557 | Ga0495600_0007557_857_1582 | 225 |
| 847 | 3300047317 | Ga0495604_0000070 | Ga0495604_0000070_10931_11656 | 225 |
| 848 | 3300047321 | Ga0495676_0128210 | Ga0495676_0128210_621_1346 | 225 |
| 849 | 3300047322 | Ga0495680_0000195 | Ga0495680_0000195_29173_29898 | 225 |
| 850 | 3300047322 | Ga0495680_0045706 | Ga0495680_0045706_914_1639 | 225 |
| 851 | 3300047322 | Ga0495680_0236023 | Ga0495680_0236023_318_995 | 225 |
| 852 | 3300047444 | Ga0495675_0001537 | Ga0495675_0001537_10937_11662 | 225 |
| 853 | 3300047444 | Ga0495675_0040590 | Ga0495675_0040590_1599_2324 | 225 |
| 854 | 3300047444 | Ga0495675_0213267 | Ga0495675_0213267_327_1004 | 225 |
| 855 | 3300047471 | Ga0495684_0017015 | Ga0495684_0017015_4500_5225 | 225 |
| 856 | 3300047471 | Ga0495684_0121735 | Ga0495684_0121735_789_1466 | 225 |
| 857 | 3300047673 | Ga0495593_0266855 | Ga0495593_0266855_10_687 | 225 |
| 858 | 3300047673 | Ga0495593_0383662 | Ga0495593_0383662_13_690 | 225 |
| 859 | 3300048088 | Ga0495602_0000122 | Ga0495602_0000122_29676_30401 | 225 |
| 860 | 3300048088 | Ga0495602_0057291 | Ga0495602_0057291_2645_3370 | 225 |
| 861 | 3300048088 | Ga0495602_0371960 | Ga0495602_0371960_164_841 | 225 |
| 862 | 3300048903 | Ga0496100_0014426 | Ga0496100_0014426_683_1360 | 225 |
| 863 | 3300048903 | Ga0496100_0253288 | Ga0496100_0253288_156_833 | 225 |
| 864 | 3300048903 | Ga0496100_0525331 | Ga0496100_0525331_155_832 | 225 |
| 865 | 3300048903 | Ga0496100_0719996 | Ga0496100_0719996_20_697 | 225 |
| 866 | 3300048904 | Ga0496101_0080889 | Ga0496101_0080889_1630_2307 | 225 |
| 867 | 3300048904 | Ga0496101_0467164 | Ga0496101_0467164_81_758 | 225 |
| 868 | 3300048905 | Ga0496102_0006584 | Ga0496102_0006584_4477_5154 | 225 |
| 869 | 3300048905 | Ga0496102_0018232 | Ga0496102_0018232_2484_3209 | 225 |
| 870 | 3300048905 | Ga0496102_0060479 | Ga0496102_0060479_1043_1720 | 225 |
| 871 | 3300048905 | Ga0496102_0127560 | Ga0496102_0127560_304_981 | 225 |
| 872 | 3300048905 | Ga0496102_0144484 | Ga0496102_0144484_845_1522 | 225 |
| 873 | 3300048906 | Ga0496103_0090114 | Ga0496103_0090114_239_916 | 225 |
| 874 | 3300048907 | Ga0496104_0002900 | Ga0496104_0002900_13285_14010 | 225 |
| 875 | 3300048907 | Ga0496104_0255440 | Ga0496104_0255440_809_1486 | 225 |
| 876 | 3300048908 | Ga0496105_0022958 | Ga0496105_0022958_848_1573 | 225 |
| 877 | 3300048908 | Ga0496105_0053757 | Ga0496105_0053757_2591_3268 | 225 |
| 878 | 3300048908 | Ga0496105_0174319 | Ga0496105_0174319_181_858 | 225 |
| 879 | 3300048908 | Ga0496105_0230839 | Ga0496105_0230839_490_1167 | 225 |
| 880 | 3300048909 | Ga0496106_0098630 | Ga0496106_0098630_1359_2084 | 225 |
| 881 | 3300048910 | Ga0496107_0039192 | Ga0496107_0039192_622_1299 | 225 |
| 882 | 3300048910 | Ga0496107_0125469 | Ga0496107_0125469_1063_1740 | 225 |
| 883 | 3300048910 | Ga0496107_0350441 | Ga0496107_0350441_326_1003 | 225 |
| 884 | 3300048911 | Ga0496108_0001829 | Ga0496108_0001829_9083_9808 | 225 |
| 885 | 3300048911 | Ga0496108_0160244 | Ga0496108_0160244_604_1281 | 225 |
| 886 | 3300048912 | Ga0496109_0005390 | Ga0496109_0005390_4468_5193 | 225 |
| 887 | 3300048912 | Ga0496109_0021188 | Ga0496109_0021188_1441_2118 | 225 |
| 888 | 3300048912 | Ga0496109_0161070 | Ga0496109_0161070_1137_1814 | 225 |
| 889 | 3300048912 | Ga0496109_0209303 | Ga0496109_0209303_234_911 | 225 |
| 890 | 3300048912 | Ga0496109_0279195 | Ga0496109_0279195_818_1495 | 225 |
| 891 | 3300048912 | Ga0496109_0371042 | Ga0496109_0371042_448_1155 | 225 |
| 892 | 3300048912 | Ga0496109_0404815 | Ga0496109_0404815_228_905 | 225 |
| 893 | 3300048913 | Ga0496110_0002280 | Ga0496110_0002280_4321_5046 | 225 |
| 894 | 3300048913 | Ga0496110_0077325 | Ga0496110_0077325_823_1500 | 225 |
| 895 | 3300048913 | Ga0496110_0444023 | Ga0496110_0444023_263_940 | 225 |
| 896 | 3300048914 | Ga0496111_0029689 | Ga0496111_0029689_2575_3300 | 225 |
| 897 | 3300048914 | Ga0496111_0068214 | Ga0496111_0068214_865_1542 | 225 |
| 898 | 3300048914 | Ga0496111_0342579 | Ga0496111_0342579_148_825 | 225 |
| 899 | 3300048915 | Ga0496112_0015530 | Ga0496112_0015530_5251_5976 | 225 |
| 900 | 3300048915 | Ga0496112_0192418 | Ga0496112_0192418_868_1545 | 225 |
| 901 | 3300048917 | Ga0496114_0002623 | Ga0496114_0002623_770_1447 | 225 |
| 902 | 3300048917 | Ga0496114_0039618 | Ga0496114_0039618_3035_3712 | 225 |
| 903 | 3300048917 | Ga0496114_0061330 | Ga0496114_0061330_1413_2090 | 225 |
| 904 | 3300048917 | Ga0496114_0104067 | Ga0496114_0104067_790_1467 | 225 |
| 905 | 3300048917 | Ga0496114_0137371 | Ga0496114_0137371_865_1542 | 225 |
| 906 | 3300048917 | Ga0496114_0271830 | Ga0496114_0271830_699_1376 | 225 |
| 907 | 3300048917 | Ga0496114_0735411 | Ga0496114_0735411_169_846 | 225 |
| 908 | 3300048917 | Ga0496114_0752771 | Ga0496114_0752771_149_826 | 225 |
| 909 | 3300048918 | Ga0496115_0034174 | Ga0496115_0034174_2165_2842 | 225 |
| 910 | 3300048918 | Ga0496115_0126115 | Ga0496115_0126115_1123_1800 | 225 |
| 911 | 3300048918 | Ga0496115_0173083 | Ga0496115_0173083_976_1653 | 225 |
| 912 | 3300048922 | Ga0496119_0014576 | Ga0496119_0014576_1858_2535 | 225 |
| 913 | 3300048925 | Ga0496122_0000427 | Ga0496122_0000427_69478_70155 | 225 |
| 914 | 3300048925 | Ga0496122_0001313 | Ga0496122_0001313_33858_34535 | 225 |
| 915 | 3300048926 | Ga0496123_0001011 | Ga0496123_0001011_35411_36088 | 225 |
| 916 | 3300048927 | Ga0496124_0002673 | Ga0496124_0002673_9422_10099 | 225 |
| 917 | 3300048928 | Ga0496125_0000224 | Ga0496125_0000224_21361_22038 | 225 |
| 918 | 3300048929 | Ga0496126_0018319 | Ga0496126_0018319_3928_4605 | 225 |
| 919 | 3300049568 | Ga0501031_0001184 | Ga0501031_0001184_5884_6561 | 225 |
| 920 | 3300049568 | Ga0501031_0038291 | Ga0501031_0038291_596_1321 | 225 |
| 921 | 3300049568 | Ga0501031_0167370 | Ga0501031_0167370_487_1164 | 225 |
| 922 | 3300049570 | Ga0501033_0040853 | Ga0501033_0040853_1237_1914 | 225 |
| 923 | 3300049570 | Ga0501033_0467233 | Ga0501033_0467233_139_816 | 225 |
| 924 | 3300049572 | Ga0501036_0003151 | Ga0501036_0003151_8681_9358 | 225 |
| 925 | 3300049572 | Ga0501036_0072511 | Ga0501036_0072511_415_1092 | 225 |
| 926 | 3300049572 | Ga0501036_0573998 | Ga0501036_0573998_224_901 | 225 |
| 927 | 3300049572 | Ga0501036_0738665 | Ga0501036_0738665_12_689 | 225 |
| 928 | 3300049573 | Ga0501037_0077424 | Ga0501037_0077424_551_1228 | 225 |
| 929 | 3300049574 | Ga0501038_0006359 | Ga0501038_0006359_1611_2288 | 225 |
| 930 | 3300049574 | Ga0501038_0060824 | Ga0501038_0060824_429_1106 | 225 |
| 931 | 3300049574 | Ga0501038_0296849 | Ga0501038_0296849_120_797 | 225 |
| 932 | 3300049575 | Ga0501039_0060759 | Ga0501039_0060759_373_1050 | 225 |
| 933 | 3300049575 | Ga0501039_0095713 | Ga0501039_0095713_1030_1707 | 225 |
| 934 | 3300049575 | Ga0501039_0119059 | Ga0501039_0119059_1138_1815 | 225 |
| 935 | 3300049575 | Ga0501039_0197241 | Ga0501039_0197241_158_835 | 225 |
| 936 | 3300049575 | Ga0501039_0264249 | Ga0501039_0264249_293_970 | 225 |
| 937 | 3300049576 | Ga0501040_0001769 | Ga0501040_0001769_7053_7730 | 225 |
| 938 | 3300049576 | Ga0501040_0373067 | Ga0501040_0373067_130_807 | 225 |
| 939 | 3300049577 | Ga0501041_0033268 | Ga0501041_0033268_2072_2749 | 225 |
| 940 | 3300049577 | Ga0501041_0116836 | Ga0501041_0116836_290_967 | 225 |
| 941 | 3300049577 | Ga0501041_0199410 | Ga0501041_0199410_369_1046 | 225 |
| 942 | 3300049578 | Ga0501042_0002229 | Ga0501042_0002229_8681_9358 | 225 |
| 943 | 3300049578 | Ga0501042_0022572 | Ga0501042_0022572_1073_1750 | 225 |
| 944 | 3300049579 | Ga0501043_0621674 | Ga0501043_0621674_70_747 | 225 |
| 945 | 3300049580 | Ga0501046_0008898 | Ga0501046_0008898_6501_7178 | 225 |
| 946 | 3300049582 | Ga0501048_0002457 | Ga0501048_0002457_8208_8885 | 225 |
| 947 | 3300049582 | Ga0501048_0459223 | Ga0501048_0459223_13_690 | 225 |
| 948 | 3300049582 | Ga0501048_0479940 | Ga0501048_0479940_171_848 | 225 |
| 949 | 3300049583 | Ga0501067_0011575 | Ga0501067_0011575_3348_4043 | 225 |
| 950 | 3300049583 | Ga0501067_0013348 | Ga0501067_0013348_27_704 | 225 |
| 951 | 3300049583 | Ga0501067_0037804 | Ga0501067_0037804_1292_1969 | 225 |
| 952 | 3300049583 | Ga0501067_0271487 | Ga0501067_0271487_41_718 | 225 |
| 953 | 3300049584 | Ga0501068_0017893 | Ga0501068_0017893_1752_2429 | 225 |
| 954 | 3300049585 | Ga0501069_0069242 | Ga0501069_0069242_1106_1783 | 225 |
| 955 | 3300049585 | Ga0501069_0100181 | Ga0501069_0100181_603_1280 | 225 |
| 956 | 3300049587 | Ga0501071_0000242 | Ga0501071_0000242_6059_6736 | 225 |
| 957 | 3300049587 | Ga0501071_0049006 | Ga0501071_0049006_293_970 | 225 |
| 958 | 3300049587 | Ga0501071_0290036 | Ga0501071_0290036_91_768 | 225 |
| 959 | 3300049588 | Ga0501072_0139940 | Ga0501072_0139940_1010_1687 | 225 |
| 960 | 3300049590 | Ga0501074_0006376 | Ga0501074_0006376_1660_2337 | 225 |
| 961 | 3300049591 | Ga0501075_0001324 | Ga0501075_0001324_10407_11084 | 225 |
| 962 | 3300049592 | Ga0501076_0003324 | Ga0501076_0003324_1890_2567 | 225 |
| 963 | 3300049592 | Ga0501076_0385447 | Ga0501076_0385447_306_983 | 225 |
| 964 | 3300049592 | Ga0501076_0657676 | Ga0501076_0657676_166_843 | 225 |
| 965 | 3300049593 | Ga0501077_0016615 | Ga0501077_0016615_268_945 | 225 |
| 966 | 3300049593 | Ga0501077_0324691 | Ga0501077_0324691_116_793 | 225 |
| 967 | 3300049741 | Ga0501079_0001427 | Ga0501079_0001427_3760_4437 | 225 |
| 968 | 3300049741 | Ga0501079_0261470 | Ga0501079_0261470_629_1306 | 225 |
| 969 | 3300049742 | Ga0501080_0012152 | Ga0501080_0012152_1410_2087 | 225 |
| 970 | 3300049823 | Ga0501044_0061626 | Ga0501044_0061626_204_881 | 225 |
| 971 | 3300049824 | Ga0501045_0120494 | Ga0501045_0120494_741_1418 | 225 |
| 972 | 3300050491 | nmdc:mga00v17_109896_c1 | nmdc:mga00v17_109896_c1_241_918 | 225 |
| 973 | 3300050495 | nmdc:mga04h51_13427_c1 | nmdc:mga04h51_13427_c1_565_1242 | 225 |
| 974 | 3300050507 | nmdc:mga05p37_2183_c1 | nmdc:mga05p37_2183_c1_65_742 | 225 |
| 975 | 3300050507 | nmdc:mga05p37_573_c1 | nmdc:mga05p37_573_c1_32872_33549 | 225 |
| 976 | 3300050508 | nmdc:mga09592_115689_c1 | nmdc:mga09592_115689_c1_892_1569 | 225 |
| 977 | 3300050508 | nmdc:mga09592_227_c1 | nmdc:mga09592_227_c1_14447_15124 | 225 |
| 978 | 3300050509 | nmdc:mga0qj67_14713_c1 | nmdc:mga0qj67_14713_c1_4281_4958 | 225 |
| 979 | 3300050509 | nmdc:mga0qj67_22215_c1 | nmdc:mga0qj67_22215_c1_576_1253 | 225 |
| 980 | 3300050510 | nmdc:mga06r32_6575_c1 | nmdc:mga06r32_6575_c1_9353_10030 | 225 |
| 981 | 3300050510 | nmdc:mga06r32_83_c1 | nmdc:mga06r32_83_c1_46148_46825 | 225 |
| 982 | 3300050511 | nmdc:mga08y16_1700_c1 | nmdc:mga08y16_1700_c1_7105_7782 | 225 |
| 983 | 3300050512 | nmdc:mga0n895_337582_c1 | nmdc:mga0n895_337582_c1_503_1180 | 225 |
| 984 | 3300050512 | nmdc:mga0n895_679369_c1 | nmdc:mga0n895_679369_c1_338_1015 | 225 |
| 985 | 3300053077 | Ga0495601_0010947 | Ga0495601_0010947_3290_4015 | 225 |
| 986 | 3300053084 | Ga0495595_0000288 | Ga0495595_0000288_15014_15739 | 225 |
| 987 | 3300053085 | Ga0495619_0132905 | Ga0495619_0132905_541_1218 | 225 |
| 988 | 3300053117 | Ga0500593_006236 | Ga0500593_006236_4051_4728 | 225 |
| 989 | 3300053129 | Ga0500628_090127 | Ga0500628_090127_24_725 | 225 |
| 990 | 3300054114 | Ga0501084_0008293 | Ga0501084_0008293_3917_4594 | 225 |
| 991 | 3300060353 | Ga0501082_0008844 | Ga0501082_0008844_7951_8628 | 225 |
| 992 | 3300061719 | Ga0466962_0024932 | Ga0466962_0024932_471_1148 | 225 |
| 993 | 3300061734 | Ga0530510_0001746 | Ga0530510_0001746_2862_3539 | 225 |
| 994 | iso_pu_bacteria | 2728369276 | 2729906950 | 225 |
| 995 | iso_pu_bacteria | 3001889506 | 3001892337 | 225 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3i54-assembly1.cif.gz_A | crystal structure of mtbcrp in complex with camp | 0.9606 | 4 | 224 |
| 4cyd-assembly2.cif.gz_C | glxr bound to camp | 0.9523 | 3 | 225 |
| 3i54-assembly2.cif.gz_C | crystal structure of mtbcrp in complex with camp | 0.952 | 21 | 224 |
| 4cyd-assembly2.cif.gz_A | glxr bound to camp | 0.9507 | 3 | 225 |
| 3i54-assembly1.cif.gz_B | crystal structure of mtbcrp in complex with camp | 0.9501 | 3 | 224 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3i59B02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9777 | 146 | 214 | 1.10.10.10 |
| 4a2uH02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9734 | 146 | 225 | 1.10.10.10 |
| 4cydD02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9718 | 146 | 222 | 1.10.10.10 |
| 3mzhA02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9696 | 146 | 225 | 1.10.10.10 |
| 4a2uH02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9616 | 146 | 225 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2N2HDB7-F1-model_v4 | Transcriptional regulator | 0.9643 | 3 | 99 |
|
| AF-A0A4Q3GWR6-F1-model_v4 | deleted | 0.9577 | 146 | 224 |
|
| AF-A0A7C4RU19-F1-model_v4 | Cyclic nucleotide-binding domain-containing protein | 0.9497 | 1 | 99 |
GO:0003700
GO:0005829 |
| AF-S4XX20-F1-model_v4 | Crp/Fnr family transcriptional regulator | 0.941 | 39 | 223 |
GO:0003677
GO:0003700 GO:0005829 |
| AF-A0A1Q7EDL1-F1-model_v4 | Cyclic nucleotide-binding domain-containing protein | 0.9395 | 27 | 106 |
GO:0005829
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar