F487741

General Info

Members Datasets Scaffolds Average Seq Length
995 491 896 226

Family's Representative Sequence

Representative Sequence 3300020082|Ga0206353_10205279|Ga0206353_102052791
Length 255
Sequence VDNDVLRQSPLFSALDDEAATALRASMSETRLRRGEVLFHEGDEGDKLYIVTEGKVKLGRTSSDGRENLLAIQGPGQMFGELSLFDPGPRSATVTAVTDATFSSLSHEDLLRWLDGRPAVARGLLAQLAGRLRRANDVVADLVFSDVPGRVAKALLDLADRFGRTAEDGIHVHHDLTQEELAQLVGASRETVNKALADFAHRGWLRLEGKSVLILDPERLARRVVETVYADVDPVLWGAAELSVRAQIEYLRGQG

Samples

Sample ID Description Type Environment
1 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
2 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
3 2558860280 Kutzneria sp. 744 Isolate Unclassified
4 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
5 2582580736 Prauserella sp. Am3 Isolate Unclassified
6 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
7 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
8 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
9 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
10 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
11 2643221548 Streptomyces sp. Root55 Isolate Unclassified
12 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
13 2643221578 Streptomyces sp. Root63 Isolate Unclassified
14 2643221613 Oerskovia sp. Root22 Isolate Unclassified
15 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
16 2643221641 Nocardioides sp. Root122 Isolate Unclassified
17 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
18 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
19 2643221690 Cellulomonas sp. Root485 Isolate Unclassified
20 2643221694 Cellulomonas sp. Root137 Isolate Unclassified
21 2643221721 Oerskovia sp. Root918 Isolate Unclassified
22 2643221722 Cellulomonas sp. Root930 Isolate Unclassified
23 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
24 2728369276 Kineococcus rhizosphaerae DSM 19711 Isolate Rhizosphere
25 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
26 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
27 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
28 2738543027 Promicromonospora sp. CF082 Isolate Unclassified
29 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
30 2739367654 Promicromonospora sp. YR516 Isolate Unclassified
31 2739367898 Nocardioides sp. CF479 Isolate Unclassified
32 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
33 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
34 2758568621 Promicromonospora sukumoe SAI-064 Isolate Unclassified
35 2775506925 Saccharopolyspora phatthalungensis NRRL B-24798 Isolate Rhizosphere
36 2784132109 Dermacoccus sp. DS28 SAI-028 Isolate Unclassified
37 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
38 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
39 2808606365 Phycicoccus sp. SLBN-51 Isolate Unclassified
40 2808606394 Promicromonospora sp. C35 Isolate Unclassified
41 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
42 2811994880 Cellulomonas sp. SLBN-39 Isolate Unclassified
43 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
44 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
45 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
46 2835188231 Isoptericola variabilis JZ7 Isolate Unclassified
47 2839986021 Cellulosimicrobium cellulans JZ5 Isolate Unclassified
48 2842888712 Tsukamurella sp. R-71941 Isolate Unclassified
49 2857479173 Micrococcus sp. R-74225 Isolate Unclassified
50 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
51 2857632687 Micrococcus sp. R-73081 Isolate Unclassified
52 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
53 2862574272 Streptomyces sp. AcE210 Isolate Nodule
54 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
55 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
56 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
57 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
58 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
59 2870801768 Micrococcus endophyticus DSM 17945 Isolate Unclassified
60 2870804320 Micrococcus yunnanensis DSM 21948 Isolate Unclassified
61 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
62 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
63 2884994152 Cellulomonas sp. H30R-01 Isolate Rhizosphere
64 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
65 2891326441 Actinokineospora pegani TRM65233 Isolate Unclassified
66 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
67 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
68 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
69 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
70 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
71 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
72 2915358134 Pseudonocardia pini CAP47R Isolate Unclassified
73 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
74 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
75 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
76 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
77 2919446982 Phycicoccus sp. 3266 Isolate Rhizosphere
78 2922554459 Rhodococcus sp. 66b Isolate Unclassified
79 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
80 2932431166 Cellulosimicrobium sp. 4261 Isolate Rhizosphere
81 2935890801 Oerskovia enterophila 3230 Isolate Rhizosphere
82 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
83 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
84 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
85 2956939328 Lolliginicoccus suaedae LNNU 331112 Isolate Rhizosphere
86 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
87 2974315732 Rhodococcus sp. SORGH_AS 301 Isolate Unclassified
88 2984523437 Rhodococcus sp. SORGH_AS303 Isolate Aerial Root
89 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
90 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
91 3001119090 Lolliginicoccus lacisalsi G463 Isolate Rhizosphere
92 3001889506 Janibacter sp. YIM B02568 Isolate Unclassified
93 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
94 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
95 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
96 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
97 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
98 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
99 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
100 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
101 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
102 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
103 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
104 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
105 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
106 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
107 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
108 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
109 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
110 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
111 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
112 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
113 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
114 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
115 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
116 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
117 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
118 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
119 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
120 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
121 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
122 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
123 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
124 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
125 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
126 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
127 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
128 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
129 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
130 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
131 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
132 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
133 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
134 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
135 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
136 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
137 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
138 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
139 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
140 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
141 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
142 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
143 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
144 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
145 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
146 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
147 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
148 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
149 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
150 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
151 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
152 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
153 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
154 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
155 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
156 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
157 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
158 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
159 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
160 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
161 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
162 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
163 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
164 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
165 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
166 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
167 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
168 3300009988 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG Metagenome Rhizosphere
169 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
170 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
171 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
172 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
173 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
174 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
175 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
176 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
177 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
178 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
179 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
180 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
181 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
182 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
183 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
184 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
185 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
186 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
187 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
188 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
189 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
190 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
191 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
192 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
242 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
246 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
247 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
248 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
249 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
250 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
251 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
252 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
253 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
254 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
255 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
256 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
257 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
258 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
259 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
260 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
261 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
262 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
263 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
264 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
265 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
266 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
267 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
268 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
269 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
270 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
271 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
272 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
273 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
274 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
275 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
276 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
277 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
278 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
279 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
280 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
281 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
282 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
283 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
284 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
285 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
286 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
287 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
288 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
289 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
290 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
291 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
292 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
293 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
294 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
295 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
296 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
297 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
298 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
299 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
300 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
301 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
302 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
303 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
304 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
305 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
306 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
307 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
308 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
309 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
310 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
311 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
312 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
313 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
314 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
315 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
316 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
317 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
318 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
319 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
320 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
321 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
322 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
323 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
324 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
325 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
326 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
327 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
328 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
329 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
330 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
331 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
332 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
333 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
334 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
335 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
336 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
337 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
338 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
339 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
340 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
341 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
342 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
343 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
344 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
345 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
346 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
347 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
348 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
349 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
350 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
351 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
352 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
353 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
354 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
355 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
356 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
357 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
358 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
359 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
360 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
361 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
362 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
363 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
364 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
365 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
366 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
367 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
368 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
369 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
370 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
371 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
372 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
373 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
374 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
375 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
376 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
377 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
378 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
379 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
380 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
381 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
382 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
383 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
384 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
385 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
386 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
387 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
388 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
389 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
390 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
391 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
392 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
393 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
394 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
395 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
396 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
397 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
398 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
399 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
400 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
401 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
402 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
403 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
404 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
405 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
406 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
407 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
408 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
409 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
410 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
411 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
412 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
413 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
414 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
415 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
416 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
417 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
418 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
419 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
420 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
421 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
422 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
423 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
424 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
425 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
426 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
427 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
428 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
429 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
430 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
431 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
432 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
433 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
434 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
435 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
436 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
437 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
438 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
439 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
440 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
441 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
442 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
443 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
444 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
445 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
446 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
447 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
448 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
449 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
450 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
451 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
452 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
453 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
454 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
455 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
456 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
457 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
458 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
459 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
460 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
461 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
462 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
463 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
464 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
465 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
466 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
467 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
468 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
469 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
470 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
471 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
472 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
473 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
474 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
475 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
476 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
477 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
478 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
479 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
480 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
481 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
482 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
483 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
484 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
485 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
486 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
487 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
488 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
489 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule
490 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere
491 8056579771 Promicromonospora iranensis UTMC 00792 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.44
Metatranscriptomes 1.61
Isolates 9.95

Biome Distribution

Category Percentage (%)
Aerial Root 0.3
Bulb 0
Endosphere 1.91
Nodule 0.2
Rhizoplane 6.43
Rhizosphere 80.1
Stem 0
Stem Tuber 0.1
Unclassified 10.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10015616 3300001989 Bacteria 2759
2 JGI24735J21928_10045086 3300002067 Bacteria 1281
3 JGI24735J21928_10070776 3300002067 Bacteria 999
4 JGI25160J50197_1042269 3300003354 Bacteria 1038
5 Ga0006562J51391_1046570 3300003578 Bacteria 2413
6 Ga0070658_10005717 3300005327 Bacteria 10086
7 Ga0070658_10059768 3300005327 Bacteria 3104
8 Ga0070658_10160210 3300005327 Bacteria 1887
9 Ga0070658_10304334 3300005327 Bacteria 1359
10 Ga0070676_10343869 3300005328 Bacteria 1024
11 Ga0070683_100129855 3300005329 Bacteria 2384
12 Ga0070683_100489581 3300005329 Bacteria 1174
13 Ga0068869_100087253 3300005334 Bacteria 2340
14 Ga0070680_100001364 3300005336 Bacteria 17666
15 Ga0070680_100036721 3300005336 Bacteria 3959
16 Ga0070680_100040970 3300005336 Bacteria 3754
17 Ga0070680_100058618 3300005336 Bacteria 3149
18 Ga0070682_100073395 3300005337 Bacteria 2195
19 Ga0070682_100113663 3300005337 Bacteria 1808
20 Ga0070682_100178411 3300005337 Bacteria 1481
21 Ga0070682_100246469 3300005337 Bacteria 1285
22 Ga0068868_100057799 3300005338 Bacteria 3065
23 Ga0068868_100162580 3300005338 Bacteria 1844
24 Ga0070660_100110009 3300005339 Bacteria 2191
25 Ga0070689_100200667 3300005340 Bacteria 1628
26 Ga0070691_10045962 3300005341 Bacteria 2073
27 Ga0070668_100000514 3300005347 Bacteria 25634
28 Ga0070668_100049408 3300005347 Bacteria 3236
29 Ga0070668_100172248 3300005347 Bacteria 1763
30 Ga0070668_100315528 3300005347 Bacteria 1315
31 Ga0070668_100415862 3300005347 Bacteria 1150
32 Ga0070675_100227892 3300005354 Bacteria 1624
33 Ga0070674_100039819 3300005356 Bacteria 3176
34 Ga0070659_100278770 3300005366 Bacteria 1390
35 Ga0070714_100011321 3300005435 Bacteria 7074
36 Ga0070714_100189816 3300005435 Bacteria 1874
37 Ga0070713_100094562 3300005436 Bacteria 2577
38 Ga0070713_100103618 3300005436 Bacteria 2469
39 Ga0070713_100267186 3300005436 Bacteria 1565
40 Ga0070713_100291284 3300005436 Bacteria 1500
41 Ga0070710_10016542 3300005437 Bacteria 3756
42 Ga0070705_100096864 3300005440 Bacteria 1853
43 Ga0070700_100103323 3300005441 Bacteria 1881
44 Ga0070700_100241432 3300005441 Bacteria 1291
45 Ga0070708_100064689 3300005445 Bacteria 3277
46 Ga0070708_100205495 3300005445 Bacteria 1845
47 Ga0070663_100002651 3300005455 Bacteria 10128
48 Ga0070663_100080066 3300005455 Bacteria 2398
49 Ga0070663_100146243 3300005455 Bacteria 1808
50 Ga0070678_100129245 3300005456 Bacteria 2004
51 Ga0070678_100304768 3300005456 Bacteria 1355
52 Ga0070678_100791199 3300005456 Bacteria 860
53 Ga0070681_10000699 3300005458 Bacteria 27854
54 Ga0070681_10002094 3300005458 Bacteria 18131
55 Ga0070681_10270654 3300005458 Bacteria 1610
56 Ga0070685_10132433 3300005466 Bacteria 1560
57 Ga0070706_100131294 3300005467 Bacteria 2337
58 Ga0070706_100211198 3300005467 Bacteria 1812
59 Ga0070707_100439745 3300005468 Bacteria 1265
60 Ga0070707_100853998 3300005468 Bacteria 874
61 Ga0070698_100000708 3300005471 Bacteria 35672
62 Ga0070698_100000817 3300005471 Bacteria 33998
63 Ga0070679_100000016 3300005530 Bacteria 139454
64 Ga0070679_100005127 3300005530 Bacteria 12108
65 Ga0070679_100217893 3300005530 Bacteria 1871
66 Ga0070679_100277455 3300005530 Bacteria 1629
67 Ga0070679_100558662 3300005530 Bacteria 1088
68 Ga0070684_100003966 3300005535 Bacteria 11211
69 Ga0070684_100119100 3300005535 Bacteria 2374
70 Ga0070684_100141500 3300005535 Bacteria 2175
71 Ga0070684_100305937 3300005535 Bacteria 1459
72 Ga0068853_100025230 3300005539 Bacteria 4988
73 Ga0070672_100307549 3300005543 Bacteria 1345
74 Ga0070672_100372232 3300005543 Bacteria 1221
75 Ga0070672_100373031 3300005543 Bacteria 1219
76 Ga0070693_100309479 3300005547 Bacteria 1068
77 Ga0070665_100134978 3300005548 Bacteria 2469
78 Ga0070665_100234266 3300005548 Bacteria 1836
79 Ga0070665_100312848 3300005548 Bacteria 1574
80 Ga0070665_101288685 3300005548 Bacteria 741
81 Ga0068855_100119246 3300005563 Bacteria 3021
82 Ga0070664_100141426 3300005564 Bacteria 2119
83 Ga0070664_100375235 3300005564 Bacteria 1297
84 Ga0068857_100023807 3300005577 Bacteria 5392
85 Ga0068857_100040943 3300005577 Bacteria 4107
86 Ga0068857_100140524 3300005577 Bacteria 2182
87 Ga0068857_100192116 3300005577 Bacteria 1859
88 Ga0068854_100164222 3300005578 Bacteria 1722
89 Ga0068856_100087885 3300005614 Bacteria 3090
90 Ga0068856_100484710 3300005614 Bacteria 1257
91 Ga0070702_100035872 3300005615 Bacteria 2742
92 Ga0070702_100167662 3300005615 Bacteria 1425
93 Ga0068852_100121073 3300005616 Bacteria 2396
94 Ga0068852_100227264 3300005616 Bacteria 1778
95 Ga0068852_100262894 3300005616 Bacteria 1657
96 Ga0068859_100210674 3300005617 Bacteria 2030
97 Ga0068864_100352644 3300005618 Bacteria 1388
98 Ga0068864_101004052 3300005618 Bacteria 828
99 Ga0068866_10072522 3300005718 Bacteria 1825
100 Ga0068861_100053493 3300005719 Bacteria 3072
101 Ga0068870_10042549 3300005840 Bacteria 2365
102 Ga0068863_100249115 3300005841 Bacteria 1716
103 Ga0068858_100590881 3300005842 Bacteria 1076
104 Ga0081455_10007035 3300005937 Bacteria 11945
105 Ga0081455_10433117 3300005937 Bacteria 903
106 Ga0081538_10000417 3300005981 Bacteria 47830
107 Ga0081538_10031451 3300005981 Bacteria 3579
108 Ga0081539_10000027 3300005985 Bacteria 328691
109 Ga0075365_10340947 3300006038 Bacteria 1056
110 Ga0070712_100055849 3300006175 Bacteria 2767
111 Ga0075367_10134435 3300006178 Bacteria 1529
112 Ga0068871_100002346 3300006358 Bacteria 12901
113 Ga0075430_100001802 3300006846 Bacteria 17520
114 Ga0075430_100006192 3300006846 Bacteria 10087
115 Ga0075431_100001725 3300006847 Bacteria 20568
116 Ga0075431_100001755 3300006847 Bacteria 20403
117 Ga0075434_100222303 3300006871 Bacteria 1908
118 Ga0075429_100001988 3300006880 Bacteria 16983
119 Ga0075429_100016094 3300006880 Bacteria 6478
120 Ga0097620_100210674 3300006931 Bacteria 2030
121 Ga0105240_10615507 3300009093 Bacteria 1194
122 Ga0111539_10018001 3300009094 Bacteria 8750
123 Ga0111539_10360620 3300009094 Bacteria 1692
124 Ga0111539_10589772 3300009094 Bacteria 1294
125 Ga0105245_10020841 3300009098 Bacteria 5746
126 Ga0105245_10198585 3300009098 Bacteria 1925
127 Ga0105245_10237514 3300009098 Bacteria 1765
128 Ga0105245_10334667 3300009098 Bacteria 1495
129 Ga0105245_10874753 3300009098 Bacteria 939
130 Ga0114129_10016875 3300009147 Bacteria 10395
131 Ga0114129_10065489 3300009147 Bacteria 5071
132 Ga0114129_11714457 3300009147 Bacteria 766
133 Ga0105243_10001133 3300009148 Bacteria 24160
134 Ga0105243_10075374 3300009148 Bacteria 2738
135 Ga0105243_10168242 3300009148 Bacteria 1896
136 Ga0105243_10459206 3300009148 Bacteria 1197
137 Ga0105243_10625379 3300009148 Bacteria 1040
138 Ga0105243_10771183 3300009148 Bacteria 945
139 Ga0105243_10870028 3300009148 Bacteria 894
140 Ga0105242_10012950 3300009176 Bacteria 6431
141 Ga0105242_10056290 3300009176 Bacteria 3218
142 Ga0105242_10192426 3300009176 Bacteria 1807
143 Ga0105248_10127328 3300009177 Bacteria 2873
144 Ga0105248_10361691 3300009177 Bacteria 1634
145 Ga0105248_10784886 3300009177 Bacteria 1075
146 Ga0105237_10087968 3300009545 Bacteria 3096
147 Ga0105237_10108868 3300009545 Bacteria 2762
148 Ga0105237_10520597 3300009545 Bacteria 1196
149 Ga0105249_10319660 3300009553 Bacteria 1563
150 Ga0105035_101768 3300009988 Bacteria 1533
151 Ga0105239_10280250 3300010375 Bacteria 1877
152 Ga0105239_10448571 3300010375 Bacteria 1463
153 Ga0105239_10477382 3300010375 Bacteria 1416
154 Ga0105246_10037244 3300011119 Bacteria 3264
155 Ga0157335_1004266 3300012492 Bacteria 955
156 Ga0157371_10206178 3300013102 Bacteria 1410
157 Ga0157371_10305073 3300013102 Bacteria 1153
158 Ga0157369_10067886 3300013105 Bacteria 3832
159 Ga0157369_10266986 3300013105 Bacteria 1784
160 Ga0157369_10467648 3300013105 Bacteria 1305
161 Ga0157369_10840698 3300013105 Bacteria 943
162 Ga0157369_10858617 3300013105 Bacteria 931
163 Ga0157374_10009898 3300013296 Bacteria 8182
164 Ga0157374_10332018 3300013296 Bacteria 1508
165 Ga0157374_10553504 3300013296 Bacteria 1158
166 Ga0157378_10041806 3300013297 Bacteria 4067
167 Ga0163162_10145893 3300013306 Bacteria 2483
168 Ga0163162_10246253 3300013306 Bacteria 1919
169 Ga0163162_10256364 3300013306 Bacteria 1881
170 Ga0157372_10067228 3300013307 Bacteria 4027
171 Ga0157372_10286793 3300013307 Bacteria 1915
172 Ga0157372_10351097 3300013307 Bacteria 1718
173 Ga0157375_10028637 3300013308 Bacteria 5226
174 Ga0157375_10154215 3300013308 Bacteria 2435
175 Ga0157375_10226188 3300013308 Bacteria 2030
176 Ga0157375_10548643 3300013308 Bacteria 1318
177 Ga0157375_11037269 3300013308 Bacteria 958
178 Ga0157375_11203268 3300013308 Bacteria 889
179 Ga0163163_10003442 3300014325 Bacteria 13446
180 Ga0163163_10419864 3300014325 Bacteria 1396
181 Ga0157380_10101500 3300014326 Bacteria 2397
182 Ga0157380_10272461 3300014326 Bacteria 1544
183 Ga0157380_10444440 3300014326 Bacteria 1243
184 Ga0157377_10023060 3300014745 Bacteria 3294
185 Ga0157379_10002390 3300014968 Bacteria 15680
186 Ga0157379_10180503 3300014968 Bacteria 1907
187 Ga0157376_10007343 3300014969 Bacteria 7856
188 Ga0163161_10049749 3300017792 Bacteria 3030
189 Ga0163161_10148043 3300017792 Bacteria 1782
190 Ga0163161_10258361 3300017792 Bacteria 1360
191 Ga0206356_10146858 3300020070 Bacteria 1224
192 Ga0206356_10640822 3300020070 Bacteria 1519
193 Ga0206356_10804711 3300020070 Bacteria 1192
194 Ga0206356_11268019 3300020070 Bacteria 1551
195 Ga0206351_10683577 3300020077 Bacteria 1074
196 Ga0206353_10205279 3300020082 Bacteria 1812
197 Ga0206353_10235487 3300020082 Bacteria 1060
198 Ga0206353_10607554 3300020082 Bacteria 2956
199 Ga0206353_10786672 3300020082 Bacteria 5745
200 Ga0206353_11891632 3300020082 Bacteria 802
201 Ga0213876_10001520 3300021384 Bacteria 14348
202 Ga0213876_10017812 3300021384 Bacteria 3748
203 Ga0213875_10000221 3300021388 Bacteria 57905
204 Ga0213875_10009789 3300021388 Bacteria 4837
205 Ga0213875_10014027 3300021388 Bacteria 3919
206 Ga0224712_10035499 3300022467 Bacteria 1841
207 Ga0224712_10071847 3300022467 Bacteria 1407
208 Ga0224712_10116778 3300022467 Bacteria 1151
209 Ga0224712_10262238 3300022467 Bacteria 801
210 Ga0209758_1010962 3300025297 Bacteria 5327
211 Ga0207656_10019393 3300025321 Bacteria 2690
212 Ga0207692_10065526 3300025898 Bacteria 1895
213 Ga0207642_10420788 3300025899 Bacteria 803
214 Ga0207710_10012332 3300025900 Bacteria 3596
215 Ga0207688_10004602 3300025901 Bacteria 7512
216 Ga0207688_10085157 3300025901 Bacteria 1810
217 Ga0207647_10007385 3300025904 Bacteria 7946
218 Ga0207647_10171646 3300025904 Bacteria 1262
219 Ga0207645_10014867 3300025907 Bacteria 5193
220 Ga0207643_10013050 3300025908 Bacteria 4492
221 Ga0207705_10000470 3300025909 Bacteria 34558
222 Ga0207705_10291805 3300025909 Bacteria 1249
223 Ga0207705_10539733 3300025909 Bacteria 906
224 Ga0207684_10001496 3300025910 Bacteria 25101
225 Ga0207684_10161486 3300025910 Bacteria 1930
226 Ga0207707_10000185 3300025912 Bacteria 65663
227 Ga0207707_10572160 3300025912 Bacteria 958
228 Ga0207671_10125517 3300025914 Bacteria 1965
229 Ga0207671_10176266 3300025914 Bacteria 1662
230 Ga0207671_10345493 3300025914 Bacteria 1179
231 Ga0207693_10046808 3300025915 Bacteria 3398
232 Ga0207663_10430692 3300025916 Bacteria 1014
233 Ga0207660_10007057 3300025917 Bacteria 7278
234 Ga0207660_10043218 3300025917 Bacteria 3166
235 Ga0207660_10073494 3300025917 Bacteria 2493
236 Ga0207657_10188967 3300025919 Bacteria 1663
237 Ga0207657_10195134 3300025919 Bacteria 1631
238 Ga0207657_10253310 3300025919 Bacteria 1403
239 Ga0207652_10001048 3300025921 Bacteria 25276
240 Ga0207652_10025309 3300025921 Bacteria 4932
241 Ga0207652_10081336 3300025921 Bacteria 2833
242 Ga0207652_10209407 3300025921 Bacteria 1755
243 Ga0207652_10252126 3300025921 Bacteria 1592
244 Ga0207652_10564922 3300025921 Bacteria 1022
245 Ga0207646_10001862 3300025922 Bacteria 25443
246 Ga0207646_10380867 3300025922 Bacteria 1274
247 Ga0207687_10133549 3300025927 Bacteria 1874
248 Ga0207700_10077540 3300025928 Bacteria 2582
249 Ga0207700_10178372 3300025928 Bacteria 1777
250 Ga0207700_10328821 3300025928 Bacteria 1326
251 Ga0207664_10008962 3300025929 Bacteria 7005
252 Ga0207664_10097820 3300025929 Bacteria 2418
253 Ga0207664_10113260 3300025929 Bacteria 2259
254 Ga0207706_10070653 3300025933 Bacteria 3071
255 Ga0207686_10094902 3300025934 Bacteria 1978
256 Ga0207709_10000356 3300025935 Bacteria 46632
257 Ga0207709_10326808 3300025935 Bacteria 1150
258 Ga0207709_10826752 3300025935 Bacteria 749
259 Ga0207669_10158319 3300025937 Bacteria 1596
260 Ga0207704_10502727 3300025938 Bacteria 977
261 Ga0207665_10082543 3300025939 Bacteria 2215
262 Ga0207691_10081078 3300025940 Bacteria 2917
263 Ga0207691_10271255 3300025940 Bacteria 1461
264 Ga0207711_10307629 3300025941 Bacteria 1463
265 Ga0207689_10065444 3300025942 Bacteria 2989
266 Ga0207689_10385003 3300025942 Bacteria 1168
267 Ga0207661_10068915 3300025944 Bacteria 2882
268 Ga0207661_10409640 3300025944 Bacteria 1230
269 Ga0207661_10653496 3300025944 Bacteria 966
270 Ga0207661_10774322 3300025944 Bacteria 883
271 Ga0207679_10347461 3300025945 Bacteria 1292
272 Ga0207679_11013228 3300025945 Bacteria 761
273 Ga0207651_10048409 3300025960 Bacteria 2874
274 Ga0207712_10015125 3300025961 Bacteria 4973
275 Ga0207712_10281668 3300025961 Bacteria 1357
276 Ga0207668_10012757 3300025972 Bacteria 5152
277 Ga0207668_10072336 3300025972 Bacteria 2467
278 Ga0207668_10102057 3300025972 Bacteria 2133
279 Ga0207668_10274803 3300025972 Bacteria 1379
280 Ga0207658_10197826 3300025986 Bacteria 1676
281 Ga0207658_10456665 3300025986 Bacteria 1132
282 Ga0207658_10688098 3300025986 Bacteria 924
283 Ga0207677_10034460 3300026023 Bacteria 3279
284 Ga0207703_10186182 3300026035 Bacteria 1835
285 Ga0207639_10846743 3300026041 Bacteria 853
286 Ga0207678_10000054 3300026067 Bacteria 87616
287 Ga0207678_10023227 3300026067 Bacteria 5424
288 Ga0207678_10273051 3300026067 Bacteria 1450
289 Ga0207708_10227548 3300026075 Bacteria 1496
290 Ga0207708_10800105 3300026075 Bacteria 811
291 Ga0207708_10832099 3300026075 Bacteria 796
292 Ga0207702_10040822 3300026078 Bacteria 3890
293 Ga0207702_10537269 3300026078 Bacteria 1142
294 Ga0207702_11303495 3300026078 Bacteria 720
295 Ga0207641_10165730 3300026088 Bacteria 2012
296 Ga0207648_10269220 3300026089 Bacteria 1521
297 Ga0207676_10334276 3300026095 Bacteria 1395
298 Ga0207676_10824493 3300026095 Bacteria 906
299 Ga0207674_10055991 3300026116 Bacteria 4006
300 Ga0207674_10069016 3300026116 Bacteria 3555
301 Ga0207674_10081024 3300026116 Bacteria 3248
302 Ga0207674_10154769 3300026116 Bacteria 2248
303 Ga0207674_10458407 3300026116 Bacteria 1232
304 Ga0207675_100007887 3300026118 Bacteria 10041
305 Ga0207675_100049410 3300026118 Bacteria 3926
306 Ga0207683_10033184 3300026121 Bacteria 4483
307 Ga0207683_10309154 3300026121 Bacteria 1447
308 Ga0207683_10631126 3300026121 Bacteria 992
309 Ga0207698_10098800 3300026142 Bacteria 2413
310 Ga0207698_10247702 3300026142 Bacteria 1628
311 Ga0207428_10119860 3300027907 Bacteria 2018
312 Ga0268266_10074264 3300028379 Bacteria 2952
313 Ga0268266_10278754 3300028379 Bacteria 1554
314 Ga0268265_10044138 3300028380 Bacteria 3318
315 Ga0268265_10469893 3300028380 Bacteria 1179
316 Ga0268264_10154211 3300028381 Bacteria 2062
317 Ga0307517_10026479 3300028786 Bacteria 7025
318 Ga0307515_10017159 3300028794 Bacteria 13209
319 Ga0307515_10045822 3300028794 Bacteria 6704
320 Ga0307515_10160461 3300028794 Bacteria 2296
321 Ga0307515_10222639 3300028794 Bacteria 1700
322 Ga0307515_10271020 3300028794 Bacteria 1418
323 Ga0307511_10060505 3300030521 Bacteria 2898
324 Ga0307511_10161577 3300030521 Bacteria 1256
325 Ga0307512_10008082 3300030522 Bacteria 10305
326 Ga0307512_10013770 3300030522 Bacteria 7563
327 Ga0307512_10216102 3300030522 Bacteria 1010
328 Ga0307512_10230096 3300030522 Bacteria 954
329 Ga0265327_10175228 3300031251 Bacteria 983
330 Ga0307513_10033014 3300031456 Bacteria 5825
331 Ga0307513_10239286 3300031456 Bacteria 1621
332 Ga0307513_10380257 3300031456 Bacteria 1151
333 Ga0307509_10029556 3300031507 Bacteria 6080
334 Ga0307408_100082526 3300031548 Bacteria 2406
335 Ga0307408_100162721 3300031548 Bacteria 1774
336 Ga0307408_100264284 3300031548 Bacteria 1426
337 Ga0307408_100474409 3300031548 Bacteria 1090
338 Ga0307508_10212388 3300031616 Bacteria 1535
339 Ga0307514_10008147 3300031649 Bacteria 8953
340 Ga0307514_10059712 3300031649 Bacteria 2912
341 Ga0307514_10168104 3300031649 Bacteria 1438
342 Ga0307514_10176509 3300031649 Bacteria 1385
343 Ga0316575_10003903 3300031665 Bacteria 5209
344 Ga0316579_10002822 3300031691 Bacteria 6648
345 Ga0316579_10149533 3300031691 Bacteria 1126
346 Ga0316576_10000951 3300031727 Bacteria 14821
347 Ga0316576_10012619 3300031727 Bacteria 5589
348 Ga0316576_10016994 3300031727 Bacteria 4933
349 Ga0316576_10018918 3300031727 Bacteria 4712
350 Ga0316576_10039027 3300031727 Bacteria 3407
351 Ga0316576_10053604 3300031727 Bacteria 2939
352 Ga0316576_10065340 3300031727 Bacteria 2673
353 Ga0316576_10117887 3300031727 Bacteria 1992
354 Ga0316578_10000741 3300031728 Bacteria 11879
355 Ga0316578_10014913 3300031728 Bacteria 4167
356 Ga0316578_10015115 3300031728 Bacteria 4143
357 Ga0316578_10017710 3300031728 Bacteria 3884
358 Ga0316578_10069819 3300031728 Bacteria 2079
359 Ga0316578_10172700 3300031728 Bacteria 1303
360 Ga0307516_10019954 3300031730 Bacteria 6929
361 Ga0307405_10132287 3300031731 Bacteria 1726
362 Ga0307405_10147862 3300031731 Bacteria 1648
363 Ga0307405_10308844 3300031731 Bacteria 1203
364 Ga0316577_10025018 3300031733 Bacteria 3321
365 Ga0316577_10032277 3300031733 Bacteria 2925
366 Ga0316577_10055135 3300031733 Bacteria 2218
367 Ga0307413_10003445 3300031824 Bacteria 6658
368 Ga0307413_10482587 3300031824 Bacteria 991
369 Ga0307518_10000115 3300031838 Bacteria 56725
370 Ga0307518_10184982 3300031838 Bacteria 1403
371 Ga0307410_10015971 3300031852 Bacteria 4464
372 Ga0307410_10035741 3300031852 Bacteria 3230
373 Ga0307410_10130493 3300031852 Bacteria 1845
374 Ga0307410_10371469 3300031852 Bacteria 1148
375 Ga0307410_10391707 3300031852 Bacteria 1120
376 Ga0307406_10074511 3300031901 Bacteria 2235
377 Ga0307407_10061635 3300031903 Bacteria 2193
378 Ga0307412_10005135 3300031911 Bacteria 7334
379 Ga0307412_10038452 3300031911 Bacteria 3082
380 Ga0307409_100003830 3300031995 Bacteria 8303
381 Ga0307409_100007897 3300031995 Bacteria 6408
382 Ga0307409_100116980 3300031995 Bacteria 2248
383 Ga0307409_100183397 3300031995 Bacteria 1855
384 Ga0307409_100449052 3300031995 Bacteria 1244
385 Ga0307409_100461832 3300031995 Bacteria 1228
386 Ga0307416_100075345 3300032002 Bacteria 2823
387 Ga0307416_100121070 3300032002 Bacteria 2332
388 Ga0307416_100321509 3300032002 Bacteria 1550
389 Ga0307416_100442747 3300032002 Bacteria 1350
390 Ga0307416_100463040 3300032002 Bacteria 1323
391 Ga0307416_100634019 3300032002 Bacteria 1152
392 Ga0307414_10109738 3300032004 Bacteria 2097
393 Ga0307411_10087017 3300032005 Bacteria 2169
394 Ga0307411_10138703 3300032005 Bacteria 1790
395 Ga0307411_10204950 3300032005 Bacteria 1518
396 Ga0307411_10738936 3300032005 Bacteria 861
397 Ga0307415_100042790 3300032126 Bacteria 3017
398 Ga0307415_100225227 3300032126 Bacteria 1506
399 Ga0307415_100290226 3300032126 Bacteria 1350
400 Ga0316583_10037593 3300032133 Bacteria 1716
401 Ga0316585_10009368 3300032137 Bacteria 2855
402 Ga0316580_10016251 3300032139 Bacteria 2282
403 Ga0316580_10023382 3300032139 Bacteria 1908
404 Ga0316580_10084267 3300032139 Bacteria 972
405 Ga0307507_10038539 3300033179 Bacteria 4842
406 Ga0307507_10105891 3300033179 Bacteria 2326
407 Ga0307507_10280581 3300033179 Bacteria 1042
408 Ga0307507_10323070 3300033179 Bacteria 927
409 Ga0307510_10066364 3300033180 Bacteria 3644
410 Ga0307510_10080849 3300033180 Bacteria 3157
411 Ga0307510_10295030 3300033180 Bacteria 1085
412 Ga0373928_0048578 3300035084 Bacteria 996
413 Ga0373934_0000421 3300035086 Bacteria 14827
414 Ga0373936_0145746 3300035113 Bacteria 1024
415 Ga0373953_0000116 3300035117 Bacteria 19418
416 Ga0373954_0001000 3300035118 Bacteria 11155
417 Ga0373956_0005182 3300035119 Bacteria 5218
418 Ga0373957_0000035 3300035120 Bacteria 34674
419 Ga0373955_0000072 3300035172 Bacteria 40814
420 Ga0373955_0045548 3300035172 Bacteria 2367
421 Ga0316574_0010580 3300035398 Bacteria 5218
422 Ga0316574_0029239 3300035398 Bacteria 3328
423 Ga0316574_0034798 3300035398 Bacteria 3074
424 Ga0316574_0035275 3300035398 Bacteria 3055
425 Ga0316574_0068145 3300035398 Bacteria 2244
426 Ga0316574_0146970 3300035398 Bacteria 1519
427 Ga0373924_0001000 3300035410 Bacteria 8959
428 Ga0373933_0000327 3300035724 Bacteria 30644
429 Ga0373947_0498313 3300035725 Bacteria 827
430 Ga0373937_0000010 3300036401 Bacteria 163001
431 Ga0373937_0440067 3300036401 Bacteria 1237
432 Ga0373937_1045922 3300036401 Bacteria 765
433 Ga0316582_0011735 3300036647 Bacteria 4858
434 Ga0316582_0023777 3300036647 Bacteria 3655
435 Ga0316582_0175809 3300036647 Bacteria 1455
436 Ga0316584_0000926 3300036712 Bacteria 16714
437 Ga0316584_0006199 3300036712 Bacteria 8094
438 Ga0316584_0043795 3300036712 Bacteria 3338
439 Ga0316584_0104946 3300036712 Bacteria 2114
440 Ga0316584_0157346 3300036712 Bacteria 1689
441 Ga0316584_0422655 3300036712 Bacteria 946
442 Ga0373925_0047160 3300037068 Bacteria 3206
443 Ga0395900_0538878 3300037418 Bacteria 1113
444 Ga0395898_0556308 3300037466 Bacteria 1089
445 Ga0436364_0109597 3300037853 Bacteria 56310
446 Ga0436364_0480718 3300037853 Bacteria 6731
447 Ga0436364_1145828 3300037853 Bacteria 21168
448 Ga0395901_0011144 3300038443 Bacteria 9110
449 Ga0395901_0059400 3300038443 Bacteria 3978
450 Ga0395901_0065266 3300038443 Bacteria 3790
451 Ga0395901_0251763 3300038443 Bacteria 1840
452 Ga0436365_0351909 3300039437 Bacteria 6223
453 Ga0436365_0398569 3300039437 Bacteria 109705
454 Ga0436365_1406538 3300039437 Bacteria 977
455 Ga0436362_1280188 3300039453 Bacteria 53853
456 Ga0439447_063540 3300041407 Bacteria 865
457 Ga0451800_1017266 3300041459 Bacteria 954
458 Ga0451837_1298356 3300041494 Bacteria 1989
459 Ga0451853_3707206 3300041512 Bacteria 889
460 Ga0451853_3939996 3300041512 Bacteria 1114
461 Ga0439457_007559 3300042014 Bacteria 2603
462 Ga0450900_004422 3300042136 Bacteria 1614
463 Ga0450901_006636 3300042533 Bacteria 1191
464 Ga0466969_0043284 3300044656 Bacteria 2244
465 Ga0466969_0069180 3300044656 Bacteria 1700
466 Ga0466969_0069417 3300044656 Bacteria 1697
467 Ga0466972_0177323 3300044658 Bacteria 999
468 Ga0466965_0027672 3300044683 Bacteria 2753
469 Ga0466965_0131860 3300044683 Bacteria 1296
470 Ga0466966_0039876 3300044684 Bacteria 3023
471 Ga0466966_0070708 3300044684 Bacteria 2187
472 Ga0466966_0311640 3300044684 Bacteria 946
473 Ga0466961_0004439 3300044693 Bacteria 8785
474 Ga0466961_0096107 3300044693 Bacteria 1868
475 Ga0466961_0160398 3300044693 Bacteria 1402
476 Ga0466961_0325729 3300044693 Bacteria 937
477 Ga0466963_0004210 3300044694 Bacteria 8339
478 Ga0466963_0006354 3300044694 Bacteria 6988
479 Ga0466963_0076727 3300044694 Bacteria 2257
480 Ga0466963_0213874 3300044694 Bacteria 1349
481 Ga0466964_0102390 3300044706 Bacteria 1264
482 Ga0466971_0006249 3300044719 Bacteria 5177
483 Ga0466971_0037606 3300044719 Bacteria 2170
484 Ga0466971_0099501 3300044719 Bacteria 1335
485 Ga0466968_0000536 3300044735 Bacteria 12902
486 Ga0466970_0084586 3300044765 Bacteria 1717
487 Ga0466970_0138849 3300044765 Bacteria 1338
488 Ga0466957_0002180 3300044842 Bacteria 10488
489 Ga0466957_0040748 3300044842 Bacteria 2806
490 Ga0466960_0117462 3300044901 Bacteria 1389
491 Ga0466960_0130960 3300044901 Bacteria 1323
492 Ga0466959_0104176 3300045049 Bacteria 2029
493 Ga0466959_0263705 3300045049 Bacteria 1185
494 Ga0466958_0000222 3300045836 Bacteria 21572
495 Ga0466958_0001933 3300045836 Bacteria 10158
496 Ga0466958_0033828 3300045836 Bacteria 3047
497 Ga0466958_0043886 3300045836 Bacteria 2694
498 Ga0466958_0079108 3300045836 Bacteria 2021
499 Ga0466967_0000897 3300045976 Bacteria 15920
500 Ga0466967_0055133 3300045976 Bacteria 3501
501 Ga0466967_0514987 3300045976 Bacteria 1175
502 Ga0466967_0707106 3300045976 Bacteria 998
503 Ga0466967_1220170 3300045976 Bacteria 749
504 Ga0495617_012215 3300046452 Bacteria 2925
505 Ga0495627_010238 3300046453 Bacteria 3416
506 Ga0495627_032214 3300046453 Bacteria 1650
507 Ga0495592_0000136 3300046454 Bacteria 65571
508 Ga0495592_0003591 3300046454 Bacteria 11152
509 Ga0495592_0011391 3300046454 Bacteria 6728
510 Ga0495592_0019127 3300046454 Bacteria 5211
511 Ga0495592_0153561 3300046454 Bacteria 1590
512 Ga0495603_0045735 3300046455 Bacteria 2609
513 Ga0495629_0131568 3300046459 Bacteria 1743
514 Ga0495638_0041549 3300046460 Bacteria 2908
515 Ga0495638_0118612 3300046460 Bacteria 1565
516 Ga0495638_0317540 3300046460 Bacteria 833
517 Ga0495641_0031386 3300046461 Bacteria 2539
518 Ga0495641_0233784 3300046461 Bacteria 825
519 Ga0495651_0000047 3300046462 Bacteria 89551
520 Ga0495651_0003035 3300046462 Bacteria 12947
521 Ga0495651_0023678 3300046462 Bacteria 4775
522 Ga0495651_0033457 3300046462 Bacteria 4009
523 Ga0495653_0000753 3300046463 Bacteria 24762
524 Ga0495653_0034862 3300046463 Bacteria 3974
525 Ga0495653_0036225 3300046463 Bacteria 3888
526 Ga0495650_0172958 3300046471 Bacteria 764
527 Ga0495580_0332498 3300046472 Bacteria 1031
528 Ga0495582_0019152 3300046473 Bacteria 3745
529 Ga0495582_0115194 3300046473 Bacteria 1511
530 Ga0495605_0013624 3300046474 Bacteria 4473
531 Ga0495639_0129388 3300046475 Bacteria 1208
532 Ga0495639_0137583 3300046475 Bacteria 1172
533 Ga0495662_0001288 3300046476 Bacteria 12402
534 Ga0495662_0003663 3300046476 Bacteria 7748
535 Ga0495662_0017546 3300046476 Bacteria 3464
536 Ga0495662_0063549 3300046476 Bacteria 1783
537 Ga0495664_0001242 3300046477 Bacteria 13340
538 Ga0495585_0141256 3300046492 Bacteria 1261
539 Ga0495594_0040796 3300046499 Bacteria 2541
540 Ga0495594_0299281 3300046499 Bacteria 916
541 Ga0495594_0434283 3300046499 Bacteria 746
542 Ga0495607_0066932 3300046501 Bacteria 2019
543 Ga0495583_0145757 3300046506 Bacteria 983
544 Ga0495606_0008611 3300046507 Bacteria 8817
545 Ga0495608_0000089 3300046511 Bacteria 65189
546 Ga0495610_0061513 3300046512 Bacteria 1783
547 Ga0495616_0005356 3300046513 Bacteria 7914
548 Ga0495618_0163263 3300046514 Bacteria 1419
549 Ga0495628_0000325 3300046516 Bacteria 43145
550 Ga0495628_0008019 3300046516 Bacteria 9093
551 Ga0495628_0039995 3300046516 Bacteria 3749
552 Ga0495628_0054388 3300046516 Bacteria 3156
553 Ga0495630_0080247 3300046517 Bacteria 2461
554 Ga0495630_0090222 3300046517 Bacteria 2315
555 Ga0495631_0030817 3300046518 Bacteria 2430
556 Ga0495637_0016491 3300046520 Bacteria 3452
557 Ga0495643_0017243 3300046522 Bacteria 4225
558 Ga0495644_0069083 3300046523 Bacteria 1327
559 Ga0495648_0084247 3300046524 Bacteria 1799
560 Ga0495666_0007706 3300046526 Bacteria 5386
561 Ga0495642_0023733 3300046528 Bacteria 2423
562 Ga0495652_0000982 3300046529 Bacteria 32624
563 Ga0495652_0001869 3300046529 Bacteria 22391
564 Ga0495652_0005996 3300046529 Bacteria 11367
565 Ga0495652_0010249 3300046529 Bacteria 8498
566 Ga0495652_0049229 3300046529 Bacteria 3608
567 Ga0495654_0005236 3300046530 Bacteria 7567
568 Ga0495665_0096586 3300046531 Bacteria 1552
569 Ga0495640_0031330 3300046533 Bacteria 3796
570 Ga0495640_0036682 3300046533 Bacteria 3462
571 Ga0495586_0070901 3300046535 Bacteria 1903
572 Ga0495586_0072381 3300046535 Bacteria 1884
573 Ga0495586_0472641 3300046535 Bacteria 723
574 Ga0495587_0000074 3300046536 Bacteria 78796
575 Ga0495587_0007885 3300046536 Bacteria 6880
576 Ga0495587_0185004 3300046536 Bacteria 1180
577 Ga0495587_0193746 3300046536 Bacteria 1150
578 Ga0495609_0009374 3300046538 Bacteria 4739
579 Ga0495597_0032612 3300046542 Bacteria 2363
580 Ga0495645_0007753 3300046543 Bacteria 7466
581 Ga0495645_0033616 3300046543 Bacteria 3741
582 Ga0495645_0172993 3300046543 Bacteria 1485
583 Ga0495645_0301023 3300046543 Bacteria 1047
584 Ga0495622_0003753 3300046557 Bacteria 7107
585 Ga0495622_0020000 3300046557 Bacteria 3116
586 Ga0495622_0089249 3300046557 Bacteria 1416
587 Ga0495633_0004412 3300046558 Bacteria 8956
588 Ga0495633_0022209 3300046558 Bacteria 3163
589 Ga0495667_0000064 3300046559 Bacteria 89628
590 Ga0495667_0013616 3300046559 Bacteria 5499
591 Ga0495667_0104907 3300046559 Bacteria 1827
592 Ga0495668_0027050 3300046616 Bacteria 3250
593 Ga0495634_0004615 3300046642 Bacteria 10755
594 Ga0495634_0066300 3300046642 Bacteria 2390
595 Ga0495634_0126419 3300046642 Bacteria 1633
596 Ga0495611_0007737 3300046648 Bacteria 4564
597 Ga0495611_0017328 3300046648 Bacteria 3081
598 Ga0495611_0034487 3300046648 Bacteria 2237
599 Ga0495625_0024361 3300046660 Bacteria 4608
600 Ga0495635_0000630 3300046663 Bacteria 22652
601 Ga0495635_0090831 3300046663 Bacteria 2089
602 Ga0495635_0239138 3300046663 Bacteria 1225
603 Ga0495635_0530005 3300046663 Bacteria 773
604 Ga0495661_0054646 3300046665 Bacteria 2396
605 Ga0495588_0001717 3300046674 Bacteria 9330
606 Ga0495588_0036196 3300046674 Bacteria 2503
607 Ga0495588_0049795 3300046674 Bacteria 2155
608 Ga0495588_0094696 3300046674 Bacteria 1566
609 Ga0495657_0000009 3300046675 Bacteria 217555
610 Ga0495657_0002765 3300046675 Bacteria 14612
611 Ga0495657_0042959 3300046675 Bacteria 3083
612 Ga0495657_0125148 3300046675 Bacteria 1615
613 Ga0495657_0155911 3300046675 Bacteria 1415
614 Ga0495657_0424292 3300046675 Bacteria 780
615 Ga0495599_0000084 3300046678 Bacteria 65440
616 Ga0495599_0003486 3300046678 Bacteria 9206
617 Ga0495599_0104641 3300046678 Bacteria 1763
618 Ga0495623_0000168 3300046679 Bacteria 40826
619 Ga0495623_0214693 3300046679 Bacteria 1099
620 Ga0495646_0000669 3300046680 Bacteria 18793
621 Ga0495646_0001071 3300046680 Bacteria 15889
622 Ga0495646_0048936 3300046680 Bacteria 2567
623 Ga0495647_0205450 3300046681 Bacteria 865
624 Ga0495658_0018437 3300046683 Bacteria 3629
625 Ga0495658_0328326 3300046683 Bacteria 970
626 Ga0495613_0005024 3300046689 Bacteria 9931
627 Ga0495613_0005879 3300046689 Bacteria 9182
628 Ga0495613_0045585 3300046689 Bacteria 3242
629 Ga0495613_0311478 3300046689 Bacteria 1088
630 Ga0495613_0459646 3300046689 Bacteria 861
631 Ga0495624_0085021 3300046690 Bacteria 1954
632 Ga0495670_0019746 3300046691 Bacteria 3321
633 Ga0495670_0026594 3300046691 Bacteria 2865
634 Ga0495671_0002799 3300046692 Bacteria 10913
635 Ga0495649_0089699 3300046694 Bacteria 1639
636 Ga0495589_0020293 3300046794 Bacteria 3399
637 Ga0495600_0002372 3300046809 Bacteria 10766
638 Ga0495600_0007557 3300046809 Bacteria 6655
639 Ga0495600_0012433 3300046809 Bacteria 5322
640 Ga0495600_0290851 3300046809 Bacteria 1032
641 Ga0495660_0044528 3300046810 Bacteria 2440
642 Ga0495581_0149944 3300047315 Bacteria 1361
643 Ga0495581_0242232 3300047315 Bacteria 1054
644 Ga0495604_0000070 3300047317 Bacteria 89500
645 Ga0495604_0000597 3300047317 Bacteria 31188
646 Ga0495604_0009513 3300047317 Bacteria 7682
647 Ga0495636_0015296 3300047318 Bacteria 3058
648 Ga0495636_0018570 3300047318 Bacteria 2791
649 Ga0495636_0039887 3300047318 Bacteria 1946
650 Ga0495674_0015461 3300047319 Bacteria 7132
651 Ga0495674_0238463 3300047319 Bacteria 1499
652 Ga0495674_0342338 3300047319 Bacteria 1215
653 Ga0495672_0078790 3300047320 Bacteria 1842
654 Ga0495676_0018161 3300047321 Bacteria 6203
655 Ga0495676_0019814 3300047321 Bacteria 5912
656 Ga0495676_0040776 3300047321 Bacteria 3828
657 Ga0495676_0128210 3300047321 Bacteria 1835
658 Ga0495680_0000195 3300047322 Bacteria 65440
659 Ga0495680_0045706 3300047322 Bacteria 3456
660 Ga0495680_0053938 3300047322 Bacteria 3124
661 Ga0495680_0236023 3300047322 Bacteria 1300
662 Ga0495683_0169752 3300047323 Bacteria 1003
663 Ga0495687_003104 3300047443 Bacteria 12436
664 Ga0495687_003604 3300047443 Bacteria 11080
665 Ga0495687_073098 3300047443 Bacteria 1367
666 Ga0495675_0001537 3300047444 Bacteria 13918
667 Ga0495675_0009811 3300047444 Bacteria 5970
668 Ga0495675_0019818 3300047444 Bacteria 4273
669 Ga0495675_0040590 3300047444 Bacteria 2965
670 Ga0495675_0182016 3300047444 Bacteria 1286
671 Ga0495675_0213267 3300047444 Bacteria 1171
672 Ga0495677_0100213 3300047445 Bacteria 1096
673 Ga0495679_056473 3300047446 Bacteria 1163
674 Ga0495685_017784 3300047447 Bacteria 2436
675 Ga0495681_0011323 3300047470 Bacteria 5319
676 Ga0495681_0022268 3300047470 Bacteria 3396
677 Ga0495684_0017015 3300047471 Bacteria 5601
678 Ga0495684_0034517 3300047471 Bacteria 3881
679 Ga0495684_0121735 3300047471 Bacteria 1965
680 Ga0495684_0425487 3300047471 Bacteria 927
681 Ga0495686_0010043 3300047472 Bacteria 6762
682 Ga0495686_0292582 3300047472 Bacteria 901
683 Ga0495593_0000502 3300047673 Bacteria 22126
684 Ga0495593_0266855 3300047673 Bacteria 857
685 Ga0495593_0383662 3300047673 Bacteria 703
686 Ga0495602_0000122 3300048088 Bacteria 73031
687 Ga0495602_0004911 3300048088 Bacteria 14001
688 Ga0495602_0057291 3300048088 Bacteria 3419
689 Ga0495602_0371960 3300048088 Bacteria 1026
690 Ga0495614_0003948 3300048089 Bacteria 6657
691 Ga0495614_0035603 3300048089 Bacteria 2138
692 Ga0495614_0199190 3300048089 Bacteria 905
693 Ga0496100_0014426 3300048903 Bacteria 4587
694 Ga0496100_0253288 3300048903 Bacteria 1303
695 Ga0496100_0287766 3300048903 Bacteria 1227
696 Ga0496100_0360466 3300048903 Bacteria 1100
697 Ga0496100_0525331 3300048903 Bacteria 914
698 Ga0496100_0719996 3300048903 Bacteria 779
699 Ga0496101_0080889 3300048904 Bacteria 2401
700 Ga0496101_0467164 3300048904 Bacteria 996
701 Ga0496102_0006584 3300048905 Bacteria 9922
702 Ga0496102_0018232 3300048905 Bacteria 6164
703 Ga0496102_0060479 3300048905 Bacteria 3464
704 Ga0496102_0127560 3300048905 Bacteria 2379
705 Ga0496102_0144484 3300048905 Bacteria 2232
706 Ga0496103_0090114 3300048906 Bacteria 1935
707 Ga0496104_0002900 3300048907 Bacteria 14772
708 Ga0496104_0196757 3300048907 Bacteria 1928
709 Ga0496104_0235405 3300048907 Bacteria 1743
710 Ga0496104_0255440 3300048907 Bacteria 1665
711 Ga0496105_0022958 3300048908 Bacteria 5058
712 Ga0496105_0053757 3300048908 Bacteria 3326
713 Ga0496105_0174319 3300048908 Bacteria 1762
714 Ga0496105_0230839 3300048908 Bacteria 1504
715 Ga0496106_0098630 3300048909 Bacteria 2264
716 Ga0496106_0279844 3300048909 Bacteria 1336
717 Ga0496107_0039192 3300048910 Bacteria 3399
718 Ga0496107_0125469 3300048910 Bacteria 1893
719 Ga0496107_0350441 3300048910 Bacteria 1099
720 Ga0496108_0001829 3300048911 Bacteria 16995
721 Ga0496108_0160244 3300048911 Bacteria 1944
722 Ga0496108_0169104 3300048911 Bacteria 1891
723 Ga0496108_0591079 3300048911 Bacteria 967
724 Ga0496109_0005390 3300048912 Bacteria 10696
725 Ga0496109_0021188 3300048912 Bacteria 5746
726 Ga0496109_0161070 3300048912 Bacteria 2102
727 Ga0496109_0209303 3300048912 Bacteria 1834
728 Ga0496109_0279195 3300048912 Bacteria 1574
729 Ga0496109_0371042 3300048912 Bacteria 1352
730 Ga0496109_0404815 3300048912 Bacteria 1289
731 Ga0496110_0002280 3300048913 Bacteria 14327
732 Ga0496110_0042628 3300048913 Bacteria 3961
733 Ga0496110_0059109 3300048913 Bacteria 3378
734 Ga0496110_0077325 3300048913 Bacteria 2960
735 Ga0496110_0143092 3300048913 Bacteria 2162
736 Ga0496110_0444023 3300048913 Bacteria 1182
737 Ga0496111_0029689 3300048914 Bacteria 3884
738 Ga0496111_0068214 3300048914 Bacteria 2584
739 Ga0496111_0110152 3300048914 Bacteria 2028
740 Ga0496111_0342579 3300048914 Bacteria 1106
741 Ga0496112_0015530 3300048915 Bacteria 7111
742 Ga0496112_0192418 3300048915 Bacteria 2001
743 Ga0496114_0002623 3300048917 Bacteria 13721
744 Ga0496114_0039618 3300048917 Bacteria 3899
745 Ga0496114_0061330 3300048917 Bacteria 3145
746 Ga0496114_0104067 3300048917 Bacteria 2427
747 Ga0496114_0137371 3300048917 Bacteria 2114
748 Ga0496114_0271830 3300048917 Bacteria 1493
749 Ga0496114_0304162 3300048917 Bacteria 1408
750 Ga0496114_0382720 3300048917 Bacteria 1246
751 Ga0496114_0735411 3300048917 Bacteria 863
752 Ga0496114_0752771 3300048917 Bacteria 852
753 Ga0496115_0034174 3300048918 Bacteria 4018
754 Ga0496115_0126115 3300048918 Bacteria 2109
755 Ga0496115_0173083 3300048918 Bacteria 1785
756 Ga0496119_0014576 3300048922 Bacteria 6134
757 Ga0496122_0000427 3300048925 Bacteria 88913
758 Ga0496122_0001313 3300048925 Bacteria 40783
759 Ga0496123_0001011 3300048926 Bacteria 42966
760 Ga0496124_0002673 3300048927 Bacteria 22841
761 Ga0496125_0000224 3300048928 Bacteria 115811
762 Ga0496126_0018319 3300048929 Bacteria 6944
763 Ga0495682_0007362 3300049460 Bacteria 4387
764 Ga0501311_037554 3300049527 Bacteria 724
765 Ga0501031_0001184 3300049568 Bacteria 15874
766 Ga0501031_0035365 3300049568 Bacteria 3258
767 Ga0501031_0038291 3300049568 Bacteria 3130
768 Ga0501031_0167370 3300049568 Bacteria 1436
769 Ga0501032_0009955 3300049569 Bacteria 6865
770 Ga0501032_0029677 3300049569 Bacteria 3751
771 Ga0501032_0045823 3300049569 Bacteria 2956
772 Ga0501033_0037030 3300049570 Bacteria 3653
773 Ga0501033_0040853 3300049570 Bacteria 3462
774 Ga0501033_0467233 3300049570 Bacteria 875
775 Ga0501034_0017666 3300049571 Bacteria 7314
776 Ga0501034_0025134 3300049571 Bacteria 6062
777 Ga0501034_0974355 3300049571 Bacteria 733
778 Ga0501036_0003151 3300049572 Bacteria 13156
779 Ga0501036_0016460 3300049572 Bacteria 6176
780 Ga0501036_0072511 3300049572 Bacteria 2911
781 Ga0501036_0573998 3300049572 Bacteria 937
782 Ga0501036_0738665 3300049572 Bacteria 812
783 Ga0501037_0001542 3300049573 Bacteria 16807
784 Ga0501037_0077424 3300049573 Bacteria 2413
785 Ga0501037_0311926 3300049573 Bacteria 1090
786 Ga0501038_0006359 3300049574 Bacteria 10933
787 Ga0501038_0013850 3300049574 Bacteria 7349
788 Ga0501038_0027453 3300049574 Bacteria 5064
789 Ga0501038_0060824 3300049574 Bacteria 3232
790 Ga0501038_0296849 3300049574 Bacteria 1269
791 Ga0501038_0631517 3300049574 Bacteria 808
792 Ga0501039_0060759 3300049575 Bacteria 2926
793 Ga0501039_0066115 3300049575 Bacteria 2806
794 Ga0501039_0095713 3300049575 Bacteria 2315
795 Ga0501039_0119059 3300049575 Bacteria 2068
796 Ga0501039_0197241 3300049575 Bacteria 1583
797 Ga0501039_0264249 3300049575 Bacteria 1352
798 Ga0501039_0325856 3300049575 Bacteria 1207
799 Ga0501040_0001769 3300049576 Bacteria 13881
800 Ga0501040_0373067 3300049576 Bacteria 1023
801 Ga0501041_0033268 3300049577 Bacteria 3118
802 Ga0501041_0116836 3300049577 Bacteria 1657
803 Ga0501041_0199410 3300049577 Bacteria 1254
804 Ga0501042_0002229 3300049578 Bacteria 11834
805 Ga0501042_0022572 3300049578 Bacteria 4397
806 Ga0501042_0025478 3300049578 Bacteria 4155
807 Ga0501042_0199680 3300049578 Bacteria 1442
808 Ga0501043_0186935 3300049579 Bacteria 1612
809 Ga0501043_0621674 3300049579 Bacteria 796
810 Ga0501046_0008898 3300049580 Bacteria 8715
811 Ga0501046_0096852 3300049580 Bacteria 2266
812 Ga0501047_0067949 3300049581 Bacteria 3433
813 Ga0501047_0180795 3300049581 Bacteria 1975
814 Ga0501047_0633149 3300049581 Bacteria 890
815 Ga0501048_0002457 3300049582 Bacteria 14135
816 Ga0501048_0013393 3300049582 Bacteria 6086
817 Ga0501048_0459223 3300049582 Bacteria 912
818 Ga0501048_0479940 3300049582 Bacteria 891
819 Ga0501067_0011575 3300049583 Bacteria 4887
820 Ga0501067_0013348 3300049583 Bacteria 4549
821 Ga0501067_0037804 3300049583 Bacteria 2681
822 Ga0501067_0271487 3300049583 Bacteria 944
823 Ga0501068_0017893 3300049584 Bacteria 4103
824 Ga0501069_0002848 3300049585 Bacteria 8858
825 Ga0501069_0069242 3300049585 Bacteria 1976
826 Ga0501069_0100181 3300049585 Bacteria 1644
827 Ga0501070_0001688 3300049586 Bacteria 19572
828 Ga0501070_0002568 3300049586 Bacteria 15892
829 Ga0501070_0294168 3300049586 Bacteria 1323
830 Ga0501071_0000242 3300049587 Bacteria 25216
831 Ga0501071_0049006 3300049587 Bacteria 3040
832 Ga0501071_0290036 3300049587 Bacteria 1239
833 Ga0501072_0139940 3300049588 Bacteria 1929
834 Ga0501073_0040926 3300049589 Bacteria 3276
835 Ga0501074_0000467 3300049590 Bacteria 24425
836 Ga0501074_0006376 3300049590 Bacteria 8517
837 Ga0501075_0001324 3300049591 Bacteria 16072
838 Ga0501076_0003324 3300049592 Bacteria 11279
839 Ga0501076_0385447 3300049592 Bacteria 1152
840 Ga0501076_0657676 3300049592 Bacteria 865
841 Ga0501077_0016615 3300049593 Bacteria 4638
842 Ga0501077_0284487 3300049593 Bacteria 1053
843 Ga0501077_0324691 3300049593 Bacteria 981
844 Ga0501079_0000775 3300049741 Bacteria 21903
845 Ga0501079_0001427 3300049741 Bacteria 16880
846 Ga0501079_0261470 3300049741 Bacteria 1353
847 Ga0501080_0000216 3300049742 Bacteria 42846
848 Ga0501080_0001308 3300049742 Bacteria 20742
849 Ga0501080_0012152 3300049742 Bacteria 7890
850 Ga0501080_0177105 3300049742 Bacteria 1964
851 Ga0501282_006660 3300049778 Bacteria 1235
852 Ga0501035_0014210 3300049822 Bacteria 7348
853 Ga0501035_0062968 3300049822 Bacteria 3299
854 Ga0501044_0024328 3300049823 Bacteria 6432
855 Ga0501044_0025847 3300049823 Bacteria 6224
856 Ga0501044_0042064 3300049823 Bacteria 4755
857 Ga0501044_0061626 3300049823 Bacteria 3837
858 Ga0501044_0364985 3300049823 Bacteria 1361
859 Ga0501045_0120494 3300049824 Bacteria 1948
860 Ga0501045_0600989 3300049824 Bacteria 814
861 nmdc:mga00v17_109896_c1 3300050491 Bacteria 1748
862 nmdc:mga04h51_13427_c1 3300050495 Bacteria 2318
863 nmdc:mga05p37_2183_c1 3300050507 Bacteria 20557
864 nmdc:mga05p37_573_c1 3300050507 Bacteria 40363
865 nmdc:mga09592_115689_c1 3300050508 Bacteria 2302
866 nmdc:mga09592_227_c1 3300050508 Bacteria 40641
867 nmdc:mga0qj67_14713_c1 3300050509 Bacteria 5916
868 nmdc:mga0qj67_22215_c1 3300050509 Bacteria 4873
869 nmdc:mga06r32_6575_c1 3300050510 Bacteria 10443
870 nmdc:mga06r32_83_c1 3300050510 Bacteria 64174
871 nmdc:mga08y16_1700_c1 3300050511 Bacteria 22309
872 nmdc:mga08y16_289193_c1 3300050511 Bacteria 1690
873 nmdc:mga0n895_337582_c1 3300050512 Bacteria 1526
874 nmdc:mga0n895_679369_c1 3300050512 Bacteria 1027
875 Ga0495601_0010947 3300053077 Bacteria 5415
876 Ga0495595_0000288 3300053084 Bacteria 19645
877 Ga0495619_0132905 3300053085 Bacteria 1710
878 Ga0500644_0074958 3300053088 Bacteria 1229
879 Ga0500644_0106263 3300053088 Bacteria 1074
880 Ga0500644_0244546 3300053088 Bacteria 755
881 Ga0500583_0124604 3300053092 Bacteria 1276
882 Ga0500640_004946 3300053095 Bacteria 4904
883 Ga0500650_0288150 3300053098 Bacteria 729
884 Ga0500593_006236 3300053117 Bacteria 4759
885 Ga0500628_090127 3300053129 Bacteria 798
886 Ga0500577_0051165 3300053142 Bacteria 1552
887 Ga0500577_0085207 3300053142 Bacteria 1267
888 Ga0500586_126805 3300053145 Bacteria 886
889 Ga0500600_0096129 3300053149 Bacteria 1572
890 Ga0500624_002937 3300053157 Bacteria 2253
891 Ga0501084_0008293 3300054114 Bacteria 8572
892 Ga0501084_0259444 3300054114 Bacteria 1467
893 Ga0501082_0008844 3300060353 Bacteria 8686
894 Ga0466962_0006460 3300061719 Bacteria 5627
895 Ga0466962_0024932 3300061719 Bacteria 2871
896 Ga0530510_0001746 3300061734 Bacteria 14819

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009148 Ga0105243_10771183 Ga0105243_107711831 207
2 3300017792 Ga0163161_10148043 Ga0163161_101480432 207
3 iso_pu_bacteria 2775506925 2776370631 209
4 3300044658 Ga0466972_0177323 Ga0466972_0177323_12_647 210
5 3300045976 Ga0466967_0707106 Ga0466967_0707106_339_974 210
6 3300046453 Ga0495627_032214 Ga0495627_032214_944_1579 211
7 3300049823 Ga0501044_0025847 Ga0501044_0025847_485_1186 214
8 3300049578 Ga0501042_0199680 Ga0501042_0199680_777_1424 215
9 iso_pu_bacteria 2643221567 2643851560 216
10 iso_pu_bacteria 2643221624 2644137850 216
11 iso_pu_bacteria 2643221690 2644505476 216
12 iso_pu_bacteria 2643221694 2644524725 216
13 iso_pu_bacteria 2643221722 2644668813 216
14 3300039437 Ga0436365_0351909 Ga0436365_0351909_709_1365 217
15 3300039453 Ga0436362_1280188 Ga0436362_1280188_40154_40810 217
16 iso_pu_bacteria 2808606365 2808872634 217
17 3300031727 Ga0316576_10012619 Ga0316576_100126193 219
18 3300031727 Ga0316576_10016994 Ga0316576_100169943 219
19 3300031728 Ga0316578_10014913 Ga0316578_100149136 219
20 3300031728 Ga0316578_10172700 Ga0316578_101727001 219
21 3300041407 Ga0439447_063540 Ga0439447_063540_94_771 219
22 iso_pu_bacteria 2558860280 2559427661 219
23 iso_pu_bacteria 2565956761 2566994951 219
24 iso_pu_bacteria 2582580736 2583151914 219
25 iso_pu_bacteria 2585427649 2586065217 219
26 iso_pu_bacteria 2738541308 2738890883 219
27 iso_pu_bacteria 2738543005 2739206952 219
28 iso_pu_bacteria 2738543011 2739238882 219
29 iso_pu_bacteria 2738543034 2739362645 219
30 iso_pu_bacteria 2744054611 2744955530 219
31 iso_pu_bacteria 2791354901 2791913765 219
32 iso_pu_bacteria 2795385472 2795793891 219
33 iso_pu_bacteria 2808606522 2809593612 219
34 iso_pu_bacteria 2816332139 2816506091 219
35 iso_pu_bacteria 2842888712 2842889637 219
36 iso_pu_bacteria 2863067949 2863069530 219
37 iso_pu_bacteria 2866552031 2866553301 219
38 iso_pu_bacteria 2866612099 2866612439 219
39 iso_pu_bacteria 2889300758 2889303992 219
40 iso_pu_bacteria 2891326441 2891328384 219
41 iso_pu_bacteria 2899359706 2899362328 219
42 iso_pu_bacteria 2899370129 2899373033 219
43 iso_pu_bacteria 2904535858 2904535900 219
44 iso_pu_bacteria 2904765812 2904768033 219
45 iso_pu_bacteria 2904770941 2904774131 219
46 iso_pu_bacteria 2908811453 2908815334 219
47 iso_pu_bacteria 2915358134 2915363887 219
48 iso_pu_bacteria 2915768154 2915776006 219
49 iso_pu_bacteria 2917736166 2917739187 219
50 iso_pu_bacteria 2919420072 2919423536 219
51 iso_pu_bacteria 2919432681 2919436144 219
52 iso_pu_bacteria 2922554459 2922556064 219
53 iso_pu_bacteria 2928142448 2928146682 219
54 iso_pu_bacteria 2939743619 2939745614 219
55 iso_pu_bacteria 2956939328 2956940797 219
56 iso_pu_bacteria 2974315732 2974319512 219
57 iso_pu_bacteria 2984523437 2984527718 219
58 iso_pu_bacteria 3001119090 3001120487 219
59 iso_pu_bacteria 8003314358 8003315287 219
60 iso_pu_bacteria 8056207758 8056214954 219
61 3300005347 Ga0070668_100415862 Ga0070668_1004158622 220
62 3300005456 Ga0070678_100791199 Ga0070678_1007911991 220
63 3300005543 Ga0070672_100373031 Ga0070672_1003730312 220
64 3300006038 Ga0075365_10340947 Ga0075365_103409472 220
65 3300025972 Ga0207668_10274803 Ga0207668_102748032 220
66 3300026089 Ga0207648_10269220 Ga0207648_102692202 220
67 3300031995 Ga0307409_100461832 Ga0307409_1004618322 220
68 iso_pu_bacteria 2515154155 2515855460 220
69 iso_pu_bacteria 2554235005 2554257133 220
70 iso_pu_bacteria 2582581312 2585297952 220
71 iso_pu_bacteria 2582581314 2585312995 220
72 iso_pu_bacteria 2616644814 2616702948 220
73 iso_pu_bacteria 2616644941 2616903703 220
74 iso_pu_bacteria 2643221548 2643763414 220
75 iso_pu_bacteria 2643221578 2643900607 220
76 iso_pu_bacteria 2643221673 2644405172 220
77 iso_pu_bacteria 2643221682 2644463716 220
78 iso_pu_bacteria 2675903058 2676474303 220
79 iso_pu_bacteria 2818991463 2819698202 220
80 iso_pu_bacteria 2827628540 2827633228 220
81 iso_pu_bacteria 2862290372 2862294538 220
82 iso_pu_bacteria 2867346516 2867348658 220
83 iso_pu_bacteria 2873151551 2873155053 220
84 iso_pu_bacteria 2875391855 2875394762 220
85 iso_pu_bacteria 2946045630 2946049084 220
86 iso_pu_bacteria 2954002825 2954006230 220
87 iso_pu_bacteria 2966598605 2966602396 220
88 iso_pu_bacteria 3006321560 3006325266 220
89 iso_pu_bacteria 3006425503 3006425597 220
90 iso_pu_bacteria 3006486233 3006492749 220
91 3300002067 JGI24735J21928_10045086 JGI24735J21928_100450861 221
92 3300005535 Ga0070684_100305937 Ga0070684_1003059371 221
93 3300005577 Ga0068857_100040943 Ga0068857_1000409432 221
94 3300020070 Ga0206356_11268019 Ga0206356_112680192 221
95 3300020082 Ga0206353_10607554 Ga0206353_106075542 221
96 3300025921 Ga0207652_10209407 Ga0207652_102094071 221
97 3300026116 Ga0207674_10154769 Ga0207674_101547692 221
98 3300031548 Ga0307408_100082526 Ga0307408_1000825263 221
99 3300031665 Ga0316575_10003903 Ga0316575_100039034 221
100 3300031691 Ga0316579_10002822 Ga0316579_100028225 221
101 3300031691 Ga0316579_10149533 Ga0316579_101495331 221
102 3300031727 Ga0316576_10039027 Ga0316576_100390273 221
103 3300031727 Ga0316576_10065340 Ga0316576_100653403 221
104 3300031728 Ga0316578_10000741 Ga0316578_100007419 221
105 3300031728 Ga0316578_10015115 Ga0316578_100151154 221
106 3300031731 Ga0307405_10147862 Ga0307405_101478622 221
107 3300031733 Ga0316577_10032277 Ga0316577_100322773 221
108 3300031733 Ga0316577_10055135 Ga0316577_100551352 221
109 3300031901 Ga0307406_10074511 Ga0307406_100745113 221
110 3300031903 Ga0307407_10061635 Ga0307407_100616352 221
111 3300031911 Ga0307412_10005135 Ga0307412_100051352 221
112 3300031995 Ga0307409_100003830 Ga0307409_1000038308 221
113 3300032002 Ga0307416_100075345 Ga0307416_1000753453 221
114 3300032005 Ga0307411_10087017 Ga0307411_100870173 221
115 3300032133 Ga0316583_10037593 Ga0316583_100375932 221
116 3300032137 Ga0316585_10009368 Ga0316585_100093683 221
117 3300032139 Ga0316580_10016251 Ga0316580_100162512 221
118 3300032139 Ga0316580_10023382 Ga0316580_100233822 221
119 iso_pu_bacteria 2643221613 2644080956 221
120 iso_pu_bacteria 2643221641 2644232095 221
121 iso_pu_bacteria 2643221721 2644663727 221
122 iso_pu_bacteria 2738543027 2739325721 221
123 iso_pu_bacteria 2739367654 2739608422 221
124 iso_pu_bacteria 2739367898 2740168540 221
125 iso_pu_bacteria 2758568522 2760305775 221
126 iso_pu_bacteria 2758568621 2760625715 221
127 iso_pu_bacteria 2784132109 2784473277 221
128 iso_pu_bacteria 2808606394 2809030746 221
129 iso_pu_bacteria 2811994880 2812363819 221
130 iso_pu_bacteria 2839986021 2839986682 221
131 iso_pu_bacteria 2857479173 2857480702 221
132 iso_pu_bacteria 2857481737 2857484936 221
133 iso_pu_bacteria 2857632687 2857634016 221
134 iso_pu_bacteria 2868088558 2868091495 221
135 iso_pu_bacteria 2870801768 2870801806 221
136 iso_pu_bacteria 2870804320 2870806199 221
137 iso_pu_bacteria 2884994152 2884997031 221
138 iso_pu_bacteria 2919446982 2919448945 221
139 iso_pu_bacteria 2932431166 2932434554 221
140 iso_pu_bacteria 2935890801 2935892454 221
141 iso_pu_bacteria 2984576629 2984577735 221
142 iso_pu_bacteria 2990256926 2990260566 221
143 iso_pu_bacteria 8054609563 8054614037 221
144 iso_pu_bacteria 8056579771 8056584674 221
145 iso_pu_bacteria 2835188231 2835189873 222
146 3300005327 Ga0070658_10160210 Ga0070658_101602103 223
147 3300005327 Ga0070658_10304334 Ga0070658_103043342 223
148 3300005328 Ga0070676_10343869 Ga0070676_103438691 223
149 3300005329 Ga0070683_100129855 Ga0070683_1001298552 223
150 3300005329 Ga0070683_100489581 Ga0070683_1004895812 223
151 3300005334 Ga0068869_100087253 Ga0068869_1000872532 223
152 3300005337 Ga0070682_100073395 Ga0070682_1000733954 223
153 3300005337 Ga0070682_100113663 Ga0070682_1001136632 223
154 3300005337 Ga0070682_100178411 Ga0070682_1001784111 223
155 3300005337 Ga0070682_100246469 Ga0070682_1002464691 223
156 3300005338 Ga0068868_100162580 Ga0068868_1001625802 223
157 3300005339 Ga0070660_100110009 Ga0070660_1001100092 223
158 3300005340 Ga0070689_100200667 Ga0070689_1002006672 223
159 3300005347 Ga0070668_100000514 Ga0070668_10000051425 223
160 3300005347 Ga0070668_100049408 Ga0070668_1000494083 223
161 3300005347 Ga0070668_100172248 Ga0070668_1001722482 223
162 3300005354 Ga0070675_100227892 Ga0070675_1002278922 223
163 3300005356 Ga0070674_100039819 Ga0070674_1000398193 223
164 3300005366 Ga0070659_100278770 Ga0070659_1002787702 223
165 3300005435 Ga0070714_100011321 Ga0070714_1000113216 223
166 3300005436 Ga0070713_100094562 Ga0070713_1000945622 223
167 3300005441 Ga0070700_100103323 Ga0070700_1001033232 223
168 3300005455 Ga0070663_100002651 Ga0070663_10000265111 223
169 3300005455 Ga0070663_100080066 Ga0070663_1000800662 223
170 3300005455 Ga0070663_100146243 Ga0070663_1001462431 223
171 3300005456 Ga0070678_100129245 Ga0070678_1001292453 223
172 3300005456 Ga0070678_100304768 Ga0070678_1003047682 223
173 3300005466 Ga0070685_10132433 Ga0070685_101324332 223
174 3300005543 Ga0070672_100372232 Ga0070672_1003722322 223
175 3300005548 Ga0070665_100134978 Ga0070665_1001349782 223
176 3300005548 Ga0070665_100234266 Ga0070665_1002342662 223
177 3300005548 Ga0070665_100312848 Ga0070665_1003128483 223
178 3300005564 Ga0070664_100141426 Ga0070664_1001414262 223
179 3300005564 Ga0070664_100375235 Ga0070664_1003752352 223
180 3300005577 Ga0068857_100140524 Ga0068857_1001405242 223
181 3300005577 Ga0068857_100192116 Ga0068857_1001921162 223
182 3300005578 Ga0068854_100164222 Ga0068854_1001642222 223
183 3300005614 Ga0068856_100484710 Ga0068856_1004847102 223
184 3300005615 Ga0070702_100167662 Ga0070702_1001676621 223
185 3300005616 Ga0068852_100227264 Ga0068852_1002272643 223
186 3300005616 Ga0068852_100262894 Ga0068852_1002628942 223
187 3300005617 Ga0068859_100210674 Ga0068859_1002106742 223
188 3300005618 Ga0068864_100352644 Ga0068864_1003526442 223
189 3300005719 Ga0068861_100053493 Ga0068861_1000534933 223
190 3300005840 Ga0068870_10042549 Ga0068870_100425492 223
191 3300005841 Ga0068863_100249115 Ga0068863_1002491153 223
192 3300005842 Ga0068858_100590881 Ga0068858_1005908812 223
193 3300005985 Ga0081539_10000027 Ga0081539_10000027283 223
194 3300006931 Ga0097620_100210674 Ga0097620_1002106742 223
195 3300009094 Ga0111539_10360620 Ga0111539_103606202 223
196 3300009094 Ga0111539_10589772 Ga0111539_105897721 223
197 3300009098 Ga0105245_10198585 Ga0105245_101985852 223
198 3300009098 Ga0105245_10334667 Ga0105245_103346672 223
199 3300009148 Ga0105243_10001133 Ga0105243_100011338 223
200 3300009148 Ga0105243_10168242 Ga0105243_101682421 223
201 3300009148 Ga0105243_10625379 Ga0105243_106253791 223
202 3300009545 Ga0105237_10520597 Ga0105237_105205971 223
203 3300009988 Ga0105035_101768 Ga0105035_1017681 223
204 3300010375 Ga0105239_10477382 Ga0105239_104773821 223
205 3300012492 Ga0157335_1004266 Ga0157335_10042662 223
206 3300013102 Ga0157371_10206178 Ga0157371_102061782 223
207 3300013296 Ga0157374_10332018 Ga0157374_103320183 223
208 3300013306 Ga0163162_10145893 Ga0163162_101458932 223
209 3300013307 Ga0157372_10286793 Ga0157372_102867932 223
210 3300013308 Ga0157375_10548643 Ga0157375_105486432 223
211 3300014325 Ga0163163_10419864 Ga0163163_104198642 223
212 3300014745 Ga0157377_10023060 Ga0157377_100230602 223
213 3300014968 Ga0157379_10180503 Ga0157379_101805032 223
214 3300020070 Ga0206356_10804711 Ga0206356_108047111 223
215 3300020082 Ga0206353_10235487 Ga0206353_102354871 223
216 3300021384 Ga0213876_10017812 Ga0213876_100178126 223
217 3300021388 Ga0213875_10000221 Ga0213875_1000022125 223
218 3300021388 Ga0213875_10014027 Ga0213875_100140274 223
219 3300022467 Ga0224712_10071847 Ga0224712_100718472 223
220 3300022467 Ga0224712_10116778 Ga0224712_101167782 223
221 3300022467 Ga0224712_10262238 Ga0224712_102622381 223
222 3300025321 Ga0207656_10019393 Ga0207656_100193934 223
223 3300025899 Ga0207642_10420788 Ga0207642_104207881 223
224 3300025900 Ga0207710_10012332 Ga0207710_100123324 223
225 3300025901 Ga0207688_10004602 Ga0207688_100046025 223
226 3300025901 Ga0207688_10085157 Ga0207688_100851572 223
227 3300025904 Ga0207647_10171646 Ga0207647_101716462 223
228 3300025907 Ga0207645_10014867 Ga0207645_100148675 223
229 3300025908 Ga0207643_10013050 Ga0207643_100130502 223
230 3300025909 Ga0207705_10291805 Ga0207705_102918052 223
231 3300025914 Ga0207671_10176266 Ga0207671_101762663 223
232 3300025916 Ga0207663_10430692 Ga0207663_104306922 223
233 3300025919 Ga0207657_10188967 Ga0207657_101889672 223
234 3300025919 Ga0207657_10253310 Ga0207657_102533101 223
235 3300025928 Ga0207700_10077540 Ga0207700_100775403 223
236 3300025929 Ga0207664_10008962 Ga0207664_100089623 223
237 3300025933 Ga0207706_10070653 Ga0207706_100706532 223
238 3300025935 Ga0207709_10000356 Ga0207709_1000035642 223
239 3300025935 Ga0207709_10326808 Ga0207709_103268082 223
240 3300025937 Ga0207669_10158319 Ga0207669_101583192 223
241 3300025938 Ga0207704_10502727 Ga0207704_105027271 223
242 3300025940 Ga0207691_10271255 Ga0207691_102712552 223
243 3300025942 Ga0207689_10065444 Ga0207689_100654443 223
244 3300025942 Ga0207689_10385003 Ga0207689_103850032 223
245 3300025944 Ga0207661_10068915 Ga0207661_100689153 223
246 3300025944 Ga0207661_10409640 Ga0207661_104096402 223
247 3300025944 Ga0207661_10653496 Ga0207661_106534961 223
248 3300025945 Ga0207679_11013228 Ga0207679_110132281 223
249 3300025960 Ga0207651_10048409 Ga0207651_100484093 223
250 3300025972 Ga0207668_10012757 Ga0207668_100127571 223
251 3300025972 Ga0207668_10072336 Ga0207668_100723362 223
252 3300025972 Ga0207668_10102057 Ga0207668_101020571 223
253 3300025986 Ga0207658_10456665 Ga0207658_104566652 223
254 3300026035 Ga0207703_10186182 Ga0207703_101861822 223
255 3300026067 Ga0207678_10000054 Ga0207678_1000005436 223
256 3300026067 Ga0207678_10023227 Ga0207678_100232276 223
257 3300026067 Ga0207678_10273051 Ga0207678_102730512 223
258 3300026075 Ga0207708_10227548 Ga0207708_102275482 223
259 3300026078 Ga0207702_11303495 Ga0207702_113034951 223
260 3300026095 Ga0207676_10334276 Ga0207676_103342762 223
261 3300026116 Ga0207674_10081024 Ga0207674_100810242 223
262 3300026116 Ga0207674_10458407 Ga0207674_104584072 223
263 3300026118 Ga0207675_100007887 Ga0207675_10000788710 223
264 3300026118 Ga0207675_100049410 Ga0207675_1000494103 223
265 3300026121 Ga0207683_10033184 Ga0207683_100331843 223
266 3300026121 Ga0207683_10309154 Ga0207683_103091541 223
267 3300026142 Ga0207698_10247702 Ga0207698_102477022 223
268 3300028379 Ga0268266_10074264 Ga0268266_100742642 223
269 3300028379 Ga0268266_10278754 Ga0268266_102787542 223
270 3300028380 Ga0268265_10044138 Ga0268265_100441383 223
271 3300028380 Ga0268265_10469893 Ga0268265_104698931 223
272 3300028381 Ga0268264_10154211 Ga0268264_101542113 223
273 3300028794 Ga0307515_10045822 Ga0307515_100458226 223
274 3300028794 Ga0307515_10271020 Ga0307515_102710202 223
275 3300030521 Ga0307511_10161577 Ga0307511_101615772 223
276 3300030522 Ga0307512_10013770 Ga0307512_100137703 223
277 3300031456 Ga0307513_10239286 Ga0307513_102392862 223
278 3300031824 Ga0307413_10003445 Ga0307413_100034457 223
279 3300031838 Ga0307518_10000115 Ga0307518_1000011525 223
280 3300031838 Ga0307518_10184982 Ga0307518_101849822 223
281 3300031852 Ga0307410_10035741 Ga0307410_100357413 223
282 3300032002 Ga0307416_100442747 Ga0307416_1004427471 223
283 3300032005 Ga0307411_10738936 Ga0307411_107389361 223
284 3300032126 Ga0307415_100042790 Ga0307415_1000427902 223
285 3300033179 Ga0307507_10038539 Ga0307507_100385396 223
286 3300033180 Ga0307510_10066364 Ga0307510_100663641 223
287 3300036401 Ga0373937_1045922 Ga0373937_1045922_74_748 223
288 3300037853 Ga0436364_0109597 Ga0436364_0109597_28107_28781 223
289 3300037853 Ga0436364_1145828 Ga0436364_1145828_7698_8372 223
290 3300044684 Ga0466966_0039876 Ga0466966_0039876_2003_2677 223
291 3300044693 Ga0466961_0160398 Ga0466961_0160398_49_723 223
292 3300044719 Ga0466971_0099501 Ga0466971_0099501_593_1267 223
293 3300044735 Ga0466968_0000536 Ga0466968_0000536_3770_4444 223
294 3300044842 Ga0466957_0040748 Ga0466957_0040748_49_723 223
295 3300045049 Ga0466959_0263705 Ga0466959_0263705_80_754 223
296 3300045836 Ga0466958_0001933 Ga0466958_0001933_7469_8143 223
297 3300045976 Ga0466967_0000897 Ga0466967_0000897_9900_10574 223
298 3300045976 Ga0466967_1220170 Ga0466967_1220170_11_685 223
299 3300048903 Ga0496100_0287766 Ga0496100_0287766_431_1105 223
300 3300048907 Ga0496104_0196757 Ga0496104_0196757_245_919 223
301 3300048911 Ga0496108_0169104 Ga0496108_0169104_351_1025 223
302 3300048911 Ga0496108_0591079 Ga0496108_0591079_29_703 223
303 3300048913 Ga0496110_0059109 Ga0496110_0059109_479_1153 223
304 3300048913 Ga0496110_0143092 Ga0496110_0143092_1262_1936 223
305 3300048914 Ga0496111_0110152 Ga0496111_0110152_1135_1809 223
306 3300049571 Ga0501034_0974355 Ga0501034_0974355_42_716 223
307 3300049581 Ga0501047_0633149 Ga0501047_0633149_172_846 223
308 3300050511 nmdc:mga08y16_289193_c1 nmdc:mga08y16_289193_c1_607_1281 223
309 3300053088 Ga0500644_0074958 Ga0500644_0074958_351_1025 223
310 3300053088 Ga0500644_0244546 Ga0500644_0244546_39_713 223
311 3300053142 Ga0500577_0051165 Ga0500577_0051165_586_1260 223
312 3300003354 JGI25160J50197_1042269 JGI25160J50197_10422691 224
313 3300003578 Ga0006562J51391_1046570 Ga0006562J51391_10465701 224
314 3300005327 Ga0070658_10005717 Ga0070658_100057173 224
315 3300005327 Ga0070658_10059768 Ga0070658_100597682 224
316 3300005336 Ga0070680_100001364 Ga0070680_1000013646 224
317 3300005336 Ga0070680_100036721 Ga0070680_1000367212 224
318 3300005336 Ga0070680_100040970 Ga0070680_1000409702 224
319 3300005336 Ga0070680_100058618 Ga0070680_1000586184 224
320 3300005458 Ga0070681_10000699 Ga0070681_100006997 224
321 3300005458 Ga0070681_10002094 Ga0070681_100020942 224
322 3300005458 Ga0070681_10270654 Ga0070681_102706542 224
323 3300005530 Ga0070679_100000016 Ga0070679_10000001626 224
324 3300005530 Ga0070679_100005127 Ga0070679_1000051272 224
325 3300005530 Ga0070679_100217893 Ga0070679_1002178932 224
326 3300005530 Ga0070679_100277455 Ga0070679_1002774552 224
327 3300005535 Ga0070684_100003966 Ga0070684_10000396614 224
328 3300005539 Ga0068853_100025230 Ga0068853_1000252304 224
329 3300005548 Ga0070665_101288685 Ga0070665_1012886851 224
330 3300005616 Ga0068852_100121073 Ga0068852_1001210732 224
331 3300006178 Ga0075367_10134435 Ga0075367_101344352 224
332 3300009093 Ga0105240_10615507 Ga0105240_106155072 224
333 3300009176 Ga0105242_10056290 Ga0105242_100562904 224
334 3300009177 Ga0105248_10361691 Ga0105248_103616912 224
335 3300009545 Ga0105237_10087968 Ga0105237_100879683 224
336 3300011119 Ga0105246_10037244 Ga0105246_100372444 224
337 3300013105 Ga0157369_10266986 Ga0157369_102669862 224
338 3300014326 Ga0157380_10444440 Ga0157380_104444402 224
339 3300020070 Ga0206356_10146858 Ga0206356_101468582 224
340 3300021384 Ga0213876_10001520 Ga0213876_100015205 224
341 3300021388 Ga0213875_10009789 Ga0213875_100097894 224
342 3300025297 Ga0209758_1010962 Ga0209758_10109622 224
343 3300025909 Ga0207705_10000470 Ga0207705_1000047028 224
344 3300025909 Ga0207705_10539733 Ga0207705_105397331 224
345 3300025912 Ga0207707_10000185 Ga0207707_100001857 224
346 3300025912 Ga0207707_10572160 Ga0207707_105721601 224
347 3300025914 Ga0207671_10345493 Ga0207671_103454932 224
348 3300025917 Ga0207660_10007057 Ga0207660_100070576 224
349 3300025917 Ga0207660_10043218 Ga0207660_100432184 224
350 3300025917 Ga0207660_10073494 Ga0207660_100734942 224
351 3300025919 Ga0207657_10195134 Ga0207657_101951342 224
352 3300025921 Ga0207652_10001048 Ga0207652_1000104810 224
353 3300025921 Ga0207652_10025309 Ga0207652_100253092 224
354 3300025921 Ga0207652_10081336 Ga0207652_100813363 224
355 3300025921 Ga0207652_10252126 Ga0207652_102521263 224
356 3300025921 Ga0207652_10564922 Ga0207652_105649221 224
357 3300025927 Ga0207687_10133549 Ga0207687_101335491 224
358 3300025986 Ga0207658_10688098 Ga0207658_106880981 224
359 3300026041 Ga0207639_10846743 Ga0207639_108467431 224
360 3300026095 Ga0207676_10824493 Ga0207676_108244931 224
361 3300028786 Ga0307517_10026479 Ga0307517_100264792 224
362 3300028794 Ga0307515_10017159 Ga0307515_1001715910 224
363 3300028794 Ga0307515_10160461 Ga0307515_101604612 224
364 3300028794 Ga0307515_10222639 Ga0307515_102226392 224
365 3300030521 Ga0307511_10060505 Ga0307511_100605051 224
366 3300030522 Ga0307512_10008082 Ga0307512_100080828 224
367 3300030522 Ga0307512_10216102 Ga0307512_102161021 224
368 3300031456 Ga0307513_10033014 Ga0307513_100330143 224
369 3300031456 Ga0307513_10380257 Ga0307513_103802573 224
370 3300031507 Ga0307509_10029556 Ga0307509_100295566 224
371 3300031616 Ga0307508_10212388 Ga0307508_102123882 224
372 3300031649 Ga0307514_10008147 Ga0307514_100081472 224
373 3300031649 Ga0307514_10059712 Ga0307514_100597122 224
374 3300031649 Ga0307514_10168104 Ga0307514_101681041 224
375 3300031649 Ga0307514_10176509 Ga0307514_101765091 224
376 3300031727 Ga0316576_10018918 Ga0316576_100189185 224
377 3300031727 Ga0316576_10053604 Ga0316576_100536045 224
378 3300031727 Ga0316576_10117887 Ga0316576_101178872 224
379 3300031728 Ga0316578_10017710 Ga0316578_100177105 224
380 3300031728 Ga0316578_10069819 Ga0316578_100698194 224
381 3300031730 Ga0307516_10019954 Ga0307516_100199546 224
382 3300031731 Ga0307405_10308844 Ga0307405_103088442 224
383 3300031733 Ga0316577_10025018 Ga0316577_100250181 224
384 3300031852 Ga0307410_10130493 Ga0307410_101304932 224
385 3300031852 Ga0307410_10371469 Ga0307410_103714692 224
386 3300032002 Ga0307416_100463040 Ga0307416_1004630401 224
387 3300032005 Ga0307411_10138703 Ga0307411_101387031 224
388 3300032005 Ga0307411_10204950 Ga0307411_102049502 224
389 3300033179 Ga0307507_10105891 Ga0307507_101058912 224
390 3300033179 Ga0307507_10280581 Ga0307507_102805811 224
391 3300033179 Ga0307507_10323070 Ga0307507_103230702 224
392 3300033180 Ga0307510_10080849 Ga0307510_100808494 224
393 3300033180 Ga0307510_10295030 Ga0307510_102950302 224
394 3300035398 Ga0316574_0029239 Ga0316574_0029239_2525_3199 224
395 3300035398 Ga0316574_0034798 Ga0316574_0034798_333_1007 224
396 3300036647 Ga0316582_0175809 Ga0316582_0175809_696_1370 224
397 3300036712 Ga0316584_0006199 Ga0316584_0006199_1730_2404 224
398 3300036712 Ga0316584_0043795 Ga0316584_0043795_138_812 224
399 3300036712 Ga0316584_0157346 Ga0316584_0157346_828_1511 224
400 3300037418 Ga0395900_0538878 Ga0395900_0538878_342_1016 224
401 3300037853 Ga0436364_0480718 Ga0436364_0480718_3961_4635 224
402 3300039437 Ga0436365_0398569 Ga0436365_0398569_24381_25055 224
403 3300041494 Ga0451837_1298356 Ga0451837_1298356_728_1402 224
404 3300044656 Ga0466969_0069180 Ga0466969_0069180_1003_1677 224
405 3300044656 Ga0466969_0069417 Ga0466969_0069417_531_1205 224
406 3300044683 Ga0466965_0027672 Ga0466965_0027672_1061_1741 224
407 3300044684 Ga0466966_0311640 Ga0466966_0311640_51_725 224
408 3300044693 Ga0466961_0096107 Ga0466961_0096107_363_1037 224
409 3300044693 Ga0466961_0325729 Ga0466961_0325729_97_771 224
410 3300044694 Ga0466963_0004210 Ga0466963_0004210_2399_3073 224
411 3300044694 Ga0466963_0076727 Ga0466963_0076727_785_1465 224
412 3300044694 Ga0466963_0213874 Ga0466963_0213874_549_1223 224
413 3300044706 Ga0466964_0102390 Ga0466964_0102390_30_710 224
414 3300044719 Ga0466971_0006249 Ga0466971_0006249_166_846 224
415 3300044842 Ga0466957_0002180 Ga0466957_0002180_5492_6175 224
416 3300045836 Ga0466958_0000222 Ga0466958_0000222_3369_4049 224
417 3300045836 Ga0466958_0033828 Ga0466958_0033828_822_1505 224
418 3300045836 Ga0466958_0043886 Ga0466958_0043886_729_1403 224
419 3300045836 Ga0466958_0079108 Ga0466958_0079108_1262_1936 224
420 3300046452 Ga0495617_012215 Ga0495617_012215_1927_2601 224
421 3300046453 Ga0495627_010238 Ga0495627_010238_2049_2723 224
422 3300046454 Ga0495592_0003591 Ga0495592_0003591_1772_2446 224
423 3300046454 Ga0495592_0011391 Ga0495592_0011391_398_1072 224
424 3300046454 Ga0495592_0153561 Ga0495592_0153561_221_895 224
425 3300046455 Ga0495603_0045735 Ga0495603_0045735_33_707 224
426 3300046460 Ga0495638_0041549 Ga0495638_0041549_1525_2199 224
427 3300046460 Ga0495638_0118612 Ga0495638_0118612_818_1519 224
428 3300046460 Ga0495638_0317540 Ga0495638_0317540_98_772 224
429 3300046461 Ga0495641_0031386 Ga0495641_0031386_520_1200 224
430 3300046461 Ga0495641_0233784 Ga0495641_0233784_73_753 224
431 3300046462 Ga0495651_0003035 Ga0495651_0003035_3376_4050 224
432 3300046462 Ga0495651_0023678 Ga0495651_0023678_2050_2724 224
433 3300046463 Ga0495653_0034862 Ga0495653_0034862_2517_3230 224
434 3300046471 Ga0495650_0172958 Ga0495650_0172958_25_699 224
435 3300046472 Ga0495580_0332498 Ga0495580_0332498_264_938 224
436 3300046473 Ga0495582_0019152 Ga0495582_0019152_510_1184 224
437 3300046473 Ga0495582_0115194 Ga0495582_0115194_20_694 224
438 3300046474 Ga0495605_0013624 Ga0495605_0013624_1239_1913 224
439 3300046475 Ga0495639_0129388 Ga0495639_0129388_436_1110 224
440 3300046476 Ga0495662_0001288 Ga0495662_0001288_9913_10587 224
441 3300046476 Ga0495662_0003663 Ga0495662_0003663_6861_7535 224
442 3300046476 Ga0495662_0017546 Ga0495662_0017546_90_764 224
443 3300046477 Ga0495664_0001242 Ga0495664_0001242_9533_10207 224
444 3300046492 Ga0495585_0141256 Ga0495585_0141256_545_1219 224
445 3300046499 Ga0495594_0040796 Ga0495594_0040796_1809_2483 224
446 3300046499 Ga0495594_0299281 Ga0495594_0299281_106_780 224
447 3300046499 Ga0495594_0434283 Ga0495594_0434283_56_730 224
448 3300046501 Ga0495607_0066932 Ga0495607_0066932_1089_1763 224
449 3300046506 Ga0495583_0145757 Ga0495583_0145757_289_963 224
450 3300046507 Ga0495606_0008611 Ga0495606_0008611_7211_7885 224
451 3300046512 Ga0495610_0061513 Ga0495610_0061513_59_733 224
452 3300046513 Ga0495616_0005356 Ga0495616_0005356_1884_2558 224
453 3300046516 Ga0495628_0008019 Ga0495628_0008019_3657_4331 224
454 3300046516 Ga0495628_0039995 Ga0495628_0039995_68_742 224
455 3300046517 Ga0495630_0080247 Ga0495630_0080247_594_1268 224
456 3300046517 Ga0495630_0090222 Ga0495630_0090222_1568_2242 224
457 3300046518 Ga0495631_0030817 Ga0495631_0030817_952_1626 224
458 3300046520 Ga0495637_0016491 Ga0495637_0016491_1249_1923 224
459 3300046522 Ga0495643_0017243 Ga0495643_0017243_2771_3445 224
460 3300046523 Ga0495644_0069083 Ga0495644_0069083_403_1077 224
461 3300046524 Ga0495648_0084247 Ga0495648_0084247_905_1579 224
462 3300046526 Ga0495666_0007706 Ga0495666_0007706_3987_4661 224
463 3300046528 Ga0495642_0023733 Ga0495642_0023733_198_872 224
464 3300046529 Ga0495652_0001869 Ga0495652_0001869_18392_19066 224
465 3300046529 Ga0495652_0010249 Ga0495652_0010249_6660_7334 224
466 3300046529 Ga0495652_0049229 Ga0495652_0049229_2884_3558 224
467 3300046530 Ga0495654_0005236 Ga0495654_0005236_1564_2238 224
468 3300046531 Ga0495665_0096586 Ga0495665_0096586_73_747 224
469 3300046533 Ga0495640_0036682 Ga0495640_0036682_422_1096 224
470 3300046535 Ga0495586_0072381 Ga0495586_0072381_1129_1803 224
471 3300046536 Ga0495587_0185004 Ga0495587_0185004_231_905 224
472 3300046536 Ga0495587_0193746 Ga0495587_0193746_219_893 224
473 3300046538 Ga0495609_0009374 Ga0495609_0009374_1903_2577 224
474 3300046542 Ga0495597_0032612 Ga0495597_0032612_1632_2306 224
475 3300046543 Ga0495645_0007753 Ga0495645_0007753_6171_6845 224
476 3300046543 Ga0495645_0033616 Ga0495645_0033616_951_1625 224
477 3300046543 Ga0495645_0172993 Ga0495645_0172993_123_797 224
478 3300046557 Ga0495622_0003753 Ga0495622_0003753_3462_4136 224
479 3300046557 Ga0495622_0020000 Ga0495622_0020000_360_1034 224
480 3300046557 Ga0495622_0089249 Ga0495622_0089249_17_691 224
481 3300046558 Ga0495633_0004412 Ga0495633_0004412_7666_8340 224
482 3300046558 Ga0495633_0022209 Ga0495633_0022209_1747_2421 224
483 3300046559 Ga0495667_0104907 Ga0495667_0104907_266_940 224
484 3300046616 Ga0495668_0027050 Ga0495668_0027050_1772_2446 224
485 3300046642 Ga0495634_0004615 Ga0495634_0004615_2292_2966 224
486 3300046642 Ga0495634_0126419 Ga0495634_0126419_571_1245 224
487 3300046648 Ga0495611_0007737 Ga0495611_0007737_1867_2568 224
488 3300046648 Ga0495611_0017328 Ga0495611_0017328_969_1643 224
489 3300046648 Ga0495611_0034487 Ga0495611_0034487_481_1155 224
490 3300046660 Ga0495625_0024361 Ga0495625_0024361_912_1586 224
491 3300046663 Ga0495635_0000630 Ga0495635_0000630_2164_2838 224
492 3300046663 Ga0495635_0239138 Ga0495635_0239138_131_805 224
493 3300046663 Ga0495635_0530005 Ga0495635_0530005_33_707 224
494 3300046665 Ga0495661_0054646 Ga0495661_0054646_325_999 224
495 3300046674 Ga0495588_0001717 Ga0495588_0001717_2817_3491 224
496 3300046674 Ga0495588_0036196 Ga0495588_0036196_720_1394 224
497 3300046674 Ga0495588_0049795 Ga0495588_0049795_1449_2123 224
498 3300046675 Ga0495657_0002765 Ga0495657_0002765_2959_3633 224
499 3300046675 Ga0495657_0042959 Ga0495657_0042959_2213_2887 224
500 3300046675 Ga0495657_0125148 Ga0495657_0125148_283_957 224
501 3300046675 Ga0495657_0155911 Ga0495657_0155911_451_1125 224
502 3300046675 Ga0495657_0424292 Ga0495657_0424292_74_748 224
503 3300046678 Ga0495599_0104641 Ga0495599_0104641_919_1593 224
504 3300046679 Ga0495623_0214693 Ga0495623_0214693_208_882 224
505 3300046680 Ga0495646_0000669 Ga0495646_0000669_10856_11530 224
506 3300046680 Ga0495646_0048936 Ga0495646_0048936_309_983 224
507 3300046683 Ga0495658_0018437 Ga0495658_0018437_1720_2394 224
508 3300046689 Ga0495613_0005024 Ga0495613_0005024_8648_9322 224
509 3300046689 Ga0495613_0005879 Ga0495613_0005879_6925_7599 224
510 3300046689 Ga0495613_0045585 Ga0495613_0045585_33_707 224
511 3300046689 Ga0495613_0459646 Ga0495613_0459646_25_699 224
512 3300046691 Ga0495670_0019746 Ga0495670_0019746_1208_1882 224
513 3300046691 Ga0495670_0026594 Ga0495670_0026594_1072_1773 224
514 3300046692 Ga0495671_0002799 Ga0495671_0002799_2783_3457 224
515 3300046694 Ga0495649_0089699 Ga0495649_0089699_189_863 224
516 3300046794 Ga0495589_0020293 Ga0495589_0020293_2268_2942 224
517 3300046809 Ga0495600_0002372 Ga0495600_0002372_1417_2091 224
518 3300046809 Ga0495600_0012433 Ga0495600_0012433_2015_2689 224
519 3300046809 Ga0495600_0290851 Ga0495600_0290851_48_722 224
520 3300046810 Ga0495660_0044528 Ga0495660_0044528_294_968 224
521 3300047315 Ga0495581_0149944 Ga0495581_0149944_347_1021 224
522 3300047315 Ga0495581_0242232 Ga0495581_0242232_215_889 224
523 3300047317 Ga0495604_0000597 Ga0495604_0000597_12143_12817 224
524 3300047317 Ga0495604_0009513 Ga0495604_0009513_6011_6685 224
525 3300047318 Ga0495636_0015296 Ga0495636_0015296_1855_2529 224
526 3300047318 Ga0495636_0018570 Ga0495636_0018570_138_839 224
527 3300047318 Ga0495636_0039887 Ga0495636_0039887_479_1153 224
528 3300047319 Ga0495674_0015461 Ga0495674_0015461_1898_2572 224
529 3300047319 Ga0495674_0238463 Ga0495674_0238463_463_1137 224
530 3300047319 Ga0495674_0342338 Ga0495674_0342338_272_946 224
531 3300047320 Ga0495672_0078790 Ga0495672_0078790_486_1160 224
532 3300047321 Ga0495676_0018161 Ga0495676_0018161_805_1479 224
533 3300047321 Ga0495676_0019814 Ga0495676_0019814_1748_2422 224
534 3300047321 Ga0495676_0040776 Ga0495676_0040776_2194_2895 224
535 3300047322 Ga0495680_0053938 Ga0495680_0053938_64_738 224
536 3300047323 Ga0495683_0169752 Ga0495683_0169752_309_983 224
537 3300047443 Ga0495687_003104 Ga0495687_003104_6382_7056 224
538 3300047443 Ga0495687_003604 Ga0495687_003604_8924_9598 224
539 3300047443 Ga0495687_073098 Ga0495687_073098_31_705 224
540 3300047444 Ga0495675_0009811 Ga0495675_0009811_4703_5377 224
541 3300047444 Ga0495675_0019818 Ga0495675_0019818_73_747 224
542 3300047444 Ga0495675_0182016 Ga0495675_0182016_495_1169 224
543 3300047445 Ga0495677_0100213 Ga0495677_0100213_73_747 224
544 3300047446 Ga0495679_056473 Ga0495679_056473_292_966 224
545 3300047447 Ga0495685_017784 Ga0495685_017784_35_709 224
546 3300047470 Ga0495681_0011323 Ga0495681_0011323_339_1013 224
547 3300047470 Ga0495681_0022268 Ga0495681_0022268_2588_3262 224
548 3300047471 Ga0495684_0034517 Ga0495684_0034517_1863_2537 224
549 3300047471 Ga0495684_0425487 Ga0495684_0425487_219_893 224
550 3300047472 Ga0495686_0010043 Ga0495686_0010043_5406_6080 224
551 3300047472 Ga0495686_0292582 Ga0495686_0292582_49_723 224
552 3300047673 Ga0495593_0000502 Ga0495593_0000502_1882_2556 224
553 3300048088 Ga0495602_0004911 Ga0495602_0004911_3271_3945 224
554 3300048089 Ga0495614_0003948 Ga0495614_0003948_192_866 224
555 3300048089 Ga0495614_0035603 Ga0495614_0035603_1128_1802 224
556 3300048089 Ga0495614_0199190 Ga0495614_0199190_78_779 224
557 3300048903 Ga0496100_0360466 Ga0496100_0360466_16_690 224
558 3300048907 Ga0496104_0235405 Ga0496104_0235405_540_1220 224
559 3300048909 Ga0496106_0279844 Ga0496106_0279844_214_888 224
560 3300048913 Ga0496110_0042628 Ga0496110_0042628_1116_1796 224
561 3300048917 Ga0496114_0304162 Ga0496114_0304162_249_929 224
562 3300048917 Ga0496114_0382720 Ga0496114_0382720_507_1181 224
563 3300049460 Ga0495682_0007362 Ga0495682_0007362_3397_4071 224
564 3300049527 Ga0501311_037554 Ga0501311_037554_26_700 224
565 3300049568 Ga0501031_0035365 Ga0501031_0035365_2012_2686 224
566 3300049569 Ga0501032_0009955 Ga0501032_0009955_5441_6115 224
567 3300049569 Ga0501032_0029677 Ga0501032_0029677_863_1537 224
568 3300049569 Ga0501032_0045823 Ga0501032_0045823_1385_2059 224
569 3300049570 Ga0501033_0037030 Ga0501033_0037030_368_1042 224
570 3300049571 Ga0501034_0017666 Ga0501034_0017666_5443_6117 224
571 3300049571 Ga0501034_0025134 Ga0501034_0025134_4220_4894 224
572 3300049572 Ga0501036_0016460 Ga0501036_0016460_3525_4199 224
573 3300049573 Ga0501037_0001542 Ga0501037_0001542_5498_6172 224
574 3300049573 Ga0501037_0311926 Ga0501037_0311926_203_877 224
575 3300049574 Ga0501038_0013850 Ga0501038_0013850_5394_6068 224
576 3300049574 Ga0501038_0027453 Ga0501038_0027453_4360_5034 224
577 3300049574 Ga0501038_0631517 Ga0501038_0631517_121_795 224
578 3300049575 Ga0501039_0066115 Ga0501039_0066115_1615_2289 224
579 3300049575 Ga0501039_0325856 Ga0501039_0325856_504_1178 224
580 3300049578 Ga0501042_0025478 Ga0501042_0025478_1994_2668 224
581 3300049579 Ga0501043_0186935 Ga0501043_0186935_379_1053 224
582 3300049580 Ga0501046_0096852 Ga0501046_0096852_1133_1807 224
583 3300049581 Ga0501047_0067949 Ga0501047_0067949_795_1469 224
584 3300049581 Ga0501047_0180795 Ga0501047_0180795_405_1079 224
585 3300049582 Ga0501048_0013393 Ga0501048_0013393_2451_3125 224
586 3300049585 Ga0501069_0002848 Ga0501069_0002848_6467_7141 224
587 3300049586 Ga0501070_0001688 Ga0501070_0001688_172_903 224
588 3300049586 Ga0501070_0002568 Ga0501070_0002568_6635_7309 224
589 3300049586 Ga0501070_0294168 Ga0501070_0294168_356_1030 224
590 3300049589 Ga0501073_0040926 Ga0501073_0040926_1515_2246 224
591 3300049590 Ga0501074_0000467 Ga0501074_0000467_19992_20723 224
592 3300049593 Ga0501077_0284487 Ga0501077_0284487_13_687 224
593 3300049741 Ga0501079_0000775 Ga0501079_0000775_20292_21023 224
594 3300049742 Ga0501080_0000216 Ga0501080_0000216_30814_31488 224
595 3300049742 Ga0501080_0001308 Ga0501080_0001308_17747_18478 224
596 3300049742 Ga0501080_0177105 Ga0501080_0177105_1159_1833 224
597 3300049778 Ga0501282_006660 Ga0501282_006660_241_915 224
598 3300049822 Ga0501035_0014210 Ga0501035_0014210_3718_4392 224
599 3300049822 Ga0501035_0062968 Ga0501035_0062968_1007_1681 224
600 3300049823 Ga0501044_0024328 Ga0501044_0024328_4790_5464 224
601 3300049823 Ga0501044_0042064 Ga0501044_0042064_3398_4072 224
602 3300049823 Ga0501044_0364985 Ga0501044_0364985_136_810 224
603 3300049824 Ga0501045_0600989 Ga0501045_0600989_50_724 224
604 3300053088 Ga0500644_0106263 Ga0500644_0106263_104_778 224
605 3300053092 Ga0500583_0124604 Ga0500583_0124604_18_692 224
606 3300053095 Ga0500640_004946 Ga0500640_004946_1793_2467 224
607 3300053098 Ga0500650_0288150 Ga0500650_0288150_20_694 224
608 3300053142 Ga0500577_0085207 Ga0500577_0085207_437_1111 224
609 3300053145 Ga0500586_126805 Ga0500586_126805_58_732 224
610 3300053149 Ga0500600_0096129 Ga0500600_0096129_52_726 224
611 3300053157 Ga0500624_002937 Ga0500624_002937_1177_1851 224
612 3300054114 Ga0501084_0259444 Ga0501084_0259444_765_1457 224
613 3300061719 Ga0466962_0006460 Ga0466962_0006460_1840_2520 224
614 iso_pu_bacteria 2862574272 2862578519 224
615 3300001989 JGI24739J22299_10015616 JGI24739J22299_100156162 225
616 3300002067 JGI24735J21928_10070776 JGI24735J21928_100707762 225
617 3300005338 Ga0068868_100057799 Ga0068868_1000577992 225
618 3300005341 Ga0070691_10045962 Ga0070691_100459623 225
619 3300005347 Ga0070668_100315528 Ga0070668_1003155282 225
620 3300005435 Ga0070714_100189816 Ga0070714_1001898162 225
621 3300005436 Ga0070713_100103618 Ga0070713_1001036183 225
622 3300005436 Ga0070713_100267186 Ga0070713_1002671862 225
623 3300005436 Ga0070713_100291284 Ga0070713_1002912842 225
624 3300005437 Ga0070710_10016542 Ga0070710_100165423 225
625 3300005440 Ga0070705_100096864 Ga0070705_1000968642 225
626 3300005441 Ga0070700_100241432 Ga0070700_1002414322 225
627 3300005445 Ga0070708_100064689 Ga0070708_1000646891 225
628 3300005445 Ga0070708_100205495 Ga0070708_1002054952 225
629 3300005467 Ga0070706_100131294 Ga0070706_1001312941 225
630 3300005467 Ga0070706_100211198 Ga0070706_1002111982 225
631 3300005468 Ga0070707_100439745 Ga0070707_1004397452 225
632 3300005468 Ga0070707_100853998 Ga0070707_1008539982 225
633 3300005471 Ga0070698_100000708 Ga0070698_1000007087 225
634 3300005471 Ga0070698_100000817 Ga0070698_10000081713 225
635 3300005530 Ga0070679_100558662 Ga0070679_1005586622 225
636 3300005535 Ga0070684_100119100 Ga0070684_1001191002 225
637 3300005535 Ga0070684_100141500 Ga0070684_1001415002 225
638 3300005543 Ga0070672_100307549 Ga0070672_1003075492 225
639 3300005547 Ga0070693_100309479 Ga0070693_1003094792 225
640 3300005563 Ga0068855_100119246 Ga0068855_1001192463 225
641 3300005577 Ga0068857_100023807 Ga0068857_1000238072 225
642 3300005614 Ga0068856_100087885 Ga0068856_1000878852 225
643 3300005615 Ga0070702_100035872 Ga0070702_1000358723 225
644 3300005618 Ga0068864_101004052 Ga0068864_1010040521 225
645 3300005718 Ga0068866_10072522 Ga0068866_100725222 225
646 3300005937 Ga0081455_10007035 Ga0081455_1000703516 225
647 3300005937 Ga0081455_10433117 Ga0081455_104331171 225
648 3300005981 Ga0081538_10000417 Ga0081538_100004178 225
649 3300005981 Ga0081538_10031451 Ga0081538_100314513 225
650 3300006175 Ga0070712_100055849 Ga0070712_1000558493 225
651 3300006358 Ga0068871_100002346 Ga0068871_1000023464 225
652 3300006846 Ga0075430_100001802 Ga0075430_10000180219 225
653 3300006846 Ga0075430_100006192 Ga0075430_10000619212 225
654 3300006847 Ga0075431_100001725 Ga0075431_1000017256 225
655 3300006847 Ga0075431_100001755 Ga0075431_10000175514 225
656 3300006871 Ga0075434_100222303 Ga0075434_1002223031 225
657 3300006880 Ga0075429_100001988 Ga0075429_10000198813 225
658 3300006880 Ga0075429_100016094 Ga0075429_1000160946 225
659 3300009094 Ga0111539_10018001 Ga0111539_100180019 225
660 3300009098 Ga0105245_10020841 Ga0105245_100208417 225
661 3300009098 Ga0105245_10237514 Ga0105245_102375142 225
662 3300009098 Ga0105245_10874753 Ga0105245_108747531 225
663 3300009147 Ga0114129_10016875 Ga0114129_1001687510 225
664 3300009147 Ga0114129_10065489 Ga0114129_100654896 225
665 3300009147 Ga0114129_11714457 Ga0114129_117144571 225
666 3300009148 Ga0105243_10075374 Ga0105243_100753744 225
667 3300009148 Ga0105243_10459206 Ga0105243_104592062 225
668 3300009148 Ga0105243_10870028 Ga0105243_108700281 225
669 3300009176 Ga0105242_10012950 Ga0105242_100129507 225
670 3300009176 Ga0105242_10192426 Ga0105242_101924262 225
671 3300009177 Ga0105248_10127328 Ga0105248_101273282 225
672 3300009177 Ga0105248_10784886 Ga0105248_107848861 225
673 3300009545 Ga0105237_10108868 Ga0105237_101088682 225
674 3300009553 Ga0105249_10319660 Ga0105249_103196602 225
675 3300010375 Ga0105239_10280250 Ga0105239_102802503 225
676 3300010375 Ga0105239_10448571 Ga0105239_104485712 225
677 3300013102 Ga0157371_10305073 Ga0157371_103050732 225
678 3300013105 Ga0157369_10067886 Ga0157369_100678863 225
679 3300013105 Ga0157369_10467648 Ga0157369_104676482 225
680 3300013105 Ga0157369_10840698 Ga0157369_108406982 225
681 3300013105 Ga0157369_10858617 Ga0157369_108586172 225
682 3300013296 Ga0157374_10009898 Ga0157374_100098987 225
683 3300013296 Ga0157374_10553504 Ga0157374_105535041 225
684 3300013297 Ga0157378_10041806 Ga0157378_100418064 225
685 3300013306 Ga0163162_10246253 Ga0163162_102462532 225
686 3300013306 Ga0163162_10256364 Ga0163162_102563641 225
687 3300013307 Ga0157372_10067228 Ga0157372_100672285 225
688 3300013307 Ga0157372_10351097 Ga0157372_103510972 225
689 3300013308 Ga0157375_10028637 Ga0157375_100286373 225
690 3300013308 Ga0157375_10154215 Ga0157375_101542152 225
691 3300013308 Ga0157375_10226188 Ga0157375_102261881 225
692 3300013308 Ga0157375_11037269 Ga0157375_110372691 225
693 3300013308 Ga0157375_11203268 Ga0157375_112032681 225
694 3300014325 Ga0163163_10003442 Ga0163163_100034429 225
695 3300014326 Ga0157380_10101500 Ga0157380_101015003 225
696 3300014326 Ga0157380_10272461 Ga0157380_102724611 225
697 3300014968 Ga0157379_10002390 Ga0157379_1000239010 225
698 3300014969 Ga0157376_10007343 Ga0157376_100073437 225
699 3300017792 Ga0163161_10049749 Ga0163161_100497492 225
700 3300017792 Ga0163161_10258361 Ga0163161_102583611 225
701 3300020070 Ga0206356_10640822 Ga0206356_106408222 225
702 3300020077 Ga0206351_10683577 Ga0206351_106835772 225
703 3300020082 Ga0206353_10205279 Ga0206353_102052791 225
704 3300020082 Ga0206353_10786672 Ga0206353_107866722 225
705 3300020082 Ga0206353_11891632 Ga0206353_118916321 225
706 3300022467 Ga0224712_10035499 Ga0224712_100354992 225
707 3300025898 Ga0207692_10065526 Ga0207692_100655262 225
708 3300025904 Ga0207647_10007385 Ga0207647_100073853 225
709 3300025910 Ga0207684_10001496 Ga0207684_1000149615 225
710 3300025910 Ga0207684_10161486 Ga0207684_101614862 225
711 3300025914 Ga0207671_10125517 Ga0207671_101255172 225
712 3300025915 Ga0207693_10046808 Ga0207693_100468083 225
713 3300025922 Ga0207646_10001862 Ga0207646_1000186214 225
714 3300025922 Ga0207646_10380867 Ga0207646_103808671 225
715 3300025928 Ga0207700_10178372 Ga0207700_101783722 225
716 3300025928 Ga0207700_10328821 Ga0207700_103288212 225
717 3300025929 Ga0207664_10097820 Ga0207664_100978202 225
718 3300025929 Ga0207664_10113260 Ga0207664_101132603 225
719 3300025934 Ga0207686_10094902 Ga0207686_100949022 225
720 3300025935 Ga0207709_10826752 Ga0207709_108267521 225
721 3300025939 Ga0207665_10082543 Ga0207665_100825432 225
722 3300025940 Ga0207691_10081078 Ga0207691_100810783 225
723 3300025941 Ga0207711_10307629 Ga0207711_103076292 225
724 3300025944 Ga0207661_10774322 Ga0207661_107743221 225
725 3300025945 Ga0207679_10347461 Ga0207679_103474612 225
726 3300025961 Ga0207712_10015125 Ga0207712_100151254 225
727 3300025961 Ga0207712_10281668 Ga0207712_102816682 225
728 3300025986 Ga0207658_10197826 Ga0207658_101978262 225
729 3300026023 Ga0207677_10034460 Ga0207677_100344603 225
730 3300026075 Ga0207708_10800105 Ga0207708_108001051 225
731 3300026075 Ga0207708_10832099 Ga0207708_108320991 225
732 3300026078 Ga0207702_10040822 Ga0207702_100408224 225
733 3300026078 Ga0207702_10537269 Ga0207702_105372691 225
734 3300026088 Ga0207641_10165730 Ga0207641_101657302 225
735 3300026116 Ga0207674_10055991 Ga0207674_100559915 225
736 3300026116 Ga0207674_10069016 Ga0207674_100690162 225
737 3300026121 Ga0207683_10631126 Ga0207683_106311262 225
738 3300026142 Ga0207698_10098800 Ga0207698_100988001 225
739 3300027907 Ga0207428_10119860 Ga0207428_101198602 225
740 3300030522 Ga0307512_10230096 Ga0307512_102300961 225
741 3300031251 Ga0265327_10175228 Ga0265327_101752281 225
742 3300031548 Ga0307408_100162721 Ga0307408_1001627212 225
743 3300031548 Ga0307408_100264284 Ga0307408_1002642842 225
744 3300031548 Ga0307408_100474409 Ga0307408_1004744091 225
745 3300031727 Ga0316576_10000951 Ga0316576_100009514 225
746 3300031731 Ga0307405_10132287 Ga0307405_101322872 225
747 3300031824 Ga0307413_10482587 Ga0307413_104825872 225
748 3300031852 Ga0307410_10015971 Ga0307410_100159715 225
749 3300031852 Ga0307410_10391707 Ga0307410_103917072 225
750 3300031911 Ga0307412_10038452 Ga0307412_100384522 225
751 3300031995 Ga0307409_100007897 Ga0307409_1000078971 225
752 3300031995 Ga0307409_100116980 Ga0307409_1001169803 225
753 3300031995 Ga0307409_100183397 Ga0307409_1001833973 225
754 3300031995 Ga0307409_100449052 Ga0307409_1004490521 225
755 3300032002 Ga0307416_100121070 Ga0307416_1001210703 225
756 3300032002 Ga0307416_100321509 Ga0307416_1003215092 225
757 3300032002 Ga0307416_100634019 Ga0307416_1006340191 225
758 3300032004 Ga0307414_10109738 Ga0307414_101097382 225
759 3300032126 Ga0307415_100225227 Ga0307415_1002252272 225
760 3300032126 Ga0307415_100290226 Ga0307415_1002902262 225
761 3300032139 Ga0316580_10084267 Ga0316580_100842671 225
762 3300035084 Ga0373928_0048578 Ga0373928_0048578_203_892 225
763 3300035086 Ga0373934_0000421 Ga0373934_0000421_2647_3372 225
764 3300035113 Ga0373936_0145746 Ga0373936_0145746_154_837 225
765 3300035117 Ga0373953_0000116 Ga0373953_0000116_14567_15292 225
766 3300035118 Ga0373954_0001000 Ga0373954_0001000_8595_9320 225
767 3300035119 Ga0373956_0005182 Ga0373956_0005182_3965_4690 225
768 3300035120 Ga0373957_0000035 Ga0373957_0000035_4777_5502 225
769 3300035172 Ga0373955_0000072 Ga0373955_0000072_10917_11642 225
770 3300035172 Ga0373955_0045548 Ga0373955_0045548_1212_1937 225
771 3300035398 Ga0316574_0010580 Ga0316574_0010580_517_1194 225
772 3300035398 Ga0316574_0035275 Ga0316574_0035275_1989_2666 225
773 3300035398 Ga0316574_0068145 Ga0316574_0068145_462_1139 225
774 3300035398 Ga0316574_0146970 Ga0316574_0146970_36_713 225
775 3300035410 Ga0373924_0001000 Ga0373924_0001000_5297_6022 225
776 3300035724 Ga0373933_0000327 Ga0373933_0000327_18988_19713 225
777 3300035725 Ga0373947_0498313 Ga0373947_0498313_50_775 225
778 3300036401 Ga0373937_0000010 Ga0373937_0000010_77896_78621 225
779 3300036401 Ga0373937_0440067 Ga0373937_0440067_51_776 225
780 3300036647 Ga0316582_0011735 Ga0316582_0011735_4155_4832 225
781 3300036647 Ga0316582_0023777 Ga0316582_0023777_1421_2098 225
782 3300036712 Ga0316584_0000926 Ga0316584_0000926_1930_2607 225
783 3300036712 Ga0316584_0104946 Ga0316584_0104946_51_728 225
784 3300036712 Ga0316584_0422655 Ga0316584_0422655_101_778 225
785 3300037068 Ga0373925_0047160 Ga0373925_0047160_1766_2449 225
786 3300037466 Ga0395898_0556308 Ga0395898_0556308_195_872 225
787 3300038443 Ga0395901_0011144 Ga0395901_0011144_3773_4450 225
788 3300038443 Ga0395901_0059400 Ga0395901_0059400_1299_1976 225
789 3300038443 Ga0395901_0065266 Ga0395901_0065266_931_1608 225
790 3300038443 Ga0395901_0251763 Ga0395901_0251763_488_1165 225
791 3300039437 Ga0436365_1406538 Ga0436365_1406538_51_728 225
792 3300041459 Ga0451800_1017266 Ga0451800_1017266_165_842 225
793 3300041512 Ga0451853_3707206 Ga0451853_3707206_41_718 225
794 3300041512 Ga0451853_3939996 Ga0451853_3939996_221_898 225
795 3300042014 Ga0439457_007559 Ga0439457_007559_959_1636 225
796 3300042136 Ga0450900_004422 Ga0450900_004422_183_860 225
797 3300042533 Ga0450901_006636 Ga0450901_006636_458_1135 225
798 3300044656 Ga0466969_0043284 Ga0466969_0043284_1115_1792 225
799 3300044683 Ga0466965_0131860 Ga0466965_0131860_101_781 225
800 3300044684 Ga0466966_0070708 Ga0466966_0070708_991_1668 225
801 3300044693 Ga0466961_0004439 Ga0466961_0004439_6384_7061 225
802 3300044694 Ga0466963_0006354 Ga0466963_0006354_3051_3728 225
803 3300044719 Ga0466971_0037606 Ga0466971_0037606_19_696 225
804 3300044765 Ga0466970_0084586 Ga0466970_0084586_242_919 225
805 3300044765 Ga0466970_0138849 Ga0466970_0138849_612_1289 225
806 3300044901 Ga0466960_0117462 Ga0466960_0117462_607_1284 225
807 3300044901 Ga0466960_0130960 Ga0466960_0130960_41_718 225
808 3300045049 Ga0466959_0104176 Ga0466959_0104176_1336_2013 225
809 3300045976 Ga0466967_0055133 Ga0466967_0055133_1949_2626 225
810 3300045976 Ga0466967_0514987 Ga0466967_0514987_435_1112 225
811 3300046454 Ga0495592_0000136 Ga0495592_0000136_35548_36273 225
812 3300046454 Ga0495592_0019127 Ga0495592_0019127_3928_4653 225
813 3300046459 Ga0495629_0131568 Ga0495629_0131568_52_729 225
814 3300046462 Ga0495651_0000047 Ga0495651_0000047_77896_78621 225
815 3300046462 Ga0495651_0033457 Ga0495651_0033457_1143_1868 225
816 3300046463 Ga0495653_0000753 Ga0495653_0000753_7270_7995 225
817 3300046463 Ga0495653_0036225 Ga0495653_0036225_498_1223 225
818 3300046475 Ga0495639_0137583 Ga0495639_0137583_279_1004 225
819 3300046476 Ga0495662_0063549 Ga0495662_0063549_1074_1757 225
820 3300046511 Ga0495608_0000089 Ga0495608_0000089_28921_29646 225
821 3300046514 Ga0495618_0163263 Ga0495618_0163263_302_1027 225
822 3300046516 Ga0495628_0000325 Ga0495628_0000325_31499_32224 225
823 3300046516 Ga0495628_0054388 Ga0495628_0054388_429_1154 225
824 3300046529 Ga0495652_0000982 Ga0495652_0000982_10918_11643 225
825 3300046529 Ga0495652_0005996 Ga0495652_0005996_9625_10350 225
826 3300046533 Ga0495640_0031330 Ga0495640_0031330_1064_1789 225
827 3300046535 Ga0495586_0070901 Ga0495586_0070901_369_1094 225
828 3300046535 Ga0495586_0472641 Ga0495586_0472641_25_702 225
829 3300046536 Ga0495587_0000074 Ga0495587_0000074_29171_29896 225
830 3300046536 Ga0495587_0007885 Ga0495587_0007885_3309_4034 225
831 3300046543 Ga0495645_0301023 Ga0495645_0301023_42_767 225
832 3300046559 Ga0495667_0000064 Ga0495667_0000064_59757_60482 225
833 3300046559 Ga0495667_0013616 Ga0495667_0013616_3861_4586 225
834 3300046642 Ga0495634_0066300 Ga0495634_0066300_1153_1878 225
835 3300046663 Ga0495635_0090831 Ga0495635_0090831_888_1565 225
836 3300046674 Ga0495588_0094696 Ga0495588_0094696_77_802 225
837 3300046675 Ga0495657_0000009 Ga0495657_0000009_187658_188383 225
838 3300046678 Ga0495599_0000084 Ga0495599_0000084_35543_36268 225
839 3300046678 Ga0495599_0003486 Ga0495599_0003486_6502_7227 225
840 3300046679 Ga0495623_0000168 Ga0495623_0000168_10930_11655 225
841 3300046680 Ga0495646_0001071 Ga0495646_0001071_4237_4962 225
842 3300046681 Ga0495647_0205450 Ga0495647_0205450_49_774 225
843 3300046683 Ga0495658_0328326 Ga0495658_0328326_187_864 225
844 3300046689 Ga0495613_0311478 Ga0495613_0311478_346_1071 225
845 3300046690 Ga0495624_0085021 Ga0495624_0085021_466_1191 225
846 3300046809 Ga0495600_0007557 Ga0495600_0007557_857_1582 225
847 3300047317 Ga0495604_0000070 Ga0495604_0000070_10931_11656 225
848 3300047321 Ga0495676_0128210 Ga0495676_0128210_621_1346 225
849 3300047322 Ga0495680_0000195 Ga0495680_0000195_29173_29898 225
850 3300047322 Ga0495680_0045706 Ga0495680_0045706_914_1639 225
851 3300047322 Ga0495680_0236023 Ga0495680_0236023_318_995 225
852 3300047444 Ga0495675_0001537 Ga0495675_0001537_10937_11662 225
853 3300047444 Ga0495675_0040590 Ga0495675_0040590_1599_2324 225
854 3300047444 Ga0495675_0213267 Ga0495675_0213267_327_1004 225
855 3300047471 Ga0495684_0017015 Ga0495684_0017015_4500_5225 225
856 3300047471 Ga0495684_0121735 Ga0495684_0121735_789_1466 225
857 3300047673 Ga0495593_0266855 Ga0495593_0266855_10_687 225
858 3300047673 Ga0495593_0383662 Ga0495593_0383662_13_690 225
859 3300048088 Ga0495602_0000122 Ga0495602_0000122_29676_30401 225
860 3300048088 Ga0495602_0057291 Ga0495602_0057291_2645_3370 225
861 3300048088 Ga0495602_0371960 Ga0495602_0371960_164_841 225
862 3300048903 Ga0496100_0014426 Ga0496100_0014426_683_1360 225
863 3300048903 Ga0496100_0253288 Ga0496100_0253288_156_833 225
864 3300048903 Ga0496100_0525331 Ga0496100_0525331_155_832 225
865 3300048903 Ga0496100_0719996 Ga0496100_0719996_20_697 225
866 3300048904 Ga0496101_0080889 Ga0496101_0080889_1630_2307 225
867 3300048904 Ga0496101_0467164 Ga0496101_0467164_81_758 225
868 3300048905 Ga0496102_0006584 Ga0496102_0006584_4477_5154 225
869 3300048905 Ga0496102_0018232 Ga0496102_0018232_2484_3209 225
870 3300048905 Ga0496102_0060479 Ga0496102_0060479_1043_1720 225
871 3300048905 Ga0496102_0127560 Ga0496102_0127560_304_981 225
872 3300048905 Ga0496102_0144484 Ga0496102_0144484_845_1522 225
873 3300048906 Ga0496103_0090114 Ga0496103_0090114_239_916 225
874 3300048907 Ga0496104_0002900 Ga0496104_0002900_13285_14010 225
875 3300048907 Ga0496104_0255440 Ga0496104_0255440_809_1486 225
876 3300048908 Ga0496105_0022958 Ga0496105_0022958_848_1573 225
877 3300048908 Ga0496105_0053757 Ga0496105_0053757_2591_3268 225
878 3300048908 Ga0496105_0174319 Ga0496105_0174319_181_858 225
879 3300048908 Ga0496105_0230839 Ga0496105_0230839_490_1167 225
880 3300048909 Ga0496106_0098630 Ga0496106_0098630_1359_2084 225
881 3300048910 Ga0496107_0039192 Ga0496107_0039192_622_1299 225
882 3300048910 Ga0496107_0125469 Ga0496107_0125469_1063_1740 225
883 3300048910 Ga0496107_0350441 Ga0496107_0350441_326_1003 225
884 3300048911 Ga0496108_0001829 Ga0496108_0001829_9083_9808 225
885 3300048911 Ga0496108_0160244 Ga0496108_0160244_604_1281 225
886 3300048912 Ga0496109_0005390 Ga0496109_0005390_4468_5193 225
887 3300048912 Ga0496109_0021188 Ga0496109_0021188_1441_2118 225
888 3300048912 Ga0496109_0161070 Ga0496109_0161070_1137_1814 225
889 3300048912 Ga0496109_0209303 Ga0496109_0209303_234_911 225
890 3300048912 Ga0496109_0279195 Ga0496109_0279195_818_1495 225
891 3300048912 Ga0496109_0371042 Ga0496109_0371042_448_1155 225
892 3300048912 Ga0496109_0404815 Ga0496109_0404815_228_905 225
893 3300048913 Ga0496110_0002280 Ga0496110_0002280_4321_5046 225
894 3300048913 Ga0496110_0077325 Ga0496110_0077325_823_1500 225
895 3300048913 Ga0496110_0444023 Ga0496110_0444023_263_940 225
896 3300048914 Ga0496111_0029689 Ga0496111_0029689_2575_3300 225
897 3300048914 Ga0496111_0068214 Ga0496111_0068214_865_1542 225
898 3300048914 Ga0496111_0342579 Ga0496111_0342579_148_825 225
899 3300048915 Ga0496112_0015530 Ga0496112_0015530_5251_5976 225
900 3300048915 Ga0496112_0192418 Ga0496112_0192418_868_1545 225
901 3300048917 Ga0496114_0002623 Ga0496114_0002623_770_1447 225
902 3300048917 Ga0496114_0039618 Ga0496114_0039618_3035_3712 225
903 3300048917 Ga0496114_0061330 Ga0496114_0061330_1413_2090 225
904 3300048917 Ga0496114_0104067 Ga0496114_0104067_790_1467 225
905 3300048917 Ga0496114_0137371 Ga0496114_0137371_865_1542 225
906 3300048917 Ga0496114_0271830 Ga0496114_0271830_699_1376 225
907 3300048917 Ga0496114_0735411 Ga0496114_0735411_169_846 225
908 3300048917 Ga0496114_0752771 Ga0496114_0752771_149_826 225
909 3300048918 Ga0496115_0034174 Ga0496115_0034174_2165_2842 225
910 3300048918 Ga0496115_0126115 Ga0496115_0126115_1123_1800 225
911 3300048918 Ga0496115_0173083 Ga0496115_0173083_976_1653 225
912 3300048922 Ga0496119_0014576 Ga0496119_0014576_1858_2535 225
913 3300048925 Ga0496122_0000427 Ga0496122_0000427_69478_70155 225
914 3300048925 Ga0496122_0001313 Ga0496122_0001313_33858_34535 225
915 3300048926 Ga0496123_0001011 Ga0496123_0001011_35411_36088 225
916 3300048927 Ga0496124_0002673 Ga0496124_0002673_9422_10099 225
917 3300048928 Ga0496125_0000224 Ga0496125_0000224_21361_22038 225
918 3300048929 Ga0496126_0018319 Ga0496126_0018319_3928_4605 225
919 3300049568 Ga0501031_0001184 Ga0501031_0001184_5884_6561 225
920 3300049568 Ga0501031_0038291 Ga0501031_0038291_596_1321 225
921 3300049568 Ga0501031_0167370 Ga0501031_0167370_487_1164 225
922 3300049570 Ga0501033_0040853 Ga0501033_0040853_1237_1914 225
923 3300049570 Ga0501033_0467233 Ga0501033_0467233_139_816 225
924 3300049572 Ga0501036_0003151 Ga0501036_0003151_8681_9358 225
925 3300049572 Ga0501036_0072511 Ga0501036_0072511_415_1092 225
926 3300049572 Ga0501036_0573998 Ga0501036_0573998_224_901 225
927 3300049572 Ga0501036_0738665 Ga0501036_0738665_12_689 225
928 3300049573 Ga0501037_0077424 Ga0501037_0077424_551_1228 225
929 3300049574 Ga0501038_0006359 Ga0501038_0006359_1611_2288 225
930 3300049574 Ga0501038_0060824 Ga0501038_0060824_429_1106 225
931 3300049574 Ga0501038_0296849 Ga0501038_0296849_120_797 225
932 3300049575 Ga0501039_0060759 Ga0501039_0060759_373_1050 225
933 3300049575 Ga0501039_0095713 Ga0501039_0095713_1030_1707 225
934 3300049575 Ga0501039_0119059 Ga0501039_0119059_1138_1815 225
935 3300049575 Ga0501039_0197241 Ga0501039_0197241_158_835 225
936 3300049575 Ga0501039_0264249 Ga0501039_0264249_293_970 225
937 3300049576 Ga0501040_0001769 Ga0501040_0001769_7053_7730 225
938 3300049576 Ga0501040_0373067 Ga0501040_0373067_130_807 225
939 3300049577 Ga0501041_0033268 Ga0501041_0033268_2072_2749 225
940 3300049577 Ga0501041_0116836 Ga0501041_0116836_290_967 225
941 3300049577 Ga0501041_0199410 Ga0501041_0199410_369_1046 225
942 3300049578 Ga0501042_0002229 Ga0501042_0002229_8681_9358 225
943 3300049578 Ga0501042_0022572 Ga0501042_0022572_1073_1750 225
944 3300049579 Ga0501043_0621674 Ga0501043_0621674_70_747 225
945 3300049580 Ga0501046_0008898 Ga0501046_0008898_6501_7178 225
946 3300049582 Ga0501048_0002457 Ga0501048_0002457_8208_8885 225
947 3300049582 Ga0501048_0459223 Ga0501048_0459223_13_690 225
948 3300049582 Ga0501048_0479940 Ga0501048_0479940_171_848 225
949 3300049583 Ga0501067_0011575 Ga0501067_0011575_3348_4043 225
950 3300049583 Ga0501067_0013348 Ga0501067_0013348_27_704 225
951 3300049583 Ga0501067_0037804 Ga0501067_0037804_1292_1969 225
952 3300049583 Ga0501067_0271487 Ga0501067_0271487_41_718 225
953 3300049584 Ga0501068_0017893 Ga0501068_0017893_1752_2429 225
954 3300049585 Ga0501069_0069242 Ga0501069_0069242_1106_1783 225
955 3300049585 Ga0501069_0100181 Ga0501069_0100181_603_1280 225
956 3300049587 Ga0501071_0000242 Ga0501071_0000242_6059_6736 225
957 3300049587 Ga0501071_0049006 Ga0501071_0049006_293_970 225
958 3300049587 Ga0501071_0290036 Ga0501071_0290036_91_768 225
959 3300049588 Ga0501072_0139940 Ga0501072_0139940_1010_1687 225
960 3300049590 Ga0501074_0006376 Ga0501074_0006376_1660_2337 225
961 3300049591 Ga0501075_0001324 Ga0501075_0001324_10407_11084 225
962 3300049592 Ga0501076_0003324 Ga0501076_0003324_1890_2567 225
963 3300049592 Ga0501076_0385447 Ga0501076_0385447_306_983 225
964 3300049592 Ga0501076_0657676 Ga0501076_0657676_166_843 225
965 3300049593 Ga0501077_0016615 Ga0501077_0016615_268_945 225
966 3300049593 Ga0501077_0324691 Ga0501077_0324691_116_793 225
967 3300049741 Ga0501079_0001427 Ga0501079_0001427_3760_4437 225
968 3300049741 Ga0501079_0261470 Ga0501079_0261470_629_1306 225
969 3300049742 Ga0501080_0012152 Ga0501080_0012152_1410_2087 225
970 3300049823 Ga0501044_0061626 Ga0501044_0061626_204_881 225
971 3300049824 Ga0501045_0120494 Ga0501045_0120494_741_1418 225
972 3300050491 nmdc:mga00v17_109896_c1 nmdc:mga00v17_109896_c1_241_918 225
973 3300050495 nmdc:mga04h51_13427_c1 nmdc:mga04h51_13427_c1_565_1242 225
974 3300050507 nmdc:mga05p37_2183_c1 nmdc:mga05p37_2183_c1_65_742 225
975 3300050507 nmdc:mga05p37_573_c1 nmdc:mga05p37_573_c1_32872_33549 225
976 3300050508 nmdc:mga09592_115689_c1 nmdc:mga09592_115689_c1_892_1569 225
977 3300050508 nmdc:mga09592_227_c1 nmdc:mga09592_227_c1_14447_15124 225
978 3300050509 nmdc:mga0qj67_14713_c1 nmdc:mga0qj67_14713_c1_4281_4958 225
979 3300050509 nmdc:mga0qj67_22215_c1 nmdc:mga0qj67_22215_c1_576_1253 225
980 3300050510 nmdc:mga06r32_6575_c1 nmdc:mga06r32_6575_c1_9353_10030 225
981 3300050510 nmdc:mga06r32_83_c1 nmdc:mga06r32_83_c1_46148_46825 225
982 3300050511 nmdc:mga08y16_1700_c1 nmdc:mga08y16_1700_c1_7105_7782 225
983 3300050512 nmdc:mga0n895_337582_c1 nmdc:mga0n895_337582_c1_503_1180 225
984 3300050512 nmdc:mga0n895_679369_c1 nmdc:mga0n895_679369_c1_338_1015 225
985 3300053077 Ga0495601_0010947 Ga0495601_0010947_3290_4015 225
986 3300053084 Ga0495595_0000288 Ga0495595_0000288_15014_15739 225
987 3300053085 Ga0495619_0132905 Ga0495619_0132905_541_1218 225
988 3300053117 Ga0500593_006236 Ga0500593_006236_4051_4728 225
989 3300053129 Ga0500628_090127 Ga0500628_090127_24_725 225
990 3300054114 Ga0501084_0008293 Ga0501084_0008293_3917_4594 225
991 3300060353 Ga0501082_0008844 Ga0501082_0008844_7951_8628 225
992 3300061719 Ga0466962_0024932 Ga0466962_0024932_471_1148 225
993 3300061734 Ga0530510_0001746 Ga0530510_0001746_2862_3539 225
994 iso_pu_bacteria 2728369276 2729906950 225
995 iso_pu_bacteria 3001889506 3001892337 225

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00027

cNMP_binding

Cyclic nucleotide-binding domain

29

117

0.96

PF13545

HTH_Crp_2

Crp-like helix-turn-helix domain

149

223

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3i54-assembly1.cif.gz_A crystal structure of mtbcrp in complex with camp 0.9606 4 224
4cyd-assembly2.cif.gz_C glxr bound to camp 0.9523 3 225
3i54-assembly2.cif.gz_C crystal structure of mtbcrp in complex with camp 0.952 21 224
4cyd-assembly2.cif.gz_A glxr bound to camp 0.9507 3 225
3i54-assembly1.cif.gz_B crystal structure of mtbcrp in complex with camp 0.9501 3 224
ID Description Score Start End Superfamily
3i59B02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9777 146 214 1.10.10.10
4a2uH02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9734 146 225 1.10.10.10
4cydD02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9718 146 222 1.10.10.10
3mzhA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9696 146 225 1.10.10.10
4a2uH02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9616 146 225 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A2N2HDB7-F1-model_v4 Transcriptional regulator 0.9643 3 99
AF-A0A4Q3GWR6-F1-model_v4 deleted 0.9577 146 224
AF-A0A7C4RU19-F1-model_v4 Cyclic nucleotide-binding domain-containing protein 0.9497 1 99 GO:0003700
GO:0005829
AF-S4XX20-F1-model_v4 Crp/Fnr family transcriptional regulator 0.941 39 223 GO:0003677
GO:0003700
GO:0005829
AF-A0A1Q7EDL1-F1-model_v4 Cyclic nucleotide-binding domain-containing protein 0.9395 27 106 GO:0005829

Feature Viewer

pLDDT pTM Quality
90.33 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map