F487649

General Info

Members Datasets Scaffolds Average Seq Length
991 420 988 271

Family's Representative Sequence

Representative Sequence 3300054114|Ga0501084_0111220|Ga0501084_0111220_490_1356
Length 288
Sequence MVPENSLDWRAFTSNCAQTSGGLPMLTSQAVARELPRLRRYARALTGNQTSGDAYVTATLEALAEDPSSLNADDDISIGLFSAFTRIWNSVELNTSSSAGGLIDEHIRGMTPLPRQAFLLVSLEDFAEPAAAKILDVPVIELRRLIEEAGRELAAEIATEVLIIEDEPLIAMDLEGLVESLGHSVTGIGRTQKEAVALAKEKPPGLILADIRLADMSSGVDAVNEMLQDLEVPVIFITAYPEQLLTGERPEPAFLITKPFRPTTVAAVISQALFFGRKATTRKKAVEA

Samples

Sample ID Description Type Environment
1 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
2 2842694124 Methylopila sp. R-72369 Isolate Unclassified
3 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
4 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
5 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
6 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
7 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
8 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
9 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
10 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
11 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
12 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
13 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
14 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
15 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
16 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
17 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
18 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
19 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
20 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
21 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
22 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
23 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
24 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
25 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
26 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
27 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
28 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
29 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
30 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
31 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
32 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
33 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
34 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
35 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
36 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
37 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
38 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
39 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
40 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
41 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
42 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
43 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
44 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
45 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
46 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
47 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
48 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
49 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
50 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
51 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
52 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
53 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
54 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
55 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
56 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
57 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
58 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
59 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
60 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
61 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
62 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
63 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
64 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
65 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
66 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
67 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
68 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
69 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
70 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
71 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
72 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
73 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
74 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
75 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
76 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
77 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
78 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
79 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
80 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
81 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
82 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
83 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
84 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
85 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
86 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
87 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
88 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
89 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
90 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
91 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
92 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
93 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
94 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
95 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
96 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
97 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
98 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
99 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
100 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
101 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
102 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
103 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
104 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
105 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
106 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
107 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
108 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
109 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
110 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
111 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
112 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
113 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
114 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
115 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
116 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
117 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
118 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
119 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
120 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
121 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
122 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
123 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
124 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
125 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
126 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
127 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
128 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
129 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
130 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
131 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
132 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
133 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
134 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
135 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
136 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
137 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
138 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
139 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
140 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
141 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
142 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
143 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
144 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
145 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
146 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
147 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
148 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
149 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
150 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
151 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
152 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
153 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
154 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
155 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
156 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
157 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
158 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
159 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
160 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
161 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
163 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
232 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
233 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
234 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
235 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
236 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
237 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
238 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
242 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
243 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
244 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
245 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
246 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
247 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
248 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
249 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
250 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
251 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
252 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
253 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
254 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
255 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
256 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
257 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
258 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
259 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
260 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
261 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
262 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
263 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
264 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
265 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
266 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
267 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
268 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
269 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
270 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
271 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
272 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
273 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
274 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
275 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
276 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
277 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
278 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
279 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
280 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
281 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
282 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
283 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
284 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
285 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
286 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
287 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
288 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
289 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
290 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
291 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
292 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
293 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
294 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
295 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
296 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
297 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
298 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
299 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
300 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
301 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
302 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
303 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
304 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
305 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
306 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
307 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
308 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
309 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
310 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
311 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
312 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
313 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
314 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
315 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
316 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
317 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
318 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
319 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
320 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
321 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
322 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
323 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
324 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
325 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
326 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
327 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
328 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
329 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
330 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
331 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
332 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
333 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
334 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
335 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
336 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
337 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
338 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
339 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
340 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
341 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
342 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
343 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
344 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
345 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
346 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
347 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
348 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
349 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
350 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
351 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
352 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
353 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
354 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
355 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
356 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
357 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
358 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
359 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
360 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
361 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
362 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
363 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
364 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
365 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
366 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
367 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
368 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
369 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
370 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
371 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
372 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
373 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
374 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
375 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
376 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
377 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
378 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
379 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
380 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
381 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
382 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
383 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
384 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
385 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
386 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
387 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
388 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
389 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
390 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
391 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
392 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
393 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
394 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
395 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
396 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
397 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
398 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
399 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
400 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
401 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
402 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
403 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
404 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
405 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
406 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
407 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
408 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
409 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
410 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
411 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
412 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
413 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
414 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
415 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
416 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
417 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
418 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
419 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
420 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.99
Metatranscriptomes 0.91
Isolates 0.1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.03
Nodule 0
Rhizoplane 5.65
Rhizosphere 90.11
Stem 0
Stem Tuber 0
Unclassified 1.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 2214572714 2209111006 Bacteria 5910
2 ARcpr5oldR_c000130 3300000041 Bacteria 13090
3 ARSoilYngRDRAFT_c00118 3300000042 Bacteria 13503
4 ARcpr5yngRDRAFT_c000035 3300000043 Bacteria 21396
5 ARCol0yngRDRAFT_1000209 3300000652 Bacteria 9893
6 JGI24752J21851_1013069 3300001976 Bacteria 1084
7 JGI24746J21847_1000683 3300001977 Bacteria 5199
8 JGI24747J21853_1003746 3300001978 Bacteria 1327
9 JGI24739J22299_10000158 3300001989 Bacteria 22012
10 JGI24737J22298_10001510 3300001990 Bacteria 8284
11 JGI24737J22298_10001948 3300001990 Bacteria 7386
12 JGI24743J22301_10018083 3300001991 Bacteria 1329
13 JGI24745J21846_1001135 3300002073 Bacteria 2534
14 JGI24748J21848_1000574 3300002074 Bacteria 3956
15 JGI24748J21848_1000699 3300002074 Bacteria 3614
16 JGI24738J21930_10003334 3300002075 Bacteria 4072
17 JGI24749J21850_1005514 3300002076 Bacteria 1771
18 JGI24749J21850_1012555 3300002076 Bacteria 1189
19 JGI24744J21845_10001094 3300002077 Bacteria 5249
20 JGI24035J26624_1000023 3300002126 Bacteria 11063
21 JGI24033J26618_1001768 3300002155 Bacteria 2161
22 JGI24034J26672_10001325 3300002239 Bacteria 3266
23 JGI24742J22300_10000706 3300002244 Bacteria 5053
24 JGI24751J29686_10002998 3300002459 Bacteria 3409
25 JGI24751J29686_10008505 3300002459 Bacteria 2101
26 JGI25405J52794_10031077 3300003911 Bacteria 1109
27 Ga0065712_10007917 3300005290 Bacteria 6107
28 Ga0065712_10089850 3300005290 Bacteria 2450
29 Ga0065715_10089004 3300005293 Bacteria 17365
30 Ga0065707_10143694 3300005295 Unclassified 1723
31 Ga0070658_10006919 3300005327 Bacteria 9160
32 Ga0070676_10001138 3300005328 Bacteria 13281
33 Ga0070676_10126576 3300005328 Unclassified 1610
34 Ga0070676_10182049 3300005328 Bacteria 1367
35 Ga0070683_100163764 3300005329 Bacteria 2110
36 Ga0070690_100000727 3300005330 Bacteria 16862
37 Ga0070690_100126144 3300005330 Bacteria 1723
38 Ga0070670_100004168 3300005331 Bacteria 12095
39 Ga0070670_100060563 3300005331 Bacteria 3250
40 Ga0070670_100110934 3300005331 Bacteria 2364
41 Ga0070677_10003207 3300005333 Bacteria 5264
42 Ga0070677_10003757 3300005333 Bacteria 4911
43 Ga0068869_100087385 3300005334 Bacteria 2339
44 Ga0070666_10018444 3300005335 Bacteria 4487
45 Ga0070666_10018621 3300005335 Bacteria 4469
46 Ga0070680_100006389 3300005336 Bacteria 8955
47 Ga0070680_100024710 3300005336 Bacteria 4802
48 Ga0070680_100067076 3300005336 Bacteria 2943
49 Ga0070680_100135083 3300005336 Bacteria 2066
50 Ga0070680_100193681 3300005336 Bacteria 1713
51 Ga0070682_100007941 3300005337 Bacteria 5969
52 Ga0070682_100096561 3300005337 Bacteria 1943
53 Ga0068868_100000944 3300005338 Bacteria 19746
54 Ga0068868_100050586 3300005338 Bacteria 3264
55 Ga0068868_100115031 3300005338 Bacteria 2189
56 Ga0068868_100302318 3300005338 Bacteria 1359
57 Ga0070660_100015021 3300005339 Bacteria 5585
58 Ga0070660_100048298 3300005339 Bacteria 3269
59 Ga0070660_100084985 3300005339 Bacteria 2488
60 Ga0070660_100117966 3300005339 Bacteria 2116
61 Ga0070660_100126808 3300005339 Bacteria 2040
62 Ga0070660_100143923 3300005339 Bacteria 1914
63 Ga0070689_100000646 3300005340 Bacteria 21086
64 Ga0070689_100002989 3300005340 Bacteria 11115
65 Ga0070689_100006613 3300005340 Bacteria 8049
66 Ga0070689_100009931 3300005340 Bacteria 6770
67 Ga0070689_100027299 3300005340 Bacteria 4303
68 Ga0070689_100086479 3300005340 Bacteria 2466
69 Ga0070691_10000125 3300005341 Bacteria 23286
70 Ga0070687_100000773 3300005343 Bacteria 10637
71 Ga0070687_100050373 3300005343 Bacteria 2150
72 Ga0070687_100115673 3300005343 Bacteria 1525
73 Ga0070661_100013869 3300005344 Bacteria 5662
74 Ga0070661_100018561 3300005344 Bacteria 4947
75 Ga0070692_10038970 3300005345 Bacteria 2425
76 Ga0070669_100172652 3300005353 Bacteria 1686
77 Ga0070675_100005686 3300005354 Bacteria 9545
78 Ga0070675_100112209 3300005354 Bacteria 2308
79 Ga0070671_100000170 3300005355 Bacteria 42992
80 Ga0070671_100032596 3300005355 Bacteria 4306
81 Ga0070671_100053267 3300005355 Bacteria 3363
82 Ga0070671_100054894 3300005355 Bacteria 3313
83 Ga0070674_100026051 3300005356 Bacteria 3815
84 Ga0070674_100053517 3300005356 Bacteria 2788
85 Ga0070673_100015366 3300005364 Bacteria 5375
86 Ga0070673_100020936 3300005364 Bacteria 4728
87 Ga0070673_100136776 3300005364 Unclassified 2063
88 Ga0070673_100154134 3300005364 Bacteria 1948
89 Ga0070688_100001455 3300005365 Bacteria 11770
90 Ga0070688_100002194 3300005365 Bacteria 9852
91 Ga0070688_100008402 3300005365 Bacteria 5602
92 Ga0070688_100081413 3300005365 Bacteria 2096
93 Ga0070688_100091355 3300005365 Bacteria 1989
94 Ga0070659_100000621 3300005366 Bacteria 25919
95 Ga0070659_100128803 3300005366 Bacteria 2054
96 Ga0070667_100044536 3300005367 Bacteria 3727
97 Ga0070667_100133608 3300005367 Bacteria 2168
98 Ga0070667_100139072 3300005367 Unclassified 2125
99 Ga0070703_10001450 3300005406 Bacteria 7142
100 Ga0070709_10006995 3300005434 Bacteria 6165
101 Ga0070709_10019522 3300005434 Bacteria 3920
102 Ga0070709_10113191 3300005434 Unclassified 1827
103 Ga0070714_100037912 3300005435 Bacteria 4053
104 Ga0070714_100095284 3300005435 Bacteria 2614
105 Ga0070714_100099561 3300005435 Bacteria 2559
106 Ga0070713_100019242 3300005436 Bacteria 5207
107 Ga0070713_100029152 3300005436 Bacteria 4367
108 Ga0070713_100067156 3300005436 Bacteria 3018
109 Ga0070713_100167387 3300005436 Bacteria 1966
110 Ga0070713_100256266 3300005436 Bacteria 1598
111 Ga0070710_10014458 3300005437 Bacteria 3975
112 Ga0070710_10016436 3300005437 Bacteria 3766
113 Ga0070710_10062381 3300005437 Bacteria 2125
114 Ga0070711_100008373 3300005439 Bacteria 6335
115 Ga0070711_100050862 3300005439 Bacteria 2843
116 Ga0070711_100336725 3300005439 Bacteria 1209
117 Ga0070705_100004061 3300005440 Bacteria 7149
118 Ga0070705_100172914 3300005440 Bacteria 1456
119 Ga0070700_100080805 3300005441 Unclassified 2098
120 Ga0070694_100002007 3300005444 Bacteria 12098
121 Ga0070694_100004869 3300005444 Bacteria 8086
122 Ga0070708_100053874 3300005445 Bacteria 3572
123 Ga0070663_100016477 3300005455 Bacteria 4802
124 Ga0070663_100030911 3300005455 Bacteria 3674
125 Ga0070663_100076820 3300005455 Bacteria 2443
126 Ga0070663_100225669 3300005455 Bacteria 1473
127 Ga0070678_100051868 3300005456 Bacteria 2976
128 Ga0070678_100073272 3300005456 Bacteria 2570
129 Ga0070678_100109769 3300005456 Bacteria 2156
130 Ga0070662_100016774 3300005457 Bacteria 4923
131 Ga0070662_100033442 3300005457 Bacteria 3620
132 Ga0070662_100050943 3300005457 Bacteria 2988
133 Ga0070681_10004332 3300005458 Bacteria 13487
134 Ga0070681_10016792 3300005458 Bacteria 7309
135 Ga0070681_10017562 3300005458 Bacteria 7149
136 Ga0070681_10034345 3300005458 Bacteria 5091
137 Ga0070681_10101784 3300005458 Bacteria 2818
138 Ga0070681_10131805 3300005458 Bacteria 2432
139 Ga0068867_100007473 3300005459 Bacteria 7727
140 Ga0068867_100540740 3300005459 Bacteria 1007
141 Ga0070685_10018648 3300005466 Bacteria 3735
142 Ga0070685_10019896 3300005466 Bacteria 3627
143 Ga0070685_10034894 3300005466 Bacteria 2836
144 Ga0070698_100056891 3300005471 Bacteria 3960
145 Ga0070698_100141478 3300005471 Bacteria 2357
146 Ga0070699_100065967 3300005518 Bacteria 3142
147 Ga0070699_100148577 3300005518 Bacteria 2072
148 Ga0070679_100021073 3300005530 Bacteria 6360
149 Ga0070679_100102549 3300005530 Bacteria 2847
150 Ga0070679_100106382 3300005530 Bacteria 2791
151 Ga0070679_100592576 3300005530 Bacteria 1052
152 Ga0070684_100005730 3300005535 Bacteria 9545
153 Ga0070684_100096228 3300005535 Bacteria 2639
154 Ga0068853_100073930 3300005539 Bacteria 2973
155 Ga0068853_100175892 3300005539 Bacteria 1939
156 Ga0068853_100239910 3300005539 Bacteria 1661
157 Ga0070672_100000557 3300005543 Bacteria 21802
158 Ga0070672_100066989 3300005543 Bacteria 2844
159 Ga0070672_100154999 3300005543 Bacteria 1897
160 Ga0070672_100372903 3300005543 Unclassified 1220
161 Ga0070686_100002869 3300005544 Bacteria 9472
162 Ga0070686_100003376 3300005544 Bacteria 8749
163 Ga0070686_100010566 3300005544 Bacteria 5210
164 Ga0070686_100077078 3300005544 Bacteria 2197
165 Ga0070695_100009085 3300005545 Bacteria 5907
166 Ga0070696_100026503 3300005546 Bacteria 3944
167 Ga0070696_100133658 3300005546 Bacteria 1807
168 Ga0070693_100009465 3300005547 Bacteria 4847
169 Ga0070665_100021216 3300005548 Bacteria 6530
170 Ga0070704_100004070 3300005549 Bacteria 8436
171 Ga0070704_100008436 3300005549 Bacteria 6180
172 Ga0068855_100016277 3300005563 Bacteria 8943
173 Ga0068855_100106615 3300005563 Bacteria 3220
174 Ga0068855_100303236 3300005563 Bacteria 1769
175 Ga0070664_100000263 3300005564 Bacteria 37910
176 Ga0070664_100033520 3300005564 Bacteria 4303
177 Ga0070664_100052452 3300005564 Bacteria 3455
178 Ga0070664_100086013 3300005564 Bacteria 2716
179 Ga0070664_100171002 3300005564 Bacteria 1928
180 Ga0068857_100000888 3300005577 Bacteria 22595
181 Ga0068857_100032844 3300005577 Bacteria 4587
182 Ga0068854_100005378 3300005578 Bacteria 8082
183 Ga0068856_100003260 3300005614 Bacteria 16512
184 Ga0068856_100384779 3300005614 Bacteria 1422
185 Ga0070702_100001911 3300005615 Bacteria 8749
186 Ga0068852_100000579 3300005616 Bacteria 24117
187 Ga0068852_100020377 3300005616 Bacteria 5274
188 Ga0068852_100156337 3300005616 Bacteria 2124
189 Ga0068859_100003690 3300005617 Bacteria 15603
190 Ga0068859_100047890 3300005617 Bacteria 4295
191 Ga0068859_100077356 3300005617 Bacteria 3368
192 Ga0068859_100154435 3300005617 Bacteria 2372
193 Ga0068859_100206704 3300005617 Unclassified 2048
194 Ga0068864_100001260 3300005618 Bacteria 21062
195 Ga0068864_100032661 3300005618 Bacteria 4423
196 Ga0068864_100082174 3300005618 Bacteria 2826
197 Ga0068866_10001077 3300005718 Bacteria 12040
198 Ga0068866_10082741 3300005718 Bacteria 1728
199 Ga0068861_100001782 3300005719 Bacteria 13850
200 Ga0068861_100033648 3300005719 Bacteria 3783
201 Ga0068861_100129105 3300005719 Bacteria 2049
202 Ga0068861_100291730 3300005719 Bacteria 1409
203 Ga0068851_10200170 3300005834 Bacteria 1114
204 Ga0068870_10000108 3300005840 Bacteria 28313
205 Ga0068863_100001201 3300005841 Bacteria 25868
206 Ga0068863_100025548 3300005841 Bacteria 5631
207 Ga0068863_100064839 3300005841 Bacteria 3455
208 Ga0068858_100000419 3300005842 Bacteria 44155
209 Ga0068858_100027844 3300005842 Bacteria 5250
210 Ga0068858_100046567 3300005842 Bacteria 4020
211 Ga0068858_100181425 3300005842 Bacteria 1988
212 Ga0068858_100327084 3300005842 Bacteria 1466
213 Ga0068860_100001359 3300005843 Bacteria 26585
214 Ga0068860_100020550 3300005843 Bacteria 6396
215 Ga0068860_100059646 3300005843 Bacteria 3627
216 Ga0068860_100162464 3300005843 Bacteria 2154
217 Ga0068862_100005815 3300005844 Bacteria 10279
218 Ga0068862_100217261 3300005844 Bacteria 1729
219 Ga0068862_100438684 3300005844 Bacteria 1229
220 Ga0068862_100689519 3300005844 Bacteria 989
221 Ga0081455_10000009 3300005937 Bacteria 249885
222 Ga0081455_10004299 3300005937 Bacteria 16034
223 Ga0081455_10009512 3300005937 Bacteria 9988
224 Ga0081455_10031917 3300005937 Bacteria 4755
225 Ga0081455_10052863 3300005937 Bacteria 3474
226 Ga0081455_10109166 3300005937 Bacteria 2202
227 Ga0081538_10004153 3300005981 Bacteria 13436
228 Ga0081538_10025193 3300005981 Bacteria 4204
229 Ga0081538_10123568 3300005981 Bacteria 1237
230 Ga0081540_1003051 3300005983 Bacteria 13420
231 Ga0081539_10002606 3300005985 Bacteria 24730
232 Ga0070717_10012616 3300006028 Bacteria 6447
233 Ga0070717_10060095 3300006028 Bacteria 3147
234 Ga0070717_10166732 3300006028 Bacteria 1913
235 Ga0075365_10061816 3300006038 Bacteria 2502
236 Ga0075365_10382844 3300006038 Bacteria 992
237 Ga0075368_10015550 3300006042 Bacteria 2825
238 Ga0075368_10041123 3300006042 Bacteria 1816
239 Ga0075432_10005568 3300006058 Bacteria 4290
240 Ga0075432_10024861 3300006058 Bacteria 2054
241 Ga0075432_10102466 3300006058 Bacteria 1059
242 Ga0070715_10008072 3300006163 Bacteria 3653
243 Ga0070716_100004485 3300006173 Bacteria 6678
244 Ga0070716_100049983 3300006173 Unclassified 2371
245 Ga0070716_100515807 3300006173 Bacteria 885
246 Ga0070712_100005677 3300006175 Bacteria 7715
247 Ga0070712_100005829 3300006175 Bacteria 7623
248 Ga0070712_100011711 3300006175 Bacteria 5573
249 Ga0070712_100026436 3300006175 Bacteria 3866
250 Ga0070712_100040984 3300006175 Bacteria 3177
251 Ga0070712_100123361 3300006175 Bacteria 1953
252 Ga0075367_10023664 3300006178 Bacteria 3458
253 Ga0075366_10006561 3300006195 Bacteria 6382
254 Ga0097621_100002584 3300006237 Bacteria 12403
255 Ga0097621_100012651 3300006237 Bacteria 6265
256 Ga0097621_100043375 3300006237 Bacteria 3626
257 Ga0075370_10029418 3300006353 Bacteria 3061
258 Ga0075370_10031420 3300006353 Bacteria 2964
259 Ga0068871_100000417 3300006358 Bacteria 29416
260 Ga0068871_100011895 3300006358 Bacteria 6403
261 Ga0068871_100013278 3300006358 Bacteria 6110
262 Ga0075428_100003881 3300006844 Bacteria 16432
263 Ga0075428_100131390 3300006844 Bacteria 2723
264 Ga0075428_100244896 3300006844 Bacteria 1934
265 Ga0075428_100248253 3300006844 Bacteria 1918
266 Ga0075428_100266783 3300006844 Bacteria 1843
267 Ga0075428_100300619 3300006844 Bacteria 1725
268 Ga0075428_100325983 3300006844 Bacteria 1650
269 Ga0075430_100001576 3300006846 Bacteria 18645
270 Ga0075430_100003854 3300006846 Bacteria 12635
271 Ga0075430_100019980 3300006846 Bacteria 5701
272 Ga0075430_100022460 3300006846 Bacteria 5369
273 Ga0075430_100157543 3300006846 Bacteria 1890
274 Ga0075430_100346115 3300006846 Bacteria 1228
275 Ga0075431_100003990 3300006847 Bacteria 14380
276 Ga0075431_100061408 3300006847 Bacteria 3877
277 Ga0075431_100071416 3300006847 Bacteria 3582
278 Ga0075431_100133607 3300006847 Bacteria 2558
279 Ga0075431_100150388 3300006847 Bacteria 2397
280 Ga0075431_100187571 3300006847 Bacteria 2120
281 Ga0075431_100231619 3300006847 Bacteria 1882
282 Ga0075431_100304756 3300006847 Bacteria 1609
283 Ga0075433_10000187 3300006852 Bacteria 34883
284 Ga0075433_10140923 3300006852 Bacteria 2143
285 Ga0075433_10172118 3300006852 Bacteria 1927
286 Ga0075434_100001354 3300006871 Bacteria 20567
287 Ga0075434_100002767 3300006871 Bacteria 15520
288 Ga0075434_100050801 3300006871 Bacteria 4119
289 Ga0075434_100076390 3300006871 Bacteria 3344
290 Ga0075434_100084508 3300006871 Bacteria 3173
291 Ga0075434_100085012 3300006871 Bacteria 3163
292 Ga0075434_100420353 3300006871 Bacteria 1358
293 Ga0075429_100027801 3300006880 Bacteria 4909
294 Ga0075429_100149796 3300006880 Bacteria 2042
295 Ga0075429_100212877 3300006880 Bacteria 1693
296 Ga0068865_100000450 3300006881 Bacteria 22865
297 Ga0068865_100075220 3300006881 Unclassified 2408
298 Ga0075436_100034598 3300006914 Bacteria 3484
299 Ga0075436_100304814 3300006914 Bacteria 1142
300 Ga0097620_100003690 3300006931 Bacteria 15603
301 Ga0097620_100047890 3300006931 Bacteria 4295
302 Ga0097620_100077356 3300006931 Bacteria 3368
303 Ga0097620_100154423 3300006931 Bacteria 2372
304 Ga0097620_100206713 3300006931 Unclassified 2048
305 Ga0075435_100036177 3300007076 Bacteria 3922
306 Ga0075435_100425497 3300007076 Bacteria 1144
307 Ga0099795_10003382 3300007788 Bacteria 3937
308 Ga0099795_10062088 3300007788 Bacteria 1389
309 Ga0105244_10121696 3300009036 Bacteria 1263
310 Ga0105240_10038333 3300009093 Bacteria 6147
311 Ga0111539_10006363 3300009094 Bacteria 15229
312 Ga0111539_10039525 3300009094 Bacteria 5684
313 Ga0111539_10048283 3300009094 Bacteria 5083
314 Ga0111539_10201534 3300009094 Bacteria 2320
315 Ga0111539_10363797 3300009094 Bacteria 1684
316 Ga0111539_10886496 3300009094 Bacteria 1038
317 Ga0105245_10000898 3300009098 Bacteria 27086
318 Ga0105245_10019401 3300009098 Bacteria 5956
319 Ga0105245_10058770 3300009098 Bacteria 3461
320 Ga0105245_10142916 3300009098 Bacteria 2255
321 Ga0105247_10003526 3300009101 Bacteria 10172
322 Ga0105247_10052803 3300009101 Bacteria 2507
323 Ga0114129_10000995 3300009147 Bacteria 37077
324 Ga0114129_10043385 3300009147 Bacteria 6327
325 Ga0114129_10066405 3300009147 Bacteria 5032
326 Ga0114129_10068674 3300009147 Bacteria 4941
327 Ga0114129_10266962 3300009147 Bacteria 2291
328 Ga0114129_10353298 3300009147 Bacteria 1946
329 Ga0105243_10002051 3300009148 Bacteria 17085
330 Ga0105243_10089977 3300009148 Bacteria 2525
331 Ga0105243_10203901 3300009148 Bacteria 1736
332 Ga0105243_10708890 3300009148 Bacteria 982
333 Ga0105241_10001526 3300009174 Bacteria 17741
334 Ga0105241_10152988 3300009174 Bacteria 1889
335 Ga0105242_10000399 3300009176 Bacteria 34466
336 Ga0105242_10247102 3300009176 Bacteria 1606
337 Ga0105248_10004145 3300009177 Bacteria 16029
338 Ga0105248_10026703 3300009177 Bacteria 6420
339 Ga0105248_10031820 3300009177 Bacteria 5895
340 Ga0105248_10078259 3300009177 Bacteria 3717
341 Ga0105248_10081870 3300009177 Bacteria 3629
342 Ga0105248_10095812 3300009177 Bacteria 3341
343 Ga0105248_10571375 3300009177 Bacteria 1276
344 Ga0105237_10006666 3300009545 Bacteria 12762
345 Ga0105237_10075814 3300009545 Bacteria 3354
346 Ga0105238_10017057 3300009551 Bacteria 7372
347 Ga0105238_10059456 3300009551 Bacteria 3829
348 Ga0105238_10100771 3300009551 Bacteria 2871
349 Ga0105238_10171795 3300009551 Bacteria 2144
350 Ga0105238_10183822 3300009551 Bacteria 2067
351 Ga0105249_10002756 3300009553 Bacteria 15191
352 Ga0099796_10023205 3300010159 Bacteria 1934
353 Ga0105239_10009796 3300010375 Bacteria 10767
354 Ga0105239_10184640 3300010375 Bacteria 2334
355 Ga0105239_10432739 3300010375 Bacteria 1491
356 Ga0105246_10000033 3300011119 Bacteria 50575
357 Ga0105246_10188930 3300011119 Bacteria 1593
358 Ga0105246_10223477 3300011119 Bacteria 1477
359 Ga0157373_10006645 3300013100 Bacteria 8615
360 Ga0157371_10033300 3300013102 Bacteria 3703
361 Ga0157371_10068893 3300013102 Bacteria 2505
362 Ga0157370_10198539 3300013104 Bacteria 1861
363 Ga0157374_10002423 3300013296 Bacteria 15718
364 Ga0157374_10054544 3300013296 Bacteria 3729
365 Ga0157374_10444840 3300013296 Bacteria 1297
366 Ga0157378_10011328 3300013297 Bacteria 7804
367 Ga0163162_10001526 3300013306 Bacteria 21576
368 Ga0163162_10068838 3300013306 Bacteria 3591
369 Ga0163162_10642162 3300013306 Bacteria 1185
370 Ga0163162_10795344 3300013306 Bacteria 1063
371 Ga0157372_10001162 3300013307 Bacteria 28497
372 Ga0157375_10000124 3300013308 Bacteria 76003
373 Ga0157375_10017274 3300013308 Bacteria 6507
374 Ga0157375_10217286 3300013308 Bacteria 2070
375 Ga0157375_10614352 3300013308 Bacteria 1245
376 Ga0163163_10000745 3300014325 Bacteria 27709
377 Ga0163163_10019246 3300014325 Bacteria 6408
378 Ga0157380_10000140 3300014326 Bacteria 40628
379 Ga0157380_10064645 3300014326 Bacteria 2938
380 Ga0157377_10000117 3300014745 Bacteria 53219
381 Ga0157379_10000785 3300014968 Bacteria 25777
382 Ga0157379_10317925 3300014968 Bacteria 1421
383 Ga0157379_10393996 3300014968 Bacteria 1272
384 Ga0157376_10000034 3300014969 Bacteria 161526
385 Ga0157376_10023138 3300014969 Bacteria 4858
386 Ga0163161_10000448 3300017792 Bacteria 34334
387 Ga0163161_10250117 3300017792 Bacteria 1381
388 Ga0206352_10618637 3300020078 Bacteria 849
389 Ga0206350_10087095 3300020080 Bacteria 847
390 Ga0213873_10076792 3300021358 Bacteria 929
391 Ga0213872_10018295 3300021361 Bacteria 3232
392 Ga0213875_10000025 3300021388 Bacteria 197787
393 Ga0224572_1005633 3300024225 Bacteria 2241
394 Ga0228598_1003747 3300024227 Bacteria 3248
395 Ga0228598_1019940 3300024227 Bacteria 1321
396 Ga0207666_1000017 3300025271 Bacteria 40049
397 Ga0207666_1000125 3300025271 Bacteria 11954
398 Ga0207673_1000060 3300025290 Bacteria 9200
399 Ga0207697_10000009 3300025315 Bacteria 67526
400 Ga0207697_10001569 3300025315 Bacteria 12343
401 Ga0207713_1032298 3300025735 Bacteria 2301
402 Ga0207653_10001876 3300025885 Bacteria 6729
403 Ga0207653_10015121 3300025885 Unclassified 2422
404 Ga0207682_10000301 3300025893 Bacteria 22279
405 Ga0207682_10010412 3300025893 Bacteria 3645
406 Ga0207692_10005014 3300025898 Bacteria 5272
407 Ga0207692_10019482 3300025898 Bacteria 3067
408 Ga0207692_10083224 3300025898 Bacteria 1716
409 Ga0207642_10002547 3300025899 Bacteria 5673
410 Ga0207642_10317890 3300025899 Bacteria 908
411 Ga0207710_10011377 3300025900 Bacteria 3747
412 Ga0207710_10013038 3300025900 Bacteria 3503
413 Ga0207710_10036104 3300025900 Bacteria 2178
414 Ga0207688_10000012 3300025901 Bacteria 60353
415 Ga0207688_10005642 3300025901 Bacteria 6806
416 Ga0207688_10133339 3300025901 Bacteria 1457
417 Ga0207680_10004369 3300025903 Bacteria 6700
418 Ga0207680_10027612 3300025903 Bacteria 3163
419 Ga0207680_10335967 3300025903 Bacteria 1059
420 Ga0207647_10005111 3300025904 Bacteria 9660
421 Ga0207647_10005834 3300025904 Bacteria 8979
422 Ga0207685_10013690 3300025905 Bacteria 2517
423 Ga0207685_10044633 3300025905 Bacteria 1677
424 Ga0207699_10005829 3300025906 Bacteria 5928
425 Ga0207699_10100296 3300025906 Bacteria 1836
426 Ga0207699_10125698 3300025906 Bacteria 1665
427 Ga0207645_10000124 3300025907 Bacteria 58746
428 Ga0207645_10032352 3300025907 Bacteria 3362
429 Ga0207645_10036464 3300025907 Bacteria 3157
430 Ga0207645_10054407 3300025907 Bacteria 2556
431 Ga0207643_10000046 3300025908 Bacteria 80736
432 Ga0207643_10080377 3300025908 Bacteria 1888
433 Ga0207705_10108072 3300025909 Bacteria 2053
434 Ga0207654_10003867 3300025911 Bacteria 7546
435 Ga0207654_10062488 3300025911 Bacteria 2182
436 Ga0207707_10036253 3300025912 Bacteria 4313
437 Ga0207707_10190039 3300025912 Bacteria 1792
438 Ga0207707_10214100 3300025912 Bacteria 1678
439 Ga0207707_10350297 3300025912 Bacteria 1272
440 Ga0207695_10065683 3300025913 Bacteria 3729
441 Ga0207695_10184013 3300025913 Bacteria 2009
442 Ga0207671_10127298 3300025914 Bacteria 1952
443 Ga0207671_10228930 3300025914 Bacteria 1458
444 Ga0207693_10004620 3300025915 Bacteria 11619
445 Ga0207693_10005130 3300025915 Bacteria 10967
446 Ga0207693_10013189 3300025915 Bacteria 6667
447 Ga0207693_10046296 3300025915 Bacteria 3417
448 Ga0207693_10172981 3300025915 Bacteria 1700
449 Ga0207663_10011495 3300025916 Bacteria 4753
450 Ga0207663_10163433 3300025916 Bacteria 1574
451 Ga0207663_10214114 3300025916 Bacteria 1398
452 Ga0207660_10000489 3300025917 Bacteria 26431
453 Ga0207660_10020291 3300025917 Bacteria 4456
454 Ga0207660_10049252 3300025917 Bacteria 2985
455 Ga0207660_10202880 3300025917 Bacteria 1549
456 Ga0207660_10277299 3300025917 Bacteria 1329
457 Ga0207662_10008508 3300025918 Bacteria 5620
458 Ga0207662_10025829 3300025918 Bacteria 3384
459 Ga0207662_10034499 3300025918 Bacteria 2953
460 Ga0207662_10076811 3300025918 Bacteria 2030
461 Ga0207662_10115546 3300025918 Bacteria 1677
462 Ga0207657_10000162 3300025919 Bacteria 68121
463 Ga0207657_10008982 3300025919 Bacteria 10097
464 Ga0207657_10039314 3300025919 Bacteria 4206
465 Ga0207657_10085018 3300025919 Bacteria 2651
466 Ga0207657_10223662 3300025919 Bacteria 1507
467 Ga0207649_10000798 3300025920 Bacteria 20284
468 Ga0207649_10412506 3300025920 Bacteria 1013
469 Ga0207652_10028398 3300025921 Bacteria 4668
470 Ga0207652_10092934 3300025921 Bacteria 2654
471 Ga0207652_10137907 3300025921 Bacteria 2179
472 Ga0207652_10534187 3300025921 Bacteria 1055
473 Ga0207646_10059826 3300025922 Bacteria 3402
474 Ga0207646_10673409 3300025922 Bacteria 926
475 Ga0207681_10011712 3300025923 Bacteria 5391
476 Ga0207681_10203594 3300025923 Bacteria 1521
477 Ga0207694_10043046 3300025924 Bacteria 3485
478 Ga0207694_10065822 3300025924 Bacteria 2826
479 Ga0207694_10102049 3300025924 Bacteria 2274
480 Ga0207694_10218328 3300025924 Bacteria 1554
481 Ga0207650_10087109 3300025925 Bacteria 2379
482 Ga0207659_10000017 3300025926 Bacteria 159908
483 Ga0207687_10006873 3300025927 Bacteria 7495
484 Ga0207687_10024743 3300025927 Bacteria 4013
485 Ga0207687_10188644 3300025927 Bacteria 1603
486 Ga0207687_10406477 3300025927 Bacteria 1121
487 Ga0207700_10001122 3300025928 Bacteria 15358
488 Ga0207700_10178476 3300025928 Bacteria 1776
489 Ga0207664_10044126 3300025929 Bacteria 3490
490 Ga0207664_10082606 3300025929 Bacteria 2617
491 Ga0207664_10086393 3300025929 Bacteria 2562
492 Ga0207664_10103171 3300025929 Bacteria 2359
493 Ga0207644_10012971 3300025931 Bacteria 5544
494 Ga0207644_10013070 3300025931 Bacteria 5526
495 Ga0207644_10036024 3300025931 Bacteria 3471
496 Ga0207644_10043725 3300025931 Bacteria 3180
497 Ga0207644_10510269 3300025931 Bacteria 992
498 Ga0207690_10000151 3300025932 Bacteria 54897
499 Ga0207706_10000368 3300025933 Bacteria 48834
500 Ga0207706_10007484 3300025933 Bacteria 10098
501 Ga0207706_10008477 3300025933 Bacteria 9481
502 Ga0207706_10017363 3300025933 Bacteria 6483
503 Ga0207706_10018620 3300025933 Bacteria 6247
504 Ga0207686_10003886 3300025934 Bacteria 8011
505 Ga0207686_10016902 3300025934 Bacteria 4100
506 Ga0207686_10023460 3300025934 Bacteria 3564
507 Ga0207709_10000256 3300025935 Bacteria 63853
508 Ga0207709_10022765 3300025935 Bacteria 3557
509 Ga0207709_10139977 3300025935 Unclassified 1662
510 Ga0207709_10616639 3300025935 Bacteria 860
511 Ga0207670_10000086 3300025936 Bacteria 63570
512 Ga0207670_10027694 3300025936 Bacteria 3587
513 Ga0207670_10068924 3300025936 Bacteria 2438
514 Ga0207670_10085467 3300025936 Bacteria 2217
515 Ga0207670_10098770 3300025936 Bacteria 2081
516 Ga0207670_10170788 3300025936 Bacteria 1630
517 Ga0207669_10001765 3300025937 Bacteria 9180
518 Ga0207669_10014117 3300025937 Bacteria 3995
519 Ga0207669_10021878 3300025937 Bacteria 3386
520 Ga0207669_10069684 3300025937 Bacteria 2201
521 Ga0207669_10196812 3300025937 Bacteria 1459
522 Ga0207669_10312254 3300025937 Bacteria 1199
523 Ga0207704_10002423 3300025938 Bacteria 8389
524 Ga0207704_10052873 3300025938 Unclassified 2465
525 Ga0207704_10160794 3300025938 Bacteria 1598
526 Ga0207665_10010248 3300025939 Bacteria 6157
527 Ga0207665_10042186 3300025939 Bacteria 3049
528 Ga0207665_10210897 3300025939 Bacteria 1419
529 Ga0207691_10000303 3300025940 Bacteria 48873
530 Ga0207691_10004340 3300025940 Bacteria 13762
531 Ga0207691_10203100 3300025940 Bacteria 1724
532 Ga0207691_10397324 3300025940 Bacteria 1176
533 Ga0207711_10013210 3300025941 Bacteria 6859
534 Ga0207711_10057541 3300025941 Bacteria 3342
535 Ga0207711_10121154 3300025941 Bacteria 2335
536 Ga0207711_10348899 3300025941 Bacteria 1370
537 Ga0207711_10375601 3300025941 Bacteria 1319
538 Ga0207689_10000109 3300025942 Bacteria 67941
539 Ga0207689_10037728 3300025942 Bacteria 4005
540 Ga0207661_10010457 3300025944 Bacteria 6680
541 Ga0207661_10218844 3300025944 Bacteria 1682
542 Ga0207661_10333953 3300025944 Bacteria 1365
543 Ga0207679_10000031 3300025945 Bacteria 165962
544 Ga0207679_10133638 3300025945 Bacteria 1994
545 Ga0207679_10640370 3300025945 Bacteria 961
546 Ga0207667_10002481 3300025949 Bacteria 22990
547 Ga0207667_10044884 3300025949 Bacteria 4682
548 Ga0207651_10000044 3300025960 Bacteria 58072
549 Ga0207651_10049035 3300025960 Bacteria 2858
550 Ga0207651_10061834 3300025960 Unclassified 2607
551 Ga0207712_10001848 3300025961 Bacteria 13972
552 Ga0207712_10057628 3300025961 Bacteria 2742
553 Ga0207668_10001339 3300025972 Bacteria 14601
554 Ga0207668_10233163 3300025972 Unclassified 1485
555 Ga0207640_10210056 3300025981 Bacteria 1482
556 Ga0207658_10025019 3300025986 Bacteria 4179
557 Ga0207658_10032961 3300025986 Bacteria 3692
558 Ga0207658_10034292 3300025986 Bacteria 3627
559 Ga0207658_10103050 3300025986 Bacteria 2239
560 Ga0207658_10316734 3300025986 Bacteria 1349
561 Ga0207658_10438273 3300025986 Bacteria 1155
562 Ga0207677_10006203 3300026023 Bacteria 6535
563 Ga0207677_10056419 3300026023 Bacteria 2691
564 Ga0207703_10018118 3300026035 Bacteria 5500
565 Ga0207703_10031219 3300026035 Bacteria 4211
566 Ga0207703_10170841 3300026035 Bacteria 1912
567 Ga0207703_10202260 3300026035 Bacteria 1765
568 Ga0207703_10459859 3300026035 Unclassified 1190
569 Ga0207639_10053044 3300026041 Bacteria 3092
570 Ga0207639_10374939 3300026041 Unclassified 1276
571 Ga0207678_10000158 3300026067 Bacteria 56255
572 Ga0207678_10031192 3300026067 Bacteria 4650
573 Ga0207678_10047158 3300026067 Bacteria 3727
574 Ga0207708_10000098 3300026075 Bacteria 67005
575 Ga0207708_10005985 3300026075 Bacteria 9009
576 Ga0207702_10008602 3300026078 Bacteria 8606
577 Ga0207702_10425025 3300026078 Bacteria 1285
578 Ga0207641_10000408 3300026088 Bacteria 50477
579 Ga0207648_10000696 3300026089 Bacteria 37592
580 Ga0207648_10014142 3300026089 Bacteria 7382
581 Ga0207648_10055376 3300026089 Bacteria 3462
582 Ga0207676_10037167 3300026095 Bacteria 3709
583 Ga0207676_10117072 3300026095 Bacteria 2240
584 Ga0207676_10190212 3300026095 Bacteria 1805
585 Ga0207674_10000420 3300026116 Bacteria 55287
586 Ga0207674_10010481 3300026116 Bacteria 10494
587 Ga0207675_100001146 3300026118 Bacteria 26264
588 Ga0207675_100024805 3300026118 Bacteria 5579
589 Ga0207675_100085001 3300026118 Bacteria 2969
590 Ga0207675_100470399 3300026118 Bacteria 1248
591 Ga0207683_10000004 3300026121 Bacteria 188086
592 Ga0207683_10001766 3300026121 Bacteria 19131
593 Ga0207683_10017083 3300026121 Bacteria 6176
594 Ga0207683_10065450 3300026121 Bacteria 3205
595 Ga0207683_10078238 3300026121 Bacteria 2930
596 Ga0207698_10005316 3300026142 Bacteria 7936
597 Ga0207698_10615545 3300026142 Bacteria 1072
598 Ga0209179_1008391 3300027512 Unclassified 1740
599 Ga0209179_1016983 3300027512 Bacteria 1372
600 Ga0209983_1012408 3300027665 Bacteria 1749
601 Ga0209971_1021584 3300027682 Bacteria 1532
602 Ga0209966_1001342 3300027695 Bacteria 4312
603 Ga0209966_1034142 3300027695 Bacteria 1040
604 Ga0209998_10001259 3300027717 Bacteria 6207
605 Ga0209998_10003935 3300027717 Bacteria 3199
606 Ga0209813_10016575 3300027866 Bacteria 2013
607 Ga0209813_10035088 3300027866 Bacteria 1500
608 Ga0209974_10000117 3300027876 Bacteria 23200
609 Ga0209974_10006843 3300027876 Bacteria 3956
610 Ga0209974_10028923 3300027876 Unclassified 1836
611 Ga0209974_10029881 3300027876 Bacteria 1806
612 Ga0207428_10000250 3300027907 Bacteria 73217
613 Ga0207428_10001707 3300027907 Bacteria 22539
614 Ga0207428_10006503 3300027907 Bacteria 10786
615 Ga0207428_10007251 3300027907 Bacteria 10137
616 Ga0207428_10023620 3300027907 Bacteria 5167
617 Ga0268266_10019723 3300028379 Bacteria 5745
618 Ga0268266_10064479 3300028379 Bacteria 3165
619 Ga0268266_10070409 3300028379 Bacteria 3031
620 Ga0268265_10005880 3300028380 Bacteria 8360
621 Ga0268264_10018374 3300028381 Bacteria 5717
622 Ga0268264_10074225 3300028381 Bacteria 2888
623 Ga0268264_10365487 3300028381 Bacteria 1378
624 Ga0268264_10415273 3300028381 Bacteria 1296
625 Ga0265762_1005243 3300030760 Bacteria 2323
626 Ga0265760_10031613 3300031090 Bacteria 1561
627 Ga0265330_10156849 3300031235 Bacteria 967
628 Ga0265325_10064261 3300031241 Bacteria 1855
629 Ga0265325_10200729 3300031241 Bacteria 920
630 Ga0265340_10007163 3300031247 Bacteria 6075
631 Ga0265340_10012516 3300031247 Bacteria 4478
632 Ga0265340_10017482 3300031247 Bacteria 3710
633 Ga0265340_10075396 3300031247 Bacteria 1594
634 Ga0265339_10001522 3300031249 Bacteria 17112
635 Ga0265339_10106548 3300031249 Bacteria 1454
636 Ga0265316_10006562 3300031344 Bacteria 11097
637 Ga0265316_10289717 3300031344 Bacteria 1195
638 Ga0307509_10001384 3300031507 Bacteria 41108
639 Ga0265313_10000181 3300031595 Bacteria 67263
640 Ga0265313_10007831 3300031595 Bacteria 7212
641 Ga0265313_10008019 3300031595 Bacteria 7088
642 Ga0265313_10011961 3300031595 Bacteria 5350
643 Ga0265313_10073281 3300031595 Bacteria 1572
644 Ga0265342_10005915 3300031712 Bacteria 9216
645 Ga0265342_10008745 3300031712 Bacteria 7222
646 Ga0265342_10067079 3300031712 Bacteria 2101
647 Ga0307409_100285899 3300031995 Bacteria 1527
648 Ga0316583_10032105 3300032133 Bacteria 1867
649 Ga0373958_0021183 3300034819 Bacteria 1204
650 Ga0373959_0033533 3300034820 Bacteria 1048
651 Ga0373938_0000421 3300034957 Bacteria 6838
652 Ga0373926_0007240 3300035083 Bacteria 3698
653 Ga0373928_0034835 3300035084 Bacteria 1132
654 Ga0373934_0033278 3300035086 Bacteria 2023
655 Ga0373940_0031602 3300035088 Bacteria 1414
656 Ga0373949_0001809 3300035090 Bacteria 5846
657 Ga0373951_0009831 3300035091 Bacteria 2150
658 Ga0373952_0002647 3300035092 Bacteria 3231
659 Ga0373923_0158125 3300035111 Bacteria 1033
660 Ga0373932_0001391 3300035112 Bacteria 6783
661 Ga0373939_0010614 3300035114 Bacteria 2308
662 Ga0373941_0009316 3300035115 Bacteria 2469
663 Ga0373954_0143184 3300035118 Bacteria 1167
664 Ga0373956_0100444 3300035119 Bacteria 1342
665 Ga0373957_0000917 3300035120 Bacteria 7716
666 Ga0373960_0003777 3300035121 Bacteria 3443
667 Ga0373943_0037316 3300035170 Bacteria 2332
668 Ga0373946_0002428 3300035171 Bacteria 6588
669 Ga0373946_0019518 3300035171 Bacteria 2612
670 Ga0373955_0023921 3300035172 Bacteria 3117
671 Ga0373961_0046212 3300035241 Bacteria 1275
672 Ga0373962_0003202 3300035242 Bacteria 3926
673 Ga0373924_0002733 3300035410 Bacteria 5961
674 Ga0373924_0028043 3300035410 Bacteria 2242
675 Ga0373931_0000034 3300035691 Bacteria 86665
676 Ga0373931_0001311 3300035691 Bacteria 10650
677 Ga0373931_0022363 3300035691 Bacteria 3182
678 Ga0373931_0051906 3300035691 Bacteria 2185
679 Ga0373935_0008152 3300035692 Bacteria 6280
680 Ga0373935_0147022 3300035692 Bacteria 1596
681 Ga0373935_0325535 3300035692 Bacteria 1091
682 Ga0373935_0377021 3300035692 Bacteria 1015
683 Ga0373927_0000839 3300035695 Bacteria 23542
684 Ga0373927_0099229 3300035695 Bacteria 1894
685 Ga0373927_0148020 3300035695 Bacteria 1537
686 Ga0373933_0012620 3300035724 Bacteria 4668
687 Ga0373933_0272572 3300035724 Bacteria 1092
688 Ga0373947_0000796 3300035725 Bacteria 18989
689 Ga0373947_0276004 3300035725 Bacteria 1116
690 Ga0373937_0019531 3300036401 Bacteria 6063
691 Ga0373937_0323068 3300036401 Bacteria 1460
692 Ga0316582_0001394 3300036647 Bacteria 10541
693 Ga0316582_0192382 3300036647 Bacteria 1390
694 Ga0316584_0166581 3300036712 Bacteria 1636
695 Ga0373925_0002955 3300037068 Bacteria 13418
696 Ga0373925_0021172 3300037068 Bacteria 4738
697 Ga0373925_0217275 3300037068 Bacteria 1525
698 Ga0395898_0027542 3300037466 Bacteria 5702
699 Ga0436364_0273714 3300037853 Bacteria 1285
700 Ga0436364_1209910 3300037853 Bacteria 45322
701 Ga0436364_1454759 3300037853 Bacteria 1725
702 Ga0395901_0014197 3300038443 Bacteria 8109
703 Ga0436365_1309021 3300039437 Bacteria 2428
704 Ga0436365_1311189 3300039437 Bacteria 2624
705 Ga0436365_1565429 3300039437 Bacteria 1603
706 Ga0436361_0379330 3300039447 Bacteria 1943
707 Ga0436361_0743304 3300039447 Bacteria 4652
708 Ga0439450_002141 3300042008 Bacteria 3047
709 Ga0466963_0052011 3300044694 Bacteria 2717
710 Ga0466963_0110995 3300044694 Bacteria 1883
711 Ga0466957_0028996 3300044842 Bacteria 3297
712 Ga0466957_0065742 3300044842 Bacteria 2234
713 Ga0466958_0040840 3300045836 Bacteria 2788
714 Ga0466958_0097744 3300045836 Bacteria 1822
715 Ga0466967_0151147 3300045976 Bacteria 2170
716 Ga0495592_0020986 3300046454 Bacteria 4967
717 Ga0495603_0020845 3300046455 Bacteria 3968
718 Ga0495651_0004824 3300046462 Bacteria 10317
719 Ga0495651_0017751 3300046462 Bacteria 5509
720 Ga0495580_0042600 3300046472 Bacteria 3233
721 Ga0495582_0029880 3300046473 Bacteria 2991
722 Ga0495605_0038453 3300046474 Bacteria 2400
723 Ga0495639_0038306 3300046475 Bacteria 2153
724 Ga0495662_0004502 3300046476 Bacteria 6992
725 Ga0495664_0004807 3300046477 Bacteria 7389
726 Ga0495664_0006400 3300046477 Bacteria 6504
727 Ga0495584_0094389 3300046491 Bacteria 1510
728 Ga0495594_0024062 3300046499 Bacteria 3268
729 Ga0495608_0010475 3300046511 Bacteria 6470
730 Ga0495608_0135213 3300046511 Bacteria 1576
731 Ga0495618_0000917 3300046514 Bacteria 20251
732 Ga0495618_0108433 3300046514 Bacteria 1778
733 Ga0495618_0183340 3300046514 Bacteria 1329
734 Ga0495628_0007281 3300046516 Bacteria 9588
735 Ga0495630_0011479 3300046517 Bacteria 6415
736 Ga0495630_0061315 3300046517 Bacteria 2824
737 Ga0495666_0012399 3300046526 Bacteria 4249
738 Ga0495652_0010662 3300046529 Bacteria 8324
739 Ga0495652_0021608 3300046529 Bacteria 5719
740 Ga0495652_0177800 3300046529 Bacteria 1636
741 Ga0495665_0012185 3300046531 Bacteria 4652
742 Ga0495665_0092134 3300046531 Bacteria 1593
743 Ga0495640_0003215 3300046533 Bacteria 13152
744 Ga0495640_0005374 3300046533 Bacteria 10189
745 Ga0495640_0093106 3300046533 Bacteria 1986
746 Ga0495587_0026356 3300046536 Bacteria 3545
747 Ga0495598_0014273 3300046537 Bacteria 1984
748 Ga0495645_0001763 3300046543 Bacteria 14717
749 Ga0495645_0004378 3300046543 Bacteria 9645
750 Ga0495667_0000256 3300046559 Bacteria 34418
751 Ga0495667_0092950 3300046559 Bacteria 1953
752 Ga0495634_0003473 3300046642 Bacteria 12621
753 Ga0495634_0044121 3300046642 Bacteria 3019
754 Ga0495634_0098678 3300046642 Bacteria 1889
755 Ga0495635_0001674 3300046663 Bacteria 14916
756 Ga0495635_0003010 3300046663 Bacteria 11578
757 Ga0495635_0019505 3300046663 Bacteria 4726
758 Ga0495635_0389808 3300046663 Bacteria 926
759 Ga0495588_0052958 3300046674 Bacteria 2092
760 Ga0495657_0002838 3300046675 Bacteria 14378
761 Ga0495599_0002175 3300046678 Bacteria 11380
762 Ga0495623_0008613 3300046679 Bacteria 6623
763 Ga0495646_0001535 3300046680 Bacteria 13774
764 Ga0495647_0010400 3300046681 Bacteria 3166
765 Ga0495647_0059631 3300046681 Bacteria 1503
766 Ga0495658_0040583 3300046683 Bacteria 2588
767 Ga0495613_0095948 3300046689 Bacteria 2144
768 Ga0495624_0002424 3300046690 Bacteria 14161
769 Ga0495624_0040939 3300046690 Bacteria 2966
770 Ga0495600_0008376 3300046809 Bacteria 6350
771 Ga0495581_0008086 3300047315 Bacteria 6089
772 Ga0495604_0012925 3300047317 Bacteria 6652
773 Ga0495604_0175636 3300047317 Bacteria 1502
774 Ga0495674_0001984 3300047319 Bacteria 20115
775 Ga0495674_0004803 3300047319 Bacteria 13003
776 Ga0495674_0345711 3300047319 Bacteria 1208
777 Ga0495674_0379723 3300047319 Bacteria 1143
778 Ga0495676_0299706 3300047321 Bacteria 1084
779 Ga0495680_0005564 3300047322 Bacteria 11827
780 Ga0495680_0008253 3300047322 Bacteria 9484
781 Ga0495675_0000532 3300047444 Bacteria 24684
782 Ga0495685_004853 3300047447 Bacteria 4365
783 Ga0495684_0000987 3300047471 Bacteria 23140
784 Ga0495684_0009836 3300047471 Bacteria 7378
785 Ga0495593_0082439 3300047673 Bacteria 1662
786 Ga0495602_0005750 3300048088 Bacteria 13013
787 Ga0495615_0009209 3300048090 Bacteria 1935
788 Ga0495615_0012574 3300048090 Bacteria 1748
789 Ga0496100_0000842 3300048903 Bacteria 14711
790 Ga0496100_0073931 3300048903 Bacteria 2282
791 Ga0496101_0007404 3300048904 Bacteria 7112
792 Ga0496101_0017864 3300048904 Bacteria 4814
793 Ga0496101_0077127 3300048904 Bacteria 2455
794 Ga0496101_0135469 3300048904 Bacteria 1873
795 Ga0496101_0160773 3300048904 Bacteria 1722
796 Ga0496102_0001935 3300048905 Bacteria 17830
797 Ga0496102_0011713 3300048905 Bacteria 7569
798 Ga0496102_0051622 3300048905 Bacteria 3746
799 Ga0496103_0004653 3300048906 Bacteria 8311
800 Ga0496103_0010777 3300048906 Bacteria 5409
801 Ga0496104_0011266 3300048907 Bacteria 8004
802 Ga0496104_0084266 3300048907 Bacteria 3033
803 Ga0496104_0172235 3300048907 Bacteria 2075
804 Ga0496104_0230375 3300048907 Bacteria 1764
805 Ga0496104_0642583 3300048907 Bacteria 970
806 Ga0496105_0041290 3300048908 Bacteria 3802
807 Ga0496105_0186660 3300048908 Bacteria 1696
808 Ga0496106_0000405 3300048909 Bacteria 30644
809 Ga0496106_0055867 3300048909 Bacteria 2984
810 Ga0496107_0004066 3300048910 Bacteria 9849
811 Ga0496107_0005799 3300048910 Bacteria 8453
812 Ga0496107_0034287 3300048910 Bacteria 3635
813 Ga0496107_0050462 3300048910 Bacteria 2999
814 Ga0496108_0001198 3300048911 Bacteria 20317
815 Ga0496108_0025837 3300048911 Bacteria 4842
816 Ga0496108_0032267 3300048911 Bacteria 4350
817 Ga0496108_0034437 3300048911 Bacteria 4208
818 Ga0496108_0049561 3300048911 Bacteria 3512
819 Ga0496108_0141846 3300048911 Bacteria 2070
820 Ga0496109_0151200 3300048912 Bacteria 2173
821 Ga0496110_0010646 3300048913 Bacteria 7486
822 Ga0496110_0041865 3300048913 Bacteria 3999
823 Ga0496110_0070107 3300048913 Bacteria 3105
824 Ga0496110_0494729 3300048913 Bacteria 1113
825 Ga0496111_0004338 3300048914 Bacteria 8949
826 Ga0496111_0009762 3300048914 Bacteria 6415
827 Ga0496111_0069131 3300048914 Bacteria 2568
828 Ga0496111_0194583 3300048914 Bacteria 1507
829 Ga0496112_0047842 3300048915 Bacteria 4195
830 Ga0496112_0143557 3300048915 Bacteria 2356
831 Ga0496113_0002604 3300048916 Bacteria 10547
832 Ga0496113_0079720 3300048916 Bacteria 2507
833 Ga0496113_0150213 3300048916 Bacteria 1837
834 Ga0496113_0170106 3300048916 Bacteria 1725
835 Ga0496114_0005575 3300048917 Bacteria 9865
836 Ga0496114_0016691 3300048917 Bacteria 5920
837 Ga0496114_0018204 3300048917 Bacteria 5676
838 Ga0496114_0071524 3300048917 Bacteria 2915
839 Ga0496114_0147538 3300048917 Bacteria 2040
840 Ga0496115_0053006 3300048918 Bacteria 3255
841 Ga0496115_0067368 3300048918 Bacteria 2895
842 Ga0496115_0191993 3300048918 Bacteria 1687
843 Ga0496115_0211939 3300048918 Bacteria 1600
844 Ga0496115_0478452 3300048918 Bacteria 1003
845 Ga0496119_0000893 3300048922 Bacteria 39064
846 Ga0496122_0002944 3300048925 Bacteria 23216
847 Ga0496123_0001139 3300048926 Bacteria 39727
848 Ga0501031_0228033 3300049568 Bacteria 1212
849 Ga0501032_0005175 3300049569 Bacteria 9721
850 Ga0501033_0029607 3300049570 Bacteria 4115
851 Ga0501033_0083303 3300049570 Bacteria 2344
852 Ga0501033_0129315 3300049570 Bacteria 1830
853 Ga0501034_0164419 3300049571 Bacteria 2188
854 Ga0501034_0184946 3300049571 Bacteria 2047
855 Ga0501034_0257328 3300049571 Bacteria 1689
856 Ga0501036_0009276 3300049572 Bacteria 8086
857 Ga0501036_0327333 3300049572 Bacteria 1280
858 Ga0501037_0001340 3300049573 Bacteria 18079
859 Ga0501038_0001023 3300049574 Bacteria 25193
860 Ga0501039_0015388 3300049575 Bacteria 5856
861 Ga0501039_0529808 3300049575 Bacteria 925
862 Ga0501042_0299785 3300049578 Bacteria 1161
863 Ga0501043_0025349 3300049579 Bacteria 4652
864 Ga0501043_0192196 3300049579 Bacteria 1587
865 Ga0501046_0000060 3300049580 Bacteria 125548
866 Ga0501046_0008699 3300049580 Bacteria 8822
867 Ga0501046_0038257 3300049580 Bacteria 3852
868 Ga0501047_0055872 3300049581 Bacteria 3817
869 Ga0501047_0061462 3300049581 Bacteria 3624
870 Ga0501047_0195600 3300049581 Bacteria 1884
871 Ga0501047_0419955 3300049581 Bacteria 1169
872 Ga0501048_0002666 3300049582 Bacteria 13620
873 Ga0501048_0087158 3300049582 Bacteria 2203
874 Ga0501048_0335918 3300049582 Bacteria 1077
875 Ga0501067_0005961 3300049583 Bacteria 6758
876 Ga0501067_0083621 3300049583 Bacteria 1771
877 Ga0501069_0005453 3300049585 Bacteria 6615
878 Ga0501070_0025730 3300049586 Bacteria 4936
879 Ga0501070_0043988 3300049586 Bacteria 3716
880 Ga0501070_0063526 3300049586 Bacteria 3058
881 Ga0501071_0021832 3300049587 Bacteria 4461
882 Ga0501072_0313549 3300049588 Bacteria 1247
883 Ga0501072_0374429 3300049588 Bacteria 1130
884 Ga0501072_0396274 3300049588 Bacteria 1095
885 Ga0501073_0017253 3300049589 Bacteria 5229
886 Ga0501073_0142636 3300049589 Bacteria 1660
887 Ga0501074_0008132 3300049590 Bacteria 7601
888 Ga0501074_0060646 3300049590 Bacteria 2725
889 Ga0501074_0212813 3300049590 Bacteria 1377
890 Ga0501075_0274824 3300049591 Bacteria 1284
891 Ga0501076_0106477 3300049592 Bacteria 2264
892 Ga0501077_0046198 3300049593 Bacteria 2767
893 Ga0501079_0006545 3300049741 Bacteria 8757
894 Ga0501079_0086067 3300049741 Bacteria 2433
895 Ga0501079_0426513 3300049741 Bacteria 1041
896 Ga0501080_0099237 3300049742 Bacteria 2702
897 Ga0501080_0254987 3300049742 Bacteria 1599
898 Ga0501083_0007790 3300049744 Bacteria 7588
899 Ga0501083_0012367 3300049744 Bacteria 5972
900 Ga0501083_0089078 3300049744 Bacteria 2039
901 Ga0501083_0149372 3300049744 Bacteria 1530
902 Ga0501035_0206329 3300049822 Bacteria 1683
903 Ga0501035_0294822 3300049822 Bacteria 1368
904 Ga0501035_0352720 3300049822 Bacteria 1231
905 Ga0501044_0000260 3300049823 Bacteria 67087
906 Ga0501044_0008573 3300049823 Bacteria 11199
907 Ga0501044_0010896 3300049823 Bacteria 9868
908 Ga0501044_0322843 3300049823 Bacteria 1468
909 Ga0501044_0487609 3300049823 Bacteria 1135
910 Ga0501045_0490490 3300049824 Bacteria 912
911 nmdc:mga03683_41279_c1 3300050489 Bacteria 1895
912 nmdc:mga03n38_79548_c1 3300050490 Bacteria 1537
913 nmdc:mga00v17_19362_c1 3300050491 Bacteria 3885
914 nmdc:mga0yw44_383517_c1 3300050492 Bacteria 949
915 nmdc:mga0yw44_63367_c1 3300050492 Bacteria 2273
916 nmdc:mga0yw44_75835_c1 3300050492 Bacteria 2098
917 nmdc:mga0k408_55917_c1 3300050493 Bacteria 2289
918 nmdc:mga06z11_113993_c1 3300050494 Bacteria 1500
919 nmdc:mga06z11_53313_c1 3300050494 Bacteria 2080
920 nmdc:mga04h51_29994_c1 3300050495 Bacteria 1708
921 nmdc:mga07m45_147397_c1 3300050496 Bacteria 1364
922 nmdc:mga07m45_15773_c1 3300050496 Bacteria 4037
923 nmdc:mga07m45_26560_c1 3300050496 Bacteria 3184
924 nmdc:mga07m45_27289_c1 3300050496 Bacteria 3144
925 nmdc:mga05p37_153275_c1 3300050507 Bacteria 2817
926 nmdc:mga05p37_163552_c1 3300050507 Bacteria 2717
927 nmdc:mga05p37_290189_c1 3300050507 Bacteria 1947
928 nmdc:mga05p37_354142_c1 3300050507 Bacteria 1728
929 nmdc:mga05p37_5377_c1 3300050507 Bacteria 15055
930 nmdc:mga09592_170167_c1 3300050508 Bacteria 1884
931 nmdc:mga09592_21364_c1 3300050508 Bacteria 5335
932 nmdc:mga09592_29378_c1 3300050508 Bacteria 4573
933 nmdc:mga0qj67_151963_c1 3300050509 Bacteria 1878
934 nmdc:mga0qj67_28_c1 3300050509 Bacteria 102760
935 nmdc:mga0qj67_341240_c1 3300050509 Bacteria 1212
936 nmdc:mga0qj67_82924_c1 3300050509 Bacteria 2570
937 nmdc:mga0qj67_97253_c1 3300050509 Bacteria 2370
938 nmdc:mga06r32_270079_c1 3300050510 Bacteria 1688
939 nmdc:mga06r32_322976_c1 3300050510 Bacteria 1529
940 nmdc:mga06r32_383161_c1 3300050510 Bacteria 1389
941 nmdc:mga06r32_507731_c1 3300050510 Bacteria 1182
942 nmdc:mga06r32_752703_c1 3300050510 Bacteria 937
943 nmdc:mga08y16_22572_c1 3300050511 Bacteria 6645
944 nmdc:mga08y16_409669_c1 3300050511 Bacteria 1387
945 nmdc:mga08y16_590_c1 3300050511 Bacteria 33818
946 nmdc:mga0n895_33397_c1 3300050512 Bacteria 4945
947 nmdc:mga0n895_425283_c1 3300050512 Bacteria 1342
948 nmdc:mga0n895_4459_c1 3300050512 Bacteria 11502
949 nmdc:mga0n895_947751_c1 3300050512 Bacteria 844
950 nmdc:mga0rr50_39320_c1 3300050513 Bacteria 3430
951 nmdc:mga0rr50_8026_c1 3300050513 Bacteria 6547
952 nmdc:mga0rr50_85462_c1 3300050513 Bacteria 2445
953 nmdc:mga0a205_3619_c1 3300050515 Bacteria 13829
954 nmdc:mga0a205_733_c2 3300050515 Bacteria 10917
955 nmdc:mga0sz30_4070_c1 3300050516 Bacteria 5264
956 Ga0495601_0000418 3300053077 Bacteria 22241
957 Ga0495601_0010781 3300053077 Bacteria 5453
958 Ga0495601_0012231 3300053077 Bacteria 5146
959 Ga0495601_0039644 3300053077 Bacteria 2950
960 Ga0495612_0000251 3300053078 Bacteria 22251
961 Ga0495612_0003654 3300053078 Bacteria 6376
962 Ga0495612_0138888 3300053078 Bacteria 1053
963 Ga0495595_0002778 3300053084 Bacteria 6878
964 Ga0495619_0002566 3300053085 Bacteria 11887
965 Ga0495619_0037784 3300053085 Bacteria 3149
966 Ga0495619_0090917 3300053085 Bacteria 2066
967 Ga0495619_0165320 3300053085 Bacteria 1529
968 Ga0500556_0000363 3300053104 Bacteria 33629
969 Ga0500652_003832 3300053131 Bacteria 4595
970 Ga0500568_0016297 3300053139 Bacteria 3308
971 Ga0500568_0052466 3300053139 Bacteria 1601
972 Ga0500645_024021 3300053730 Bacteria 1866
973 Ga0501084_0049531 3300054114 Bacteria 3517
974 Ga0501084_0111220 3300054114 Bacteria 2302
975 Ga0501084_0208885 3300054114 Bacteria 1647
976 Ga0501084_0275634 3300054114 Bacteria 1420
977 Ga0501084_0292547 3300054114 Bacteria 1375
978 Ga0501084_0317794 3300054114 Bacteria 1315
979 Ga0587073_0039083 3300059492 Bacteria 1024
980 Ga0587073_0044354 3300059492 Bacteria 983
981 Ga0587073_0054520 3300059492 Bacteria 917
982 Ga0587083_0049489 3300059505 Bacteria 911
983 Ga0587075_017536 3300059644 Bacteria 1031
984 Ga0501082_0007563 3300060353 Bacteria 9373
985 Ga0501082_0231755 3300060353 Bacteria 1607
986 Ga0501082_0259670 3300060353 Bacteria 1511
987 Ga0501082_0317955 3300060353 Bacteria 1356
988 Ga0530510_0164077 3300061734 Bacteria 1644

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300027907 Ga0207428_10023620 Ga0207428_100236208 225
2 3300032133 Ga0316583_10032105 Ga0316583_100321052 229
3 3300009147 Ga0114129_10353298 Ga0114129_103532982 236
4 3300049583 Ga0501067_0005961 Ga0501067_0005961_1121_1918 236
5 3300049822 Ga0501035_0294822 Ga0501035_0294822_258_1055 236
6 3300050507 nmdc:mga05p37_290189_c1 nmdc:mga05p37_290189_c1_1061_1801 236
7 3300031507 Ga0307509_10001384 Ga0307509_1000138422 237
8 3300049571 Ga0501034_0164419 Ga0501034_0164419_719_1516 237
9 3300049580 Ga0501046_0038257 Ga0501046_0038257_104_901 237
10 3300049581 Ga0501047_0195600 Ga0501047_0195600_437_1234 237
11 3300049590 Ga0501074_0008132 Ga0501074_0008132_4469_5266 237
12 3300049592 Ga0501076_0106477 Ga0501076_0106477_1379_2176 237
13 3300049744 Ga0501083_0007790 Ga0501083_0007790_6013_6810 237
14 3300049744 Ga0501083_0089078 Ga0501083_0089078_1193_1990 237
15 3300054114 Ga0501084_0292547 Ga0501084_0292547_404_1201 237
16 3300061734 Ga0530510_0164077 Ga0530510_0164077_781_1578 237
17 3300005328 Ga0070676_10182049 Ga0070676_101820492 246
18 3300005330 Ga0070690_100126144 Ga0070690_1001261443 246
19 3300005333 Ga0070677_10003757 Ga0070677_100037577 246
20 3300005343 Ga0070687_100050373 Ga0070687_1000503733 246
21 3300005354 Ga0070675_100112209 Ga0070675_1001122093 246
22 3300005355 Ga0070671_100054894 Ga0070671_1000548946 246
23 3300005356 Ga0070674_100026051 Ga0070674_1000260516 246
24 3300005364 Ga0070673_100154134 Ga0070673_1001541343 246
25 3300005365 Ga0070688_100081413 Ga0070688_1000814133 246
26 3300005455 Ga0070663_100225669 Ga0070663_1002256693 246
27 3300005456 Ga0070678_100051868 Ga0070678_1000518683 246
28 3300005459 Ga0068867_100540740 Ga0068867_1005407401 246
29 3300005543 Ga0070672_100066989 Ga0070672_1000669893 246
30 3300005718 Ga0068866_10082741 Ga0068866_100827413 246
31 3300005719 Ga0068861_100129105 Ga0068861_1001291053 246
32 3300009094 Ga0111539_10363797 Ga0111539_103637971 246
33 3300025893 Ga0207682_10010412 Ga0207682_100104124 246
34 3300025901 Ga0207688_10133339 Ga0207688_101333393 246
35 3300025907 Ga0207645_10032352 Ga0207645_100323525 246
36 3300025918 Ga0207662_10034499 Ga0207662_100344995 246
37 3300025923 Ga0207681_10203594 Ga0207681_102035942 246
38 3300025937 Ga0207669_10069684 Ga0207669_100696844 246
39 3300025940 Ga0207691_10004340 Ga0207691_1000434011 246
40 3300026121 Ga0207683_10017083 Ga0207683_100170835 246
41 3300046537 Ga0495598_0014273 Ga0495598_0014273_903_1703 246
42 3300048090 Ga0495615_0012574 Ga0495615_0012574_196_996 246
43 3300009098 Ga0105245_10142916 Ga0105245_101429163 248
44 3300025906 Ga0207699_10125698 Ga0207699_101256982 253
45 3300009094 Ga0111539_10048283 Ga0111539_100482839 254
46 3300050511 nmdc:mga08y16_22572_c1 nmdc:mga08y16_22572_c1_2514_3293 254
47 3300031249 Ga0265339_10001522 Ga0265339_100015227 256
48 3300031344 Ga0265316_10006562 Ga0265316_100065623 256
49 3300031595 Ga0265313_10000181 Ga0265313_1000018158 256
50 3300031712 Ga0265342_10008745 Ga0265342_100087452 256
51 3300006844 Ga0075428_100266783 Ga0075428_1002667832 257
52 3300006847 Ga0075431_100187571 Ga0075431_1001875712 257
53 3300009147 Ga0114129_10068674 Ga0114129_100686742 257
54 3300050507 nmdc:mga05p37_153275_c1 nmdc:mga05p37_153275_c1_1814_2602 257
55 3300050508 nmdc:mga09592_21364_c1 nmdc:mga09592_21364_c1_2782_3576 257
56 3300050509 nmdc:mga0qj67_82924_c1 nmdc:mga0qj67_82924_c1_1027_1815 257
57 3300050510 nmdc:mga06r32_270079_c1 nmdc:mga06r32_270079_c1_665_1453 257
58 iso_pu_bacteria 2842694124 2842695434 257
59 3300031344 Ga0265316_10289717 Ga0265316_102897171 258
60 3300036647 Ga0316582_0001394 Ga0316582_0001394_2523_3317 259
61 3300036712 Ga0316584_0166581 Ga0316584_0166581_788_1582 259
62 3300021361 Ga0213872_10018295 Ga0213872_100182954 261
63 3300025912 Ga0207707_10214100 Ga0207707_102141002 261
64 3300031235 Ga0265330_10156849 Ga0265330_101568491 261
65 3300031247 Ga0265340_10007163 Ga0265340_100071633 261
66 3300031249 Ga0265339_10001522 Ga0265339_1000152217 261
67 3300031595 Ga0265313_10000181 Ga0265313_1000018148 261
68 3300031712 Ga0265342_10005915 Ga0265342_100059151 261
69 3300036647 Ga0316582_0192382 Ga0316582_0192382_199_1005 261
70 3300039447 Ga0436361_0743304 Ga0436361_0743304_3102_3902 261
71 3300049571 Ga0501034_0257328 Ga0501034_0257328_753_1544 261
72 3300049581 Ga0501047_0419955 Ga0501047_0419955_98_889 261
73 3300049744 Ga0501083_0149372 Ga0501083_0149372_83_874 261
74 3300049823 Ga0501044_0322843 Ga0501044_0322843_571_1368 261
75 3300049588 Ga0501072_0396274 Ga0501072_0396274_22_816 262
76 3300049744 Ga0501083_0012367 Ga0501083_0012367_2120_2914 262
77 3300054114 Ga0501084_0049531 Ga0501084_0049531_1699_2493 262
78 3300054114 Ga0501084_0111220 Ga0501084_0111220_490_1356 262
79 3300054114 Ga0501084_0275634 Ga0501084_0275634_518_1312 262
80 3300054114 Ga0501084_0317794 Ga0501084_0317794_13_807 262
81 3300005981 Ga0081538_10004153 Ga0081538_1000415311 263
82 3300005983 Ga0081540_1003051 Ga0081540_100305111 263
83 3300006844 Ga0075428_100325983 Ga0075428_1003259833 263
84 3300006847 Ga0075431_100061408 Ga0075431_1000614085 263
85 3300006847 Ga0075431_100304756 Ga0075431_1003047563 263
86 3300009147 Ga0114129_10266962 Ga0114129_102669623 263
87 3300005471 Ga0070698_100056891 Ga0070698_1000568914 264
88 3300031241 Ga0265325_10064261 Ga0265325_100642613 264
89 3300031247 Ga0265340_10012516 Ga0265340_100125165 264
90 3300031247 Ga0265340_10017482 Ga0265340_100174823 264
91 3300031247 Ga0265340_10075396 Ga0265340_100753963 264
92 3300031249 Ga0265339_10106548 Ga0265339_101065481 264
93 3300031595 Ga0265313_10007831 Ga0265313_100078313 264
94 3300031595 Ga0265313_10008019 Ga0265313_100080199 264
95 3300031595 Ga0265313_10073281 Ga0265313_100732813 264
96 3300031712 Ga0265342_10067079 Ga0265342_100670792 264
97 3300037853 Ga0436364_0273714 Ga0436364_0273714_200_994 264
98 3300037853 Ga0436364_1209910 Ga0436364_1209910_28859_29653 264
99 3300037853 Ga0436364_1454759 Ga0436364_1454759_102_899 264
100 3300039437 Ga0436365_1311189 Ga0436365_1311189_193_987 264
101 3300048918 Ga0496115_0478452 Ga0496115_0478452_43_837 264
102 3300049580 Ga0501046_0000060 Ga0501046_0000060_115961_116767 264
103 3300005530 Ga0070679_100106382 Ga0070679_1001063823 265
104 3300006844 Ga0075428_100244896 Ga0075428_1002448962 265
105 3300006871 Ga0075434_100076390 Ga0075434_1000763904 265
106 3300025921 Ga0207652_10092934 Ga0207652_100929343 265
107 3300025936 Ga0207670_10085467 Ga0207670_100854673 265
108 3300047319 Ga0495674_0345711 Ga0495674_0345711_111_911 265
109 3300048911 Ga0496108_0141846 Ga0496108_0141846_1190_1990 265
110 3300048922 Ga0496119_0000893 Ga0496119_0000893_9218_10021 265
111 3300048925 Ga0496122_0002944 Ga0496122_0002944_13582_14385 265
112 3300048926 Ga0496123_0001139 Ga0496123_0001139_13317_14120 265
113 3300053104 Ga0500556_0000363 Ga0500556_0000363_20080_20883 265
114 3300053131 Ga0500652_003832 Ga0500652_003832_2454_3257 265
115 3300053139 Ga0500568_0016297 Ga0500568_0016297_928_1734 265
116 3300053139 Ga0500568_0052466 Ga0500568_0052466_785_1585 265
117 2209111006 2214572714 2213615974 266
118 3300000041 ARcpr5oldR_c000130 ARcpr5oldR_00013012 266
119 3300000042 ARSoilYngRDRAFT_c00118 ARSoilYngRDRAFT_0011812 266
120 3300000043 ARcpr5yngRDRAFT_c000035 ARcpr5yngRDRAFT_0000358 266
121 3300000652 ARCol0yngRDRAFT_1000209 ARCol0yngRDRAFT_10002096 266
122 3300001976 JGI24752J21851_1013069 JGI24752J21851_10130692 266
123 3300001977 JGI24746J21847_1000683 JGI24746J21847_10006835 266
124 3300001978 JGI24747J21853_1003746 JGI24747J21853_10037463 266
125 3300001989 JGI24739J22299_10000158 JGI24739J22299_1000015818 266
126 3300001990 JGI24737J22298_10001510 JGI24737J22298_100015108 266
127 3300001990 JGI24737J22298_10001948 JGI24737J22298_100019483 266
128 3300001991 JGI24743J22301_10018083 JGI24743J22301_100180831 266
129 3300002073 JGI24745J21846_1001135 JGI24745J21846_10011354 266
130 3300002074 JGI24748J21848_1000574 JGI24748J21848_10005745 266
131 3300002074 JGI24748J21848_1000699 JGI24748J21848_10006995 266
132 3300002075 JGI24738J21930_10003334 JGI24738J21930_100033345 266
133 3300002076 JGI24749J21850_1005514 JGI24749J21850_10055141 266
134 3300002076 JGI24749J21850_1012555 JGI24749J21850_10125552 266
135 3300002077 JGI24744J21845_10001094 JGI24744J21845_100010946 266
136 3300002126 JGI24035J26624_1000023 JGI24035J26624_10000238 266
137 3300002155 JGI24033J26618_1001768 JGI24033J26618_10017683 266
138 3300002239 JGI24034J26672_10001325 JGI24034J26672_100013255 266
139 3300002244 JGI24742J22300_10000706 JGI24742J22300_100007065 266
140 3300002459 JGI24751J29686_10002998 JGI24751J29686_100029983 266
141 3300002459 JGI24751J29686_10008505 JGI24751J29686_100085052 266
142 3300003911 JGI25405J52794_10031077 JGI25405J52794_100310771 266
143 3300005290 Ga0065712_10007917 Ga0065712_100079176 266
144 3300005290 Ga0065712_10089850 Ga0065712_100898503 266
145 3300005293 Ga0065715_10089004 Ga0065715_1008900420 266
146 3300005295 Ga0065707_10143694 Ga0065707_101436941 266
147 3300005327 Ga0070658_10006919 Ga0070658_100069197 266
148 3300005328 Ga0070676_10001138 Ga0070676_100011386 266
149 3300005328 Ga0070676_10126576 Ga0070676_101265762 266
150 3300005329 Ga0070683_100163764 Ga0070683_1001637643 266
151 3300005330 Ga0070690_100000727 Ga0070690_1000007278 266
152 3300005331 Ga0070670_100004168 Ga0070670_1000041687 266
153 3300005331 Ga0070670_100060563 Ga0070670_1000605635 266
154 3300005331 Ga0070670_100110934 Ga0070670_1001109343 266
155 3300005333 Ga0070677_10003207 Ga0070677_100032075 266
156 3300005334 Ga0068869_100087385 Ga0068869_1000873851 266
157 3300005335 Ga0070666_10018444 Ga0070666_100184442 266
158 3300005335 Ga0070666_10018621 Ga0070666_100186212 266
159 3300005336 Ga0070680_100006389 Ga0070680_1000063894 266
160 3300005336 Ga0070680_100024710 Ga0070680_1000247104 266
161 3300005336 Ga0070680_100067076 Ga0070680_1000670761 266
162 3300005336 Ga0070680_100135083 Ga0070680_1001350831 266
163 3300005336 Ga0070680_100193681 Ga0070680_1001936813 266
164 3300005337 Ga0070682_100007941 Ga0070682_1000079413 266
165 3300005337 Ga0070682_100096561 Ga0070682_1000965613 266
166 3300005338 Ga0068868_100000944 Ga0068868_10000094420 266
167 3300005338 Ga0068868_100050586 Ga0068868_1000505865 266
168 3300005338 Ga0068868_100115031 Ga0068868_1001150314 266
169 3300005338 Ga0068868_100302318 Ga0068868_1003023182 266
170 3300005339 Ga0070660_100015021 Ga0070660_1000150215 266
171 3300005339 Ga0070660_100048298 Ga0070660_1000482983 266
172 3300005339 Ga0070660_100084985 Ga0070660_1000849854 266
173 3300005339 Ga0070660_100117966 Ga0070660_1001179661 266
174 3300005339 Ga0070660_100126808 Ga0070660_1001268081 266
175 3300005339 Ga0070660_100143923 Ga0070660_1001439232 266
176 3300005340 Ga0070689_100000646 Ga0070689_10000064619 266
177 3300005340 Ga0070689_100002989 Ga0070689_1000029892 266
178 3300005340 Ga0070689_100006613 Ga0070689_1000066137 266
179 3300005340 Ga0070689_100009931 Ga0070689_1000099317 266
180 3300005340 Ga0070689_100027299 Ga0070689_1000272993 266
181 3300005340 Ga0070689_100086479 Ga0070689_1000864792 266
182 3300005341 Ga0070691_10000125 Ga0070691_100001255 266
183 3300005343 Ga0070687_100000773 Ga0070687_1000007735 266
184 3300005343 Ga0070687_100115673 Ga0070687_1001156732 266
185 3300005344 Ga0070661_100013869 Ga0070661_1000138695 266
186 3300005344 Ga0070661_100018561 Ga0070661_1000185614 266
187 3300005345 Ga0070692_10038970 Ga0070692_100389705 266
188 3300005353 Ga0070669_100172652 Ga0070669_1001726523 266
189 3300005354 Ga0070675_100005686 Ga0070675_1000056869 266
190 3300005355 Ga0070671_100000170 Ga0070671_1000001704 266
191 3300005355 Ga0070671_100032596 Ga0070671_1000325964 266
192 3300005355 Ga0070671_100053267 Ga0070671_1000532672 266
193 3300005356 Ga0070674_100053517 Ga0070674_1000535174 266
194 3300005364 Ga0070673_100015366 Ga0070673_1000153661 266
195 3300005364 Ga0070673_100020936 Ga0070673_1000209365 266
196 3300005364 Ga0070673_100136776 Ga0070673_1001367762 266
197 3300005365 Ga0070688_100001455 Ga0070688_10000145514 266
198 3300005365 Ga0070688_100002194 Ga0070688_1000021948 266
199 3300005365 Ga0070688_100008402 Ga0070688_1000084025 266
200 3300005365 Ga0070688_100091355 Ga0070688_1000913552 266
201 3300005366 Ga0070659_100000621 Ga0070659_10000062123 266
202 3300005366 Ga0070659_100128803 Ga0070659_1001288032 266
203 3300005367 Ga0070667_100044536 Ga0070667_1000445364 266
204 3300005367 Ga0070667_100133608 Ga0070667_1001336081 266
205 3300005367 Ga0070667_100139072 Ga0070667_1001390721 266
206 3300005406 Ga0070703_10001450 Ga0070703_100014503 266
207 3300005434 Ga0070709_10006995 Ga0070709_100069955 266
208 3300005434 Ga0070709_10019522 Ga0070709_100195224 266
209 3300005434 Ga0070709_10113191 Ga0070709_101131913 266
210 3300005435 Ga0070714_100037912 Ga0070714_1000379124 266
211 3300005435 Ga0070714_100095284 Ga0070714_1000952844 266
212 3300005435 Ga0070714_100099561 Ga0070714_1000995612 266
213 3300005436 Ga0070713_100019242 Ga0070713_1000192425 266
214 3300005436 Ga0070713_100029152 Ga0070713_1000291523 266
215 3300005436 Ga0070713_100067156 Ga0070713_1000671561 266
216 3300005436 Ga0070713_100167387 Ga0070713_1001673871 266
217 3300005436 Ga0070713_100256266 Ga0070713_1002562662 266
218 3300005437 Ga0070710_10014458 Ga0070710_100144585 266
219 3300005437 Ga0070710_10016436 Ga0070710_100164362 266
220 3300005437 Ga0070710_10062381 Ga0070710_100623812 266
221 3300005439 Ga0070711_100008373 Ga0070711_1000083737 266
222 3300005439 Ga0070711_100050862 Ga0070711_1000508622 266
223 3300005439 Ga0070711_100336725 Ga0070711_1003367251 266
224 3300005440 Ga0070705_100004061 Ga0070705_1000040611 266
225 3300005440 Ga0070705_100172914 Ga0070705_1001729142 266
226 3300005441 Ga0070700_100080805 Ga0070700_1000808051 266
227 3300005444 Ga0070694_100002007 Ga0070694_1000020078 266
228 3300005444 Ga0070694_100004869 Ga0070694_1000048694 266
229 3300005445 Ga0070708_100053874 Ga0070708_1000538743 266
230 3300005455 Ga0070663_100016477 Ga0070663_1000164775 266
231 3300005455 Ga0070663_100030911 Ga0070663_1000309112 266
232 3300005455 Ga0070663_100076820 Ga0070663_1000768202 266
233 3300005456 Ga0070678_100073272 Ga0070678_1000732724 266
234 3300005456 Ga0070678_100109769 Ga0070678_1001097692 266
235 3300005457 Ga0070662_100016774 Ga0070662_1000167744 266
236 3300005457 Ga0070662_100033442 Ga0070662_1000334425 266
237 3300005457 Ga0070662_100050943 Ga0070662_1000509435 266
238 3300005458 Ga0070681_10004332 Ga0070681_100043328 266
239 3300005458 Ga0070681_10016792 Ga0070681_100167924 266
240 3300005458 Ga0070681_10017562 Ga0070681_100175624 266
241 3300005458 Ga0070681_10034345 Ga0070681_100343455 266
242 3300005458 Ga0070681_10101784 Ga0070681_101017841 266
243 3300005458 Ga0070681_10131805 Ga0070681_101318053 266
244 3300005459 Ga0068867_100007473 Ga0068867_1000074735 266
245 3300005466 Ga0070685_10018648 Ga0070685_100186483 266
246 3300005466 Ga0070685_10019896 Ga0070685_100198964 266
247 3300005466 Ga0070685_10034894 Ga0070685_100348943 266
248 3300005471 Ga0070698_100141478 Ga0070698_1001414782 266
249 3300005518 Ga0070699_100065967 Ga0070699_1000659675 266
250 3300005518 Ga0070699_100148577 Ga0070699_1001485774 266
251 3300005530 Ga0070679_100021073 Ga0070679_1000210733 266
252 3300005530 Ga0070679_100102549 Ga0070679_1001025492 266
253 3300005530 Ga0070679_100592576 Ga0070679_1005925761 266
254 3300005535 Ga0070684_100005730 Ga0070684_1000057309 266
255 3300005535 Ga0070684_100096228 Ga0070684_1000962283 266
256 3300005539 Ga0068853_100073930 Ga0068853_1000739303 266
257 3300005539 Ga0068853_100175892 Ga0068853_1001758923 266
258 3300005539 Ga0068853_100239910 Ga0068853_1002399101 266
259 3300005543 Ga0070672_100000557 Ga0070672_1000005574 266
260 3300005543 Ga0070672_100154999 Ga0070672_1001549992 266
261 3300005543 Ga0070672_100372903 Ga0070672_1003729031 266
262 3300005544 Ga0070686_100002869 Ga0070686_1000028697 266
263 3300005544 Ga0070686_100003376 Ga0070686_1000033765 266
264 3300005544 Ga0070686_100010566 Ga0070686_1000105664 266
265 3300005544 Ga0070686_100077078 Ga0070686_1000770782 266
266 3300005545 Ga0070695_100009085 Ga0070695_1000090854 266
267 3300005546 Ga0070696_100026503 Ga0070696_1000265033 266
268 3300005546 Ga0070696_100133658 Ga0070696_1001336583 266
269 3300005547 Ga0070693_100009465 Ga0070693_1000094654 266
270 3300005548 Ga0070665_100021216 Ga0070665_1000212166 266
271 3300005549 Ga0070704_100004070 Ga0070704_1000040703 266
272 3300005549 Ga0070704_100008436 Ga0070704_1000084365 266
273 3300005563 Ga0068855_100016277 Ga0068855_1000162773 266
274 3300005563 Ga0068855_100106615 Ga0068855_1001066152 266
275 3300005563 Ga0068855_100303236 Ga0068855_1003032362 266
276 3300005564 Ga0070664_100000263 Ga0070664_10000026344 266
277 3300005564 Ga0070664_100033520 Ga0070664_1000335205 266
278 3300005564 Ga0070664_100052452 Ga0070664_1000524523 266
279 3300005564 Ga0070664_100086013 Ga0070664_1000860132 266
280 3300005564 Ga0070664_100171002 Ga0070664_1001710021 266
281 3300005577 Ga0068857_100000888 Ga0068857_10000088811 266
282 3300005577 Ga0068857_100032844 Ga0068857_1000328443 266
283 3300005578 Ga0068854_100005378 Ga0068854_1000053785 266
284 3300005614 Ga0068856_100003260 Ga0068856_1000032605 266
285 3300005614 Ga0068856_100384779 Ga0068856_1003847792 266
286 3300005615 Ga0070702_100001911 Ga0070702_1000019114 266
287 3300005616 Ga0068852_100000579 Ga0068852_10000057918 266
288 3300005616 Ga0068852_100020377 Ga0068852_1000203778 266
289 3300005616 Ga0068852_100156337 Ga0068852_1001563371 266
290 3300005617 Ga0068859_100003690 Ga0068859_10000369014 266
291 3300005617 Ga0068859_100047890 Ga0068859_1000478903 266
292 3300005617 Ga0068859_100077356 Ga0068859_1000773562 266
293 3300005617 Ga0068859_100154435 Ga0068859_1001544352 266
294 3300005617 Ga0068859_100206704 Ga0068859_1002067041 266
295 3300005618 Ga0068864_100001260 Ga0068864_10000126014 266
296 3300005618 Ga0068864_100032661 Ga0068864_1000326615 266
297 3300005618 Ga0068864_100082174 Ga0068864_1000821745 266
298 3300005718 Ga0068866_10001077 Ga0068866_100010779 266
299 3300005719 Ga0068861_100001782 Ga0068861_1000017826 266
300 3300005719 Ga0068861_100033648 Ga0068861_1000336483 266
301 3300005719 Ga0068861_100291730 Ga0068861_1002917301 266
302 3300005834 Ga0068851_10200170 Ga0068851_102001701 266
303 3300005840 Ga0068870_10000108 Ga0068870_1000010815 266
304 3300005841 Ga0068863_100001201 Ga0068863_1000012016 266
305 3300005841 Ga0068863_100025548 Ga0068863_1000255486 266
306 3300005841 Ga0068863_100064839 Ga0068863_1000648392 266
307 3300005842 Ga0068858_100000419 Ga0068858_10000041936 266
308 3300005842 Ga0068858_100027844 Ga0068858_1000278444 266
309 3300005842 Ga0068858_100046567 Ga0068858_1000465673 266
310 3300005842 Ga0068858_100181425 Ga0068858_1001814251 266
311 3300005842 Ga0068858_100327084 Ga0068858_1003270841 266
312 3300005843 Ga0068860_100001359 Ga0068860_10000135920 266
313 3300005843 Ga0068860_100020550 Ga0068860_1000205506 266
314 3300005843 Ga0068860_100059646 Ga0068860_1000596462 266
315 3300005843 Ga0068860_100162464 Ga0068860_1001624642 266
316 3300005844 Ga0068862_100005815 Ga0068862_1000058155 266
317 3300005844 Ga0068862_100217261 Ga0068862_1002172611 266
318 3300005844 Ga0068862_100438684 Ga0068862_1004386842 266
319 3300005844 Ga0068862_100689519 Ga0068862_1006895191 266
320 3300005937 Ga0081455_10000009 Ga0081455_1000000923 266
321 3300005937 Ga0081455_10004299 Ga0081455_100042995 266
322 3300005937 Ga0081455_10009512 Ga0081455_100095128 266
323 3300005937 Ga0081455_10031917 Ga0081455_100319173 266
324 3300005937 Ga0081455_10052863 Ga0081455_100528634 266
325 3300005937 Ga0081455_10109166 Ga0081455_101091662 266
326 3300005981 Ga0081538_10025193 Ga0081538_100251936 266
327 3300005981 Ga0081538_10123568 Ga0081538_101235681 266
328 3300005985 Ga0081539_10002606 Ga0081539_100026068 266
329 3300006028 Ga0070717_10012616 Ga0070717_100126166 266
330 3300006028 Ga0070717_10060095 Ga0070717_100600955 266
331 3300006028 Ga0070717_10166732 Ga0070717_101667321 266
332 3300006038 Ga0075365_10061816 Ga0075365_100618163 266
333 3300006038 Ga0075365_10382844 Ga0075365_103828441 266
334 3300006042 Ga0075368_10015550 Ga0075368_100155504 266
335 3300006042 Ga0075368_10041123 Ga0075368_100411233 266
336 3300006058 Ga0075432_10005568 Ga0075432_100055683 266
337 3300006058 Ga0075432_10024861 Ga0075432_100248613 266
338 3300006058 Ga0075432_10102466 Ga0075432_101024661 266
339 3300006163 Ga0070715_10008072 Ga0070715_100080724 266
340 3300006173 Ga0070716_100004485 Ga0070716_1000044855 266
341 3300006173 Ga0070716_100049983 Ga0070716_1000499832 266
342 3300006173 Ga0070716_100515807 Ga0070716_1005158071 266
343 3300006175 Ga0070712_100005677 Ga0070712_1000056776 266
344 3300006175 Ga0070712_100005829 Ga0070712_1000058294 266
345 3300006175 Ga0070712_100011711 Ga0070712_1000117115 266
346 3300006175 Ga0070712_100026436 Ga0070712_1000264362 266
347 3300006175 Ga0070712_100040984 Ga0070712_1000409843 266
348 3300006175 Ga0070712_100123361 Ga0070712_1001233613 266
349 3300006178 Ga0075367_10023664 Ga0075367_100236643 266
350 3300006195 Ga0075366_10006561 Ga0075366_100065613 266
351 3300006237 Ga0097621_100002584 Ga0097621_10000258414 266
352 3300006237 Ga0097621_100012651 Ga0097621_1000126515 266
353 3300006237 Ga0097621_100043375 Ga0097621_1000433753 266
354 3300006353 Ga0075370_10029418 Ga0075370_100294184 266
355 3300006353 Ga0075370_10031420 Ga0075370_100314202 266
356 3300006358 Ga0068871_100000417 Ga0068871_10000041715 266
357 3300006358 Ga0068871_100011895 Ga0068871_1000118957 266
358 3300006358 Ga0068871_100013278 Ga0068871_1000132785 266
359 3300006844 Ga0075428_100003881 Ga0075428_1000038818 266
360 3300006844 Ga0075428_100131390 Ga0075428_1001313901 266
361 3300006844 Ga0075428_100248253 Ga0075428_1002482532 266
362 3300006844 Ga0075428_100300619 Ga0075428_1003006191 266
363 3300006846 Ga0075430_100001576 Ga0075430_10000157616 266
364 3300006846 Ga0075430_100003854 Ga0075430_10000385410 266
365 3300006846 Ga0075430_100019980 Ga0075430_1000199804 266
366 3300006846 Ga0075430_100022460 Ga0075430_1000224606 266
367 3300006846 Ga0075430_100157543 Ga0075430_1001575433 266
368 3300006846 Ga0075430_100346115 Ga0075430_1003461151 266
369 3300006847 Ga0075431_100003990 Ga0075431_1000039909 266
370 3300006847 Ga0075431_100071416 Ga0075431_1000714166 266
371 3300006847 Ga0075431_100133607 Ga0075431_1001336072 266
372 3300006847 Ga0075431_100150388 Ga0075431_1001503883 266
373 3300006847 Ga0075431_100231619 Ga0075431_1002316193 266
374 3300006852 Ga0075433_10000187 Ga0075433_1000018737 266
375 3300006852 Ga0075433_10140923 Ga0075433_101409233 266
376 3300006852 Ga0075433_10172118 Ga0075433_101721181 266
377 3300006871 Ga0075434_100001354 Ga0075434_10000135413 266
378 3300006871 Ga0075434_100002767 Ga0075434_10000276715 266
379 3300006871 Ga0075434_100050801 Ga0075434_1000508015 266
380 3300006871 Ga0075434_100084508 Ga0075434_1000845085 266
381 3300006871 Ga0075434_100085012 Ga0075434_1000850123 266
382 3300006871 Ga0075434_100420353 Ga0075434_1004203532 266
383 3300006880 Ga0075429_100027801 Ga0075429_1000278014 266
384 3300006880 Ga0075429_100149796 Ga0075429_1001497962 266
385 3300006880 Ga0075429_100212877 Ga0075429_1002128771 266
386 3300006881 Ga0068865_100000450 Ga0068865_1000004508 266
387 3300006881 Ga0068865_100075220 Ga0068865_1000752203 266
388 3300006914 Ga0075436_100034598 Ga0075436_1000345985 266
389 3300006914 Ga0075436_100304814 Ga0075436_1003048141 266
390 3300006931 Ga0097620_100003690 Ga0097620_10000369014 266
391 3300006931 Ga0097620_100047890 Ga0097620_1000478903 266
392 3300006931 Ga0097620_100077356 Ga0097620_1000773565 266
393 3300006931 Ga0097620_100154423 Ga0097620_1001544232 266
394 3300006931 Ga0097620_100206713 Ga0097620_1002067132 266
395 3300007076 Ga0075435_100036177 Ga0075435_1000361773 266
396 3300007076 Ga0075435_100425497 Ga0075435_1004254972 266
397 3300007788 Ga0099795_10003382 Ga0099795_100033822 266
398 3300007788 Ga0099795_10062088 Ga0099795_100620882 266
399 3300009036 Ga0105244_10121696 Ga0105244_101216961 266
400 3300009093 Ga0105240_10038333 Ga0105240_100383336 266
401 3300009094 Ga0111539_10006363 Ga0111539_100063635 266
402 3300009094 Ga0111539_10039525 Ga0111539_100395254 266
403 3300009094 Ga0111539_10201534 Ga0111539_102015342 266
404 3300009094 Ga0111539_10886496 Ga0111539_108864961 266
405 3300009098 Ga0105245_10000898 Ga0105245_1000089826 266
406 3300009098 Ga0105245_10019401 Ga0105245_100194017 266
407 3300009098 Ga0105245_10058770 Ga0105245_100587701 266
408 3300009101 Ga0105247_10003526 Ga0105247_100035263 266
409 3300009101 Ga0105247_10052803 Ga0105247_100528033 266
410 3300009147 Ga0114129_10000995 Ga0114129_1000099527 266
411 3300009147 Ga0114129_10043385 Ga0114129_100433858 266
412 3300009147 Ga0114129_10066405 Ga0114129_100664055 266
413 3300009148 Ga0105243_10002051 Ga0105243_1000205115 266
414 3300009148 Ga0105243_10089977 Ga0105243_100899772 266
415 3300009148 Ga0105243_10203901 Ga0105243_102039012 266
416 3300009148 Ga0105243_10708890 Ga0105243_107088901 266
417 3300009174 Ga0105241_10001526 Ga0105241_1000152615 266
418 3300009174 Ga0105241_10152988 Ga0105241_101529883 266
419 3300009176 Ga0105242_10000399 Ga0105242_1000039926 266
420 3300009176 Ga0105242_10247102 Ga0105242_102471023 266
421 3300009177 Ga0105248_10004145 Ga0105248_1000414510 266
422 3300009177 Ga0105248_10026703 Ga0105248_100267033 266
423 3300009177 Ga0105248_10031820 Ga0105248_100318206 266
424 3300009177 Ga0105248_10078259 Ga0105248_100782594 266
425 3300009177 Ga0105248_10081870 Ga0105248_100818704 266
426 3300009177 Ga0105248_10095812 Ga0105248_100958123 266
427 3300009177 Ga0105248_10571375 Ga0105248_105713751 266
428 3300009545 Ga0105237_10006666 Ga0105237_100066668 266
429 3300009545 Ga0105237_10075814 Ga0105237_100758142 266
430 3300009551 Ga0105238_10017057 Ga0105238_100170576 266
431 3300009551 Ga0105238_10059456 Ga0105238_100594563 266
432 3300009551 Ga0105238_10100771 Ga0105238_101007711 266
433 3300009551 Ga0105238_10171795 Ga0105238_101717951 266
434 3300009551 Ga0105238_10183822 Ga0105238_101838224 266
435 3300009553 Ga0105249_10002756 Ga0105249_1000275610 266
436 3300010159 Ga0099796_10023205 Ga0099796_100232052 266
437 3300010375 Ga0105239_10009796 Ga0105239_100097962 266
438 3300010375 Ga0105239_10184640 Ga0105239_101846402 266
439 3300010375 Ga0105239_10432739 Ga0105239_104327391 266
440 3300011119 Ga0105246_10000033 Ga0105246_1000003336 266
441 3300011119 Ga0105246_10188930 Ga0105246_101889303 266
442 3300011119 Ga0105246_10223477 Ga0105246_102234772 266
443 3300013100 Ga0157373_10006645 Ga0157373_100066459 266
444 3300013102 Ga0157371_10033300 Ga0157371_100333001 266
445 3300013102 Ga0157371_10068893 Ga0157371_100688931 266
446 3300013104 Ga0157370_10198539 Ga0157370_101985393 266
447 3300013296 Ga0157374_10002423 Ga0157374_100024235 266
448 3300013296 Ga0157374_10054544 Ga0157374_100545444 266
449 3300013296 Ga0157374_10444840 Ga0157374_104448401 266
450 3300013297 Ga0157378_10011328 Ga0157378_100113288 266
451 3300013306 Ga0163162_10001526 Ga0163162_100015263 266
452 3300013306 Ga0163162_10068838 Ga0163162_100688384 266
453 3300013306 Ga0163162_10642162 Ga0163162_106421622 266
454 3300013306 Ga0163162_10795344 Ga0163162_107953441 266
455 3300013307 Ga0157372_10001162 Ga0157372_1000116226 266
456 3300013308 Ga0157375_10000124 Ga0157375_1000012468 266
457 3300013308 Ga0157375_10017274 Ga0157375_100172742 266
458 3300013308 Ga0157375_10217286 Ga0157375_102172863 266
459 3300013308 Ga0157375_10614352 Ga0157375_106143522 266
460 3300014325 Ga0163163_10000745 Ga0163163_100007457 266
461 3300014325 Ga0163163_10019246 Ga0163163_100192466 266
462 3300014326 Ga0157380_10000140 Ga0157380_1000014018 266
463 3300014326 Ga0157380_10064645 Ga0157380_100646453 266
464 3300014745 Ga0157377_10000117 Ga0157377_1000011752 266
465 3300014968 Ga0157379_10000785 Ga0157379_1000078518 266
466 3300014968 Ga0157379_10317925 Ga0157379_103179251 266
467 3300014968 Ga0157379_10393996 Ga0157379_103939961 266
468 3300014969 Ga0157376_10000034 Ga0157376_100000348 266
469 3300014969 Ga0157376_10023138 Ga0157376_100231383 266
470 3300017792 Ga0163161_10000448 Ga0163161_1000044838 266
471 3300017792 Ga0163161_10250117 Ga0163161_102501171 266
472 3300020078 Ga0206352_10618637 Ga0206352_106186371 266
473 3300020080 Ga0206350_10087095 Ga0206350_100870951 266
474 3300021358 Ga0213873_10076792 Ga0213873_100767921 266
475 3300021388 Ga0213875_10000025 Ga0213875_10000025118 266
476 3300024225 Ga0224572_1005633 Ga0224572_10056332 266
477 3300024227 Ga0228598_1003747 Ga0228598_10037474 266
478 3300024227 Ga0228598_1019940 Ga0228598_10199402 266
479 3300025271 Ga0207666_1000017 Ga0207666_10000179 266
480 3300025271 Ga0207666_1000125 Ga0207666_100012512 266
481 3300025290 Ga0207673_1000060 Ga0207673_100006012 266
482 3300025315 Ga0207697_10000009 Ga0207697_1000000926 266
483 3300025315 Ga0207697_10001569 Ga0207697_100015699 266
484 3300025735 Ga0207713_1032298 Ga0207713_10322982 266
485 3300025885 Ga0207653_10001876 Ga0207653_100018765 266
486 3300025885 Ga0207653_10015121 Ga0207653_100151212 266
487 3300025893 Ga0207682_10000301 Ga0207682_100003015 266
488 3300025898 Ga0207692_10005014 Ga0207692_100050141 266
489 3300025898 Ga0207692_10019482 Ga0207692_100194822 266
490 3300025898 Ga0207692_10083224 Ga0207692_100832241 266
491 3300025899 Ga0207642_10002547 Ga0207642_100025476 266
492 3300025899 Ga0207642_10317890 Ga0207642_103178901 266
493 3300025900 Ga0207710_10011377 Ga0207710_100113774 266
494 3300025900 Ga0207710_10013038 Ga0207710_100130385 266
495 3300025900 Ga0207710_10036104 Ga0207710_100361042 266
496 3300025901 Ga0207688_10000012 Ga0207688_1000001219 266
497 3300025901 Ga0207688_10005642 Ga0207688_100056425 266
498 3300025903 Ga0207680_10004369 Ga0207680_100043692 266
499 3300025903 Ga0207680_10027612 Ga0207680_100276124 266
500 3300025903 Ga0207680_10335967 Ga0207680_103359671 266
501 3300025904 Ga0207647_10005111 Ga0207647_100051115 266
502 3300025904 Ga0207647_10005834 Ga0207647_100058348 266
503 3300025905 Ga0207685_10013690 Ga0207685_100136902 266
504 3300025905 Ga0207685_10044633 Ga0207685_100446332 266
505 3300025906 Ga0207699_10005829 Ga0207699_100058295 266
506 3300025906 Ga0207699_10100296 Ga0207699_101002961 266
507 3300025907 Ga0207645_10000124 Ga0207645_1000012427 266
508 3300025907 Ga0207645_10036464 Ga0207645_100364644 266
509 3300025907 Ga0207645_10054407 Ga0207645_100544073 266
510 3300025908 Ga0207643_10000046 Ga0207643_100000467 266
511 3300025908 Ga0207643_10080377 Ga0207643_100803772 266
512 3300025909 Ga0207705_10108072 Ga0207705_101080722 266
513 3300025911 Ga0207654_10003867 Ga0207654_100038674 266
514 3300025911 Ga0207654_10062488 Ga0207654_100624882 266
515 3300025912 Ga0207707_10036253 Ga0207707_100362532 266
516 3300025912 Ga0207707_10190039 Ga0207707_101900391 266
517 3300025912 Ga0207707_10350297 Ga0207707_103502971 266
518 3300025913 Ga0207695_10065683 Ga0207695_100656831 266
519 3300025913 Ga0207695_10184013 Ga0207695_101840132 266
520 3300025914 Ga0207671_10127298 Ga0207671_101272984 266
521 3300025914 Ga0207671_10228930 Ga0207671_102289303 266
522 3300025915 Ga0207693_10004620 Ga0207693_100046203 266
523 3300025915 Ga0207693_10005130 Ga0207693_100051306 266
524 3300025915 Ga0207693_10013189 Ga0207693_100131895 266
525 3300025915 Ga0207693_10046296 Ga0207693_100462965 266
526 3300025915 Ga0207693_10172981 Ga0207693_101729812 266
527 3300025916 Ga0207663_10011495 Ga0207663_100114955 266
528 3300025916 Ga0207663_10163433 Ga0207663_101634333 266
529 3300025916 Ga0207663_10214114 Ga0207663_102141142 266
530 3300025917 Ga0207660_10000489 Ga0207660_100004892 266
531 3300025917 Ga0207660_10020291 Ga0207660_100202915 266
532 3300025917 Ga0207660_10049252 Ga0207660_100492522 266
533 3300025917 Ga0207660_10202880 Ga0207660_102028803 266
534 3300025917 Ga0207660_10277299 Ga0207660_102772991 266
535 3300025918 Ga0207662_10008508 Ga0207662_100085087 266
536 3300025918 Ga0207662_10025829 Ga0207662_100258295 266
537 3300025918 Ga0207662_10076811 Ga0207662_100768113 266
538 3300025918 Ga0207662_10115546 Ga0207662_101155462 266
539 3300025919 Ga0207657_10000162 Ga0207657_1000016246 266
540 3300025919 Ga0207657_10008982 Ga0207657_100089827 266
541 3300025919 Ga0207657_10039314 Ga0207657_100393143 266
542 3300025919 Ga0207657_10085018 Ga0207657_100850185 266
543 3300025919 Ga0207657_10223662 Ga0207657_102236621 266
544 3300025920 Ga0207649_10000798 Ga0207649_1000079819 266
545 3300025920 Ga0207649_10412506 Ga0207649_104125062 266
546 3300025921 Ga0207652_10028398 Ga0207652_100283984 266
547 3300025921 Ga0207652_10137907 Ga0207652_101379072 266
548 3300025921 Ga0207652_10534187 Ga0207652_105341871 266
549 3300025922 Ga0207646_10059826 Ga0207646_100598264 266
550 3300025922 Ga0207646_10673409 Ga0207646_106734091 266
551 3300025923 Ga0207681_10011712 Ga0207681_100117126 266
552 3300025924 Ga0207694_10043046 Ga0207694_100430464 266
553 3300025924 Ga0207694_10065822 Ga0207694_100658224 266
554 3300025924 Ga0207694_10102049 Ga0207694_101020494 266
555 3300025924 Ga0207694_10218328 Ga0207694_102183281 266
556 3300025925 Ga0207650_10087109 Ga0207650_100871093 266
557 3300025926 Ga0207659_10000017 Ga0207659_100000176 266
558 3300025927 Ga0207687_10006873 Ga0207687_100068735 266
559 3300025927 Ga0207687_10024743 Ga0207687_100247432 266
560 3300025927 Ga0207687_10188644 Ga0207687_101886442 266
561 3300025927 Ga0207687_10406477 Ga0207687_104064771 266
562 3300025928 Ga0207700_10001122 Ga0207700_1000112218 266
563 3300025928 Ga0207700_10178476 Ga0207700_101784763 266
564 3300025929 Ga0207664_10044126 Ga0207664_100441261 266
565 3300025929 Ga0207664_10082606 Ga0207664_100826063 266
566 3300025929 Ga0207664_10086393 Ga0207664_100863932 266
567 3300025929 Ga0207664_10103171 Ga0207664_101031713 266
568 3300025931 Ga0207644_10012971 Ga0207644_100129715 266
569 3300025931 Ga0207644_10013070 Ga0207644_100130705 266
570 3300025931 Ga0207644_10036024 Ga0207644_100360241 266
571 3300025931 Ga0207644_10043725 Ga0207644_100437256 266
572 3300025931 Ga0207644_10510269 Ga0207644_105102691 266
573 3300025932 Ga0207690_10000151 Ga0207690_1000015159 266
574 3300025933 Ga0207706_10000368 Ga0207706_100003689 266
575 3300025933 Ga0207706_10007484 Ga0207706_100074844 266
576 3300025933 Ga0207706_10008477 Ga0207706_100084775 266
577 3300025933 Ga0207706_10017363 Ga0207706_100173632 266
578 3300025933 Ga0207706_10018620 Ga0207706_100186202 266
579 3300025934 Ga0207686_10003886 Ga0207686_100038868 266
580 3300025934 Ga0207686_10016902 Ga0207686_100169024 266
581 3300025934 Ga0207686_10023460 Ga0207686_100234605 266
582 3300025935 Ga0207709_10000256 Ga0207709_1000025619 266
583 3300025935 Ga0207709_10022765 Ga0207709_100227656 266
584 3300025935 Ga0207709_10139977 Ga0207709_101399772 266
585 3300025935 Ga0207709_10616639 Ga0207709_106166391 266
586 3300025936 Ga0207670_10000086 Ga0207670_1000008668 266
587 3300025936 Ga0207670_10027694 Ga0207670_100276943 266
588 3300025936 Ga0207670_10068924 Ga0207670_100689241 266
589 3300025936 Ga0207670_10098770 Ga0207670_100987702 266
590 3300025936 Ga0207670_10170788 Ga0207670_101707882 266
591 3300025937 Ga0207669_10001765 Ga0207669_100017655 266
592 3300025937 Ga0207669_10014117 Ga0207669_100141175 266
593 3300025937 Ga0207669_10021878 Ga0207669_100218783 266
594 3300025937 Ga0207669_10196812 Ga0207669_101968121 266
595 3300025937 Ga0207669_10312254 Ga0207669_103122541 266
596 3300025938 Ga0207704_10002423 Ga0207704_100024235 266
597 3300025938 Ga0207704_10052873 Ga0207704_100528732 266
598 3300025938 Ga0207704_10160794 Ga0207704_101607943 266
599 3300025939 Ga0207665_10010248 Ga0207665_100102483 266
600 3300025939 Ga0207665_10042186 Ga0207665_100421864 266
601 3300025939 Ga0207665_10210897 Ga0207665_102108971 266
602 3300025940 Ga0207691_10000303 Ga0207691_1000030310 266
603 3300025940 Ga0207691_10203100 Ga0207691_102031003 266
604 3300025940 Ga0207691_10397324 Ga0207691_103973241 266
605 3300025941 Ga0207711_10013210 Ga0207711_100132103 266
606 3300025941 Ga0207711_10057541 Ga0207711_100575413 266
607 3300025941 Ga0207711_10121154 Ga0207711_101211544 266
608 3300025941 Ga0207711_10348899 Ga0207711_103488992 266
609 3300025941 Ga0207711_10375601 Ga0207711_103756011 266
610 3300025942 Ga0207689_10000109 Ga0207689_1000010927 266
611 3300025942 Ga0207689_10037728 Ga0207689_100377284 266
612 3300025944 Ga0207661_10010457 Ga0207661_100104574 266
613 3300025944 Ga0207661_10218844 Ga0207661_102188442 266
614 3300025944 Ga0207661_10333953 Ga0207661_103339533 266
615 3300025945 Ga0207679_10000031 Ga0207679_10000031172 266
616 3300025945 Ga0207679_10133638 Ga0207679_101336383 266
617 3300025945 Ga0207679_10640370 Ga0207679_106403701 266
618 3300025949 Ga0207667_10002481 Ga0207667_1000248119 266
619 3300025949 Ga0207667_10044884 Ga0207667_100448841 266
620 3300025960 Ga0207651_10000044 Ga0207651_1000004463 266
621 3300025960 Ga0207651_10049035 Ga0207651_100490354 266
622 3300025960 Ga0207651_10061834 Ga0207651_100618343 266
623 3300025961 Ga0207712_10001848 Ga0207712_1000184811 266
624 3300025961 Ga0207712_10057628 Ga0207712_100576282 266
625 3300025972 Ga0207668_10001339 Ga0207668_100013395 266
626 3300025972 Ga0207668_10233163 Ga0207668_102331631 266
627 3300025981 Ga0207640_10210056 Ga0207640_102100562 266
628 3300025986 Ga0207658_10025019 Ga0207658_100250195 266
629 3300025986 Ga0207658_10032961 Ga0207658_100329611 266
630 3300025986 Ga0207658_10034292 Ga0207658_100342923 266
631 3300025986 Ga0207658_10103050 Ga0207658_101030502 266
632 3300025986 Ga0207658_10316734 Ga0207658_103167341 266
633 3300025986 Ga0207658_10438273 Ga0207658_104382731 266
634 3300026023 Ga0207677_10006203 Ga0207677_100062037 266
635 3300026023 Ga0207677_10056419 Ga0207677_100564192 266
636 3300026035 Ga0207703_10018118 Ga0207703_100181181 266
637 3300026035 Ga0207703_10031219 Ga0207703_100312195 266
638 3300026035 Ga0207703_10170841 Ga0207703_101708413 266
639 3300026035 Ga0207703_10202260 Ga0207703_102022603 266
640 3300026035 Ga0207703_10459859 Ga0207703_104598591 266
641 3300026041 Ga0207639_10053044 Ga0207639_100530445 266
642 3300026041 Ga0207639_10374939 Ga0207639_103749392 266
643 3300026067 Ga0207678_10000158 Ga0207678_1000015846 266
644 3300026067 Ga0207678_10031192 Ga0207678_100311923 266
645 3300026067 Ga0207678_10047158 Ga0207678_100471585 266
646 3300026075 Ga0207708_10000098 Ga0207708_1000009826 266
647 3300026075 Ga0207708_10005985 Ga0207708_100059857 266
648 3300026078 Ga0207702_10008602 Ga0207702_100086021 266
649 3300026078 Ga0207702_10425025 Ga0207702_104250251 266
650 3300026088 Ga0207641_10000408 Ga0207641_100004086 266
651 3300026089 Ga0207648_10000696 Ga0207648_1000069638 266
652 3300026089 Ga0207648_10014142 Ga0207648_100141423 266
653 3300026089 Ga0207648_10055376 Ga0207648_100553762 266
654 3300026095 Ga0207676_10037167 Ga0207676_100371674 266
655 3300026095 Ga0207676_10117072 Ga0207676_101170724 266
656 3300026095 Ga0207676_10190212 Ga0207676_101902122 266
657 3300026116 Ga0207674_10000420 Ga0207674_1000042026 266
658 3300026116 Ga0207674_10010481 Ga0207674_1001048111 266
659 3300026118 Ga0207675_100001146 Ga0207675_10000114623 266
660 3300026118 Ga0207675_100024805 Ga0207675_1000248055 266
661 3300026118 Ga0207675_100085001 Ga0207675_1000850012 266
662 3300026118 Ga0207675_100470399 Ga0207675_1004703992 266
663 3300026121 Ga0207683_10000004 Ga0207683_1000000435 266
664 3300026121 Ga0207683_10001766 Ga0207683_1000176615 266
665 3300026121 Ga0207683_10065450 Ga0207683_100654505 266
666 3300026121 Ga0207683_10078238 Ga0207683_100782383 266
667 3300026142 Ga0207698_10005316 Ga0207698_100053166 266
668 3300026142 Ga0207698_10615545 Ga0207698_106155451 266
669 3300027512 Ga0209179_1008391 Ga0209179_10083912 266
670 3300027512 Ga0209179_1016983 Ga0209179_10169832 266
671 3300027665 Ga0209983_1012408 Ga0209983_10124082 266
672 3300027682 Ga0209971_1021584 Ga0209971_10215842 266
673 3300027695 Ga0209966_1001342 Ga0209966_10013425 266
674 3300027695 Ga0209966_1034142 Ga0209966_10341421 266
675 3300027717 Ga0209998_10001259 Ga0209998_100012597 266
676 3300027717 Ga0209998_10003935 Ga0209998_100039353 266
677 3300027866 Ga0209813_10016575 Ga0209813_100165752 266
678 3300027866 Ga0209813_10035088 Ga0209813_100350882 266
679 3300027876 Ga0209974_10000117 Ga0209974_100001179 266
680 3300027876 Ga0209974_10006843 Ga0209974_100068433 266
681 3300027876 Ga0209974_10028923 Ga0209974_100289233 266
682 3300027876 Ga0209974_10029881 Ga0209974_100298813 266
683 3300027907 Ga0207428_10000250 Ga0207428_1000025065 266
684 3300027907 Ga0207428_10001707 Ga0207428_100017078 266
685 3300027907 Ga0207428_10006503 Ga0207428_100065035 266
686 3300027907 Ga0207428_10007251 Ga0207428_100072515 266
687 3300028379 Ga0268266_10019723 Ga0268266_100197236 266
688 3300028379 Ga0268266_10064479 Ga0268266_100644792 266
689 3300028379 Ga0268266_10070409 Ga0268266_100704092 266
690 3300028380 Ga0268265_10005880 Ga0268265_100058805 266
691 3300028381 Ga0268264_10018374 Ga0268264_100183742 266
692 3300028381 Ga0268264_10074225 Ga0268264_100742252 266
693 3300028381 Ga0268264_10365487 Ga0268264_103654873 266
694 3300028381 Ga0268264_10415273 Ga0268264_104152731 266
695 3300030760 Ga0265762_1005243 Ga0265762_10052433 266
696 3300031090 Ga0265760_10031613 Ga0265760_100316132 266
697 3300031241 Ga0265325_10200729 Ga0265325_102007291 266
698 3300031595 Ga0265313_10011961 Ga0265313_100119611 266
699 3300031995 Ga0307409_100285899 Ga0307409_1002858992 266
700 3300034819 Ga0373958_0021183 Ga0373958_0021183_236_1036 266
701 3300034820 Ga0373959_0033533 Ga0373959_0033533_68_868 266
702 3300034957 Ga0373938_0000421 Ga0373938_0000421_3560_4360 266
703 3300035083 Ga0373926_0007240 Ga0373926_0007240_1651_2469 266
704 3300035084 Ga0373928_0034835 Ga0373928_0034835_279_1079 266
705 3300035086 Ga0373934_0033278 Ga0373934_0033278_1031_1969 266
706 3300035088 Ga0373940_0031602 Ga0373940_0031602_269_1069 266
707 3300035090 Ga0373949_0001809 Ga0373949_0001809_3658_4458 266
708 3300035091 Ga0373951_0009831 Ga0373951_0009831_733_1533 266
709 3300035092 Ga0373952_0002647 Ga0373952_0002647_1769_2569 266
710 3300035111 Ga0373923_0158125 Ga0373923_0158125_96_902 266
711 3300035112 Ga0373932_0001391 Ga0373932_0001391_444_1244 266
712 3300035114 Ga0373939_0010614 Ga0373939_0010614_1195_1995 266
713 3300035115 Ga0373941_0009316 Ga0373941_0009316_255_1055 266
714 3300035118 Ga0373954_0143184 Ga0373954_0143184_294_1100 266
715 3300035119 Ga0373956_0100444 Ga0373956_0100444_472_1278 266
716 3300035120 Ga0373957_0000917 Ga0373957_0000917_4054_4992 266
717 3300035121 Ga0373960_0003777 Ga0373960_0003777_329_1129 266
718 3300035170 Ga0373943_0037316 Ga0373943_0037316_721_1659 266
719 3300035171 Ga0373946_0002428 Ga0373946_0002428_2133_3020 266
720 3300035171 Ga0373946_0019518 Ga0373946_0019518_1510_2328 266
721 3300035172 Ga0373955_0023921 Ga0373955_0023921_600_1538 266
722 3300035241 Ga0373961_0046212 Ga0373961_0046212_398_1198 266
723 3300035242 Ga0373962_0003202 Ga0373962_0003202_959_1759 266
724 3300035410 Ga0373924_0002733 Ga0373924_0002733_305_1243 266
725 3300035410 Ga0373924_0028043 Ga0373924_0028043_1194_2012 266
726 3300035691 Ga0373931_0000034 Ga0373931_0000034_3435_4235 266
727 3300035691 Ga0373931_0001311 Ga0373931_0001311_4498_5304 266
728 3300035691 Ga0373931_0022363 Ga0373931_0022363_1803_2609 266
729 3300035691 Ga0373931_0051906 Ga0373931_0051906_269_1093 266
730 3300035692 Ga0373935_0008152 Ga0373935_0008152_1240_2058 266
731 3300035692 Ga0373935_0147022 Ga0373935_0147022_408_1346 266
732 3300035692 Ga0373935_0325535 Ga0373935_0325535_40_843 266
733 3300035692 Ga0373935_0377021 Ga0373935_0377021_162_968 266
734 3300035695 Ga0373927_0000839 Ga0373927_0000839_4720_5607 266
735 3300035695 Ga0373927_0099229 Ga0373927_0099229_181_987 266
736 3300035695 Ga0373927_0148020 Ga0373927_0148020_116_934 266
737 3300035724 Ga0373933_0012620 Ga0373933_0012620_2356_3294 266
738 3300035724 Ga0373933_0272572 Ga0373933_0272572_276_1082 266
739 3300035725 Ga0373947_0000796 Ga0373947_0000796_3896_4783 266
740 3300035725 Ga0373947_0276004 Ga0373947_0276004_143_961 266
741 3300036401 Ga0373937_0019531 Ga0373937_0019531_1376_2314 266
742 3300036401 Ga0373937_0323068 Ga0373937_0323068_247_1053 266
743 3300037068 Ga0373925_0002955 Ga0373925_0002955_7840_8727 266
744 3300037068 Ga0373925_0021172 Ga0373925_0021172_2595_3413 266
745 3300037068 Ga0373925_0217275 Ga0373925_0217275_327_1133 266
746 3300037466 Ga0395898_0027542 Ga0395898_0027542_2959_3759 266
747 3300038443 Ga0395901_0014197 Ga0395901_0014197_988_1788 266
748 3300039437 Ga0436365_1309021 Ga0436365_1309021_508_1308 266
749 3300039437 Ga0436365_1565429 Ga0436365_1565429_495_1379 266
750 3300039447 Ga0436361_0379330 Ga0436361_0379330_989_1795 266
751 3300042008 Ga0439450_002141 Ga0439450_002141_410_1210 266
752 3300044694 Ga0466963_0052011 Ga0466963_0052011_437_1288 266
753 3300044694 Ga0466963_0110995 Ga0466963_0110995_1037_1837 266
754 3300044842 Ga0466957_0028996 Ga0466957_0028996_542_1393 266
755 3300044842 Ga0466957_0065742 Ga0466957_0065742_598_1398 266
756 3300045836 Ga0466958_0040840 Ga0466958_0040840_1054_1905 266
757 3300045836 Ga0466958_0097744 Ga0466958_0097744_26_826 266
758 3300045976 Ga0466967_0151147 Ga0466967_0151147_416_1216 266
759 3300046454 Ga0495592_0020986 Ga0495592_0020986_2818_3756 266
760 3300046455 Ga0495603_0020845 Ga0495603_0020845_980_1804 266
761 3300046462 Ga0495651_0004824 Ga0495651_0004824_8169_9107 266
762 3300046462 Ga0495651_0017751 Ga0495651_0017751_4617_5423 266
763 3300046472 Ga0495580_0042600 Ga0495580_0042600_23_910 266
764 3300046473 Ga0495582_0029880 Ga0495582_0029880_1369_2193 266
765 3300046474 Ga0495605_0038453 Ga0495605_0038453_1156_1956 266
766 3300046475 Ga0495639_0038306 Ga0495639_0038306_520_1344 266
767 3300046476 Ga0495662_0004502 Ga0495662_0004502_33_851 266
768 3300046477 Ga0495664_0004807 Ga0495664_0004807_5957_6895 266
769 3300046477 Ga0495664_0006400 Ga0495664_0006400_3652_4470 266
770 3300046491 Ga0495584_0094389 Ga0495584_0094389_443_1267 266
771 3300046499 Ga0495594_0024062 Ga0495594_0024062_1204_2028 266
772 3300046511 Ga0495608_0010475 Ga0495608_0010475_4080_5018 266
773 3300046511 Ga0495608_0135213 Ga0495608_0135213_680_1486 266
774 3300046514 Ga0495618_0000917 Ga0495618_0000917_7341_8279 266
775 3300046514 Ga0495618_0108433 Ga0495618_0108433_210_1097 266
776 3300046514 Ga0495618_0183340 Ga0495618_0183340_126_944 266
777 3300046516 Ga0495628_0007281 Ga0495628_0007281_1142_2080 266
778 3300046517 Ga0495630_0011479 Ga0495630_0011479_5118_6056 266
779 3300046517 Ga0495630_0061315 Ga0495630_0061315_487_1311 266
780 3300046526 Ga0495666_0012399 Ga0495666_0012399_1975_2862 266
781 3300046529 Ga0495652_0010662 Ga0495652_0010662_1463_2281 266
782 3300046529 Ga0495652_0021608 Ga0495652_0021608_3329_4267 266
783 3300046529 Ga0495652_0177800 Ga0495652_0177800_498_1322 266
784 3300046531 Ga0495665_0012185 Ga0495665_0012185_3632_4450 266
785 3300046531 Ga0495665_0092134 Ga0495665_0092134_728_1534 266
786 3300046533 Ga0495640_0003215 Ga0495640_0003215_2130_2948 266
787 3300046533 Ga0495640_0005374 Ga0495640_0005374_1890_2828 266
788 3300046533 Ga0495640_0093106 Ga0495640_0093106_999_1886 266
789 3300046536 Ga0495587_0026356 Ga0495587_0026356_1991_2929 266
790 3300046543 Ga0495645_0001763 Ga0495645_0001763_1375_2313 266
791 3300046543 Ga0495645_0004378 Ga0495645_0004378_4458_5276 266
792 3300046559 Ga0495667_0000256 Ga0495667_0000256_22014_22952 266
793 3300046559 Ga0495667_0092950 Ga0495667_0092950_891_1697 266
794 3300046642 Ga0495634_0003473 Ga0495634_0003473_5691_6509 266
795 3300046642 Ga0495634_0044121 Ga0495634_0044121_194_1081 266
796 3300046642 Ga0495634_0098678 Ga0495634_0098678_733_1671 266
797 3300046663 Ga0495635_0001674 Ga0495635_0001674_7264_8202 266
798 3300046663 Ga0495635_0003010 Ga0495635_0003010_2941_3759 266
799 3300046663 Ga0495635_0019505 Ga0495635_0019505_1894_2718 266
800 3300046663 Ga0495635_0389808 Ga0495635_0389808_102_908 266
801 3300046674 Ga0495588_0052958 Ga0495588_0052958_137_961 266
802 3300046675 Ga0495657_0002838 Ga0495657_0002838_3051_3989 266
803 3300046678 Ga0495599_0002175 Ga0495599_0002175_9359_10297 266
804 3300046679 Ga0495623_0008613 Ga0495623_0008613_4224_5162 266
805 3300046680 Ga0495646_0001535 Ga0495646_0001535_8268_9206 266
806 3300046681 Ga0495647_0010400 Ga0495647_0010400_685_1509 266
807 3300046681 Ga0495647_0059631 Ga0495647_0059631_546_1433 266
808 3300046683 Ga0495658_0040583 Ga0495658_0040583_1740_2564 266
809 3300046689 Ga0495613_0095948 Ga0495613_0095948_760_1698 266
810 3300046690 Ga0495624_0002424 Ga0495624_0002424_754_1641 266
811 3300046690 Ga0495624_0040939 Ga0495624_0040939_1111_1935 266
812 3300046809 Ga0495600_0008376 Ga0495600_0008376_188_1126 266
813 3300047315 Ga0495581_0008086 Ga0495581_0008086_1955_2842 266
814 3300047317 Ga0495604_0012925 Ga0495604_0012925_2514_3452 266
815 3300047317 Ga0495604_0175636 Ga0495604_0175636_477_1283 266
816 3300047319 Ga0495674_0001984 Ga0495674_0001984_11694_12518 266
817 3300047319 Ga0495674_0004803 Ga0495674_0004803_8110_9048 266
818 3300047319 Ga0495674_0379723 Ga0495674_0379723_68_886 266
819 3300047321 Ga0495676_0299706 Ga0495676_0299706_13_831 266
820 3300047322 Ga0495680_0005564 Ga0495680_0005564_418_1242 266
821 3300047322 Ga0495680_0008253 Ga0495680_0008253_499_1437 266
822 3300047444 Ga0495675_0000532 Ga0495675_0000532_19852_20790 266
823 3300047447 Ga0495685_004853 Ga0495685_004853_1345_2151 266
824 3300047471 Ga0495684_0000987 Ga0495684_0000987_7847_8734 266
825 3300047471 Ga0495684_0009836 Ga0495684_0009836_2161_2979 266
826 3300047673 Ga0495593_0082439 Ga0495593_0082439_754_1641 266
827 3300048088 Ga0495602_0005750 Ga0495602_0005750_4798_5736 266
828 3300048090 Ga0495615_0009209 Ga0495615_0009209_141_947 266
829 3300048903 Ga0496100_0000842 Ga0496100_0000842_494_1297 266
830 3300048903 Ga0496100_0073931 Ga0496100_0073931_1260_2060 266
831 3300048904 Ga0496101_0007404 Ga0496101_0007404_5654_6457 266
832 3300048904 Ga0496101_0017864 Ga0496101_0017864_307_1245 266
833 3300048904 Ga0496101_0077127 Ga0496101_0077127_1321_2121 266
834 3300048904 Ga0496101_0135469 Ga0496101_0135469_695_1501 266
835 3300048904 Ga0496101_0160773 Ga0496101_0160773_385_1185 266
836 3300048905 Ga0496102_0001935 Ga0496102_0001935_12194_12997 266
837 3300048905 Ga0496102_0011713 Ga0496102_0011713_3187_3987 266
838 3300048905 Ga0496102_0051622 Ga0496102_0051622_2929_3729 266
839 3300048906 Ga0496103_0004653 Ga0496103_0004653_4077_4877 266
840 3300048906 Ga0496103_0010777 Ga0496103_0010777_4063_5001 266
841 3300048907 Ga0496104_0011266 Ga0496104_0011266_7118_7921 266
842 3300048907 Ga0496104_0084266 Ga0496104_0084266_941_1741 266
843 3300048907 Ga0496104_0172235 Ga0496104_0172235_874_1680 266
844 3300048907 Ga0496104_0230375 Ga0496104_0230375_307_1245 266
845 3300048907 Ga0496104_0642583 Ga0496104_0642583_119_925 266
846 3300048908 Ga0496105_0041290 Ga0496105_0041290_2786_3592 266
847 3300048908 Ga0496105_0186660 Ga0496105_0186660_210_1010 266
848 3300048909 Ga0496106_0000405 Ga0496106_0000405_11505_12308 266
849 3300048909 Ga0496106_0055867 Ga0496106_0055867_1513_2313 266
850 3300048910 Ga0496107_0004066 Ga0496107_0004066_6098_7036 266
851 3300048910 Ga0496107_0005799 Ga0496107_0005799_3128_3928 266
852 3300048910 Ga0496107_0034287 Ga0496107_0034287_2152_2955 266
853 3300048910 Ga0496107_0050462 Ga0496107_0050462_886_1692 266
854 3300048911 Ga0496108_0001198 Ga0496108_0001198_4344_5147 266
855 3300048911 Ga0496108_0025837 Ga0496108_0025837_21_824 266
856 3300048911 Ga0496108_0032267 Ga0496108_0032267_1023_1961 266
857 3300048911 Ga0496108_0034437 Ga0496108_0034437_2345_3145 266
858 3300048911 Ga0496108_0049561 Ga0496108_0049561_1377_2177 266
859 3300048912 Ga0496109_0151200 Ga0496109_0151200_60_860 266
860 3300048913 Ga0496110_0010646 Ga0496110_0010646_4820_5623 266
861 3300048913 Ga0496110_0041865 Ga0496110_0041865_2926_3726 266
862 3300048913 Ga0496110_0070107 Ga0496110_0070107_519_1319 266
863 3300048913 Ga0496110_0494729 Ga0496110_0494729_290_1093 266
864 3300048914 Ga0496111_0004338 Ga0496111_0004338_380_1183 266
865 3300048914 Ga0496111_0009762 Ga0496111_0009762_4352_5155 266
866 3300048914 Ga0496111_0069131 Ga0496111_0069131_24_824 266
867 3300048914 Ga0496111_0194583 Ga0496111_0194583_659_1465 266
868 3300048915 Ga0496112_0047842 Ga0496112_0047842_1982_2785 266
869 3300048915 Ga0496112_0143557 Ga0496112_0143557_888_1688 266
870 3300048916 Ga0496113_0002604 Ga0496113_0002604_6125_6925 266
871 3300048916 Ga0496113_0079720 Ga0496113_0079720_1290_2096 266
872 3300048916 Ga0496113_0150213 Ga0496113_0150213_243_1043 266
873 3300048916 Ga0496113_0170106 Ga0496113_0170106_215_1018 266
874 3300048917 Ga0496114_0005575 Ga0496114_0005575_6236_7036 266
875 3300048917 Ga0496114_0016691 Ga0496114_0016691_4408_5346 266
876 3300048917 Ga0496114_0018204 Ga0496114_0018204_2384_3184 266
877 3300048917 Ga0496114_0071524 Ga0496114_0071524_1010_1816 266
878 3300048917 Ga0496114_0147538 Ga0496114_0147538_1179_1982 266
879 3300048918 Ga0496115_0053006 Ga0496115_0053006_1923_2747 266
880 3300048918 Ga0496115_0067368 Ga0496115_0067368_982_1920 266
881 3300048918 Ga0496115_0191993 Ga0496115_0191993_548_1366 266
882 3300048918 Ga0496115_0211939 Ga0496115_0211939_327_1130 266
883 3300049568 Ga0501031_0228033 Ga0501031_0228033_308_1117 266
884 3300049569 Ga0501032_0005175 Ga0501032_0005175_749_1558 266
885 3300049570 Ga0501033_0029607 Ga0501033_0029607_1958_2767 266
886 3300049570 Ga0501033_0083303 Ga0501033_0083303_259_1068 266
887 3300049570 Ga0501033_0129315 Ga0501033_0129315_128_934 266
888 3300049571 Ga0501034_0184946 Ga0501034_0184946_618_1427 266
889 3300049572 Ga0501036_0009276 Ga0501036_0009276_2305_3114 266
890 3300049572 Ga0501036_0327333 Ga0501036_0327333_352_1152 266
891 3300049573 Ga0501037_0001340 Ga0501037_0001340_10119_10928 266
892 3300049574 Ga0501038_0001023 Ga0501038_0001023_19840_20649 266
893 3300049575 Ga0501039_0015388 Ga0501039_0015388_3594_4403 266
894 3300049575 Ga0501039_0529808 Ga0501039_0529808_40_864 266
895 3300049578 Ga0501042_0299785 Ga0501042_0299785_77_886 266
896 3300049579 Ga0501043_0025349 Ga0501043_0025349_3180_3989 266
897 3300049579 Ga0501043_0192196 Ga0501043_0192196_741_1547 266
898 3300049580 Ga0501046_0008699 Ga0501046_0008699_3398_4207 266
899 3300049581 Ga0501047_0055872 Ga0501047_0055872_1556_2362 266
900 3300049581 Ga0501047_0061462 Ga0501047_0061462_1277_2086 266
901 3300049582 Ga0501048_0002666 Ga0501048_0002666_4646_5455 266
902 3300049582 Ga0501048_0087158 Ga0501048_0087158_52_852 266
903 3300049582 Ga0501048_0335918 Ga0501048_0335918_141_944 266
904 3300049583 Ga0501067_0083621 Ga0501067_0083621_230_1033 266
905 3300049585 Ga0501069_0005453 Ga0501069_0005453_4645_5454 266
906 3300049586 Ga0501070_0025730 Ga0501070_0025730_2966_3775 266
907 3300049586 Ga0501070_0043988 Ga0501070_0043988_1338_2144 266
908 3300049586 Ga0501070_0063526 Ga0501070_0063526_802_1608 266
909 3300049587 Ga0501071_0021832 Ga0501071_0021832_2313_3122 266
910 3300049588 Ga0501072_0313549 Ga0501072_0313549_19_840 266
911 3300049588 Ga0501072_0374429 Ga0501072_0374429_296_1102 266
912 3300049589 Ga0501073_0017253 Ga0501073_0017253_2966_3775 266
913 3300049589 Ga0501073_0142636 Ga0501073_0142636_81_947 266
914 3300049590 Ga0501074_0060646 Ga0501074_0060646_1455_2264 266
915 3300049590 Ga0501074_0212813 Ga0501074_0212813_92_895 266
916 3300049591 Ga0501075_0274824 Ga0501075_0274824_340_1143 266
917 3300049593 Ga0501077_0046198 Ga0501077_0046198_1910_2710 266
918 3300049741 Ga0501079_0006545 Ga0501079_0006545_1438_2247 266
919 3300049741 Ga0501079_0086067 Ga0501079_0086067_741_1541 266
920 3300049741 Ga0501079_0426513 Ga0501079_0426513_219_1022 266
921 3300049742 Ga0501080_0099237 Ga0501080_0099237_489_1298 266
922 3300049742 Ga0501080_0254987 Ga0501080_0254987_202_1008 266
923 3300049822 Ga0501035_0206329 Ga0501035_0206329_852_1658 266
924 3300049822 Ga0501035_0352720 Ga0501035_0352720_236_1042 266
925 3300049823 Ga0501044_0000260 Ga0501044_0000260_46932_47741 266
926 3300049823 Ga0501044_0008573 Ga0501044_0008573_3768_4577 266
927 3300049823 Ga0501044_0010896 Ga0501044_0010896_2224_3030 266
928 3300049823 Ga0501044_0487609 Ga0501044_0487609_68_874 266
929 3300049824 Ga0501045_0490490 Ga0501045_0490490_34_843 266
930 3300050489 nmdc:mga03683_41279_c1 nmdc:mga03683_41279_c1_542_1345 266
931 3300050490 nmdc:mga03n38_79548_c1 nmdc:mga03n38_79548_c1_679_1482 266
932 3300050491 nmdc:mga00v17_19362_c1 nmdc:mga00v17_19362_c1_1839_2645 266
933 3300050492 nmdc:mga0yw44_383517_c1 nmdc:mga0yw44_383517_c1_24_827 266
934 3300050492 nmdc:mga0yw44_63367_c1 nmdc:mga0yw44_63367_c1_1270_2073 266
935 3300050492 nmdc:mga0yw44_75835_c1 nmdc:mga0yw44_75835_c1_213_1019 266
936 3300050493 nmdc:mga0k408_55917_c1 nmdc:mga0k408_55917_c1_30_833 266
937 3300050494 nmdc:mga06z11_113993_c1 nmdc:mga06z11_113993_c1_155_958 266
938 3300050494 nmdc:mga06z11_53313_c1 nmdc:mga06z11_53313_c1_1080_1886 266
939 3300050495 nmdc:mga04h51_29994_c1 nmdc:mga04h51_29994_c1_505_1305 266
940 3300050496 nmdc:mga07m45_147397_c1 nmdc:mga07m45_147397_c1_492_1292 266
941 3300050496 nmdc:mga07m45_15773_c1 nmdc:mga07m45_15773_c1_306_1127 266
942 3300050496 nmdc:mga07m45_26560_c1 nmdc:mga07m45_26560_c1_2352_3158 266
943 3300050496 nmdc:mga07m45_27289_c1 nmdc:mga07m45_27289_c1_39_842 266
944 3300050507 nmdc:mga05p37_163552_c1 nmdc:mga05p37_163552_c1_1043_1846 266
945 3300050507 nmdc:mga05p37_354142_c1 nmdc:mga05p37_354142_c1_28_954 266
946 3300050507 nmdc:mga05p37_5377_c1 nmdc:mga05p37_5377_c1_10214_11020 266
947 3300050508 nmdc:mga09592_170167_c1 nmdc:mga09592_170167_c1_877_1680 266
948 3300050508 nmdc:mga09592_29378_c1 nmdc:mga09592_29378_c1_947_1753 266
949 3300050509 nmdc:mga0qj67_151963_c1 nmdc:mga0qj67_151963_c1_429_1232 266
950 3300050509 nmdc:mga0qj67_28_c1 nmdc:mga0qj67_28_c1_83144_83947 266
951 3300050509 nmdc:mga0qj67_341240_c1 nmdc:mga0qj67_341240_c1_220_1023 266
952 3300050509 nmdc:mga0qj67_97253_c1 nmdc:mga0qj67_97253_c1_746_1549 266
953 3300050510 nmdc:mga06r32_322976_c1 nmdc:mga06r32_322976_c1_397_1200 266
954 3300050510 nmdc:mga06r32_383161_c1 nmdc:mga06r32_383161_c1_132_935 266
955 3300050510 nmdc:mga06r32_507731_c1 nmdc:mga06r32_507731_c1_35_907 266
956 3300050510 nmdc:mga06r32_752703_c1 nmdc:mga06r32_752703_c1_30_833 266
957 3300050511 nmdc:mga08y16_409669_c1 nmdc:mga08y16_409669_c1_206_1006 266
958 3300050511 nmdc:mga08y16_590_c1 nmdc:mga08y16_590_c1_8572_9378 266
959 3300050512 nmdc:mga0n895_33397_c1 nmdc:mga0n895_33397_c1_2409_3284 266
960 3300050512 nmdc:mga0n895_425283_c1 nmdc:mga0n895_425283_c1_164_1003 266
961 3300050512 nmdc:mga0n895_4459_c1 nmdc:mga0n895_4459_c1_6107_6907 266
962 3300050512 nmdc:mga0n895_947751_c1 nmdc:mga0n895_947751_c1_23_826 266
963 3300050513 nmdc:mga0rr50_39320_c1 nmdc:mga0rr50_39320_c1_1692_2492 266
964 3300050513 nmdc:mga0rr50_8026_c1 nmdc:mga0rr50_8026_c1_1406_2332 266
965 3300050513 nmdc:mga0rr50_85462_c1 nmdc:mga0rr50_85462_c1_757_1575 266
966 3300050515 nmdc:mga0a205_3619_c1 nmdc:mga0a205_3619_c1_353_1279 266
967 3300050515 nmdc:mga0a205_733_c2 nmdc:mga0a205_733_c2_5293_6093 266
968 3300050516 nmdc:mga0sz30_4070_c1 nmdc:mga0sz30_4070_c1_1483_2289 266
969 3300053077 Ga0495601_0000418 Ga0495601_0000418_13941_14765 266
970 3300053077 Ga0495601_0010781 Ga0495601_0010781_3771_4709 266
971 3300053077 Ga0495601_0012231 Ga0495601_0012231_2901_3719 266
972 3300053077 Ga0495601_0039644 Ga0495601_0039644_1892_2698 266
973 3300053078 Ga0495612_0000251 Ga0495612_0000251_6965_7783 266
974 3300053078 Ga0495612_0003654 Ga0495612_0003654_4694_5632 266
975 3300053078 Ga0495612_0138888 Ga0495612_0138888_54_860 266
976 3300053084 Ga0495595_0002778 Ga0495595_0002778_2148_3086 266
977 3300053085 Ga0495619_0002566 Ga0495619_0002566_5987_6925 266
978 3300053085 Ga0495619_0037784 Ga0495619_0037784_156_1034 266
979 3300053085 Ga0495619_0090917 Ga0495619_0090917_964_1851 266
980 3300053085 Ga0495619_0165320 Ga0495619_0165320_626_1432 266
981 3300053730 Ga0500645_024021 Ga0500645_024021_197_1000 266
982 3300054114 Ga0501084_0208885 Ga0501084_0208885_763_1572 266
983 3300059492 Ga0587073_0039083 Ga0587073_0039083_59_859 266
984 3300059492 Ga0587073_0044354 Ga0587073_0044354_18_824 266
985 3300059492 Ga0587073_0054520 Ga0587073_0054520_40_858 266
986 3300059505 Ga0587083_0049489 Ga0587083_0049489_58_858 266
987 3300059644 Ga0587075_017536 Ga0587075_017536_58_858 266
988 3300060353 Ga0501082_0007563 Ga0501082_0007563_3274_4083 266
989 3300060353 Ga0501082_0231755 Ga0501082_0231755_783_1583 266
990 3300060353 Ga0501082_0259670 Ga0501082_0259670_217_1023 266
991 3300060353 Ga0501082_0317955 Ga0501082_0317955_197_1000 266

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22029

PhyR_sigma2

Sigma2 domain of PhyR

31

85

0.98

PF22233

PhyR_sigma-like

Response regulator PhyR, sigma-like domain

107

156

0.95

PF00072

Response_reg

Response regulator receiver domain

161

270

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
2o8x-assembly1.cif.gz_A "crystal structure of the ""-35 element"" promoter recognition domain of mycobacterium tuberculosis sigc" 0.9718 93 130
7bhy-assembly1.cif.gz_A dna-binding domain of deor in complex with the dna operator 0.9706 93 131
4g97-assembly1.cif.gz_A crystal structure of the response regulator phyr from brucella abortus 0.9697 1 266
2o8x-assembly1.cif.gz_B "crystal structure of the ""-35 element"" promoter recognition domain of mycobacterium tuberculosis sigc" 0.9675 93 130
4g97-assembly1.cif.gz_A crystal structure of the response regulator phyr from brucella abortus 0.9658 1 266
ID Description Score Start End Superfamily
2o8xA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9718 93 130 1.10.10.10
2o8xB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9675 93 130 1.10.10.10
3t0yA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9564 91 135 1.10.10.10
1or7A02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9538 90 130 1.10.10.10
3n0rA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9511 135 254 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A530R2W7-F1-model_v4 Response regulator 0.9856 157 260 GO:0000160
AF-X2FNI5-F1-model_v4 Two-component response regulator 0.9833 111 247 GO:0000160
AF-Q98FM8-F1-model_v4 Sensory transduction regulatory protein 0.9735 136 260 GO:0000160
AF-A0A6B2NSG7-F1-model_v4 Response regulator 0.9716 141 259 GO:0000160
AF-A0A257G5H4-F1-model_v4 Response regulator 0.9703 1 262 GO:0000160

Feature Viewer

pLDDT pTM Quality
83.78 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map