F487649
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 991 | 420 | 988 | 271 |
Family's Representative Sequence
| Representative Sequence | 3300054114|Ga0501084_0111220|Ga0501084_0111220_490_1356 |
| Length | 288 |
| Sequence | MVPENSLDWRAFTSNCAQTSGGLPMLTSQAVARELPRLRRYARALTGNQTSGDAYVTATLEALAEDPSSLNADDDISIGLFSAFTRIWNSVELNTSSSAGGLIDEHIRGMTPLPRQAFLLVSLEDFAEPAAAKILDVPVIELRRLIEEAGRELAAEIATEVLIIEDEPLIAMDLEGLVESLGHSVTGIGRTQKEAVALAKEKPPGLILADIRLADMSSGVDAVNEMLQDLEVPVIFITAYPEQLLTGERPEPAFLITKPFRPTTVAAVISQALFFGRKATTRKKAVEA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 2 | 2842694124 | Methylopila sp. R-72369 | Isolate | Unclassified |
| 3 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 4 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 5 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 6 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 7 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 8 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 9 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 10 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 11 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 12 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 13 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 14 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 15 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 16 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 17 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 18 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 19 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 20 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 21 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 22 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 23 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 24 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 25 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 26 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 27 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 34 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 38 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 40 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 50 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 66 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 67 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 68 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 71 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 72 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 73 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 75 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 80 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 81 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 83 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 84 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 85 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 87 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 88 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 89 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 90 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 91 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 92 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 93 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 94 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 95 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 96 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 97 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 98 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 99 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 100 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 101 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 103 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 104 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 105 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 106 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 107 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 108 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 109 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 110 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 112 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 113 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 114 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 115 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 116 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 117 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 118 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 119 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 120 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 121 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 123 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 124 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 138 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 155 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 156 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 157 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 158 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 159 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 160 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 161 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 236 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 238 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 242 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 243 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 244 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 245 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 246 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 247 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 248 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 249 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 250 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 251 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 252 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 253 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 254 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 255 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 256 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 257 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 258 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 259 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 260 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 261 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 262 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 263 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 264 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 265 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 266 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 267 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 268 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 269 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 270 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 271 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 272 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 273 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 274 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 275 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 276 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 277 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 278 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 279 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 280 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 281 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 282 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 283 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 284 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 285 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 286 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 287 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 288 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 289 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 290 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 291 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 292 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 293 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 294 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 295 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 296 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 343 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 344 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 345 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 346 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 347 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 348 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 349 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 350 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 351 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 352 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 353 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 354 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 355 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 356 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 357 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 358 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 359 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 360 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 361 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 362 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 363 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 364 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 365 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 366 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 367 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 368 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 369 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 370 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 371 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 372 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 373 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 374 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 375 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 376 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 377 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 378 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 379 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 380 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 381 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 382 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 383 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 384 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 385 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 386 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 387 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 388 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 389 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 390 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 391 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 392 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 393 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 394 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 395 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 396 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 397 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 398 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 399 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 400 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 401 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 402 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 403 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 404 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 405 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 406 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 407 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 412 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 413 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 414 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 415 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 416 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 417 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 418 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 419 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 420 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.99 |
| Metatranscriptomes | 0.91 |
| Isolates | 0.1 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.03 |
| Nodule | 0 |
| Rhizoplane | 5.65 |
| Rhizosphere | 90.11 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.21 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | 2214572714 | 2209111006 | Bacteria | 5910 |
| 2 | ARcpr5oldR_c000130 | 3300000041 | Bacteria | 13090 |
| 3 | ARSoilYngRDRAFT_c00118 | 3300000042 | Bacteria | 13503 |
| 4 | ARcpr5yngRDRAFT_c000035 | 3300000043 | Bacteria | 21396 |
| 5 | ARCol0yngRDRAFT_1000209 | 3300000652 | Bacteria | 9893 |
| 6 | JGI24752J21851_1013069 | 3300001976 | Bacteria | 1084 |
| 7 | JGI24746J21847_1000683 | 3300001977 | Bacteria | 5199 |
| 8 | JGI24747J21853_1003746 | 3300001978 | Bacteria | 1327 |
| 9 | JGI24739J22299_10000158 | 3300001989 | Bacteria | 22012 |
| 10 | JGI24737J22298_10001510 | 3300001990 | Bacteria | 8284 |
| 11 | JGI24737J22298_10001948 | 3300001990 | Bacteria | 7386 |
| 12 | JGI24743J22301_10018083 | 3300001991 | Bacteria | 1329 |
| 13 | JGI24745J21846_1001135 | 3300002073 | Bacteria | 2534 |
| 14 | JGI24748J21848_1000574 | 3300002074 | Bacteria | 3956 |
| 15 | JGI24748J21848_1000699 | 3300002074 | Bacteria | 3614 |
| 16 | JGI24738J21930_10003334 | 3300002075 | Bacteria | 4072 |
| 17 | JGI24749J21850_1005514 | 3300002076 | Bacteria | 1771 |
| 18 | JGI24749J21850_1012555 | 3300002076 | Bacteria | 1189 |
| 19 | JGI24744J21845_10001094 | 3300002077 | Bacteria | 5249 |
| 20 | JGI24035J26624_1000023 | 3300002126 | Bacteria | 11063 |
| 21 | JGI24033J26618_1001768 | 3300002155 | Bacteria | 2161 |
| 22 | JGI24034J26672_10001325 | 3300002239 | Bacteria | 3266 |
| 23 | JGI24742J22300_10000706 | 3300002244 | Bacteria | 5053 |
| 24 | JGI24751J29686_10002998 | 3300002459 | Bacteria | 3409 |
| 25 | JGI24751J29686_10008505 | 3300002459 | Bacteria | 2101 |
| 26 | JGI25405J52794_10031077 | 3300003911 | Bacteria | 1109 |
| 27 | Ga0065712_10007917 | 3300005290 | Bacteria | 6107 |
| 28 | Ga0065712_10089850 | 3300005290 | Bacteria | 2450 |
| 29 | Ga0065715_10089004 | 3300005293 | Bacteria | 17365 |
| 30 | Ga0065707_10143694 | 3300005295 | Unclassified | 1723 |
| 31 | Ga0070658_10006919 | 3300005327 | Bacteria | 9160 |
| 32 | Ga0070676_10001138 | 3300005328 | Bacteria | 13281 |
| 33 | Ga0070676_10126576 | 3300005328 | Unclassified | 1610 |
| 34 | Ga0070676_10182049 | 3300005328 | Bacteria | 1367 |
| 35 | Ga0070683_100163764 | 3300005329 | Bacteria | 2110 |
| 36 | Ga0070690_100000727 | 3300005330 | Bacteria | 16862 |
| 37 | Ga0070690_100126144 | 3300005330 | Bacteria | 1723 |
| 38 | Ga0070670_100004168 | 3300005331 | Bacteria | 12095 |
| 39 | Ga0070670_100060563 | 3300005331 | Bacteria | 3250 |
| 40 | Ga0070670_100110934 | 3300005331 | Bacteria | 2364 |
| 41 | Ga0070677_10003207 | 3300005333 | Bacteria | 5264 |
| 42 | Ga0070677_10003757 | 3300005333 | Bacteria | 4911 |
| 43 | Ga0068869_100087385 | 3300005334 | Bacteria | 2339 |
| 44 | Ga0070666_10018444 | 3300005335 | Bacteria | 4487 |
| 45 | Ga0070666_10018621 | 3300005335 | Bacteria | 4469 |
| 46 | Ga0070680_100006389 | 3300005336 | Bacteria | 8955 |
| 47 | Ga0070680_100024710 | 3300005336 | Bacteria | 4802 |
| 48 | Ga0070680_100067076 | 3300005336 | Bacteria | 2943 |
| 49 | Ga0070680_100135083 | 3300005336 | Bacteria | 2066 |
| 50 | Ga0070680_100193681 | 3300005336 | Bacteria | 1713 |
| 51 | Ga0070682_100007941 | 3300005337 | Bacteria | 5969 |
| 52 | Ga0070682_100096561 | 3300005337 | Bacteria | 1943 |
| 53 | Ga0068868_100000944 | 3300005338 | Bacteria | 19746 |
| 54 | Ga0068868_100050586 | 3300005338 | Bacteria | 3264 |
| 55 | Ga0068868_100115031 | 3300005338 | Bacteria | 2189 |
| 56 | Ga0068868_100302318 | 3300005338 | Bacteria | 1359 |
| 57 | Ga0070660_100015021 | 3300005339 | Bacteria | 5585 |
| 58 | Ga0070660_100048298 | 3300005339 | Bacteria | 3269 |
| 59 | Ga0070660_100084985 | 3300005339 | Bacteria | 2488 |
| 60 | Ga0070660_100117966 | 3300005339 | Bacteria | 2116 |
| 61 | Ga0070660_100126808 | 3300005339 | Bacteria | 2040 |
| 62 | Ga0070660_100143923 | 3300005339 | Bacteria | 1914 |
| 63 | Ga0070689_100000646 | 3300005340 | Bacteria | 21086 |
| 64 | Ga0070689_100002989 | 3300005340 | Bacteria | 11115 |
| 65 | Ga0070689_100006613 | 3300005340 | Bacteria | 8049 |
| 66 | Ga0070689_100009931 | 3300005340 | Bacteria | 6770 |
| 67 | Ga0070689_100027299 | 3300005340 | Bacteria | 4303 |
| 68 | Ga0070689_100086479 | 3300005340 | Bacteria | 2466 |
| 69 | Ga0070691_10000125 | 3300005341 | Bacteria | 23286 |
| 70 | Ga0070687_100000773 | 3300005343 | Bacteria | 10637 |
| 71 | Ga0070687_100050373 | 3300005343 | Bacteria | 2150 |
| 72 | Ga0070687_100115673 | 3300005343 | Bacteria | 1525 |
| 73 | Ga0070661_100013869 | 3300005344 | Bacteria | 5662 |
| 74 | Ga0070661_100018561 | 3300005344 | Bacteria | 4947 |
| 75 | Ga0070692_10038970 | 3300005345 | Bacteria | 2425 |
| 76 | Ga0070669_100172652 | 3300005353 | Bacteria | 1686 |
| 77 | Ga0070675_100005686 | 3300005354 | Bacteria | 9545 |
| 78 | Ga0070675_100112209 | 3300005354 | Bacteria | 2308 |
| 79 | Ga0070671_100000170 | 3300005355 | Bacteria | 42992 |
| 80 | Ga0070671_100032596 | 3300005355 | Bacteria | 4306 |
| 81 | Ga0070671_100053267 | 3300005355 | Bacteria | 3363 |
| 82 | Ga0070671_100054894 | 3300005355 | Bacteria | 3313 |
| 83 | Ga0070674_100026051 | 3300005356 | Bacteria | 3815 |
| 84 | Ga0070674_100053517 | 3300005356 | Bacteria | 2788 |
| 85 | Ga0070673_100015366 | 3300005364 | Bacteria | 5375 |
| 86 | Ga0070673_100020936 | 3300005364 | Bacteria | 4728 |
| 87 | Ga0070673_100136776 | 3300005364 | Unclassified | 2063 |
| 88 | Ga0070673_100154134 | 3300005364 | Bacteria | 1948 |
| 89 | Ga0070688_100001455 | 3300005365 | Bacteria | 11770 |
| 90 | Ga0070688_100002194 | 3300005365 | Bacteria | 9852 |
| 91 | Ga0070688_100008402 | 3300005365 | Bacteria | 5602 |
| 92 | Ga0070688_100081413 | 3300005365 | Bacteria | 2096 |
| 93 | Ga0070688_100091355 | 3300005365 | Bacteria | 1989 |
| 94 | Ga0070659_100000621 | 3300005366 | Bacteria | 25919 |
| 95 | Ga0070659_100128803 | 3300005366 | Bacteria | 2054 |
| 96 | Ga0070667_100044536 | 3300005367 | Bacteria | 3727 |
| 97 | Ga0070667_100133608 | 3300005367 | Bacteria | 2168 |
| 98 | Ga0070667_100139072 | 3300005367 | Unclassified | 2125 |
| 99 | Ga0070703_10001450 | 3300005406 | Bacteria | 7142 |
| 100 | Ga0070709_10006995 | 3300005434 | Bacteria | 6165 |
| 101 | Ga0070709_10019522 | 3300005434 | Bacteria | 3920 |
| 102 | Ga0070709_10113191 | 3300005434 | Unclassified | 1827 |
| 103 | Ga0070714_100037912 | 3300005435 | Bacteria | 4053 |
| 104 | Ga0070714_100095284 | 3300005435 | Bacteria | 2614 |
| 105 | Ga0070714_100099561 | 3300005435 | Bacteria | 2559 |
| 106 | Ga0070713_100019242 | 3300005436 | Bacteria | 5207 |
| 107 | Ga0070713_100029152 | 3300005436 | Bacteria | 4367 |
| 108 | Ga0070713_100067156 | 3300005436 | Bacteria | 3018 |
| 109 | Ga0070713_100167387 | 3300005436 | Bacteria | 1966 |
| 110 | Ga0070713_100256266 | 3300005436 | Bacteria | 1598 |
| 111 | Ga0070710_10014458 | 3300005437 | Bacteria | 3975 |
| 112 | Ga0070710_10016436 | 3300005437 | Bacteria | 3766 |
| 113 | Ga0070710_10062381 | 3300005437 | Bacteria | 2125 |
| 114 | Ga0070711_100008373 | 3300005439 | Bacteria | 6335 |
| 115 | Ga0070711_100050862 | 3300005439 | Bacteria | 2843 |
| 116 | Ga0070711_100336725 | 3300005439 | Bacteria | 1209 |
| 117 | Ga0070705_100004061 | 3300005440 | Bacteria | 7149 |
| 118 | Ga0070705_100172914 | 3300005440 | Bacteria | 1456 |
| 119 | Ga0070700_100080805 | 3300005441 | Unclassified | 2098 |
| 120 | Ga0070694_100002007 | 3300005444 | Bacteria | 12098 |
| 121 | Ga0070694_100004869 | 3300005444 | Bacteria | 8086 |
| 122 | Ga0070708_100053874 | 3300005445 | Bacteria | 3572 |
| 123 | Ga0070663_100016477 | 3300005455 | Bacteria | 4802 |
| 124 | Ga0070663_100030911 | 3300005455 | Bacteria | 3674 |
| 125 | Ga0070663_100076820 | 3300005455 | Bacteria | 2443 |
| 126 | Ga0070663_100225669 | 3300005455 | Bacteria | 1473 |
| 127 | Ga0070678_100051868 | 3300005456 | Bacteria | 2976 |
| 128 | Ga0070678_100073272 | 3300005456 | Bacteria | 2570 |
| 129 | Ga0070678_100109769 | 3300005456 | Bacteria | 2156 |
| 130 | Ga0070662_100016774 | 3300005457 | Bacteria | 4923 |
| 131 | Ga0070662_100033442 | 3300005457 | Bacteria | 3620 |
| 132 | Ga0070662_100050943 | 3300005457 | Bacteria | 2988 |
| 133 | Ga0070681_10004332 | 3300005458 | Bacteria | 13487 |
| 134 | Ga0070681_10016792 | 3300005458 | Bacteria | 7309 |
| 135 | Ga0070681_10017562 | 3300005458 | Bacteria | 7149 |
| 136 | Ga0070681_10034345 | 3300005458 | Bacteria | 5091 |
| 137 | Ga0070681_10101784 | 3300005458 | Bacteria | 2818 |
| 138 | Ga0070681_10131805 | 3300005458 | Bacteria | 2432 |
| 139 | Ga0068867_100007473 | 3300005459 | Bacteria | 7727 |
| 140 | Ga0068867_100540740 | 3300005459 | Bacteria | 1007 |
| 141 | Ga0070685_10018648 | 3300005466 | Bacteria | 3735 |
| 142 | Ga0070685_10019896 | 3300005466 | Bacteria | 3627 |
| 143 | Ga0070685_10034894 | 3300005466 | Bacteria | 2836 |
| 144 | Ga0070698_100056891 | 3300005471 | Bacteria | 3960 |
| 145 | Ga0070698_100141478 | 3300005471 | Bacteria | 2357 |
| 146 | Ga0070699_100065967 | 3300005518 | Bacteria | 3142 |
| 147 | Ga0070699_100148577 | 3300005518 | Bacteria | 2072 |
| 148 | Ga0070679_100021073 | 3300005530 | Bacteria | 6360 |
| 149 | Ga0070679_100102549 | 3300005530 | Bacteria | 2847 |
| 150 | Ga0070679_100106382 | 3300005530 | Bacteria | 2791 |
| 151 | Ga0070679_100592576 | 3300005530 | Bacteria | 1052 |
| 152 | Ga0070684_100005730 | 3300005535 | Bacteria | 9545 |
| 153 | Ga0070684_100096228 | 3300005535 | Bacteria | 2639 |
| 154 | Ga0068853_100073930 | 3300005539 | Bacteria | 2973 |
| 155 | Ga0068853_100175892 | 3300005539 | Bacteria | 1939 |
| 156 | Ga0068853_100239910 | 3300005539 | Bacteria | 1661 |
| 157 | Ga0070672_100000557 | 3300005543 | Bacteria | 21802 |
| 158 | Ga0070672_100066989 | 3300005543 | Bacteria | 2844 |
| 159 | Ga0070672_100154999 | 3300005543 | Bacteria | 1897 |
| 160 | Ga0070672_100372903 | 3300005543 | Unclassified | 1220 |
| 161 | Ga0070686_100002869 | 3300005544 | Bacteria | 9472 |
| 162 | Ga0070686_100003376 | 3300005544 | Bacteria | 8749 |
| 163 | Ga0070686_100010566 | 3300005544 | Bacteria | 5210 |
| 164 | Ga0070686_100077078 | 3300005544 | Bacteria | 2197 |
| 165 | Ga0070695_100009085 | 3300005545 | Bacteria | 5907 |
| 166 | Ga0070696_100026503 | 3300005546 | Bacteria | 3944 |
| 167 | Ga0070696_100133658 | 3300005546 | Bacteria | 1807 |
| 168 | Ga0070693_100009465 | 3300005547 | Bacteria | 4847 |
| 169 | Ga0070665_100021216 | 3300005548 | Bacteria | 6530 |
| 170 | Ga0070704_100004070 | 3300005549 | Bacteria | 8436 |
| 171 | Ga0070704_100008436 | 3300005549 | Bacteria | 6180 |
| 172 | Ga0068855_100016277 | 3300005563 | Bacteria | 8943 |
| 173 | Ga0068855_100106615 | 3300005563 | Bacteria | 3220 |
| 174 | Ga0068855_100303236 | 3300005563 | Bacteria | 1769 |
| 175 | Ga0070664_100000263 | 3300005564 | Bacteria | 37910 |
| 176 | Ga0070664_100033520 | 3300005564 | Bacteria | 4303 |
| 177 | Ga0070664_100052452 | 3300005564 | Bacteria | 3455 |
| 178 | Ga0070664_100086013 | 3300005564 | Bacteria | 2716 |
| 179 | Ga0070664_100171002 | 3300005564 | Bacteria | 1928 |
| 180 | Ga0068857_100000888 | 3300005577 | Bacteria | 22595 |
| 181 | Ga0068857_100032844 | 3300005577 | Bacteria | 4587 |
| 182 | Ga0068854_100005378 | 3300005578 | Bacteria | 8082 |
| 183 | Ga0068856_100003260 | 3300005614 | Bacteria | 16512 |
| 184 | Ga0068856_100384779 | 3300005614 | Bacteria | 1422 |
| 185 | Ga0070702_100001911 | 3300005615 | Bacteria | 8749 |
| 186 | Ga0068852_100000579 | 3300005616 | Bacteria | 24117 |
| 187 | Ga0068852_100020377 | 3300005616 | Bacteria | 5274 |
| 188 | Ga0068852_100156337 | 3300005616 | Bacteria | 2124 |
| 189 | Ga0068859_100003690 | 3300005617 | Bacteria | 15603 |
| 190 | Ga0068859_100047890 | 3300005617 | Bacteria | 4295 |
| 191 | Ga0068859_100077356 | 3300005617 | Bacteria | 3368 |
| 192 | Ga0068859_100154435 | 3300005617 | Bacteria | 2372 |
| 193 | Ga0068859_100206704 | 3300005617 | Unclassified | 2048 |
| 194 | Ga0068864_100001260 | 3300005618 | Bacteria | 21062 |
| 195 | Ga0068864_100032661 | 3300005618 | Bacteria | 4423 |
| 196 | Ga0068864_100082174 | 3300005618 | Bacteria | 2826 |
| 197 | Ga0068866_10001077 | 3300005718 | Bacteria | 12040 |
| 198 | Ga0068866_10082741 | 3300005718 | Bacteria | 1728 |
| 199 | Ga0068861_100001782 | 3300005719 | Bacteria | 13850 |
| 200 | Ga0068861_100033648 | 3300005719 | Bacteria | 3783 |
| 201 | Ga0068861_100129105 | 3300005719 | Bacteria | 2049 |
| 202 | Ga0068861_100291730 | 3300005719 | Bacteria | 1409 |
| 203 | Ga0068851_10200170 | 3300005834 | Bacteria | 1114 |
| 204 | Ga0068870_10000108 | 3300005840 | Bacteria | 28313 |
| 205 | Ga0068863_100001201 | 3300005841 | Bacteria | 25868 |
| 206 | Ga0068863_100025548 | 3300005841 | Bacteria | 5631 |
| 207 | Ga0068863_100064839 | 3300005841 | Bacteria | 3455 |
| 208 | Ga0068858_100000419 | 3300005842 | Bacteria | 44155 |
| 209 | Ga0068858_100027844 | 3300005842 | Bacteria | 5250 |
| 210 | Ga0068858_100046567 | 3300005842 | Bacteria | 4020 |
| 211 | Ga0068858_100181425 | 3300005842 | Bacteria | 1988 |
| 212 | Ga0068858_100327084 | 3300005842 | Bacteria | 1466 |
| 213 | Ga0068860_100001359 | 3300005843 | Bacteria | 26585 |
| 214 | Ga0068860_100020550 | 3300005843 | Bacteria | 6396 |
| 215 | Ga0068860_100059646 | 3300005843 | Bacteria | 3627 |
| 216 | Ga0068860_100162464 | 3300005843 | Bacteria | 2154 |
| 217 | Ga0068862_100005815 | 3300005844 | Bacteria | 10279 |
| 218 | Ga0068862_100217261 | 3300005844 | Bacteria | 1729 |
| 219 | Ga0068862_100438684 | 3300005844 | Bacteria | 1229 |
| 220 | Ga0068862_100689519 | 3300005844 | Bacteria | 989 |
| 221 | Ga0081455_10000009 | 3300005937 | Bacteria | 249885 |
| 222 | Ga0081455_10004299 | 3300005937 | Bacteria | 16034 |
| 223 | Ga0081455_10009512 | 3300005937 | Bacteria | 9988 |
| 224 | Ga0081455_10031917 | 3300005937 | Bacteria | 4755 |
| 225 | Ga0081455_10052863 | 3300005937 | Bacteria | 3474 |
| 226 | Ga0081455_10109166 | 3300005937 | Bacteria | 2202 |
| 227 | Ga0081538_10004153 | 3300005981 | Bacteria | 13436 |
| 228 | Ga0081538_10025193 | 3300005981 | Bacteria | 4204 |
| 229 | Ga0081538_10123568 | 3300005981 | Bacteria | 1237 |
| 230 | Ga0081540_1003051 | 3300005983 | Bacteria | 13420 |
| 231 | Ga0081539_10002606 | 3300005985 | Bacteria | 24730 |
| 232 | Ga0070717_10012616 | 3300006028 | Bacteria | 6447 |
| 233 | Ga0070717_10060095 | 3300006028 | Bacteria | 3147 |
| 234 | Ga0070717_10166732 | 3300006028 | Bacteria | 1913 |
| 235 | Ga0075365_10061816 | 3300006038 | Bacteria | 2502 |
| 236 | Ga0075365_10382844 | 3300006038 | Bacteria | 992 |
| 237 | Ga0075368_10015550 | 3300006042 | Bacteria | 2825 |
| 238 | Ga0075368_10041123 | 3300006042 | Bacteria | 1816 |
| 239 | Ga0075432_10005568 | 3300006058 | Bacteria | 4290 |
| 240 | Ga0075432_10024861 | 3300006058 | Bacteria | 2054 |
| 241 | Ga0075432_10102466 | 3300006058 | Bacteria | 1059 |
| 242 | Ga0070715_10008072 | 3300006163 | Bacteria | 3653 |
| 243 | Ga0070716_100004485 | 3300006173 | Bacteria | 6678 |
| 244 | Ga0070716_100049983 | 3300006173 | Unclassified | 2371 |
| 245 | Ga0070716_100515807 | 3300006173 | Bacteria | 885 |
| 246 | Ga0070712_100005677 | 3300006175 | Bacteria | 7715 |
| 247 | Ga0070712_100005829 | 3300006175 | Bacteria | 7623 |
| 248 | Ga0070712_100011711 | 3300006175 | Bacteria | 5573 |
| 249 | Ga0070712_100026436 | 3300006175 | Bacteria | 3866 |
| 250 | Ga0070712_100040984 | 3300006175 | Bacteria | 3177 |
| 251 | Ga0070712_100123361 | 3300006175 | Bacteria | 1953 |
| 252 | Ga0075367_10023664 | 3300006178 | Bacteria | 3458 |
| 253 | Ga0075366_10006561 | 3300006195 | Bacteria | 6382 |
| 254 | Ga0097621_100002584 | 3300006237 | Bacteria | 12403 |
| 255 | Ga0097621_100012651 | 3300006237 | Bacteria | 6265 |
| 256 | Ga0097621_100043375 | 3300006237 | Bacteria | 3626 |
| 257 | Ga0075370_10029418 | 3300006353 | Bacteria | 3061 |
| 258 | Ga0075370_10031420 | 3300006353 | Bacteria | 2964 |
| 259 | Ga0068871_100000417 | 3300006358 | Bacteria | 29416 |
| 260 | Ga0068871_100011895 | 3300006358 | Bacteria | 6403 |
| 261 | Ga0068871_100013278 | 3300006358 | Bacteria | 6110 |
| 262 | Ga0075428_100003881 | 3300006844 | Bacteria | 16432 |
| 263 | Ga0075428_100131390 | 3300006844 | Bacteria | 2723 |
| 264 | Ga0075428_100244896 | 3300006844 | Bacteria | 1934 |
| 265 | Ga0075428_100248253 | 3300006844 | Bacteria | 1918 |
| 266 | Ga0075428_100266783 | 3300006844 | Bacteria | 1843 |
| 267 | Ga0075428_100300619 | 3300006844 | Bacteria | 1725 |
| 268 | Ga0075428_100325983 | 3300006844 | Bacteria | 1650 |
| 269 | Ga0075430_100001576 | 3300006846 | Bacteria | 18645 |
| 270 | Ga0075430_100003854 | 3300006846 | Bacteria | 12635 |
| 271 | Ga0075430_100019980 | 3300006846 | Bacteria | 5701 |
| 272 | Ga0075430_100022460 | 3300006846 | Bacteria | 5369 |
| 273 | Ga0075430_100157543 | 3300006846 | Bacteria | 1890 |
| 274 | Ga0075430_100346115 | 3300006846 | Bacteria | 1228 |
| 275 | Ga0075431_100003990 | 3300006847 | Bacteria | 14380 |
| 276 | Ga0075431_100061408 | 3300006847 | Bacteria | 3877 |
| 277 | Ga0075431_100071416 | 3300006847 | Bacteria | 3582 |
| 278 | Ga0075431_100133607 | 3300006847 | Bacteria | 2558 |
| 279 | Ga0075431_100150388 | 3300006847 | Bacteria | 2397 |
| 280 | Ga0075431_100187571 | 3300006847 | Bacteria | 2120 |
| 281 | Ga0075431_100231619 | 3300006847 | Bacteria | 1882 |
| 282 | Ga0075431_100304756 | 3300006847 | Bacteria | 1609 |
| 283 | Ga0075433_10000187 | 3300006852 | Bacteria | 34883 |
| 284 | Ga0075433_10140923 | 3300006852 | Bacteria | 2143 |
| 285 | Ga0075433_10172118 | 3300006852 | Bacteria | 1927 |
| 286 | Ga0075434_100001354 | 3300006871 | Bacteria | 20567 |
| 287 | Ga0075434_100002767 | 3300006871 | Bacteria | 15520 |
| 288 | Ga0075434_100050801 | 3300006871 | Bacteria | 4119 |
| 289 | Ga0075434_100076390 | 3300006871 | Bacteria | 3344 |
| 290 | Ga0075434_100084508 | 3300006871 | Bacteria | 3173 |
| 291 | Ga0075434_100085012 | 3300006871 | Bacteria | 3163 |
| 292 | Ga0075434_100420353 | 3300006871 | Bacteria | 1358 |
| 293 | Ga0075429_100027801 | 3300006880 | Bacteria | 4909 |
| 294 | Ga0075429_100149796 | 3300006880 | Bacteria | 2042 |
| 295 | Ga0075429_100212877 | 3300006880 | Bacteria | 1693 |
| 296 | Ga0068865_100000450 | 3300006881 | Bacteria | 22865 |
| 297 | Ga0068865_100075220 | 3300006881 | Unclassified | 2408 |
| 298 | Ga0075436_100034598 | 3300006914 | Bacteria | 3484 |
| 299 | Ga0075436_100304814 | 3300006914 | Bacteria | 1142 |
| 300 | Ga0097620_100003690 | 3300006931 | Bacteria | 15603 |
| 301 | Ga0097620_100047890 | 3300006931 | Bacteria | 4295 |
| 302 | Ga0097620_100077356 | 3300006931 | Bacteria | 3368 |
| 303 | Ga0097620_100154423 | 3300006931 | Bacteria | 2372 |
| 304 | Ga0097620_100206713 | 3300006931 | Unclassified | 2048 |
| 305 | Ga0075435_100036177 | 3300007076 | Bacteria | 3922 |
| 306 | Ga0075435_100425497 | 3300007076 | Bacteria | 1144 |
| 307 | Ga0099795_10003382 | 3300007788 | Bacteria | 3937 |
| 308 | Ga0099795_10062088 | 3300007788 | Bacteria | 1389 |
| 309 | Ga0105244_10121696 | 3300009036 | Bacteria | 1263 |
| 310 | Ga0105240_10038333 | 3300009093 | Bacteria | 6147 |
| 311 | Ga0111539_10006363 | 3300009094 | Bacteria | 15229 |
| 312 | Ga0111539_10039525 | 3300009094 | Bacteria | 5684 |
| 313 | Ga0111539_10048283 | 3300009094 | Bacteria | 5083 |
| 314 | Ga0111539_10201534 | 3300009094 | Bacteria | 2320 |
| 315 | Ga0111539_10363797 | 3300009094 | Bacteria | 1684 |
| 316 | Ga0111539_10886496 | 3300009094 | Bacteria | 1038 |
| 317 | Ga0105245_10000898 | 3300009098 | Bacteria | 27086 |
| 318 | Ga0105245_10019401 | 3300009098 | Bacteria | 5956 |
| 319 | Ga0105245_10058770 | 3300009098 | Bacteria | 3461 |
| 320 | Ga0105245_10142916 | 3300009098 | Bacteria | 2255 |
| 321 | Ga0105247_10003526 | 3300009101 | Bacteria | 10172 |
| 322 | Ga0105247_10052803 | 3300009101 | Bacteria | 2507 |
| 323 | Ga0114129_10000995 | 3300009147 | Bacteria | 37077 |
| 324 | Ga0114129_10043385 | 3300009147 | Bacteria | 6327 |
| 325 | Ga0114129_10066405 | 3300009147 | Bacteria | 5032 |
| 326 | Ga0114129_10068674 | 3300009147 | Bacteria | 4941 |
| 327 | Ga0114129_10266962 | 3300009147 | Bacteria | 2291 |
| 328 | Ga0114129_10353298 | 3300009147 | Bacteria | 1946 |
| 329 | Ga0105243_10002051 | 3300009148 | Bacteria | 17085 |
| 330 | Ga0105243_10089977 | 3300009148 | Bacteria | 2525 |
| 331 | Ga0105243_10203901 | 3300009148 | Bacteria | 1736 |
| 332 | Ga0105243_10708890 | 3300009148 | Bacteria | 982 |
| 333 | Ga0105241_10001526 | 3300009174 | Bacteria | 17741 |
| 334 | Ga0105241_10152988 | 3300009174 | Bacteria | 1889 |
| 335 | Ga0105242_10000399 | 3300009176 | Bacteria | 34466 |
| 336 | Ga0105242_10247102 | 3300009176 | Bacteria | 1606 |
| 337 | Ga0105248_10004145 | 3300009177 | Bacteria | 16029 |
| 338 | Ga0105248_10026703 | 3300009177 | Bacteria | 6420 |
| 339 | Ga0105248_10031820 | 3300009177 | Bacteria | 5895 |
| 340 | Ga0105248_10078259 | 3300009177 | Bacteria | 3717 |
| 341 | Ga0105248_10081870 | 3300009177 | Bacteria | 3629 |
| 342 | Ga0105248_10095812 | 3300009177 | Bacteria | 3341 |
| 343 | Ga0105248_10571375 | 3300009177 | Bacteria | 1276 |
| 344 | Ga0105237_10006666 | 3300009545 | Bacteria | 12762 |
| 345 | Ga0105237_10075814 | 3300009545 | Bacteria | 3354 |
| 346 | Ga0105238_10017057 | 3300009551 | Bacteria | 7372 |
| 347 | Ga0105238_10059456 | 3300009551 | Bacteria | 3829 |
| 348 | Ga0105238_10100771 | 3300009551 | Bacteria | 2871 |
| 349 | Ga0105238_10171795 | 3300009551 | Bacteria | 2144 |
| 350 | Ga0105238_10183822 | 3300009551 | Bacteria | 2067 |
| 351 | Ga0105249_10002756 | 3300009553 | Bacteria | 15191 |
| 352 | Ga0099796_10023205 | 3300010159 | Bacteria | 1934 |
| 353 | Ga0105239_10009796 | 3300010375 | Bacteria | 10767 |
| 354 | Ga0105239_10184640 | 3300010375 | Bacteria | 2334 |
| 355 | Ga0105239_10432739 | 3300010375 | Bacteria | 1491 |
| 356 | Ga0105246_10000033 | 3300011119 | Bacteria | 50575 |
| 357 | Ga0105246_10188930 | 3300011119 | Bacteria | 1593 |
| 358 | Ga0105246_10223477 | 3300011119 | Bacteria | 1477 |
| 359 | Ga0157373_10006645 | 3300013100 | Bacteria | 8615 |
| 360 | Ga0157371_10033300 | 3300013102 | Bacteria | 3703 |
| 361 | Ga0157371_10068893 | 3300013102 | Bacteria | 2505 |
| 362 | Ga0157370_10198539 | 3300013104 | Bacteria | 1861 |
| 363 | Ga0157374_10002423 | 3300013296 | Bacteria | 15718 |
| 364 | Ga0157374_10054544 | 3300013296 | Bacteria | 3729 |
| 365 | Ga0157374_10444840 | 3300013296 | Bacteria | 1297 |
| 366 | Ga0157378_10011328 | 3300013297 | Bacteria | 7804 |
| 367 | Ga0163162_10001526 | 3300013306 | Bacteria | 21576 |
| 368 | Ga0163162_10068838 | 3300013306 | Bacteria | 3591 |
| 369 | Ga0163162_10642162 | 3300013306 | Bacteria | 1185 |
| 370 | Ga0163162_10795344 | 3300013306 | Bacteria | 1063 |
| 371 | Ga0157372_10001162 | 3300013307 | Bacteria | 28497 |
| 372 | Ga0157375_10000124 | 3300013308 | Bacteria | 76003 |
| 373 | Ga0157375_10017274 | 3300013308 | Bacteria | 6507 |
| 374 | Ga0157375_10217286 | 3300013308 | Bacteria | 2070 |
| 375 | Ga0157375_10614352 | 3300013308 | Bacteria | 1245 |
| 376 | Ga0163163_10000745 | 3300014325 | Bacteria | 27709 |
| 377 | Ga0163163_10019246 | 3300014325 | Bacteria | 6408 |
| 378 | Ga0157380_10000140 | 3300014326 | Bacteria | 40628 |
| 379 | Ga0157380_10064645 | 3300014326 | Bacteria | 2938 |
| 380 | Ga0157377_10000117 | 3300014745 | Bacteria | 53219 |
| 381 | Ga0157379_10000785 | 3300014968 | Bacteria | 25777 |
| 382 | Ga0157379_10317925 | 3300014968 | Bacteria | 1421 |
| 383 | Ga0157379_10393996 | 3300014968 | Bacteria | 1272 |
| 384 | Ga0157376_10000034 | 3300014969 | Bacteria | 161526 |
| 385 | Ga0157376_10023138 | 3300014969 | Bacteria | 4858 |
| 386 | Ga0163161_10000448 | 3300017792 | Bacteria | 34334 |
| 387 | Ga0163161_10250117 | 3300017792 | Bacteria | 1381 |
| 388 | Ga0206352_10618637 | 3300020078 | Bacteria | 849 |
| 389 | Ga0206350_10087095 | 3300020080 | Bacteria | 847 |
| 390 | Ga0213873_10076792 | 3300021358 | Bacteria | 929 |
| 391 | Ga0213872_10018295 | 3300021361 | Bacteria | 3232 |
| 392 | Ga0213875_10000025 | 3300021388 | Bacteria | 197787 |
| 393 | Ga0224572_1005633 | 3300024225 | Bacteria | 2241 |
| 394 | Ga0228598_1003747 | 3300024227 | Bacteria | 3248 |
| 395 | Ga0228598_1019940 | 3300024227 | Bacteria | 1321 |
| 396 | Ga0207666_1000017 | 3300025271 | Bacteria | 40049 |
| 397 | Ga0207666_1000125 | 3300025271 | Bacteria | 11954 |
| 398 | Ga0207673_1000060 | 3300025290 | Bacteria | 9200 |
| 399 | Ga0207697_10000009 | 3300025315 | Bacteria | 67526 |
| 400 | Ga0207697_10001569 | 3300025315 | Bacteria | 12343 |
| 401 | Ga0207713_1032298 | 3300025735 | Bacteria | 2301 |
| 402 | Ga0207653_10001876 | 3300025885 | Bacteria | 6729 |
| 403 | Ga0207653_10015121 | 3300025885 | Unclassified | 2422 |
| 404 | Ga0207682_10000301 | 3300025893 | Bacteria | 22279 |
| 405 | Ga0207682_10010412 | 3300025893 | Bacteria | 3645 |
| 406 | Ga0207692_10005014 | 3300025898 | Bacteria | 5272 |
| 407 | Ga0207692_10019482 | 3300025898 | Bacteria | 3067 |
| 408 | Ga0207692_10083224 | 3300025898 | Bacteria | 1716 |
| 409 | Ga0207642_10002547 | 3300025899 | Bacteria | 5673 |
| 410 | Ga0207642_10317890 | 3300025899 | Bacteria | 908 |
| 411 | Ga0207710_10011377 | 3300025900 | Bacteria | 3747 |
| 412 | Ga0207710_10013038 | 3300025900 | Bacteria | 3503 |
| 413 | Ga0207710_10036104 | 3300025900 | Bacteria | 2178 |
| 414 | Ga0207688_10000012 | 3300025901 | Bacteria | 60353 |
| 415 | Ga0207688_10005642 | 3300025901 | Bacteria | 6806 |
| 416 | Ga0207688_10133339 | 3300025901 | Bacteria | 1457 |
| 417 | Ga0207680_10004369 | 3300025903 | Bacteria | 6700 |
| 418 | Ga0207680_10027612 | 3300025903 | Bacteria | 3163 |
| 419 | Ga0207680_10335967 | 3300025903 | Bacteria | 1059 |
| 420 | Ga0207647_10005111 | 3300025904 | Bacteria | 9660 |
| 421 | Ga0207647_10005834 | 3300025904 | Bacteria | 8979 |
| 422 | Ga0207685_10013690 | 3300025905 | Bacteria | 2517 |
| 423 | Ga0207685_10044633 | 3300025905 | Bacteria | 1677 |
| 424 | Ga0207699_10005829 | 3300025906 | Bacteria | 5928 |
| 425 | Ga0207699_10100296 | 3300025906 | Bacteria | 1836 |
| 426 | Ga0207699_10125698 | 3300025906 | Bacteria | 1665 |
| 427 | Ga0207645_10000124 | 3300025907 | Bacteria | 58746 |
| 428 | Ga0207645_10032352 | 3300025907 | Bacteria | 3362 |
| 429 | Ga0207645_10036464 | 3300025907 | Bacteria | 3157 |
| 430 | Ga0207645_10054407 | 3300025907 | Bacteria | 2556 |
| 431 | Ga0207643_10000046 | 3300025908 | Bacteria | 80736 |
| 432 | Ga0207643_10080377 | 3300025908 | Bacteria | 1888 |
| 433 | Ga0207705_10108072 | 3300025909 | Bacteria | 2053 |
| 434 | Ga0207654_10003867 | 3300025911 | Bacteria | 7546 |
| 435 | Ga0207654_10062488 | 3300025911 | Bacteria | 2182 |
| 436 | Ga0207707_10036253 | 3300025912 | Bacteria | 4313 |
| 437 | Ga0207707_10190039 | 3300025912 | Bacteria | 1792 |
| 438 | Ga0207707_10214100 | 3300025912 | Bacteria | 1678 |
| 439 | Ga0207707_10350297 | 3300025912 | Bacteria | 1272 |
| 440 | Ga0207695_10065683 | 3300025913 | Bacteria | 3729 |
| 441 | Ga0207695_10184013 | 3300025913 | Bacteria | 2009 |
| 442 | Ga0207671_10127298 | 3300025914 | Bacteria | 1952 |
| 443 | Ga0207671_10228930 | 3300025914 | Bacteria | 1458 |
| 444 | Ga0207693_10004620 | 3300025915 | Bacteria | 11619 |
| 445 | Ga0207693_10005130 | 3300025915 | Bacteria | 10967 |
| 446 | Ga0207693_10013189 | 3300025915 | Bacteria | 6667 |
| 447 | Ga0207693_10046296 | 3300025915 | Bacteria | 3417 |
| 448 | Ga0207693_10172981 | 3300025915 | Bacteria | 1700 |
| 449 | Ga0207663_10011495 | 3300025916 | Bacteria | 4753 |
| 450 | Ga0207663_10163433 | 3300025916 | Bacteria | 1574 |
| 451 | Ga0207663_10214114 | 3300025916 | Bacteria | 1398 |
| 452 | Ga0207660_10000489 | 3300025917 | Bacteria | 26431 |
| 453 | Ga0207660_10020291 | 3300025917 | Bacteria | 4456 |
| 454 | Ga0207660_10049252 | 3300025917 | Bacteria | 2985 |
| 455 | Ga0207660_10202880 | 3300025917 | Bacteria | 1549 |
| 456 | Ga0207660_10277299 | 3300025917 | Bacteria | 1329 |
| 457 | Ga0207662_10008508 | 3300025918 | Bacteria | 5620 |
| 458 | Ga0207662_10025829 | 3300025918 | Bacteria | 3384 |
| 459 | Ga0207662_10034499 | 3300025918 | Bacteria | 2953 |
| 460 | Ga0207662_10076811 | 3300025918 | Bacteria | 2030 |
| 461 | Ga0207662_10115546 | 3300025918 | Bacteria | 1677 |
| 462 | Ga0207657_10000162 | 3300025919 | Bacteria | 68121 |
| 463 | Ga0207657_10008982 | 3300025919 | Bacteria | 10097 |
| 464 | Ga0207657_10039314 | 3300025919 | Bacteria | 4206 |
| 465 | Ga0207657_10085018 | 3300025919 | Bacteria | 2651 |
| 466 | Ga0207657_10223662 | 3300025919 | Bacteria | 1507 |
| 467 | Ga0207649_10000798 | 3300025920 | Bacteria | 20284 |
| 468 | Ga0207649_10412506 | 3300025920 | Bacteria | 1013 |
| 469 | Ga0207652_10028398 | 3300025921 | Bacteria | 4668 |
| 470 | Ga0207652_10092934 | 3300025921 | Bacteria | 2654 |
| 471 | Ga0207652_10137907 | 3300025921 | Bacteria | 2179 |
| 472 | Ga0207652_10534187 | 3300025921 | Bacteria | 1055 |
| 473 | Ga0207646_10059826 | 3300025922 | Bacteria | 3402 |
| 474 | Ga0207646_10673409 | 3300025922 | Bacteria | 926 |
| 475 | Ga0207681_10011712 | 3300025923 | Bacteria | 5391 |
| 476 | Ga0207681_10203594 | 3300025923 | Bacteria | 1521 |
| 477 | Ga0207694_10043046 | 3300025924 | Bacteria | 3485 |
| 478 | Ga0207694_10065822 | 3300025924 | Bacteria | 2826 |
| 479 | Ga0207694_10102049 | 3300025924 | Bacteria | 2274 |
| 480 | Ga0207694_10218328 | 3300025924 | Bacteria | 1554 |
| 481 | Ga0207650_10087109 | 3300025925 | Bacteria | 2379 |
| 482 | Ga0207659_10000017 | 3300025926 | Bacteria | 159908 |
| 483 | Ga0207687_10006873 | 3300025927 | Bacteria | 7495 |
| 484 | Ga0207687_10024743 | 3300025927 | Bacteria | 4013 |
| 485 | Ga0207687_10188644 | 3300025927 | Bacteria | 1603 |
| 486 | Ga0207687_10406477 | 3300025927 | Bacteria | 1121 |
| 487 | Ga0207700_10001122 | 3300025928 | Bacteria | 15358 |
| 488 | Ga0207700_10178476 | 3300025928 | Bacteria | 1776 |
| 489 | Ga0207664_10044126 | 3300025929 | Bacteria | 3490 |
| 490 | Ga0207664_10082606 | 3300025929 | Bacteria | 2617 |
| 491 | Ga0207664_10086393 | 3300025929 | Bacteria | 2562 |
| 492 | Ga0207664_10103171 | 3300025929 | Bacteria | 2359 |
| 493 | Ga0207644_10012971 | 3300025931 | Bacteria | 5544 |
| 494 | Ga0207644_10013070 | 3300025931 | Bacteria | 5526 |
| 495 | Ga0207644_10036024 | 3300025931 | Bacteria | 3471 |
| 496 | Ga0207644_10043725 | 3300025931 | Bacteria | 3180 |
| 497 | Ga0207644_10510269 | 3300025931 | Bacteria | 992 |
| 498 | Ga0207690_10000151 | 3300025932 | Bacteria | 54897 |
| 499 | Ga0207706_10000368 | 3300025933 | Bacteria | 48834 |
| 500 | Ga0207706_10007484 | 3300025933 | Bacteria | 10098 |
| 501 | Ga0207706_10008477 | 3300025933 | Bacteria | 9481 |
| 502 | Ga0207706_10017363 | 3300025933 | Bacteria | 6483 |
| 503 | Ga0207706_10018620 | 3300025933 | Bacteria | 6247 |
| 504 | Ga0207686_10003886 | 3300025934 | Bacteria | 8011 |
| 505 | Ga0207686_10016902 | 3300025934 | Bacteria | 4100 |
| 506 | Ga0207686_10023460 | 3300025934 | Bacteria | 3564 |
| 507 | Ga0207709_10000256 | 3300025935 | Bacteria | 63853 |
| 508 | Ga0207709_10022765 | 3300025935 | Bacteria | 3557 |
| 509 | Ga0207709_10139977 | 3300025935 | Unclassified | 1662 |
| 510 | Ga0207709_10616639 | 3300025935 | Bacteria | 860 |
| 511 | Ga0207670_10000086 | 3300025936 | Bacteria | 63570 |
| 512 | Ga0207670_10027694 | 3300025936 | Bacteria | 3587 |
| 513 | Ga0207670_10068924 | 3300025936 | Bacteria | 2438 |
| 514 | Ga0207670_10085467 | 3300025936 | Bacteria | 2217 |
| 515 | Ga0207670_10098770 | 3300025936 | Bacteria | 2081 |
| 516 | Ga0207670_10170788 | 3300025936 | Bacteria | 1630 |
| 517 | Ga0207669_10001765 | 3300025937 | Bacteria | 9180 |
| 518 | Ga0207669_10014117 | 3300025937 | Bacteria | 3995 |
| 519 | Ga0207669_10021878 | 3300025937 | Bacteria | 3386 |
| 520 | Ga0207669_10069684 | 3300025937 | Bacteria | 2201 |
| 521 | Ga0207669_10196812 | 3300025937 | Bacteria | 1459 |
| 522 | Ga0207669_10312254 | 3300025937 | Bacteria | 1199 |
| 523 | Ga0207704_10002423 | 3300025938 | Bacteria | 8389 |
| 524 | Ga0207704_10052873 | 3300025938 | Unclassified | 2465 |
| 525 | Ga0207704_10160794 | 3300025938 | Bacteria | 1598 |
| 526 | Ga0207665_10010248 | 3300025939 | Bacteria | 6157 |
| 527 | Ga0207665_10042186 | 3300025939 | Bacteria | 3049 |
| 528 | Ga0207665_10210897 | 3300025939 | Bacteria | 1419 |
| 529 | Ga0207691_10000303 | 3300025940 | Bacteria | 48873 |
| 530 | Ga0207691_10004340 | 3300025940 | Bacteria | 13762 |
| 531 | Ga0207691_10203100 | 3300025940 | Bacteria | 1724 |
| 532 | Ga0207691_10397324 | 3300025940 | Bacteria | 1176 |
| 533 | Ga0207711_10013210 | 3300025941 | Bacteria | 6859 |
| 534 | Ga0207711_10057541 | 3300025941 | Bacteria | 3342 |
| 535 | Ga0207711_10121154 | 3300025941 | Bacteria | 2335 |
| 536 | Ga0207711_10348899 | 3300025941 | Bacteria | 1370 |
| 537 | Ga0207711_10375601 | 3300025941 | Bacteria | 1319 |
| 538 | Ga0207689_10000109 | 3300025942 | Bacteria | 67941 |
| 539 | Ga0207689_10037728 | 3300025942 | Bacteria | 4005 |
| 540 | Ga0207661_10010457 | 3300025944 | Bacteria | 6680 |
| 541 | Ga0207661_10218844 | 3300025944 | Bacteria | 1682 |
| 542 | Ga0207661_10333953 | 3300025944 | Bacteria | 1365 |
| 543 | Ga0207679_10000031 | 3300025945 | Bacteria | 165962 |
| 544 | Ga0207679_10133638 | 3300025945 | Bacteria | 1994 |
| 545 | Ga0207679_10640370 | 3300025945 | Bacteria | 961 |
| 546 | Ga0207667_10002481 | 3300025949 | Bacteria | 22990 |
| 547 | Ga0207667_10044884 | 3300025949 | Bacteria | 4682 |
| 548 | Ga0207651_10000044 | 3300025960 | Bacteria | 58072 |
| 549 | Ga0207651_10049035 | 3300025960 | Bacteria | 2858 |
| 550 | Ga0207651_10061834 | 3300025960 | Unclassified | 2607 |
| 551 | Ga0207712_10001848 | 3300025961 | Bacteria | 13972 |
| 552 | Ga0207712_10057628 | 3300025961 | Bacteria | 2742 |
| 553 | Ga0207668_10001339 | 3300025972 | Bacteria | 14601 |
| 554 | Ga0207668_10233163 | 3300025972 | Unclassified | 1485 |
| 555 | Ga0207640_10210056 | 3300025981 | Bacteria | 1482 |
| 556 | Ga0207658_10025019 | 3300025986 | Bacteria | 4179 |
| 557 | Ga0207658_10032961 | 3300025986 | Bacteria | 3692 |
| 558 | Ga0207658_10034292 | 3300025986 | Bacteria | 3627 |
| 559 | Ga0207658_10103050 | 3300025986 | Bacteria | 2239 |
| 560 | Ga0207658_10316734 | 3300025986 | Bacteria | 1349 |
| 561 | Ga0207658_10438273 | 3300025986 | Bacteria | 1155 |
| 562 | Ga0207677_10006203 | 3300026023 | Bacteria | 6535 |
| 563 | Ga0207677_10056419 | 3300026023 | Bacteria | 2691 |
| 564 | Ga0207703_10018118 | 3300026035 | Bacteria | 5500 |
| 565 | Ga0207703_10031219 | 3300026035 | Bacteria | 4211 |
| 566 | Ga0207703_10170841 | 3300026035 | Bacteria | 1912 |
| 567 | Ga0207703_10202260 | 3300026035 | Bacteria | 1765 |
| 568 | Ga0207703_10459859 | 3300026035 | Unclassified | 1190 |
| 569 | Ga0207639_10053044 | 3300026041 | Bacteria | 3092 |
| 570 | Ga0207639_10374939 | 3300026041 | Unclassified | 1276 |
| 571 | Ga0207678_10000158 | 3300026067 | Bacteria | 56255 |
| 572 | Ga0207678_10031192 | 3300026067 | Bacteria | 4650 |
| 573 | Ga0207678_10047158 | 3300026067 | Bacteria | 3727 |
| 574 | Ga0207708_10000098 | 3300026075 | Bacteria | 67005 |
| 575 | Ga0207708_10005985 | 3300026075 | Bacteria | 9009 |
| 576 | Ga0207702_10008602 | 3300026078 | Bacteria | 8606 |
| 577 | Ga0207702_10425025 | 3300026078 | Bacteria | 1285 |
| 578 | Ga0207641_10000408 | 3300026088 | Bacteria | 50477 |
| 579 | Ga0207648_10000696 | 3300026089 | Bacteria | 37592 |
| 580 | Ga0207648_10014142 | 3300026089 | Bacteria | 7382 |
| 581 | Ga0207648_10055376 | 3300026089 | Bacteria | 3462 |
| 582 | Ga0207676_10037167 | 3300026095 | Bacteria | 3709 |
| 583 | Ga0207676_10117072 | 3300026095 | Bacteria | 2240 |
| 584 | Ga0207676_10190212 | 3300026095 | Bacteria | 1805 |
| 585 | Ga0207674_10000420 | 3300026116 | Bacteria | 55287 |
| 586 | Ga0207674_10010481 | 3300026116 | Bacteria | 10494 |
| 587 | Ga0207675_100001146 | 3300026118 | Bacteria | 26264 |
| 588 | Ga0207675_100024805 | 3300026118 | Bacteria | 5579 |
| 589 | Ga0207675_100085001 | 3300026118 | Bacteria | 2969 |
| 590 | Ga0207675_100470399 | 3300026118 | Bacteria | 1248 |
| 591 | Ga0207683_10000004 | 3300026121 | Bacteria | 188086 |
| 592 | Ga0207683_10001766 | 3300026121 | Bacteria | 19131 |
| 593 | Ga0207683_10017083 | 3300026121 | Bacteria | 6176 |
| 594 | Ga0207683_10065450 | 3300026121 | Bacteria | 3205 |
| 595 | Ga0207683_10078238 | 3300026121 | Bacteria | 2930 |
| 596 | Ga0207698_10005316 | 3300026142 | Bacteria | 7936 |
| 597 | Ga0207698_10615545 | 3300026142 | Bacteria | 1072 |
| 598 | Ga0209179_1008391 | 3300027512 | Unclassified | 1740 |
| 599 | Ga0209179_1016983 | 3300027512 | Bacteria | 1372 |
| 600 | Ga0209983_1012408 | 3300027665 | Bacteria | 1749 |
| 601 | Ga0209971_1021584 | 3300027682 | Bacteria | 1532 |
| 602 | Ga0209966_1001342 | 3300027695 | Bacteria | 4312 |
| 603 | Ga0209966_1034142 | 3300027695 | Bacteria | 1040 |
| 604 | Ga0209998_10001259 | 3300027717 | Bacteria | 6207 |
| 605 | Ga0209998_10003935 | 3300027717 | Bacteria | 3199 |
| 606 | Ga0209813_10016575 | 3300027866 | Bacteria | 2013 |
| 607 | Ga0209813_10035088 | 3300027866 | Bacteria | 1500 |
| 608 | Ga0209974_10000117 | 3300027876 | Bacteria | 23200 |
| 609 | Ga0209974_10006843 | 3300027876 | Bacteria | 3956 |
| 610 | Ga0209974_10028923 | 3300027876 | Unclassified | 1836 |
| 611 | Ga0209974_10029881 | 3300027876 | Bacteria | 1806 |
| 612 | Ga0207428_10000250 | 3300027907 | Bacteria | 73217 |
| 613 | Ga0207428_10001707 | 3300027907 | Bacteria | 22539 |
| 614 | Ga0207428_10006503 | 3300027907 | Bacteria | 10786 |
| 615 | Ga0207428_10007251 | 3300027907 | Bacteria | 10137 |
| 616 | Ga0207428_10023620 | 3300027907 | Bacteria | 5167 |
| 617 | Ga0268266_10019723 | 3300028379 | Bacteria | 5745 |
| 618 | Ga0268266_10064479 | 3300028379 | Bacteria | 3165 |
| 619 | Ga0268266_10070409 | 3300028379 | Bacteria | 3031 |
| 620 | Ga0268265_10005880 | 3300028380 | Bacteria | 8360 |
| 621 | Ga0268264_10018374 | 3300028381 | Bacteria | 5717 |
| 622 | Ga0268264_10074225 | 3300028381 | Bacteria | 2888 |
| 623 | Ga0268264_10365487 | 3300028381 | Bacteria | 1378 |
| 624 | Ga0268264_10415273 | 3300028381 | Bacteria | 1296 |
| 625 | Ga0265762_1005243 | 3300030760 | Bacteria | 2323 |
| 626 | Ga0265760_10031613 | 3300031090 | Bacteria | 1561 |
| 627 | Ga0265330_10156849 | 3300031235 | Bacteria | 967 |
| 628 | Ga0265325_10064261 | 3300031241 | Bacteria | 1855 |
| 629 | Ga0265325_10200729 | 3300031241 | Bacteria | 920 |
| 630 | Ga0265340_10007163 | 3300031247 | Bacteria | 6075 |
| 631 | Ga0265340_10012516 | 3300031247 | Bacteria | 4478 |
| 632 | Ga0265340_10017482 | 3300031247 | Bacteria | 3710 |
| 633 | Ga0265340_10075396 | 3300031247 | Bacteria | 1594 |
| 634 | Ga0265339_10001522 | 3300031249 | Bacteria | 17112 |
| 635 | Ga0265339_10106548 | 3300031249 | Bacteria | 1454 |
| 636 | Ga0265316_10006562 | 3300031344 | Bacteria | 11097 |
| 637 | Ga0265316_10289717 | 3300031344 | Bacteria | 1195 |
| 638 | Ga0307509_10001384 | 3300031507 | Bacteria | 41108 |
| 639 | Ga0265313_10000181 | 3300031595 | Bacteria | 67263 |
| 640 | Ga0265313_10007831 | 3300031595 | Bacteria | 7212 |
| 641 | Ga0265313_10008019 | 3300031595 | Bacteria | 7088 |
| 642 | Ga0265313_10011961 | 3300031595 | Bacteria | 5350 |
| 643 | Ga0265313_10073281 | 3300031595 | Bacteria | 1572 |
| 644 | Ga0265342_10005915 | 3300031712 | Bacteria | 9216 |
| 645 | Ga0265342_10008745 | 3300031712 | Bacteria | 7222 |
| 646 | Ga0265342_10067079 | 3300031712 | Bacteria | 2101 |
| 647 | Ga0307409_100285899 | 3300031995 | Bacteria | 1527 |
| 648 | Ga0316583_10032105 | 3300032133 | Bacteria | 1867 |
| 649 | Ga0373958_0021183 | 3300034819 | Bacteria | 1204 |
| 650 | Ga0373959_0033533 | 3300034820 | Bacteria | 1048 |
| 651 | Ga0373938_0000421 | 3300034957 | Bacteria | 6838 |
| 652 | Ga0373926_0007240 | 3300035083 | Bacteria | 3698 |
| 653 | Ga0373928_0034835 | 3300035084 | Bacteria | 1132 |
| 654 | Ga0373934_0033278 | 3300035086 | Bacteria | 2023 |
| 655 | Ga0373940_0031602 | 3300035088 | Bacteria | 1414 |
| 656 | Ga0373949_0001809 | 3300035090 | Bacteria | 5846 |
| 657 | Ga0373951_0009831 | 3300035091 | Bacteria | 2150 |
| 658 | Ga0373952_0002647 | 3300035092 | Bacteria | 3231 |
| 659 | Ga0373923_0158125 | 3300035111 | Bacteria | 1033 |
| 660 | Ga0373932_0001391 | 3300035112 | Bacteria | 6783 |
| 661 | Ga0373939_0010614 | 3300035114 | Bacteria | 2308 |
| 662 | Ga0373941_0009316 | 3300035115 | Bacteria | 2469 |
| 663 | Ga0373954_0143184 | 3300035118 | Bacteria | 1167 |
| 664 | Ga0373956_0100444 | 3300035119 | Bacteria | 1342 |
| 665 | Ga0373957_0000917 | 3300035120 | Bacteria | 7716 |
| 666 | Ga0373960_0003777 | 3300035121 | Bacteria | 3443 |
| 667 | Ga0373943_0037316 | 3300035170 | Bacteria | 2332 |
| 668 | Ga0373946_0002428 | 3300035171 | Bacteria | 6588 |
| 669 | Ga0373946_0019518 | 3300035171 | Bacteria | 2612 |
| 670 | Ga0373955_0023921 | 3300035172 | Bacteria | 3117 |
| 671 | Ga0373961_0046212 | 3300035241 | Bacteria | 1275 |
| 672 | Ga0373962_0003202 | 3300035242 | Bacteria | 3926 |
| 673 | Ga0373924_0002733 | 3300035410 | Bacteria | 5961 |
| 674 | Ga0373924_0028043 | 3300035410 | Bacteria | 2242 |
| 675 | Ga0373931_0000034 | 3300035691 | Bacteria | 86665 |
| 676 | Ga0373931_0001311 | 3300035691 | Bacteria | 10650 |
| 677 | Ga0373931_0022363 | 3300035691 | Bacteria | 3182 |
| 678 | Ga0373931_0051906 | 3300035691 | Bacteria | 2185 |
| 679 | Ga0373935_0008152 | 3300035692 | Bacteria | 6280 |
| 680 | Ga0373935_0147022 | 3300035692 | Bacteria | 1596 |
| 681 | Ga0373935_0325535 | 3300035692 | Bacteria | 1091 |
| 682 | Ga0373935_0377021 | 3300035692 | Bacteria | 1015 |
| 683 | Ga0373927_0000839 | 3300035695 | Bacteria | 23542 |
| 684 | Ga0373927_0099229 | 3300035695 | Bacteria | 1894 |
| 685 | Ga0373927_0148020 | 3300035695 | Bacteria | 1537 |
| 686 | Ga0373933_0012620 | 3300035724 | Bacteria | 4668 |
| 687 | Ga0373933_0272572 | 3300035724 | Bacteria | 1092 |
| 688 | Ga0373947_0000796 | 3300035725 | Bacteria | 18989 |
| 689 | Ga0373947_0276004 | 3300035725 | Bacteria | 1116 |
| 690 | Ga0373937_0019531 | 3300036401 | Bacteria | 6063 |
| 691 | Ga0373937_0323068 | 3300036401 | Bacteria | 1460 |
| 692 | Ga0316582_0001394 | 3300036647 | Bacteria | 10541 |
| 693 | Ga0316582_0192382 | 3300036647 | Bacteria | 1390 |
| 694 | Ga0316584_0166581 | 3300036712 | Bacteria | 1636 |
| 695 | Ga0373925_0002955 | 3300037068 | Bacteria | 13418 |
| 696 | Ga0373925_0021172 | 3300037068 | Bacteria | 4738 |
| 697 | Ga0373925_0217275 | 3300037068 | Bacteria | 1525 |
| 698 | Ga0395898_0027542 | 3300037466 | Bacteria | 5702 |
| 699 | Ga0436364_0273714 | 3300037853 | Bacteria | 1285 |
| 700 | Ga0436364_1209910 | 3300037853 | Bacteria | 45322 |
| 701 | Ga0436364_1454759 | 3300037853 | Bacteria | 1725 |
| 702 | Ga0395901_0014197 | 3300038443 | Bacteria | 8109 |
| 703 | Ga0436365_1309021 | 3300039437 | Bacteria | 2428 |
| 704 | Ga0436365_1311189 | 3300039437 | Bacteria | 2624 |
| 705 | Ga0436365_1565429 | 3300039437 | Bacteria | 1603 |
| 706 | Ga0436361_0379330 | 3300039447 | Bacteria | 1943 |
| 707 | Ga0436361_0743304 | 3300039447 | Bacteria | 4652 |
| 708 | Ga0439450_002141 | 3300042008 | Bacteria | 3047 |
| 709 | Ga0466963_0052011 | 3300044694 | Bacteria | 2717 |
| 710 | Ga0466963_0110995 | 3300044694 | Bacteria | 1883 |
| 711 | Ga0466957_0028996 | 3300044842 | Bacteria | 3297 |
| 712 | Ga0466957_0065742 | 3300044842 | Bacteria | 2234 |
| 713 | Ga0466958_0040840 | 3300045836 | Bacteria | 2788 |
| 714 | Ga0466958_0097744 | 3300045836 | Bacteria | 1822 |
| 715 | Ga0466967_0151147 | 3300045976 | Bacteria | 2170 |
| 716 | Ga0495592_0020986 | 3300046454 | Bacteria | 4967 |
| 717 | Ga0495603_0020845 | 3300046455 | Bacteria | 3968 |
| 718 | Ga0495651_0004824 | 3300046462 | Bacteria | 10317 |
| 719 | Ga0495651_0017751 | 3300046462 | Bacteria | 5509 |
| 720 | Ga0495580_0042600 | 3300046472 | Bacteria | 3233 |
| 721 | Ga0495582_0029880 | 3300046473 | Bacteria | 2991 |
| 722 | Ga0495605_0038453 | 3300046474 | Bacteria | 2400 |
| 723 | Ga0495639_0038306 | 3300046475 | Bacteria | 2153 |
| 724 | Ga0495662_0004502 | 3300046476 | Bacteria | 6992 |
| 725 | Ga0495664_0004807 | 3300046477 | Bacteria | 7389 |
| 726 | Ga0495664_0006400 | 3300046477 | Bacteria | 6504 |
| 727 | Ga0495584_0094389 | 3300046491 | Bacteria | 1510 |
| 728 | Ga0495594_0024062 | 3300046499 | Bacteria | 3268 |
| 729 | Ga0495608_0010475 | 3300046511 | Bacteria | 6470 |
| 730 | Ga0495608_0135213 | 3300046511 | Bacteria | 1576 |
| 731 | Ga0495618_0000917 | 3300046514 | Bacteria | 20251 |
| 732 | Ga0495618_0108433 | 3300046514 | Bacteria | 1778 |
| 733 | Ga0495618_0183340 | 3300046514 | Bacteria | 1329 |
| 734 | Ga0495628_0007281 | 3300046516 | Bacteria | 9588 |
| 735 | Ga0495630_0011479 | 3300046517 | Bacteria | 6415 |
| 736 | Ga0495630_0061315 | 3300046517 | Bacteria | 2824 |
| 737 | Ga0495666_0012399 | 3300046526 | Bacteria | 4249 |
| 738 | Ga0495652_0010662 | 3300046529 | Bacteria | 8324 |
| 739 | Ga0495652_0021608 | 3300046529 | Bacteria | 5719 |
| 740 | Ga0495652_0177800 | 3300046529 | Bacteria | 1636 |
| 741 | Ga0495665_0012185 | 3300046531 | Bacteria | 4652 |
| 742 | Ga0495665_0092134 | 3300046531 | Bacteria | 1593 |
| 743 | Ga0495640_0003215 | 3300046533 | Bacteria | 13152 |
| 744 | Ga0495640_0005374 | 3300046533 | Bacteria | 10189 |
| 745 | Ga0495640_0093106 | 3300046533 | Bacteria | 1986 |
| 746 | Ga0495587_0026356 | 3300046536 | Bacteria | 3545 |
| 747 | Ga0495598_0014273 | 3300046537 | Bacteria | 1984 |
| 748 | Ga0495645_0001763 | 3300046543 | Bacteria | 14717 |
| 749 | Ga0495645_0004378 | 3300046543 | Bacteria | 9645 |
| 750 | Ga0495667_0000256 | 3300046559 | Bacteria | 34418 |
| 751 | Ga0495667_0092950 | 3300046559 | Bacteria | 1953 |
| 752 | Ga0495634_0003473 | 3300046642 | Bacteria | 12621 |
| 753 | Ga0495634_0044121 | 3300046642 | Bacteria | 3019 |
| 754 | Ga0495634_0098678 | 3300046642 | Bacteria | 1889 |
| 755 | Ga0495635_0001674 | 3300046663 | Bacteria | 14916 |
| 756 | Ga0495635_0003010 | 3300046663 | Bacteria | 11578 |
| 757 | Ga0495635_0019505 | 3300046663 | Bacteria | 4726 |
| 758 | Ga0495635_0389808 | 3300046663 | Bacteria | 926 |
| 759 | Ga0495588_0052958 | 3300046674 | Bacteria | 2092 |
| 760 | Ga0495657_0002838 | 3300046675 | Bacteria | 14378 |
| 761 | Ga0495599_0002175 | 3300046678 | Bacteria | 11380 |
| 762 | Ga0495623_0008613 | 3300046679 | Bacteria | 6623 |
| 763 | Ga0495646_0001535 | 3300046680 | Bacteria | 13774 |
| 764 | Ga0495647_0010400 | 3300046681 | Bacteria | 3166 |
| 765 | Ga0495647_0059631 | 3300046681 | Bacteria | 1503 |
| 766 | Ga0495658_0040583 | 3300046683 | Bacteria | 2588 |
| 767 | Ga0495613_0095948 | 3300046689 | Bacteria | 2144 |
| 768 | Ga0495624_0002424 | 3300046690 | Bacteria | 14161 |
| 769 | Ga0495624_0040939 | 3300046690 | Bacteria | 2966 |
| 770 | Ga0495600_0008376 | 3300046809 | Bacteria | 6350 |
| 771 | Ga0495581_0008086 | 3300047315 | Bacteria | 6089 |
| 772 | Ga0495604_0012925 | 3300047317 | Bacteria | 6652 |
| 773 | Ga0495604_0175636 | 3300047317 | Bacteria | 1502 |
| 774 | Ga0495674_0001984 | 3300047319 | Bacteria | 20115 |
| 775 | Ga0495674_0004803 | 3300047319 | Bacteria | 13003 |
| 776 | Ga0495674_0345711 | 3300047319 | Bacteria | 1208 |
| 777 | Ga0495674_0379723 | 3300047319 | Bacteria | 1143 |
| 778 | Ga0495676_0299706 | 3300047321 | Bacteria | 1084 |
| 779 | Ga0495680_0005564 | 3300047322 | Bacteria | 11827 |
| 780 | Ga0495680_0008253 | 3300047322 | Bacteria | 9484 |
| 781 | Ga0495675_0000532 | 3300047444 | Bacteria | 24684 |
| 782 | Ga0495685_004853 | 3300047447 | Bacteria | 4365 |
| 783 | Ga0495684_0000987 | 3300047471 | Bacteria | 23140 |
| 784 | Ga0495684_0009836 | 3300047471 | Bacteria | 7378 |
| 785 | Ga0495593_0082439 | 3300047673 | Bacteria | 1662 |
| 786 | Ga0495602_0005750 | 3300048088 | Bacteria | 13013 |
| 787 | Ga0495615_0009209 | 3300048090 | Bacteria | 1935 |
| 788 | Ga0495615_0012574 | 3300048090 | Bacteria | 1748 |
| 789 | Ga0496100_0000842 | 3300048903 | Bacteria | 14711 |
| 790 | Ga0496100_0073931 | 3300048903 | Bacteria | 2282 |
| 791 | Ga0496101_0007404 | 3300048904 | Bacteria | 7112 |
| 792 | Ga0496101_0017864 | 3300048904 | Bacteria | 4814 |
| 793 | Ga0496101_0077127 | 3300048904 | Bacteria | 2455 |
| 794 | Ga0496101_0135469 | 3300048904 | Bacteria | 1873 |
| 795 | Ga0496101_0160773 | 3300048904 | Bacteria | 1722 |
| 796 | Ga0496102_0001935 | 3300048905 | Bacteria | 17830 |
| 797 | Ga0496102_0011713 | 3300048905 | Bacteria | 7569 |
| 798 | Ga0496102_0051622 | 3300048905 | Bacteria | 3746 |
| 799 | Ga0496103_0004653 | 3300048906 | Bacteria | 8311 |
| 800 | Ga0496103_0010777 | 3300048906 | Bacteria | 5409 |
| 801 | Ga0496104_0011266 | 3300048907 | Bacteria | 8004 |
| 802 | Ga0496104_0084266 | 3300048907 | Bacteria | 3033 |
| 803 | Ga0496104_0172235 | 3300048907 | Bacteria | 2075 |
| 804 | Ga0496104_0230375 | 3300048907 | Bacteria | 1764 |
| 805 | Ga0496104_0642583 | 3300048907 | Bacteria | 970 |
| 806 | Ga0496105_0041290 | 3300048908 | Bacteria | 3802 |
| 807 | Ga0496105_0186660 | 3300048908 | Bacteria | 1696 |
| 808 | Ga0496106_0000405 | 3300048909 | Bacteria | 30644 |
| 809 | Ga0496106_0055867 | 3300048909 | Bacteria | 2984 |
| 810 | Ga0496107_0004066 | 3300048910 | Bacteria | 9849 |
| 811 | Ga0496107_0005799 | 3300048910 | Bacteria | 8453 |
| 812 | Ga0496107_0034287 | 3300048910 | Bacteria | 3635 |
| 813 | Ga0496107_0050462 | 3300048910 | Bacteria | 2999 |
| 814 | Ga0496108_0001198 | 3300048911 | Bacteria | 20317 |
| 815 | Ga0496108_0025837 | 3300048911 | Bacteria | 4842 |
| 816 | Ga0496108_0032267 | 3300048911 | Bacteria | 4350 |
| 817 | Ga0496108_0034437 | 3300048911 | Bacteria | 4208 |
| 818 | Ga0496108_0049561 | 3300048911 | Bacteria | 3512 |
| 819 | Ga0496108_0141846 | 3300048911 | Bacteria | 2070 |
| 820 | Ga0496109_0151200 | 3300048912 | Bacteria | 2173 |
| 821 | Ga0496110_0010646 | 3300048913 | Bacteria | 7486 |
| 822 | Ga0496110_0041865 | 3300048913 | Bacteria | 3999 |
| 823 | Ga0496110_0070107 | 3300048913 | Bacteria | 3105 |
| 824 | Ga0496110_0494729 | 3300048913 | Bacteria | 1113 |
| 825 | Ga0496111_0004338 | 3300048914 | Bacteria | 8949 |
| 826 | Ga0496111_0009762 | 3300048914 | Bacteria | 6415 |
| 827 | Ga0496111_0069131 | 3300048914 | Bacteria | 2568 |
| 828 | Ga0496111_0194583 | 3300048914 | Bacteria | 1507 |
| 829 | Ga0496112_0047842 | 3300048915 | Bacteria | 4195 |
| 830 | Ga0496112_0143557 | 3300048915 | Bacteria | 2356 |
| 831 | Ga0496113_0002604 | 3300048916 | Bacteria | 10547 |
| 832 | Ga0496113_0079720 | 3300048916 | Bacteria | 2507 |
| 833 | Ga0496113_0150213 | 3300048916 | Bacteria | 1837 |
| 834 | Ga0496113_0170106 | 3300048916 | Bacteria | 1725 |
| 835 | Ga0496114_0005575 | 3300048917 | Bacteria | 9865 |
| 836 | Ga0496114_0016691 | 3300048917 | Bacteria | 5920 |
| 837 | Ga0496114_0018204 | 3300048917 | Bacteria | 5676 |
| 838 | Ga0496114_0071524 | 3300048917 | Bacteria | 2915 |
| 839 | Ga0496114_0147538 | 3300048917 | Bacteria | 2040 |
| 840 | Ga0496115_0053006 | 3300048918 | Bacteria | 3255 |
| 841 | Ga0496115_0067368 | 3300048918 | Bacteria | 2895 |
| 842 | Ga0496115_0191993 | 3300048918 | Bacteria | 1687 |
| 843 | Ga0496115_0211939 | 3300048918 | Bacteria | 1600 |
| 844 | Ga0496115_0478452 | 3300048918 | Bacteria | 1003 |
| 845 | Ga0496119_0000893 | 3300048922 | Bacteria | 39064 |
| 846 | Ga0496122_0002944 | 3300048925 | Bacteria | 23216 |
| 847 | Ga0496123_0001139 | 3300048926 | Bacteria | 39727 |
| 848 | Ga0501031_0228033 | 3300049568 | Bacteria | 1212 |
| 849 | Ga0501032_0005175 | 3300049569 | Bacteria | 9721 |
| 850 | Ga0501033_0029607 | 3300049570 | Bacteria | 4115 |
| 851 | Ga0501033_0083303 | 3300049570 | Bacteria | 2344 |
| 852 | Ga0501033_0129315 | 3300049570 | Bacteria | 1830 |
| 853 | Ga0501034_0164419 | 3300049571 | Bacteria | 2188 |
| 854 | Ga0501034_0184946 | 3300049571 | Bacteria | 2047 |
| 855 | Ga0501034_0257328 | 3300049571 | Bacteria | 1689 |
| 856 | Ga0501036_0009276 | 3300049572 | Bacteria | 8086 |
| 857 | Ga0501036_0327333 | 3300049572 | Bacteria | 1280 |
| 858 | Ga0501037_0001340 | 3300049573 | Bacteria | 18079 |
| 859 | Ga0501038_0001023 | 3300049574 | Bacteria | 25193 |
| 860 | Ga0501039_0015388 | 3300049575 | Bacteria | 5856 |
| 861 | Ga0501039_0529808 | 3300049575 | Bacteria | 925 |
| 862 | Ga0501042_0299785 | 3300049578 | Bacteria | 1161 |
| 863 | Ga0501043_0025349 | 3300049579 | Bacteria | 4652 |
| 864 | Ga0501043_0192196 | 3300049579 | Bacteria | 1587 |
| 865 | Ga0501046_0000060 | 3300049580 | Bacteria | 125548 |
| 866 | Ga0501046_0008699 | 3300049580 | Bacteria | 8822 |
| 867 | Ga0501046_0038257 | 3300049580 | Bacteria | 3852 |
| 868 | Ga0501047_0055872 | 3300049581 | Bacteria | 3817 |
| 869 | Ga0501047_0061462 | 3300049581 | Bacteria | 3624 |
| 870 | Ga0501047_0195600 | 3300049581 | Bacteria | 1884 |
| 871 | Ga0501047_0419955 | 3300049581 | Bacteria | 1169 |
| 872 | Ga0501048_0002666 | 3300049582 | Bacteria | 13620 |
| 873 | Ga0501048_0087158 | 3300049582 | Bacteria | 2203 |
| 874 | Ga0501048_0335918 | 3300049582 | Bacteria | 1077 |
| 875 | Ga0501067_0005961 | 3300049583 | Bacteria | 6758 |
| 876 | Ga0501067_0083621 | 3300049583 | Bacteria | 1771 |
| 877 | Ga0501069_0005453 | 3300049585 | Bacteria | 6615 |
| 878 | Ga0501070_0025730 | 3300049586 | Bacteria | 4936 |
| 879 | Ga0501070_0043988 | 3300049586 | Bacteria | 3716 |
| 880 | Ga0501070_0063526 | 3300049586 | Bacteria | 3058 |
| 881 | Ga0501071_0021832 | 3300049587 | Bacteria | 4461 |
| 882 | Ga0501072_0313549 | 3300049588 | Bacteria | 1247 |
| 883 | Ga0501072_0374429 | 3300049588 | Bacteria | 1130 |
| 884 | Ga0501072_0396274 | 3300049588 | Bacteria | 1095 |
| 885 | Ga0501073_0017253 | 3300049589 | Bacteria | 5229 |
| 886 | Ga0501073_0142636 | 3300049589 | Bacteria | 1660 |
| 887 | Ga0501074_0008132 | 3300049590 | Bacteria | 7601 |
| 888 | Ga0501074_0060646 | 3300049590 | Bacteria | 2725 |
| 889 | Ga0501074_0212813 | 3300049590 | Bacteria | 1377 |
| 890 | Ga0501075_0274824 | 3300049591 | Bacteria | 1284 |
| 891 | Ga0501076_0106477 | 3300049592 | Bacteria | 2264 |
| 892 | Ga0501077_0046198 | 3300049593 | Bacteria | 2767 |
| 893 | Ga0501079_0006545 | 3300049741 | Bacteria | 8757 |
| 894 | Ga0501079_0086067 | 3300049741 | Bacteria | 2433 |
| 895 | Ga0501079_0426513 | 3300049741 | Bacteria | 1041 |
| 896 | Ga0501080_0099237 | 3300049742 | Bacteria | 2702 |
| 897 | Ga0501080_0254987 | 3300049742 | Bacteria | 1599 |
| 898 | Ga0501083_0007790 | 3300049744 | Bacteria | 7588 |
| 899 | Ga0501083_0012367 | 3300049744 | Bacteria | 5972 |
| 900 | Ga0501083_0089078 | 3300049744 | Bacteria | 2039 |
| 901 | Ga0501083_0149372 | 3300049744 | Bacteria | 1530 |
| 902 | Ga0501035_0206329 | 3300049822 | Bacteria | 1683 |
| 903 | Ga0501035_0294822 | 3300049822 | Bacteria | 1368 |
| 904 | Ga0501035_0352720 | 3300049822 | Bacteria | 1231 |
| 905 | Ga0501044_0000260 | 3300049823 | Bacteria | 67087 |
| 906 | Ga0501044_0008573 | 3300049823 | Bacteria | 11199 |
| 907 | Ga0501044_0010896 | 3300049823 | Bacteria | 9868 |
| 908 | Ga0501044_0322843 | 3300049823 | Bacteria | 1468 |
| 909 | Ga0501044_0487609 | 3300049823 | Bacteria | 1135 |
| 910 | Ga0501045_0490490 | 3300049824 | Bacteria | 912 |
| 911 | nmdc:mga03683_41279_c1 | 3300050489 | Bacteria | 1895 |
| 912 | nmdc:mga03n38_79548_c1 | 3300050490 | Bacteria | 1537 |
| 913 | nmdc:mga00v17_19362_c1 | 3300050491 | Bacteria | 3885 |
| 914 | nmdc:mga0yw44_383517_c1 | 3300050492 | Bacteria | 949 |
| 915 | nmdc:mga0yw44_63367_c1 | 3300050492 | Bacteria | 2273 |
| 916 | nmdc:mga0yw44_75835_c1 | 3300050492 | Bacteria | 2098 |
| 917 | nmdc:mga0k408_55917_c1 | 3300050493 | Bacteria | 2289 |
| 918 | nmdc:mga06z11_113993_c1 | 3300050494 | Bacteria | 1500 |
| 919 | nmdc:mga06z11_53313_c1 | 3300050494 | Bacteria | 2080 |
| 920 | nmdc:mga04h51_29994_c1 | 3300050495 | Bacteria | 1708 |
| 921 | nmdc:mga07m45_147397_c1 | 3300050496 | Bacteria | 1364 |
| 922 | nmdc:mga07m45_15773_c1 | 3300050496 | Bacteria | 4037 |
| 923 | nmdc:mga07m45_26560_c1 | 3300050496 | Bacteria | 3184 |
| 924 | nmdc:mga07m45_27289_c1 | 3300050496 | Bacteria | 3144 |
| 925 | nmdc:mga05p37_153275_c1 | 3300050507 | Bacteria | 2817 |
| 926 | nmdc:mga05p37_163552_c1 | 3300050507 | Bacteria | 2717 |
| 927 | nmdc:mga05p37_290189_c1 | 3300050507 | Bacteria | 1947 |
| 928 | nmdc:mga05p37_354142_c1 | 3300050507 | Bacteria | 1728 |
| 929 | nmdc:mga05p37_5377_c1 | 3300050507 | Bacteria | 15055 |
| 930 | nmdc:mga09592_170167_c1 | 3300050508 | Bacteria | 1884 |
| 931 | nmdc:mga09592_21364_c1 | 3300050508 | Bacteria | 5335 |
| 932 | nmdc:mga09592_29378_c1 | 3300050508 | Bacteria | 4573 |
| 933 | nmdc:mga0qj67_151963_c1 | 3300050509 | Bacteria | 1878 |
| 934 | nmdc:mga0qj67_28_c1 | 3300050509 | Bacteria | 102760 |
| 935 | nmdc:mga0qj67_341240_c1 | 3300050509 | Bacteria | 1212 |
| 936 | nmdc:mga0qj67_82924_c1 | 3300050509 | Bacteria | 2570 |
| 937 | nmdc:mga0qj67_97253_c1 | 3300050509 | Bacteria | 2370 |
| 938 | nmdc:mga06r32_270079_c1 | 3300050510 | Bacteria | 1688 |
| 939 | nmdc:mga06r32_322976_c1 | 3300050510 | Bacteria | 1529 |
| 940 | nmdc:mga06r32_383161_c1 | 3300050510 | Bacteria | 1389 |
| 941 | nmdc:mga06r32_507731_c1 | 3300050510 | Bacteria | 1182 |
| 942 | nmdc:mga06r32_752703_c1 | 3300050510 | Bacteria | 937 |
| 943 | nmdc:mga08y16_22572_c1 | 3300050511 | Bacteria | 6645 |
| 944 | nmdc:mga08y16_409669_c1 | 3300050511 | Bacteria | 1387 |
| 945 | nmdc:mga08y16_590_c1 | 3300050511 | Bacteria | 33818 |
| 946 | nmdc:mga0n895_33397_c1 | 3300050512 | Bacteria | 4945 |
| 947 | nmdc:mga0n895_425283_c1 | 3300050512 | Bacteria | 1342 |
| 948 | nmdc:mga0n895_4459_c1 | 3300050512 | Bacteria | 11502 |
| 949 | nmdc:mga0n895_947751_c1 | 3300050512 | Bacteria | 844 |
| 950 | nmdc:mga0rr50_39320_c1 | 3300050513 | Bacteria | 3430 |
| 951 | nmdc:mga0rr50_8026_c1 | 3300050513 | Bacteria | 6547 |
| 952 | nmdc:mga0rr50_85462_c1 | 3300050513 | Bacteria | 2445 |
| 953 | nmdc:mga0a205_3619_c1 | 3300050515 | Bacteria | 13829 |
| 954 | nmdc:mga0a205_733_c2 | 3300050515 | Bacteria | 10917 |
| 955 | nmdc:mga0sz30_4070_c1 | 3300050516 | Bacteria | 5264 |
| 956 | Ga0495601_0000418 | 3300053077 | Bacteria | 22241 |
| 957 | Ga0495601_0010781 | 3300053077 | Bacteria | 5453 |
| 958 | Ga0495601_0012231 | 3300053077 | Bacteria | 5146 |
| 959 | Ga0495601_0039644 | 3300053077 | Bacteria | 2950 |
| 960 | Ga0495612_0000251 | 3300053078 | Bacteria | 22251 |
| 961 | Ga0495612_0003654 | 3300053078 | Bacteria | 6376 |
| 962 | Ga0495612_0138888 | 3300053078 | Bacteria | 1053 |
| 963 | Ga0495595_0002778 | 3300053084 | Bacteria | 6878 |
| 964 | Ga0495619_0002566 | 3300053085 | Bacteria | 11887 |
| 965 | Ga0495619_0037784 | 3300053085 | Bacteria | 3149 |
| 966 | Ga0495619_0090917 | 3300053085 | Bacteria | 2066 |
| 967 | Ga0495619_0165320 | 3300053085 | Bacteria | 1529 |
| 968 | Ga0500556_0000363 | 3300053104 | Bacteria | 33629 |
| 969 | Ga0500652_003832 | 3300053131 | Bacteria | 4595 |
| 970 | Ga0500568_0016297 | 3300053139 | Bacteria | 3308 |
| 971 | Ga0500568_0052466 | 3300053139 | Bacteria | 1601 |
| 972 | Ga0500645_024021 | 3300053730 | Bacteria | 1866 |
| 973 | Ga0501084_0049531 | 3300054114 | Bacteria | 3517 |
| 974 | Ga0501084_0111220 | 3300054114 | Bacteria | 2302 |
| 975 | Ga0501084_0208885 | 3300054114 | Bacteria | 1647 |
| 976 | Ga0501084_0275634 | 3300054114 | Bacteria | 1420 |
| 977 | Ga0501084_0292547 | 3300054114 | Bacteria | 1375 |
| 978 | Ga0501084_0317794 | 3300054114 | Bacteria | 1315 |
| 979 | Ga0587073_0039083 | 3300059492 | Bacteria | 1024 |
| 980 | Ga0587073_0044354 | 3300059492 | Bacteria | 983 |
| 981 | Ga0587073_0054520 | 3300059492 | Bacteria | 917 |
| 982 | Ga0587083_0049489 | 3300059505 | Bacteria | 911 |
| 983 | Ga0587075_017536 | 3300059644 | Bacteria | 1031 |
| 984 | Ga0501082_0007563 | 3300060353 | Bacteria | 9373 |
| 985 | Ga0501082_0231755 | 3300060353 | Bacteria | 1607 |
| 986 | Ga0501082_0259670 | 3300060353 | Bacteria | 1511 |
| 987 | Ga0501082_0317955 | 3300060353 | Bacteria | 1356 |
| 988 | Ga0530510_0164077 | 3300061734 | Bacteria | 1644 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300027907 | Ga0207428_10023620 | Ga0207428_100236208 | 225 |
| 2 | 3300032133 | Ga0316583_10032105 | Ga0316583_100321052 | 229 |
| 3 | 3300009147 | Ga0114129_10353298 | Ga0114129_103532982 | 236 |
| 4 | 3300049583 | Ga0501067_0005961 | Ga0501067_0005961_1121_1918 | 236 |
| 5 | 3300049822 | Ga0501035_0294822 | Ga0501035_0294822_258_1055 | 236 |
| 6 | 3300050507 | nmdc:mga05p37_290189_c1 | nmdc:mga05p37_290189_c1_1061_1801 | 236 |
| 7 | 3300031507 | Ga0307509_10001384 | Ga0307509_1000138422 | 237 |
| 8 | 3300049571 | Ga0501034_0164419 | Ga0501034_0164419_719_1516 | 237 |
| 9 | 3300049580 | Ga0501046_0038257 | Ga0501046_0038257_104_901 | 237 |
| 10 | 3300049581 | Ga0501047_0195600 | Ga0501047_0195600_437_1234 | 237 |
| 11 | 3300049590 | Ga0501074_0008132 | Ga0501074_0008132_4469_5266 | 237 |
| 12 | 3300049592 | Ga0501076_0106477 | Ga0501076_0106477_1379_2176 | 237 |
| 13 | 3300049744 | Ga0501083_0007790 | Ga0501083_0007790_6013_6810 | 237 |
| 14 | 3300049744 | Ga0501083_0089078 | Ga0501083_0089078_1193_1990 | 237 |
| 15 | 3300054114 | Ga0501084_0292547 | Ga0501084_0292547_404_1201 | 237 |
| 16 | 3300061734 | Ga0530510_0164077 | Ga0530510_0164077_781_1578 | 237 |
| 17 | 3300005328 | Ga0070676_10182049 | Ga0070676_101820492 | 246 |
| 18 | 3300005330 | Ga0070690_100126144 | Ga0070690_1001261443 | 246 |
| 19 | 3300005333 | Ga0070677_10003757 | Ga0070677_100037577 | 246 |
| 20 | 3300005343 | Ga0070687_100050373 | Ga0070687_1000503733 | 246 |
| 21 | 3300005354 | Ga0070675_100112209 | Ga0070675_1001122093 | 246 |
| 22 | 3300005355 | Ga0070671_100054894 | Ga0070671_1000548946 | 246 |
| 23 | 3300005356 | Ga0070674_100026051 | Ga0070674_1000260516 | 246 |
| 24 | 3300005364 | Ga0070673_100154134 | Ga0070673_1001541343 | 246 |
| 25 | 3300005365 | Ga0070688_100081413 | Ga0070688_1000814133 | 246 |
| 26 | 3300005455 | Ga0070663_100225669 | Ga0070663_1002256693 | 246 |
| 27 | 3300005456 | Ga0070678_100051868 | Ga0070678_1000518683 | 246 |
| 28 | 3300005459 | Ga0068867_100540740 | Ga0068867_1005407401 | 246 |
| 29 | 3300005543 | Ga0070672_100066989 | Ga0070672_1000669893 | 246 |
| 30 | 3300005718 | Ga0068866_10082741 | Ga0068866_100827413 | 246 |
| 31 | 3300005719 | Ga0068861_100129105 | Ga0068861_1001291053 | 246 |
| 32 | 3300009094 | Ga0111539_10363797 | Ga0111539_103637971 | 246 |
| 33 | 3300025893 | Ga0207682_10010412 | Ga0207682_100104124 | 246 |
| 34 | 3300025901 | Ga0207688_10133339 | Ga0207688_101333393 | 246 |
| 35 | 3300025907 | Ga0207645_10032352 | Ga0207645_100323525 | 246 |
| 36 | 3300025918 | Ga0207662_10034499 | Ga0207662_100344995 | 246 |
| 37 | 3300025923 | Ga0207681_10203594 | Ga0207681_102035942 | 246 |
| 38 | 3300025937 | Ga0207669_10069684 | Ga0207669_100696844 | 246 |
| 39 | 3300025940 | Ga0207691_10004340 | Ga0207691_1000434011 | 246 |
| 40 | 3300026121 | Ga0207683_10017083 | Ga0207683_100170835 | 246 |
| 41 | 3300046537 | Ga0495598_0014273 | Ga0495598_0014273_903_1703 | 246 |
| 42 | 3300048090 | Ga0495615_0012574 | Ga0495615_0012574_196_996 | 246 |
| 43 | 3300009098 | Ga0105245_10142916 | Ga0105245_101429163 | 248 |
| 44 | 3300025906 | Ga0207699_10125698 | Ga0207699_101256982 | 253 |
| 45 | 3300009094 | Ga0111539_10048283 | Ga0111539_100482839 | 254 |
| 46 | 3300050511 | nmdc:mga08y16_22572_c1 | nmdc:mga08y16_22572_c1_2514_3293 | 254 |
| 47 | 3300031249 | Ga0265339_10001522 | Ga0265339_100015227 | 256 |
| 48 | 3300031344 | Ga0265316_10006562 | Ga0265316_100065623 | 256 |
| 49 | 3300031595 | Ga0265313_10000181 | Ga0265313_1000018158 | 256 |
| 50 | 3300031712 | Ga0265342_10008745 | Ga0265342_100087452 | 256 |
| 51 | 3300006844 | Ga0075428_100266783 | Ga0075428_1002667832 | 257 |
| 52 | 3300006847 | Ga0075431_100187571 | Ga0075431_1001875712 | 257 |
| 53 | 3300009147 | Ga0114129_10068674 | Ga0114129_100686742 | 257 |
| 54 | 3300050507 | nmdc:mga05p37_153275_c1 | nmdc:mga05p37_153275_c1_1814_2602 | 257 |
| 55 | 3300050508 | nmdc:mga09592_21364_c1 | nmdc:mga09592_21364_c1_2782_3576 | 257 |
| 56 | 3300050509 | nmdc:mga0qj67_82924_c1 | nmdc:mga0qj67_82924_c1_1027_1815 | 257 |
| 57 | 3300050510 | nmdc:mga06r32_270079_c1 | nmdc:mga06r32_270079_c1_665_1453 | 257 |
| 58 | iso_pu_bacteria | 2842694124 | 2842695434 | 257 |
| 59 | 3300031344 | Ga0265316_10289717 | Ga0265316_102897171 | 258 |
| 60 | 3300036647 | Ga0316582_0001394 | Ga0316582_0001394_2523_3317 | 259 |
| 61 | 3300036712 | Ga0316584_0166581 | Ga0316584_0166581_788_1582 | 259 |
| 62 | 3300021361 | Ga0213872_10018295 | Ga0213872_100182954 | 261 |
| 63 | 3300025912 | Ga0207707_10214100 | Ga0207707_102141002 | 261 |
| 64 | 3300031235 | Ga0265330_10156849 | Ga0265330_101568491 | 261 |
| 65 | 3300031247 | Ga0265340_10007163 | Ga0265340_100071633 | 261 |
| 66 | 3300031249 | Ga0265339_10001522 | Ga0265339_1000152217 | 261 |
| 67 | 3300031595 | Ga0265313_10000181 | Ga0265313_1000018148 | 261 |
| 68 | 3300031712 | Ga0265342_10005915 | Ga0265342_100059151 | 261 |
| 69 | 3300036647 | Ga0316582_0192382 | Ga0316582_0192382_199_1005 | 261 |
| 70 | 3300039447 | Ga0436361_0743304 | Ga0436361_0743304_3102_3902 | 261 |
| 71 | 3300049571 | Ga0501034_0257328 | Ga0501034_0257328_753_1544 | 261 |
| 72 | 3300049581 | Ga0501047_0419955 | Ga0501047_0419955_98_889 | 261 |
| 73 | 3300049744 | Ga0501083_0149372 | Ga0501083_0149372_83_874 | 261 |
| 74 | 3300049823 | Ga0501044_0322843 | Ga0501044_0322843_571_1368 | 261 |
| 75 | 3300049588 | Ga0501072_0396274 | Ga0501072_0396274_22_816 | 262 |
| 76 | 3300049744 | Ga0501083_0012367 | Ga0501083_0012367_2120_2914 | 262 |
| 77 | 3300054114 | Ga0501084_0049531 | Ga0501084_0049531_1699_2493 | 262 |
| 78 | 3300054114 | Ga0501084_0111220 | Ga0501084_0111220_490_1356 | 262 |
| 79 | 3300054114 | Ga0501084_0275634 | Ga0501084_0275634_518_1312 | 262 |
| 80 | 3300054114 | Ga0501084_0317794 | Ga0501084_0317794_13_807 | 262 |
| 81 | 3300005981 | Ga0081538_10004153 | Ga0081538_1000415311 | 263 |
| 82 | 3300005983 | Ga0081540_1003051 | Ga0081540_100305111 | 263 |
| 83 | 3300006844 | Ga0075428_100325983 | Ga0075428_1003259833 | 263 |
| 84 | 3300006847 | Ga0075431_100061408 | Ga0075431_1000614085 | 263 |
| 85 | 3300006847 | Ga0075431_100304756 | Ga0075431_1003047563 | 263 |
| 86 | 3300009147 | Ga0114129_10266962 | Ga0114129_102669623 | 263 |
| 87 | 3300005471 | Ga0070698_100056891 | Ga0070698_1000568914 | 264 |
| 88 | 3300031241 | Ga0265325_10064261 | Ga0265325_100642613 | 264 |
| 89 | 3300031247 | Ga0265340_10012516 | Ga0265340_100125165 | 264 |
| 90 | 3300031247 | Ga0265340_10017482 | Ga0265340_100174823 | 264 |
| 91 | 3300031247 | Ga0265340_10075396 | Ga0265340_100753963 | 264 |
| 92 | 3300031249 | Ga0265339_10106548 | Ga0265339_101065481 | 264 |
| 93 | 3300031595 | Ga0265313_10007831 | Ga0265313_100078313 | 264 |
| 94 | 3300031595 | Ga0265313_10008019 | Ga0265313_100080199 | 264 |
| 95 | 3300031595 | Ga0265313_10073281 | Ga0265313_100732813 | 264 |
| 96 | 3300031712 | Ga0265342_10067079 | Ga0265342_100670792 | 264 |
| 97 | 3300037853 | Ga0436364_0273714 | Ga0436364_0273714_200_994 | 264 |
| 98 | 3300037853 | Ga0436364_1209910 | Ga0436364_1209910_28859_29653 | 264 |
| 99 | 3300037853 | Ga0436364_1454759 | Ga0436364_1454759_102_899 | 264 |
| 100 | 3300039437 | Ga0436365_1311189 | Ga0436365_1311189_193_987 | 264 |
| 101 | 3300048918 | Ga0496115_0478452 | Ga0496115_0478452_43_837 | 264 |
| 102 | 3300049580 | Ga0501046_0000060 | Ga0501046_0000060_115961_116767 | 264 |
| 103 | 3300005530 | Ga0070679_100106382 | Ga0070679_1001063823 | 265 |
| 104 | 3300006844 | Ga0075428_100244896 | Ga0075428_1002448962 | 265 |
| 105 | 3300006871 | Ga0075434_100076390 | Ga0075434_1000763904 | 265 |
| 106 | 3300025921 | Ga0207652_10092934 | Ga0207652_100929343 | 265 |
| 107 | 3300025936 | Ga0207670_10085467 | Ga0207670_100854673 | 265 |
| 108 | 3300047319 | Ga0495674_0345711 | Ga0495674_0345711_111_911 | 265 |
| 109 | 3300048911 | Ga0496108_0141846 | Ga0496108_0141846_1190_1990 | 265 |
| 110 | 3300048922 | Ga0496119_0000893 | Ga0496119_0000893_9218_10021 | 265 |
| 111 | 3300048925 | Ga0496122_0002944 | Ga0496122_0002944_13582_14385 | 265 |
| 112 | 3300048926 | Ga0496123_0001139 | Ga0496123_0001139_13317_14120 | 265 |
| 113 | 3300053104 | Ga0500556_0000363 | Ga0500556_0000363_20080_20883 | 265 |
| 114 | 3300053131 | Ga0500652_003832 | Ga0500652_003832_2454_3257 | 265 |
| 115 | 3300053139 | Ga0500568_0016297 | Ga0500568_0016297_928_1734 | 265 |
| 116 | 3300053139 | Ga0500568_0052466 | Ga0500568_0052466_785_1585 | 265 |
| 117 | 2209111006 | 2214572714 | 2213615974 | 266 |
| 118 | 3300000041 | ARcpr5oldR_c000130 | ARcpr5oldR_00013012 | 266 |
| 119 | 3300000042 | ARSoilYngRDRAFT_c00118 | ARSoilYngRDRAFT_0011812 | 266 |
| 120 | 3300000043 | ARcpr5yngRDRAFT_c000035 | ARcpr5yngRDRAFT_0000358 | 266 |
| 121 | 3300000652 | ARCol0yngRDRAFT_1000209 | ARCol0yngRDRAFT_10002096 | 266 |
| 122 | 3300001976 | JGI24752J21851_1013069 | JGI24752J21851_10130692 | 266 |
| 123 | 3300001977 | JGI24746J21847_1000683 | JGI24746J21847_10006835 | 266 |
| 124 | 3300001978 | JGI24747J21853_1003746 | JGI24747J21853_10037463 | 266 |
| 125 | 3300001989 | JGI24739J22299_10000158 | JGI24739J22299_1000015818 | 266 |
| 126 | 3300001990 | JGI24737J22298_10001510 | JGI24737J22298_100015108 | 266 |
| 127 | 3300001990 | JGI24737J22298_10001948 | JGI24737J22298_100019483 | 266 |
| 128 | 3300001991 | JGI24743J22301_10018083 | JGI24743J22301_100180831 | 266 |
| 129 | 3300002073 | JGI24745J21846_1001135 | JGI24745J21846_10011354 | 266 |
| 130 | 3300002074 | JGI24748J21848_1000574 | JGI24748J21848_10005745 | 266 |
| 131 | 3300002074 | JGI24748J21848_1000699 | JGI24748J21848_10006995 | 266 |
| 132 | 3300002075 | JGI24738J21930_10003334 | JGI24738J21930_100033345 | 266 |
| 133 | 3300002076 | JGI24749J21850_1005514 | JGI24749J21850_10055141 | 266 |
| 134 | 3300002076 | JGI24749J21850_1012555 | JGI24749J21850_10125552 | 266 |
| 135 | 3300002077 | JGI24744J21845_10001094 | JGI24744J21845_100010946 | 266 |
| 136 | 3300002126 | JGI24035J26624_1000023 | JGI24035J26624_10000238 | 266 |
| 137 | 3300002155 | JGI24033J26618_1001768 | JGI24033J26618_10017683 | 266 |
| 138 | 3300002239 | JGI24034J26672_10001325 | JGI24034J26672_100013255 | 266 |
| 139 | 3300002244 | JGI24742J22300_10000706 | JGI24742J22300_100007065 | 266 |
| 140 | 3300002459 | JGI24751J29686_10002998 | JGI24751J29686_100029983 | 266 |
| 141 | 3300002459 | JGI24751J29686_10008505 | JGI24751J29686_100085052 | 266 |
| 142 | 3300003911 | JGI25405J52794_10031077 | JGI25405J52794_100310771 | 266 |
| 143 | 3300005290 | Ga0065712_10007917 | Ga0065712_100079176 | 266 |
| 144 | 3300005290 | Ga0065712_10089850 | Ga0065712_100898503 | 266 |
| 145 | 3300005293 | Ga0065715_10089004 | Ga0065715_1008900420 | 266 |
| 146 | 3300005295 | Ga0065707_10143694 | Ga0065707_101436941 | 266 |
| 147 | 3300005327 | Ga0070658_10006919 | Ga0070658_100069197 | 266 |
| 148 | 3300005328 | Ga0070676_10001138 | Ga0070676_100011386 | 266 |
| 149 | 3300005328 | Ga0070676_10126576 | Ga0070676_101265762 | 266 |
| 150 | 3300005329 | Ga0070683_100163764 | Ga0070683_1001637643 | 266 |
| 151 | 3300005330 | Ga0070690_100000727 | Ga0070690_1000007278 | 266 |
| 152 | 3300005331 | Ga0070670_100004168 | Ga0070670_1000041687 | 266 |
| 153 | 3300005331 | Ga0070670_100060563 | Ga0070670_1000605635 | 266 |
| 154 | 3300005331 | Ga0070670_100110934 | Ga0070670_1001109343 | 266 |
| 155 | 3300005333 | Ga0070677_10003207 | Ga0070677_100032075 | 266 |
| 156 | 3300005334 | Ga0068869_100087385 | Ga0068869_1000873851 | 266 |
| 157 | 3300005335 | Ga0070666_10018444 | Ga0070666_100184442 | 266 |
| 158 | 3300005335 | Ga0070666_10018621 | Ga0070666_100186212 | 266 |
| 159 | 3300005336 | Ga0070680_100006389 | Ga0070680_1000063894 | 266 |
| 160 | 3300005336 | Ga0070680_100024710 | Ga0070680_1000247104 | 266 |
| 161 | 3300005336 | Ga0070680_100067076 | Ga0070680_1000670761 | 266 |
| 162 | 3300005336 | Ga0070680_100135083 | Ga0070680_1001350831 | 266 |
| 163 | 3300005336 | Ga0070680_100193681 | Ga0070680_1001936813 | 266 |
| 164 | 3300005337 | Ga0070682_100007941 | Ga0070682_1000079413 | 266 |
| 165 | 3300005337 | Ga0070682_100096561 | Ga0070682_1000965613 | 266 |
| 166 | 3300005338 | Ga0068868_100000944 | Ga0068868_10000094420 | 266 |
| 167 | 3300005338 | Ga0068868_100050586 | Ga0068868_1000505865 | 266 |
| 168 | 3300005338 | Ga0068868_100115031 | Ga0068868_1001150314 | 266 |
| 169 | 3300005338 | Ga0068868_100302318 | Ga0068868_1003023182 | 266 |
| 170 | 3300005339 | Ga0070660_100015021 | Ga0070660_1000150215 | 266 |
| 171 | 3300005339 | Ga0070660_100048298 | Ga0070660_1000482983 | 266 |
| 172 | 3300005339 | Ga0070660_100084985 | Ga0070660_1000849854 | 266 |
| 173 | 3300005339 | Ga0070660_100117966 | Ga0070660_1001179661 | 266 |
| 174 | 3300005339 | Ga0070660_100126808 | Ga0070660_1001268081 | 266 |
| 175 | 3300005339 | Ga0070660_100143923 | Ga0070660_1001439232 | 266 |
| 176 | 3300005340 | Ga0070689_100000646 | Ga0070689_10000064619 | 266 |
| 177 | 3300005340 | Ga0070689_100002989 | Ga0070689_1000029892 | 266 |
| 178 | 3300005340 | Ga0070689_100006613 | Ga0070689_1000066137 | 266 |
| 179 | 3300005340 | Ga0070689_100009931 | Ga0070689_1000099317 | 266 |
| 180 | 3300005340 | Ga0070689_100027299 | Ga0070689_1000272993 | 266 |
| 181 | 3300005340 | Ga0070689_100086479 | Ga0070689_1000864792 | 266 |
| 182 | 3300005341 | Ga0070691_10000125 | Ga0070691_100001255 | 266 |
| 183 | 3300005343 | Ga0070687_100000773 | Ga0070687_1000007735 | 266 |
| 184 | 3300005343 | Ga0070687_100115673 | Ga0070687_1001156732 | 266 |
| 185 | 3300005344 | Ga0070661_100013869 | Ga0070661_1000138695 | 266 |
| 186 | 3300005344 | Ga0070661_100018561 | Ga0070661_1000185614 | 266 |
| 187 | 3300005345 | Ga0070692_10038970 | Ga0070692_100389705 | 266 |
| 188 | 3300005353 | Ga0070669_100172652 | Ga0070669_1001726523 | 266 |
| 189 | 3300005354 | Ga0070675_100005686 | Ga0070675_1000056869 | 266 |
| 190 | 3300005355 | Ga0070671_100000170 | Ga0070671_1000001704 | 266 |
| 191 | 3300005355 | Ga0070671_100032596 | Ga0070671_1000325964 | 266 |
| 192 | 3300005355 | Ga0070671_100053267 | Ga0070671_1000532672 | 266 |
| 193 | 3300005356 | Ga0070674_100053517 | Ga0070674_1000535174 | 266 |
| 194 | 3300005364 | Ga0070673_100015366 | Ga0070673_1000153661 | 266 |
| 195 | 3300005364 | Ga0070673_100020936 | Ga0070673_1000209365 | 266 |
| 196 | 3300005364 | Ga0070673_100136776 | Ga0070673_1001367762 | 266 |
| 197 | 3300005365 | Ga0070688_100001455 | Ga0070688_10000145514 | 266 |
| 198 | 3300005365 | Ga0070688_100002194 | Ga0070688_1000021948 | 266 |
| 199 | 3300005365 | Ga0070688_100008402 | Ga0070688_1000084025 | 266 |
| 200 | 3300005365 | Ga0070688_100091355 | Ga0070688_1000913552 | 266 |
| 201 | 3300005366 | Ga0070659_100000621 | Ga0070659_10000062123 | 266 |
| 202 | 3300005366 | Ga0070659_100128803 | Ga0070659_1001288032 | 266 |
| 203 | 3300005367 | Ga0070667_100044536 | Ga0070667_1000445364 | 266 |
| 204 | 3300005367 | Ga0070667_100133608 | Ga0070667_1001336081 | 266 |
| 205 | 3300005367 | Ga0070667_100139072 | Ga0070667_1001390721 | 266 |
| 206 | 3300005406 | Ga0070703_10001450 | Ga0070703_100014503 | 266 |
| 207 | 3300005434 | Ga0070709_10006995 | Ga0070709_100069955 | 266 |
| 208 | 3300005434 | Ga0070709_10019522 | Ga0070709_100195224 | 266 |
| 209 | 3300005434 | Ga0070709_10113191 | Ga0070709_101131913 | 266 |
| 210 | 3300005435 | Ga0070714_100037912 | Ga0070714_1000379124 | 266 |
| 211 | 3300005435 | Ga0070714_100095284 | Ga0070714_1000952844 | 266 |
| 212 | 3300005435 | Ga0070714_100099561 | Ga0070714_1000995612 | 266 |
| 213 | 3300005436 | Ga0070713_100019242 | Ga0070713_1000192425 | 266 |
| 214 | 3300005436 | Ga0070713_100029152 | Ga0070713_1000291523 | 266 |
| 215 | 3300005436 | Ga0070713_100067156 | Ga0070713_1000671561 | 266 |
| 216 | 3300005436 | Ga0070713_100167387 | Ga0070713_1001673871 | 266 |
| 217 | 3300005436 | Ga0070713_100256266 | Ga0070713_1002562662 | 266 |
| 218 | 3300005437 | Ga0070710_10014458 | Ga0070710_100144585 | 266 |
| 219 | 3300005437 | Ga0070710_10016436 | Ga0070710_100164362 | 266 |
| 220 | 3300005437 | Ga0070710_10062381 | Ga0070710_100623812 | 266 |
| 221 | 3300005439 | Ga0070711_100008373 | Ga0070711_1000083737 | 266 |
| 222 | 3300005439 | Ga0070711_100050862 | Ga0070711_1000508622 | 266 |
| 223 | 3300005439 | Ga0070711_100336725 | Ga0070711_1003367251 | 266 |
| 224 | 3300005440 | Ga0070705_100004061 | Ga0070705_1000040611 | 266 |
| 225 | 3300005440 | Ga0070705_100172914 | Ga0070705_1001729142 | 266 |
| 226 | 3300005441 | Ga0070700_100080805 | Ga0070700_1000808051 | 266 |
| 227 | 3300005444 | Ga0070694_100002007 | Ga0070694_1000020078 | 266 |
| 228 | 3300005444 | Ga0070694_100004869 | Ga0070694_1000048694 | 266 |
| 229 | 3300005445 | Ga0070708_100053874 | Ga0070708_1000538743 | 266 |
| 230 | 3300005455 | Ga0070663_100016477 | Ga0070663_1000164775 | 266 |
| 231 | 3300005455 | Ga0070663_100030911 | Ga0070663_1000309112 | 266 |
| 232 | 3300005455 | Ga0070663_100076820 | Ga0070663_1000768202 | 266 |
| 233 | 3300005456 | Ga0070678_100073272 | Ga0070678_1000732724 | 266 |
| 234 | 3300005456 | Ga0070678_100109769 | Ga0070678_1001097692 | 266 |
| 235 | 3300005457 | Ga0070662_100016774 | Ga0070662_1000167744 | 266 |
| 236 | 3300005457 | Ga0070662_100033442 | Ga0070662_1000334425 | 266 |
| 237 | 3300005457 | Ga0070662_100050943 | Ga0070662_1000509435 | 266 |
| 238 | 3300005458 | Ga0070681_10004332 | Ga0070681_100043328 | 266 |
| 239 | 3300005458 | Ga0070681_10016792 | Ga0070681_100167924 | 266 |
| 240 | 3300005458 | Ga0070681_10017562 | Ga0070681_100175624 | 266 |
| 241 | 3300005458 | Ga0070681_10034345 | Ga0070681_100343455 | 266 |
| 242 | 3300005458 | Ga0070681_10101784 | Ga0070681_101017841 | 266 |
| 243 | 3300005458 | Ga0070681_10131805 | Ga0070681_101318053 | 266 |
| 244 | 3300005459 | Ga0068867_100007473 | Ga0068867_1000074735 | 266 |
| 245 | 3300005466 | Ga0070685_10018648 | Ga0070685_100186483 | 266 |
| 246 | 3300005466 | Ga0070685_10019896 | Ga0070685_100198964 | 266 |
| 247 | 3300005466 | Ga0070685_10034894 | Ga0070685_100348943 | 266 |
| 248 | 3300005471 | Ga0070698_100141478 | Ga0070698_1001414782 | 266 |
| 249 | 3300005518 | Ga0070699_100065967 | Ga0070699_1000659675 | 266 |
| 250 | 3300005518 | Ga0070699_100148577 | Ga0070699_1001485774 | 266 |
| 251 | 3300005530 | Ga0070679_100021073 | Ga0070679_1000210733 | 266 |
| 252 | 3300005530 | Ga0070679_100102549 | Ga0070679_1001025492 | 266 |
| 253 | 3300005530 | Ga0070679_100592576 | Ga0070679_1005925761 | 266 |
| 254 | 3300005535 | Ga0070684_100005730 | Ga0070684_1000057309 | 266 |
| 255 | 3300005535 | Ga0070684_100096228 | Ga0070684_1000962283 | 266 |
| 256 | 3300005539 | Ga0068853_100073930 | Ga0068853_1000739303 | 266 |
| 257 | 3300005539 | Ga0068853_100175892 | Ga0068853_1001758923 | 266 |
| 258 | 3300005539 | Ga0068853_100239910 | Ga0068853_1002399101 | 266 |
| 259 | 3300005543 | Ga0070672_100000557 | Ga0070672_1000005574 | 266 |
| 260 | 3300005543 | Ga0070672_100154999 | Ga0070672_1001549992 | 266 |
| 261 | 3300005543 | Ga0070672_100372903 | Ga0070672_1003729031 | 266 |
| 262 | 3300005544 | Ga0070686_100002869 | Ga0070686_1000028697 | 266 |
| 263 | 3300005544 | Ga0070686_100003376 | Ga0070686_1000033765 | 266 |
| 264 | 3300005544 | Ga0070686_100010566 | Ga0070686_1000105664 | 266 |
| 265 | 3300005544 | Ga0070686_100077078 | Ga0070686_1000770782 | 266 |
| 266 | 3300005545 | Ga0070695_100009085 | Ga0070695_1000090854 | 266 |
| 267 | 3300005546 | Ga0070696_100026503 | Ga0070696_1000265033 | 266 |
| 268 | 3300005546 | Ga0070696_100133658 | Ga0070696_1001336583 | 266 |
| 269 | 3300005547 | Ga0070693_100009465 | Ga0070693_1000094654 | 266 |
| 270 | 3300005548 | Ga0070665_100021216 | Ga0070665_1000212166 | 266 |
| 271 | 3300005549 | Ga0070704_100004070 | Ga0070704_1000040703 | 266 |
| 272 | 3300005549 | Ga0070704_100008436 | Ga0070704_1000084365 | 266 |
| 273 | 3300005563 | Ga0068855_100016277 | Ga0068855_1000162773 | 266 |
| 274 | 3300005563 | Ga0068855_100106615 | Ga0068855_1001066152 | 266 |
| 275 | 3300005563 | Ga0068855_100303236 | Ga0068855_1003032362 | 266 |
| 276 | 3300005564 | Ga0070664_100000263 | Ga0070664_10000026344 | 266 |
| 277 | 3300005564 | Ga0070664_100033520 | Ga0070664_1000335205 | 266 |
| 278 | 3300005564 | Ga0070664_100052452 | Ga0070664_1000524523 | 266 |
| 279 | 3300005564 | Ga0070664_100086013 | Ga0070664_1000860132 | 266 |
| 280 | 3300005564 | Ga0070664_100171002 | Ga0070664_1001710021 | 266 |
| 281 | 3300005577 | Ga0068857_100000888 | Ga0068857_10000088811 | 266 |
| 282 | 3300005577 | Ga0068857_100032844 | Ga0068857_1000328443 | 266 |
| 283 | 3300005578 | Ga0068854_100005378 | Ga0068854_1000053785 | 266 |
| 284 | 3300005614 | Ga0068856_100003260 | Ga0068856_1000032605 | 266 |
| 285 | 3300005614 | Ga0068856_100384779 | Ga0068856_1003847792 | 266 |
| 286 | 3300005615 | Ga0070702_100001911 | Ga0070702_1000019114 | 266 |
| 287 | 3300005616 | Ga0068852_100000579 | Ga0068852_10000057918 | 266 |
| 288 | 3300005616 | Ga0068852_100020377 | Ga0068852_1000203778 | 266 |
| 289 | 3300005616 | Ga0068852_100156337 | Ga0068852_1001563371 | 266 |
| 290 | 3300005617 | Ga0068859_100003690 | Ga0068859_10000369014 | 266 |
| 291 | 3300005617 | Ga0068859_100047890 | Ga0068859_1000478903 | 266 |
| 292 | 3300005617 | Ga0068859_100077356 | Ga0068859_1000773562 | 266 |
| 293 | 3300005617 | Ga0068859_100154435 | Ga0068859_1001544352 | 266 |
| 294 | 3300005617 | Ga0068859_100206704 | Ga0068859_1002067041 | 266 |
| 295 | 3300005618 | Ga0068864_100001260 | Ga0068864_10000126014 | 266 |
| 296 | 3300005618 | Ga0068864_100032661 | Ga0068864_1000326615 | 266 |
| 297 | 3300005618 | Ga0068864_100082174 | Ga0068864_1000821745 | 266 |
| 298 | 3300005718 | Ga0068866_10001077 | Ga0068866_100010779 | 266 |
| 299 | 3300005719 | Ga0068861_100001782 | Ga0068861_1000017826 | 266 |
| 300 | 3300005719 | Ga0068861_100033648 | Ga0068861_1000336483 | 266 |
| 301 | 3300005719 | Ga0068861_100291730 | Ga0068861_1002917301 | 266 |
| 302 | 3300005834 | Ga0068851_10200170 | Ga0068851_102001701 | 266 |
| 303 | 3300005840 | Ga0068870_10000108 | Ga0068870_1000010815 | 266 |
| 304 | 3300005841 | Ga0068863_100001201 | Ga0068863_1000012016 | 266 |
| 305 | 3300005841 | Ga0068863_100025548 | Ga0068863_1000255486 | 266 |
| 306 | 3300005841 | Ga0068863_100064839 | Ga0068863_1000648392 | 266 |
| 307 | 3300005842 | Ga0068858_100000419 | Ga0068858_10000041936 | 266 |
| 308 | 3300005842 | Ga0068858_100027844 | Ga0068858_1000278444 | 266 |
| 309 | 3300005842 | Ga0068858_100046567 | Ga0068858_1000465673 | 266 |
| 310 | 3300005842 | Ga0068858_100181425 | Ga0068858_1001814251 | 266 |
| 311 | 3300005842 | Ga0068858_100327084 | Ga0068858_1003270841 | 266 |
| 312 | 3300005843 | Ga0068860_100001359 | Ga0068860_10000135920 | 266 |
| 313 | 3300005843 | Ga0068860_100020550 | Ga0068860_1000205506 | 266 |
| 314 | 3300005843 | Ga0068860_100059646 | Ga0068860_1000596462 | 266 |
| 315 | 3300005843 | Ga0068860_100162464 | Ga0068860_1001624642 | 266 |
| 316 | 3300005844 | Ga0068862_100005815 | Ga0068862_1000058155 | 266 |
| 317 | 3300005844 | Ga0068862_100217261 | Ga0068862_1002172611 | 266 |
| 318 | 3300005844 | Ga0068862_100438684 | Ga0068862_1004386842 | 266 |
| 319 | 3300005844 | Ga0068862_100689519 | Ga0068862_1006895191 | 266 |
| 320 | 3300005937 | Ga0081455_10000009 | Ga0081455_1000000923 | 266 |
| 321 | 3300005937 | Ga0081455_10004299 | Ga0081455_100042995 | 266 |
| 322 | 3300005937 | Ga0081455_10009512 | Ga0081455_100095128 | 266 |
| 323 | 3300005937 | Ga0081455_10031917 | Ga0081455_100319173 | 266 |
| 324 | 3300005937 | Ga0081455_10052863 | Ga0081455_100528634 | 266 |
| 325 | 3300005937 | Ga0081455_10109166 | Ga0081455_101091662 | 266 |
| 326 | 3300005981 | Ga0081538_10025193 | Ga0081538_100251936 | 266 |
| 327 | 3300005981 | Ga0081538_10123568 | Ga0081538_101235681 | 266 |
| 328 | 3300005985 | Ga0081539_10002606 | Ga0081539_100026068 | 266 |
| 329 | 3300006028 | Ga0070717_10012616 | Ga0070717_100126166 | 266 |
| 330 | 3300006028 | Ga0070717_10060095 | Ga0070717_100600955 | 266 |
| 331 | 3300006028 | Ga0070717_10166732 | Ga0070717_101667321 | 266 |
| 332 | 3300006038 | Ga0075365_10061816 | Ga0075365_100618163 | 266 |
| 333 | 3300006038 | Ga0075365_10382844 | Ga0075365_103828441 | 266 |
| 334 | 3300006042 | Ga0075368_10015550 | Ga0075368_100155504 | 266 |
| 335 | 3300006042 | Ga0075368_10041123 | Ga0075368_100411233 | 266 |
| 336 | 3300006058 | Ga0075432_10005568 | Ga0075432_100055683 | 266 |
| 337 | 3300006058 | Ga0075432_10024861 | Ga0075432_100248613 | 266 |
| 338 | 3300006058 | Ga0075432_10102466 | Ga0075432_101024661 | 266 |
| 339 | 3300006163 | Ga0070715_10008072 | Ga0070715_100080724 | 266 |
| 340 | 3300006173 | Ga0070716_100004485 | Ga0070716_1000044855 | 266 |
| 341 | 3300006173 | Ga0070716_100049983 | Ga0070716_1000499832 | 266 |
| 342 | 3300006173 | Ga0070716_100515807 | Ga0070716_1005158071 | 266 |
| 343 | 3300006175 | Ga0070712_100005677 | Ga0070712_1000056776 | 266 |
| 344 | 3300006175 | Ga0070712_100005829 | Ga0070712_1000058294 | 266 |
| 345 | 3300006175 | Ga0070712_100011711 | Ga0070712_1000117115 | 266 |
| 346 | 3300006175 | Ga0070712_100026436 | Ga0070712_1000264362 | 266 |
| 347 | 3300006175 | Ga0070712_100040984 | Ga0070712_1000409843 | 266 |
| 348 | 3300006175 | Ga0070712_100123361 | Ga0070712_1001233613 | 266 |
| 349 | 3300006178 | Ga0075367_10023664 | Ga0075367_100236643 | 266 |
| 350 | 3300006195 | Ga0075366_10006561 | Ga0075366_100065613 | 266 |
| 351 | 3300006237 | Ga0097621_100002584 | Ga0097621_10000258414 | 266 |
| 352 | 3300006237 | Ga0097621_100012651 | Ga0097621_1000126515 | 266 |
| 353 | 3300006237 | Ga0097621_100043375 | Ga0097621_1000433753 | 266 |
| 354 | 3300006353 | Ga0075370_10029418 | Ga0075370_100294184 | 266 |
| 355 | 3300006353 | Ga0075370_10031420 | Ga0075370_100314202 | 266 |
| 356 | 3300006358 | Ga0068871_100000417 | Ga0068871_10000041715 | 266 |
| 357 | 3300006358 | Ga0068871_100011895 | Ga0068871_1000118957 | 266 |
| 358 | 3300006358 | Ga0068871_100013278 | Ga0068871_1000132785 | 266 |
| 359 | 3300006844 | Ga0075428_100003881 | Ga0075428_1000038818 | 266 |
| 360 | 3300006844 | Ga0075428_100131390 | Ga0075428_1001313901 | 266 |
| 361 | 3300006844 | Ga0075428_100248253 | Ga0075428_1002482532 | 266 |
| 362 | 3300006844 | Ga0075428_100300619 | Ga0075428_1003006191 | 266 |
| 363 | 3300006846 | Ga0075430_100001576 | Ga0075430_10000157616 | 266 |
| 364 | 3300006846 | Ga0075430_100003854 | Ga0075430_10000385410 | 266 |
| 365 | 3300006846 | Ga0075430_100019980 | Ga0075430_1000199804 | 266 |
| 366 | 3300006846 | Ga0075430_100022460 | Ga0075430_1000224606 | 266 |
| 367 | 3300006846 | Ga0075430_100157543 | Ga0075430_1001575433 | 266 |
| 368 | 3300006846 | Ga0075430_100346115 | Ga0075430_1003461151 | 266 |
| 369 | 3300006847 | Ga0075431_100003990 | Ga0075431_1000039909 | 266 |
| 370 | 3300006847 | Ga0075431_100071416 | Ga0075431_1000714166 | 266 |
| 371 | 3300006847 | Ga0075431_100133607 | Ga0075431_1001336072 | 266 |
| 372 | 3300006847 | Ga0075431_100150388 | Ga0075431_1001503883 | 266 |
| 373 | 3300006847 | Ga0075431_100231619 | Ga0075431_1002316193 | 266 |
| 374 | 3300006852 | Ga0075433_10000187 | Ga0075433_1000018737 | 266 |
| 375 | 3300006852 | Ga0075433_10140923 | Ga0075433_101409233 | 266 |
| 376 | 3300006852 | Ga0075433_10172118 | Ga0075433_101721181 | 266 |
| 377 | 3300006871 | Ga0075434_100001354 | Ga0075434_10000135413 | 266 |
| 378 | 3300006871 | Ga0075434_100002767 | Ga0075434_10000276715 | 266 |
| 379 | 3300006871 | Ga0075434_100050801 | Ga0075434_1000508015 | 266 |
| 380 | 3300006871 | Ga0075434_100084508 | Ga0075434_1000845085 | 266 |
| 381 | 3300006871 | Ga0075434_100085012 | Ga0075434_1000850123 | 266 |
| 382 | 3300006871 | Ga0075434_100420353 | Ga0075434_1004203532 | 266 |
| 383 | 3300006880 | Ga0075429_100027801 | Ga0075429_1000278014 | 266 |
| 384 | 3300006880 | Ga0075429_100149796 | Ga0075429_1001497962 | 266 |
| 385 | 3300006880 | Ga0075429_100212877 | Ga0075429_1002128771 | 266 |
| 386 | 3300006881 | Ga0068865_100000450 | Ga0068865_1000004508 | 266 |
| 387 | 3300006881 | Ga0068865_100075220 | Ga0068865_1000752203 | 266 |
| 388 | 3300006914 | Ga0075436_100034598 | Ga0075436_1000345985 | 266 |
| 389 | 3300006914 | Ga0075436_100304814 | Ga0075436_1003048141 | 266 |
| 390 | 3300006931 | Ga0097620_100003690 | Ga0097620_10000369014 | 266 |
| 391 | 3300006931 | Ga0097620_100047890 | Ga0097620_1000478903 | 266 |
| 392 | 3300006931 | Ga0097620_100077356 | Ga0097620_1000773565 | 266 |
| 393 | 3300006931 | Ga0097620_100154423 | Ga0097620_1001544232 | 266 |
| 394 | 3300006931 | Ga0097620_100206713 | Ga0097620_1002067132 | 266 |
| 395 | 3300007076 | Ga0075435_100036177 | Ga0075435_1000361773 | 266 |
| 396 | 3300007076 | Ga0075435_100425497 | Ga0075435_1004254972 | 266 |
| 397 | 3300007788 | Ga0099795_10003382 | Ga0099795_100033822 | 266 |
| 398 | 3300007788 | Ga0099795_10062088 | Ga0099795_100620882 | 266 |
| 399 | 3300009036 | Ga0105244_10121696 | Ga0105244_101216961 | 266 |
| 400 | 3300009093 | Ga0105240_10038333 | Ga0105240_100383336 | 266 |
| 401 | 3300009094 | Ga0111539_10006363 | Ga0111539_100063635 | 266 |
| 402 | 3300009094 | Ga0111539_10039525 | Ga0111539_100395254 | 266 |
| 403 | 3300009094 | Ga0111539_10201534 | Ga0111539_102015342 | 266 |
| 404 | 3300009094 | Ga0111539_10886496 | Ga0111539_108864961 | 266 |
| 405 | 3300009098 | Ga0105245_10000898 | Ga0105245_1000089826 | 266 |
| 406 | 3300009098 | Ga0105245_10019401 | Ga0105245_100194017 | 266 |
| 407 | 3300009098 | Ga0105245_10058770 | Ga0105245_100587701 | 266 |
| 408 | 3300009101 | Ga0105247_10003526 | Ga0105247_100035263 | 266 |
| 409 | 3300009101 | Ga0105247_10052803 | Ga0105247_100528033 | 266 |
| 410 | 3300009147 | Ga0114129_10000995 | Ga0114129_1000099527 | 266 |
| 411 | 3300009147 | Ga0114129_10043385 | Ga0114129_100433858 | 266 |
| 412 | 3300009147 | Ga0114129_10066405 | Ga0114129_100664055 | 266 |
| 413 | 3300009148 | Ga0105243_10002051 | Ga0105243_1000205115 | 266 |
| 414 | 3300009148 | Ga0105243_10089977 | Ga0105243_100899772 | 266 |
| 415 | 3300009148 | Ga0105243_10203901 | Ga0105243_102039012 | 266 |
| 416 | 3300009148 | Ga0105243_10708890 | Ga0105243_107088901 | 266 |
| 417 | 3300009174 | Ga0105241_10001526 | Ga0105241_1000152615 | 266 |
| 418 | 3300009174 | Ga0105241_10152988 | Ga0105241_101529883 | 266 |
| 419 | 3300009176 | Ga0105242_10000399 | Ga0105242_1000039926 | 266 |
| 420 | 3300009176 | Ga0105242_10247102 | Ga0105242_102471023 | 266 |
| 421 | 3300009177 | Ga0105248_10004145 | Ga0105248_1000414510 | 266 |
| 422 | 3300009177 | Ga0105248_10026703 | Ga0105248_100267033 | 266 |
| 423 | 3300009177 | Ga0105248_10031820 | Ga0105248_100318206 | 266 |
| 424 | 3300009177 | Ga0105248_10078259 | Ga0105248_100782594 | 266 |
| 425 | 3300009177 | Ga0105248_10081870 | Ga0105248_100818704 | 266 |
| 426 | 3300009177 | Ga0105248_10095812 | Ga0105248_100958123 | 266 |
| 427 | 3300009177 | Ga0105248_10571375 | Ga0105248_105713751 | 266 |
| 428 | 3300009545 | Ga0105237_10006666 | Ga0105237_100066668 | 266 |
| 429 | 3300009545 | Ga0105237_10075814 | Ga0105237_100758142 | 266 |
| 430 | 3300009551 | Ga0105238_10017057 | Ga0105238_100170576 | 266 |
| 431 | 3300009551 | Ga0105238_10059456 | Ga0105238_100594563 | 266 |
| 432 | 3300009551 | Ga0105238_10100771 | Ga0105238_101007711 | 266 |
| 433 | 3300009551 | Ga0105238_10171795 | Ga0105238_101717951 | 266 |
| 434 | 3300009551 | Ga0105238_10183822 | Ga0105238_101838224 | 266 |
| 435 | 3300009553 | Ga0105249_10002756 | Ga0105249_1000275610 | 266 |
| 436 | 3300010159 | Ga0099796_10023205 | Ga0099796_100232052 | 266 |
| 437 | 3300010375 | Ga0105239_10009796 | Ga0105239_100097962 | 266 |
| 438 | 3300010375 | Ga0105239_10184640 | Ga0105239_101846402 | 266 |
| 439 | 3300010375 | Ga0105239_10432739 | Ga0105239_104327391 | 266 |
| 440 | 3300011119 | Ga0105246_10000033 | Ga0105246_1000003336 | 266 |
| 441 | 3300011119 | Ga0105246_10188930 | Ga0105246_101889303 | 266 |
| 442 | 3300011119 | Ga0105246_10223477 | Ga0105246_102234772 | 266 |
| 443 | 3300013100 | Ga0157373_10006645 | Ga0157373_100066459 | 266 |
| 444 | 3300013102 | Ga0157371_10033300 | Ga0157371_100333001 | 266 |
| 445 | 3300013102 | Ga0157371_10068893 | Ga0157371_100688931 | 266 |
| 446 | 3300013104 | Ga0157370_10198539 | Ga0157370_101985393 | 266 |
| 447 | 3300013296 | Ga0157374_10002423 | Ga0157374_100024235 | 266 |
| 448 | 3300013296 | Ga0157374_10054544 | Ga0157374_100545444 | 266 |
| 449 | 3300013296 | Ga0157374_10444840 | Ga0157374_104448401 | 266 |
| 450 | 3300013297 | Ga0157378_10011328 | Ga0157378_100113288 | 266 |
| 451 | 3300013306 | Ga0163162_10001526 | Ga0163162_100015263 | 266 |
| 452 | 3300013306 | Ga0163162_10068838 | Ga0163162_100688384 | 266 |
| 453 | 3300013306 | Ga0163162_10642162 | Ga0163162_106421622 | 266 |
| 454 | 3300013306 | Ga0163162_10795344 | Ga0163162_107953441 | 266 |
| 455 | 3300013307 | Ga0157372_10001162 | Ga0157372_1000116226 | 266 |
| 456 | 3300013308 | Ga0157375_10000124 | Ga0157375_1000012468 | 266 |
| 457 | 3300013308 | Ga0157375_10017274 | Ga0157375_100172742 | 266 |
| 458 | 3300013308 | Ga0157375_10217286 | Ga0157375_102172863 | 266 |
| 459 | 3300013308 | Ga0157375_10614352 | Ga0157375_106143522 | 266 |
| 460 | 3300014325 | Ga0163163_10000745 | Ga0163163_100007457 | 266 |
| 461 | 3300014325 | Ga0163163_10019246 | Ga0163163_100192466 | 266 |
| 462 | 3300014326 | Ga0157380_10000140 | Ga0157380_1000014018 | 266 |
| 463 | 3300014326 | Ga0157380_10064645 | Ga0157380_100646453 | 266 |
| 464 | 3300014745 | Ga0157377_10000117 | Ga0157377_1000011752 | 266 |
| 465 | 3300014968 | Ga0157379_10000785 | Ga0157379_1000078518 | 266 |
| 466 | 3300014968 | Ga0157379_10317925 | Ga0157379_103179251 | 266 |
| 467 | 3300014968 | Ga0157379_10393996 | Ga0157379_103939961 | 266 |
| 468 | 3300014969 | Ga0157376_10000034 | Ga0157376_100000348 | 266 |
| 469 | 3300014969 | Ga0157376_10023138 | Ga0157376_100231383 | 266 |
| 470 | 3300017792 | Ga0163161_10000448 | Ga0163161_1000044838 | 266 |
| 471 | 3300017792 | Ga0163161_10250117 | Ga0163161_102501171 | 266 |
| 472 | 3300020078 | Ga0206352_10618637 | Ga0206352_106186371 | 266 |
| 473 | 3300020080 | Ga0206350_10087095 | Ga0206350_100870951 | 266 |
| 474 | 3300021358 | Ga0213873_10076792 | Ga0213873_100767921 | 266 |
| 475 | 3300021388 | Ga0213875_10000025 | Ga0213875_10000025118 | 266 |
| 476 | 3300024225 | Ga0224572_1005633 | Ga0224572_10056332 | 266 |
| 477 | 3300024227 | Ga0228598_1003747 | Ga0228598_10037474 | 266 |
| 478 | 3300024227 | Ga0228598_1019940 | Ga0228598_10199402 | 266 |
| 479 | 3300025271 | Ga0207666_1000017 | Ga0207666_10000179 | 266 |
| 480 | 3300025271 | Ga0207666_1000125 | Ga0207666_100012512 | 266 |
| 481 | 3300025290 | Ga0207673_1000060 | Ga0207673_100006012 | 266 |
| 482 | 3300025315 | Ga0207697_10000009 | Ga0207697_1000000926 | 266 |
| 483 | 3300025315 | Ga0207697_10001569 | Ga0207697_100015699 | 266 |
| 484 | 3300025735 | Ga0207713_1032298 | Ga0207713_10322982 | 266 |
| 485 | 3300025885 | Ga0207653_10001876 | Ga0207653_100018765 | 266 |
| 486 | 3300025885 | Ga0207653_10015121 | Ga0207653_100151212 | 266 |
| 487 | 3300025893 | Ga0207682_10000301 | Ga0207682_100003015 | 266 |
| 488 | 3300025898 | Ga0207692_10005014 | Ga0207692_100050141 | 266 |
| 489 | 3300025898 | Ga0207692_10019482 | Ga0207692_100194822 | 266 |
| 490 | 3300025898 | Ga0207692_10083224 | Ga0207692_100832241 | 266 |
| 491 | 3300025899 | Ga0207642_10002547 | Ga0207642_100025476 | 266 |
| 492 | 3300025899 | Ga0207642_10317890 | Ga0207642_103178901 | 266 |
| 493 | 3300025900 | Ga0207710_10011377 | Ga0207710_100113774 | 266 |
| 494 | 3300025900 | Ga0207710_10013038 | Ga0207710_100130385 | 266 |
| 495 | 3300025900 | Ga0207710_10036104 | Ga0207710_100361042 | 266 |
| 496 | 3300025901 | Ga0207688_10000012 | Ga0207688_1000001219 | 266 |
| 497 | 3300025901 | Ga0207688_10005642 | Ga0207688_100056425 | 266 |
| 498 | 3300025903 | Ga0207680_10004369 | Ga0207680_100043692 | 266 |
| 499 | 3300025903 | Ga0207680_10027612 | Ga0207680_100276124 | 266 |
| 500 | 3300025903 | Ga0207680_10335967 | Ga0207680_103359671 | 266 |
| 501 | 3300025904 | Ga0207647_10005111 | Ga0207647_100051115 | 266 |
| 502 | 3300025904 | Ga0207647_10005834 | Ga0207647_100058348 | 266 |
| 503 | 3300025905 | Ga0207685_10013690 | Ga0207685_100136902 | 266 |
| 504 | 3300025905 | Ga0207685_10044633 | Ga0207685_100446332 | 266 |
| 505 | 3300025906 | Ga0207699_10005829 | Ga0207699_100058295 | 266 |
| 506 | 3300025906 | Ga0207699_10100296 | Ga0207699_101002961 | 266 |
| 507 | 3300025907 | Ga0207645_10000124 | Ga0207645_1000012427 | 266 |
| 508 | 3300025907 | Ga0207645_10036464 | Ga0207645_100364644 | 266 |
| 509 | 3300025907 | Ga0207645_10054407 | Ga0207645_100544073 | 266 |
| 510 | 3300025908 | Ga0207643_10000046 | Ga0207643_100000467 | 266 |
| 511 | 3300025908 | Ga0207643_10080377 | Ga0207643_100803772 | 266 |
| 512 | 3300025909 | Ga0207705_10108072 | Ga0207705_101080722 | 266 |
| 513 | 3300025911 | Ga0207654_10003867 | Ga0207654_100038674 | 266 |
| 514 | 3300025911 | Ga0207654_10062488 | Ga0207654_100624882 | 266 |
| 515 | 3300025912 | Ga0207707_10036253 | Ga0207707_100362532 | 266 |
| 516 | 3300025912 | Ga0207707_10190039 | Ga0207707_101900391 | 266 |
| 517 | 3300025912 | Ga0207707_10350297 | Ga0207707_103502971 | 266 |
| 518 | 3300025913 | Ga0207695_10065683 | Ga0207695_100656831 | 266 |
| 519 | 3300025913 | Ga0207695_10184013 | Ga0207695_101840132 | 266 |
| 520 | 3300025914 | Ga0207671_10127298 | Ga0207671_101272984 | 266 |
| 521 | 3300025914 | Ga0207671_10228930 | Ga0207671_102289303 | 266 |
| 522 | 3300025915 | Ga0207693_10004620 | Ga0207693_100046203 | 266 |
| 523 | 3300025915 | Ga0207693_10005130 | Ga0207693_100051306 | 266 |
| 524 | 3300025915 | Ga0207693_10013189 | Ga0207693_100131895 | 266 |
| 525 | 3300025915 | Ga0207693_10046296 | Ga0207693_100462965 | 266 |
| 526 | 3300025915 | Ga0207693_10172981 | Ga0207693_101729812 | 266 |
| 527 | 3300025916 | Ga0207663_10011495 | Ga0207663_100114955 | 266 |
| 528 | 3300025916 | Ga0207663_10163433 | Ga0207663_101634333 | 266 |
| 529 | 3300025916 | Ga0207663_10214114 | Ga0207663_102141142 | 266 |
| 530 | 3300025917 | Ga0207660_10000489 | Ga0207660_100004892 | 266 |
| 531 | 3300025917 | Ga0207660_10020291 | Ga0207660_100202915 | 266 |
| 532 | 3300025917 | Ga0207660_10049252 | Ga0207660_100492522 | 266 |
| 533 | 3300025917 | Ga0207660_10202880 | Ga0207660_102028803 | 266 |
| 534 | 3300025917 | Ga0207660_10277299 | Ga0207660_102772991 | 266 |
| 535 | 3300025918 | Ga0207662_10008508 | Ga0207662_100085087 | 266 |
| 536 | 3300025918 | Ga0207662_10025829 | Ga0207662_100258295 | 266 |
| 537 | 3300025918 | Ga0207662_10076811 | Ga0207662_100768113 | 266 |
| 538 | 3300025918 | Ga0207662_10115546 | Ga0207662_101155462 | 266 |
| 539 | 3300025919 | Ga0207657_10000162 | Ga0207657_1000016246 | 266 |
| 540 | 3300025919 | Ga0207657_10008982 | Ga0207657_100089827 | 266 |
| 541 | 3300025919 | Ga0207657_10039314 | Ga0207657_100393143 | 266 |
| 542 | 3300025919 | Ga0207657_10085018 | Ga0207657_100850185 | 266 |
| 543 | 3300025919 | Ga0207657_10223662 | Ga0207657_102236621 | 266 |
| 544 | 3300025920 | Ga0207649_10000798 | Ga0207649_1000079819 | 266 |
| 545 | 3300025920 | Ga0207649_10412506 | Ga0207649_104125062 | 266 |
| 546 | 3300025921 | Ga0207652_10028398 | Ga0207652_100283984 | 266 |
| 547 | 3300025921 | Ga0207652_10137907 | Ga0207652_101379072 | 266 |
| 548 | 3300025921 | Ga0207652_10534187 | Ga0207652_105341871 | 266 |
| 549 | 3300025922 | Ga0207646_10059826 | Ga0207646_100598264 | 266 |
| 550 | 3300025922 | Ga0207646_10673409 | Ga0207646_106734091 | 266 |
| 551 | 3300025923 | Ga0207681_10011712 | Ga0207681_100117126 | 266 |
| 552 | 3300025924 | Ga0207694_10043046 | Ga0207694_100430464 | 266 |
| 553 | 3300025924 | Ga0207694_10065822 | Ga0207694_100658224 | 266 |
| 554 | 3300025924 | Ga0207694_10102049 | Ga0207694_101020494 | 266 |
| 555 | 3300025924 | Ga0207694_10218328 | Ga0207694_102183281 | 266 |
| 556 | 3300025925 | Ga0207650_10087109 | Ga0207650_100871093 | 266 |
| 557 | 3300025926 | Ga0207659_10000017 | Ga0207659_100000176 | 266 |
| 558 | 3300025927 | Ga0207687_10006873 | Ga0207687_100068735 | 266 |
| 559 | 3300025927 | Ga0207687_10024743 | Ga0207687_100247432 | 266 |
| 560 | 3300025927 | Ga0207687_10188644 | Ga0207687_101886442 | 266 |
| 561 | 3300025927 | Ga0207687_10406477 | Ga0207687_104064771 | 266 |
| 562 | 3300025928 | Ga0207700_10001122 | Ga0207700_1000112218 | 266 |
| 563 | 3300025928 | Ga0207700_10178476 | Ga0207700_101784763 | 266 |
| 564 | 3300025929 | Ga0207664_10044126 | Ga0207664_100441261 | 266 |
| 565 | 3300025929 | Ga0207664_10082606 | Ga0207664_100826063 | 266 |
| 566 | 3300025929 | Ga0207664_10086393 | Ga0207664_100863932 | 266 |
| 567 | 3300025929 | Ga0207664_10103171 | Ga0207664_101031713 | 266 |
| 568 | 3300025931 | Ga0207644_10012971 | Ga0207644_100129715 | 266 |
| 569 | 3300025931 | Ga0207644_10013070 | Ga0207644_100130705 | 266 |
| 570 | 3300025931 | Ga0207644_10036024 | Ga0207644_100360241 | 266 |
| 571 | 3300025931 | Ga0207644_10043725 | Ga0207644_100437256 | 266 |
| 572 | 3300025931 | Ga0207644_10510269 | Ga0207644_105102691 | 266 |
| 573 | 3300025932 | Ga0207690_10000151 | Ga0207690_1000015159 | 266 |
| 574 | 3300025933 | Ga0207706_10000368 | Ga0207706_100003689 | 266 |
| 575 | 3300025933 | Ga0207706_10007484 | Ga0207706_100074844 | 266 |
| 576 | 3300025933 | Ga0207706_10008477 | Ga0207706_100084775 | 266 |
| 577 | 3300025933 | Ga0207706_10017363 | Ga0207706_100173632 | 266 |
| 578 | 3300025933 | Ga0207706_10018620 | Ga0207706_100186202 | 266 |
| 579 | 3300025934 | Ga0207686_10003886 | Ga0207686_100038868 | 266 |
| 580 | 3300025934 | Ga0207686_10016902 | Ga0207686_100169024 | 266 |
| 581 | 3300025934 | Ga0207686_10023460 | Ga0207686_100234605 | 266 |
| 582 | 3300025935 | Ga0207709_10000256 | Ga0207709_1000025619 | 266 |
| 583 | 3300025935 | Ga0207709_10022765 | Ga0207709_100227656 | 266 |
| 584 | 3300025935 | Ga0207709_10139977 | Ga0207709_101399772 | 266 |
| 585 | 3300025935 | Ga0207709_10616639 | Ga0207709_106166391 | 266 |
| 586 | 3300025936 | Ga0207670_10000086 | Ga0207670_1000008668 | 266 |
| 587 | 3300025936 | Ga0207670_10027694 | Ga0207670_100276943 | 266 |
| 588 | 3300025936 | Ga0207670_10068924 | Ga0207670_100689241 | 266 |
| 589 | 3300025936 | Ga0207670_10098770 | Ga0207670_100987702 | 266 |
| 590 | 3300025936 | Ga0207670_10170788 | Ga0207670_101707882 | 266 |
| 591 | 3300025937 | Ga0207669_10001765 | Ga0207669_100017655 | 266 |
| 592 | 3300025937 | Ga0207669_10014117 | Ga0207669_100141175 | 266 |
| 593 | 3300025937 | Ga0207669_10021878 | Ga0207669_100218783 | 266 |
| 594 | 3300025937 | Ga0207669_10196812 | Ga0207669_101968121 | 266 |
| 595 | 3300025937 | Ga0207669_10312254 | Ga0207669_103122541 | 266 |
| 596 | 3300025938 | Ga0207704_10002423 | Ga0207704_100024235 | 266 |
| 597 | 3300025938 | Ga0207704_10052873 | Ga0207704_100528732 | 266 |
| 598 | 3300025938 | Ga0207704_10160794 | Ga0207704_101607943 | 266 |
| 599 | 3300025939 | Ga0207665_10010248 | Ga0207665_100102483 | 266 |
| 600 | 3300025939 | Ga0207665_10042186 | Ga0207665_100421864 | 266 |
| 601 | 3300025939 | Ga0207665_10210897 | Ga0207665_102108971 | 266 |
| 602 | 3300025940 | Ga0207691_10000303 | Ga0207691_1000030310 | 266 |
| 603 | 3300025940 | Ga0207691_10203100 | Ga0207691_102031003 | 266 |
| 604 | 3300025940 | Ga0207691_10397324 | Ga0207691_103973241 | 266 |
| 605 | 3300025941 | Ga0207711_10013210 | Ga0207711_100132103 | 266 |
| 606 | 3300025941 | Ga0207711_10057541 | Ga0207711_100575413 | 266 |
| 607 | 3300025941 | Ga0207711_10121154 | Ga0207711_101211544 | 266 |
| 608 | 3300025941 | Ga0207711_10348899 | Ga0207711_103488992 | 266 |
| 609 | 3300025941 | Ga0207711_10375601 | Ga0207711_103756011 | 266 |
| 610 | 3300025942 | Ga0207689_10000109 | Ga0207689_1000010927 | 266 |
| 611 | 3300025942 | Ga0207689_10037728 | Ga0207689_100377284 | 266 |
| 612 | 3300025944 | Ga0207661_10010457 | Ga0207661_100104574 | 266 |
| 613 | 3300025944 | Ga0207661_10218844 | Ga0207661_102188442 | 266 |
| 614 | 3300025944 | Ga0207661_10333953 | Ga0207661_103339533 | 266 |
| 615 | 3300025945 | Ga0207679_10000031 | Ga0207679_10000031172 | 266 |
| 616 | 3300025945 | Ga0207679_10133638 | Ga0207679_101336383 | 266 |
| 617 | 3300025945 | Ga0207679_10640370 | Ga0207679_106403701 | 266 |
| 618 | 3300025949 | Ga0207667_10002481 | Ga0207667_1000248119 | 266 |
| 619 | 3300025949 | Ga0207667_10044884 | Ga0207667_100448841 | 266 |
| 620 | 3300025960 | Ga0207651_10000044 | Ga0207651_1000004463 | 266 |
| 621 | 3300025960 | Ga0207651_10049035 | Ga0207651_100490354 | 266 |
| 622 | 3300025960 | Ga0207651_10061834 | Ga0207651_100618343 | 266 |
| 623 | 3300025961 | Ga0207712_10001848 | Ga0207712_1000184811 | 266 |
| 624 | 3300025961 | Ga0207712_10057628 | Ga0207712_100576282 | 266 |
| 625 | 3300025972 | Ga0207668_10001339 | Ga0207668_100013395 | 266 |
| 626 | 3300025972 | Ga0207668_10233163 | Ga0207668_102331631 | 266 |
| 627 | 3300025981 | Ga0207640_10210056 | Ga0207640_102100562 | 266 |
| 628 | 3300025986 | Ga0207658_10025019 | Ga0207658_100250195 | 266 |
| 629 | 3300025986 | Ga0207658_10032961 | Ga0207658_100329611 | 266 |
| 630 | 3300025986 | Ga0207658_10034292 | Ga0207658_100342923 | 266 |
| 631 | 3300025986 | Ga0207658_10103050 | Ga0207658_101030502 | 266 |
| 632 | 3300025986 | Ga0207658_10316734 | Ga0207658_103167341 | 266 |
| 633 | 3300025986 | Ga0207658_10438273 | Ga0207658_104382731 | 266 |
| 634 | 3300026023 | Ga0207677_10006203 | Ga0207677_100062037 | 266 |
| 635 | 3300026023 | Ga0207677_10056419 | Ga0207677_100564192 | 266 |
| 636 | 3300026035 | Ga0207703_10018118 | Ga0207703_100181181 | 266 |
| 637 | 3300026035 | Ga0207703_10031219 | Ga0207703_100312195 | 266 |
| 638 | 3300026035 | Ga0207703_10170841 | Ga0207703_101708413 | 266 |
| 639 | 3300026035 | Ga0207703_10202260 | Ga0207703_102022603 | 266 |
| 640 | 3300026035 | Ga0207703_10459859 | Ga0207703_104598591 | 266 |
| 641 | 3300026041 | Ga0207639_10053044 | Ga0207639_100530445 | 266 |
| 642 | 3300026041 | Ga0207639_10374939 | Ga0207639_103749392 | 266 |
| 643 | 3300026067 | Ga0207678_10000158 | Ga0207678_1000015846 | 266 |
| 644 | 3300026067 | Ga0207678_10031192 | Ga0207678_100311923 | 266 |
| 645 | 3300026067 | Ga0207678_10047158 | Ga0207678_100471585 | 266 |
| 646 | 3300026075 | Ga0207708_10000098 | Ga0207708_1000009826 | 266 |
| 647 | 3300026075 | Ga0207708_10005985 | Ga0207708_100059857 | 266 |
| 648 | 3300026078 | Ga0207702_10008602 | Ga0207702_100086021 | 266 |
| 649 | 3300026078 | Ga0207702_10425025 | Ga0207702_104250251 | 266 |
| 650 | 3300026088 | Ga0207641_10000408 | Ga0207641_100004086 | 266 |
| 651 | 3300026089 | Ga0207648_10000696 | Ga0207648_1000069638 | 266 |
| 652 | 3300026089 | Ga0207648_10014142 | Ga0207648_100141423 | 266 |
| 653 | 3300026089 | Ga0207648_10055376 | Ga0207648_100553762 | 266 |
| 654 | 3300026095 | Ga0207676_10037167 | Ga0207676_100371674 | 266 |
| 655 | 3300026095 | Ga0207676_10117072 | Ga0207676_101170724 | 266 |
| 656 | 3300026095 | Ga0207676_10190212 | Ga0207676_101902122 | 266 |
| 657 | 3300026116 | Ga0207674_10000420 | Ga0207674_1000042026 | 266 |
| 658 | 3300026116 | Ga0207674_10010481 | Ga0207674_1001048111 | 266 |
| 659 | 3300026118 | Ga0207675_100001146 | Ga0207675_10000114623 | 266 |
| 660 | 3300026118 | Ga0207675_100024805 | Ga0207675_1000248055 | 266 |
| 661 | 3300026118 | Ga0207675_100085001 | Ga0207675_1000850012 | 266 |
| 662 | 3300026118 | Ga0207675_100470399 | Ga0207675_1004703992 | 266 |
| 663 | 3300026121 | Ga0207683_10000004 | Ga0207683_1000000435 | 266 |
| 664 | 3300026121 | Ga0207683_10001766 | Ga0207683_1000176615 | 266 |
| 665 | 3300026121 | Ga0207683_10065450 | Ga0207683_100654505 | 266 |
| 666 | 3300026121 | Ga0207683_10078238 | Ga0207683_100782383 | 266 |
| 667 | 3300026142 | Ga0207698_10005316 | Ga0207698_100053166 | 266 |
| 668 | 3300026142 | Ga0207698_10615545 | Ga0207698_106155451 | 266 |
| 669 | 3300027512 | Ga0209179_1008391 | Ga0209179_10083912 | 266 |
| 670 | 3300027512 | Ga0209179_1016983 | Ga0209179_10169832 | 266 |
| 671 | 3300027665 | Ga0209983_1012408 | Ga0209983_10124082 | 266 |
| 672 | 3300027682 | Ga0209971_1021584 | Ga0209971_10215842 | 266 |
| 673 | 3300027695 | Ga0209966_1001342 | Ga0209966_10013425 | 266 |
| 674 | 3300027695 | Ga0209966_1034142 | Ga0209966_10341421 | 266 |
| 675 | 3300027717 | Ga0209998_10001259 | Ga0209998_100012597 | 266 |
| 676 | 3300027717 | Ga0209998_10003935 | Ga0209998_100039353 | 266 |
| 677 | 3300027866 | Ga0209813_10016575 | Ga0209813_100165752 | 266 |
| 678 | 3300027866 | Ga0209813_10035088 | Ga0209813_100350882 | 266 |
| 679 | 3300027876 | Ga0209974_10000117 | Ga0209974_100001179 | 266 |
| 680 | 3300027876 | Ga0209974_10006843 | Ga0209974_100068433 | 266 |
| 681 | 3300027876 | Ga0209974_10028923 | Ga0209974_100289233 | 266 |
| 682 | 3300027876 | Ga0209974_10029881 | Ga0209974_100298813 | 266 |
| 683 | 3300027907 | Ga0207428_10000250 | Ga0207428_1000025065 | 266 |
| 684 | 3300027907 | Ga0207428_10001707 | Ga0207428_100017078 | 266 |
| 685 | 3300027907 | Ga0207428_10006503 | Ga0207428_100065035 | 266 |
| 686 | 3300027907 | Ga0207428_10007251 | Ga0207428_100072515 | 266 |
| 687 | 3300028379 | Ga0268266_10019723 | Ga0268266_100197236 | 266 |
| 688 | 3300028379 | Ga0268266_10064479 | Ga0268266_100644792 | 266 |
| 689 | 3300028379 | Ga0268266_10070409 | Ga0268266_100704092 | 266 |
| 690 | 3300028380 | Ga0268265_10005880 | Ga0268265_100058805 | 266 |
| 691 | 3300028381 | Ga0268264_10018374 | Ga0268264_100183742 | 266 |
| 692 | 3300028381 | Ga0268264_10074225 | Ga0268264_100742252 | 266 |
| 693 | 3300028381 | Ga0268264_10365487 | Ga0268264_103654873 | 266 |
| 694 | 3300028381 | Ga0268264_10415273 | Ga0268264_104152731 | 266 |
| 695 | 3300030760 | Ga0265762_1005243 | Ga0265762_10052433 | 266 |
| 696 | 3300031090 | Ga0265760_10031613 | Ga0265760_100316132 | 266 |
| 697 | 3300031241 | Ga0265325_10200729 | Ga0265325_102007291 | 266 |
| 698 | 3300031595 | Ga0265313_10011961 | Ga0265313_100119611 | 266 |
| 699 | 3300031995 | Ga0307409_100285899 | Ga0307409_1002858992 | 266 |
| 700 | 3300034819 | Ga0373958_0021183 | Ga0373958_0021183_236_1036 | 266 |
| 701 | 3300034820 | Ga0373959_0033533 | Ga0373959_0033533_68_868 | 266 |
| 702 | 3300034957 | Ga0373938_0000421 | Ga0373938_0000421_3560_4360 | 266 |
| 703 | 3300035083 | Ga0373926_0007240 | Ga0373926_0007240_1651_2469 | 266 |
| 704 | 3300035084 | Ga0373928_0034835 | Ga0373928_0034835_279_1079 | 266 |
| 705 | 3300035086 | Ga0373934_0033278 | Ga0373934_0033278_1031_1969 | 266 |
| 706 | 3300035088 | Ga0373940_0031602 | Ga0373940_0031602_269_1069 | 266 |
| 707 | 3300035090 | Ga0373949_0001809 | Ga0373949_0001809_3658_4458 | 266 |
| 708 | 3300035091 | Ga0373951_0009831 | Ga0373951_0009831_733_1533 | 266 |
| 709 | 3300035092 | Ga0373952_0002647 | Ga0373952_0002647_1769_2569 | 266 |
| 710 | 3300035111 | Ga0373923_0158125 | Ga0373923_0158125_96_902 | 266 |
| 711 | 3300035112 | Ga0373932_0001391 | Ga0373932_0001391_444_1244 | 266 |
| 712 | 3300035114 | Ga0373939_0010614 | Ga0373939_0010614_1195_1995 | 266 |
| 713 | 3300035115 | Ga0373941_0009316 | Ga0373941_0009316_255_1055 | 266 |
| 714 | 3300035118 | Ga0373954_0143184 | Ga0373954_0143184_294_1100 | 266 |
| 715 | 3300035119 | Ga0373956_0100444 | Ga0373956_0100444_472_1278 | 266 |
| 716 | 3300035120 | Ga0373957_0000917 | Ga0373957_0000917_4054_4992 | 266 |
| 717 | 3300035121 | Ga0373960_0003777 | Ga0373960_0003777_329_1129 | 266 |
| 718 | 3300035170 | Ga0373943_0037316 | Ga0373943_0037316_721_1659 | 266 |
| 719 | 3300035171 | Ga0373946_0002428 | Ga0373946_0002428_2133_3020 | 266 |
| 720 | 3300035171 | Ga0373946_0019518 | Ga0373946_0019518_1510_2328 | 266 |
| 721 | 3300035172 | Ga0373955_0023921 | Ga0373955_0023921_600_1538 | 266 |
| 722 | 3300035241 | Ga0373961_0046212 | Ga0373961_0046212_398_1198 | 266 |
| 723 | 3300035242 | Ga0373962_0003202 | Ga0373962_0003202_959_1759 | 266 |
| 724 | 3300035410 | Ga0373924_0002733 | Ga0373924_0002733_305_1243 | 266 |
| 725 | 3300035410 | Ga0373924_0028043 | Ga0373924_0028043_1194_2012 | 266 |
| 726 | 3300035691 | Ga0373931_0000034 | Ga0373931_0000034_3435_4235 | 266 |
| 727 | 3300035691 | Ga0373931_0001311 | Ga0373931_0001311_4498_5304 | 266 |
| 728 | 3300035691 | Ga0373931_0022363 | Ga0373931_0022363_1803_2609 | 266 |
| 729 | 3300035691 | Ga0373931_0051906 | Ga0373931_0051906_269_1093 | 266 |
| 730 | 3300035692 | Ga0373935_0008152 | Ga0373935_0008152_1240_2058 | 266 |
| 731 | 3300035692 | Ga0373935_0147022 | Ga0373935_0147022_408_1346 | 266 |
| 732 | 3300035692 | Ga0373935_0325535 | Ga0373935_0325535_40_843 | 266 |
| 733 | 3300035692 | Ga0373935_0377021 | Ga0373935_0377021_162_968 | 266 |
| 734 | 3300035695 | Ga0373927_0000839 | Ga0373927_0000839_4720_5607 | 266 |
| 735 | 3300035695 | Ga0373927_0099229 | Ga0373927_0099229_181_987 | 266 |
| 736 | 3300035695 | Ga0373927_0148020 | Ga0373927_0148020_116_934 | 266 |
| 737 | 3300035724 | Ga0373933_0012620 | Ga0373933_0012620_2356_3294 | 266 |
| 738 | 3300035724 | Ga0373933_0272572 | Ga0373933_0272572_276_1082 | 266 |
| 739 | 3300035725 | Ga0373947_0000796 | Ga0373947_0000796_3896_4783 | 266 |
| 740 | 3300035725 | Ga0373947_0276004 | Ga0373947_0276004_143_961 | 266 |
| 741 | 3300036401 | Ga0373937_0019531 | Ga0373937_0019531_1376_2314 | 266 |
| 742 | 3300036401 | Ga0373937_0323068 | Ga0373937_0323068_247_1053 | 266 |
| 743 | 3300037068 | Ga0373925_0002955 | Ga0373925_0002955_7840_8727 | 266 |
| 744 | 3300037068 | Ga0373925_0021172 | Ga0373925_0021172_2595_3413 | 266 |
| 745 | 3300037068 | Ga0373925_0217275 | Ga0373925_0217275_327_1133 | 266 |
| 746 | 3300037466 | Ga0395898_0027542 | Ga0395898_0027542_2959_3759 | 266 |
| 747 | 3300038443 | Ga0395901_0014197 | Ga0395901_0014197_988_1788 | 266 |
| 748 | 3300039437 | Ga0436365_1309021 | Ga0436365_1309021_508_1308 | 266 |
| 749 | 3300039437 | Ga0436365_1565429 | Ga0436365_1565429_495_1379 | 266 |
| 750 | 3300039447 | Ga0436361_0379330 | Ga0436361_0379330_989_1795 | 266 |
| 751 | 3300042008 | Ga0439450_002141 | Ga0439450_002141_410_1210 | 266 |
| 752 | 3300044694 | Ga0466963_0052011 | Ga0466963_0052011_437_1288 | 266 |
| 753 | 3300044694 | Ga0466963_0110995 | Ga0466963_0110995_1037_1837 | 266 |
| 754 | 3300044842 | Ga0466957_0028996 | Ga0466957_0028996_542_1393 | 266 |
| 755 | 3300044842 | Ga0466957_0065742 | Ga0466957_0065742_598_1398 | 266 |
| 756 | 3300045836 | Ga0466958_0040840 | Ga0466958_0040840_1054_1905 | 266 |
| 757 | 3300045836 | Ga0466958_0097744 | Ga0466958_0097744_26_826 | 266 |
| 758 | 3300045976 | Ga0466967_0151147 | Ga0466967_0151147_416_1216 | 266 |
| 759 | 3300046454 | Ga0495592_0020986 | Ga0495592_0020986_2818_3756 | 266 |
| 760 | 3300046455 | Ga0495603_0020845 | Ga0495603_0020845_980_1804 | 266 |
| 761 | 3300046462 | Ga0495651_0004824 | Ga0495651_0004824_8169_9107 | 266 |
| 762 | 3300046462 | Ga0495651_0017751 | Ga0495651_0017751_4617_5423 | 266 |
| 763 | 3300046472 | Ga0495580_0042600 | Ga0495580_0042600_23_910 | 266 |
| 764 | 3300046473 | Ga0495582_0029880 | Ga0495582_0029880_1369_2193 | 266 |
| 765 | 3300046474 | Ga0495605_0038453 | Ga0495605_0038453_1156_1956 | 266 |
| 766 | 3300046475 | Ga0495639_0038306 | Ga0495639_0038306_520_1344 | 266 |
| 767 | 3300046476 | Ga0495662_0004502 | Ga0495662_0004502_33_851 | 266 |
| 768 | 3300046477 | Ga0495664_0004807 | Ga0495664_0004807_5957_6895 | 266 |
| 769 | 3300046477 | Ga0495664_0006400 | Ga0495664_0006400_3652_4470 | 266 |
| 770 | 3300046491 | Ga0495584_0094389 | Ga0495584_0094389_443_1267 | 266 |
| 771 | 3300046499 | Ga0495594_0024062 | Ga0495594_0024062_1204_2028 | 266 |
| 772 | 3300046511 | Ga0495608_0010475 | Ga0495608_0010475_4080_5018 | 266 |
| 773 | 3300046511 | Ga0495608_0135213 | Ga0495608_0135213_680_1486 | 266 |
| 774 | 3300046514 | Ga0495618_0000917 | Ga0495618_0000917_7341_8279 | 266 |
| 775 | 3300046514 | Ga0495618_0108433 | Ga0495618_0108433_210_1097 | 266 |
| 776 | 3300046514 | Ga0495618_0183340 | Ga0495618_0183340_126_944 | 266 |
| 777 | 3300046516 | Ga0495628_0007281 | Ga0495628_0007281_1142_2080 | 266 |
| 778 | 3300046517 | Ga0495630_0011479 | Ga0495630_0011479_5118_6056 | 266 |
| 779 | 3300046517 | Ga0495630_0061315 | Ga0495630_0061315_487_1311 | 266 |
| 780 | 3300046526 | Ga0495666_0012399 | Ga0495666_0012399_1975_2862 | 266 |
| 781 | 3300046529 | Ga0495652_0010662 | Ga0495652_0010662_1463_2281 | 266 |
| 782 | 3300046529 | Ga0495652_0021608 | Ga0495652_0021608_3329_4267 | 266 |
| 783 | 3300046529 | Ga0495652_0177800 | Ga0495652_0177800_498_1322 | 266 |
| 784 | 3300046531 | Ga0495665_0012185 | Ga0495665_0012185_3632_4450 | 266 |
| 785 | 3300046531 | Ga0495665_0092134 | Ga0495665_0092134_728_1534 | 266 |
| 786 | 3300046533 | Ga0495640_0003215 | Ga0495640_0003215_2130_2948 | 266 |
| 787 | 3300046533 | Ga0495640_0005374 | Ga0495640_0005374_1890_2828 | 266 |
| 788 | 3300046533 | Ga0495640_0093106 | Ga0495640_0093106_999_1886 | 266 |
| 789 | 3300046536 | Ga0495587_0026356 | Ga0495587_0026356_1991_2929 | 266 |
| 790 | 3300046543 | Ga0495645_0001763 | Ga0495645_0001763_1375_2313 | 266 |
| 791 | 3300046543 | Ga0495645_0004378 | Ga0495645_0004378_4458_5276 | 266 |
| 792 | 3300046559 | Ga0495667_0000256 | Ga0495667_0000256_22014_22952 | 266 |
| 793 | 3300046559 | Ga0495667_0092950 | Ga0495667_0092950_891_1697 | 266 |
| 794 | 3300046642 | Ga0495634_0003473 | Ga0495634_0003473_5691_6509 | 266 |
| 795 | 3300046642 | Ga0495634_0044121 | Ga0495634_0044121_194_1081 | 266 |
| 796 | 3300046642 | Ga0495634_0098678 | Ga0495634_0098678_733_1671 | 266 |
| 797 | 3300046663 | Ga0495635_0001674 | Ga0495635_0001674_7264_8202 | 266 |
| 798 | 3300046663 | Ga0495635_0003010 | Ga0495635_0003010_2941_3759 | 266 |
| 799 | 3300046663 | Ga0495635_0019505 | Ga0495635_0019505_1894_2718 | 266 |
| 800 | 3300046663 | Ga0495635_0389808 | Ga0495635_0389808_102_908 | 266 |
| 801 | 3300046674 | Ga0495588_0052958 | Ga0495588_0052958_137_961 | 266 |
| 802 | 3300046675 | Ga0495657_0002838 | Ga0495657_0002838_3051_3989 | 266 |
| 803 | 3300046678 | Ga0495599_0002175 | Ga0495599_0002175_9359_10297 | 266 |
| 804 | 3300046679 | Ga0495623_0008613 | Ga0495623_0008613_4224_5162 | 266 |
| 805 | 3300046680 | Ga0495646_0001535 | Ga0495646_0001535_8268_9206 | 266 |
| 806 | 3300046681 | Ga0495647_0010400 | Ga0495647_0010400_685_1509 | 266 |
| 807 | 3300046681 | Ga0495647_0059631 | Ga0495647_0059631_546_1433 | 266 |
| 808 | 3300046683 | Ga0495658_0040583 | Ga0495658_0040583_1740_2564 | 266 |
| 809 | 3300046689 | Ga0495613_0095948 | Ga0495613_0095948_760_1698 | 266 |
| 810 | 3300046690 | Ga0495624_0002424 | Ga0495624_0002424_754_1641 | 266 |
| 811 | 3300046690 | Ga0495624_0040939 | Ga0495624_0040939_1111_1935 | 266 |
| 812 | 3300046809 | Ga0495600_0008376 | Ga0495600_0008376_188_1126 | 266 |
| 813 | 3300047315 | Ga0495581_0008086 | Ga0495581_0008086_1955_2842 | 266 |
| 814 | 3300047317 | Ga0495604_0012925 | Ga0495604_0012925_2514_3452 | 266 |
| 815 | 3300047317 | Ga0495604_0175636 | Ga0495604_0175636_477_1283 | 266 |
| 816 | 3300047319 | Ga0495674_0001984 | Ga0495674_0001984_11694_12518 | 266 |
| 817 | 3300047319 | Ga0495674_0004803 | Ga0495674_0004803_8110_9048 | 266 |
| 818 | 3300047319 | Ga0495674_0379723 | Ga0495674_0379723_68_886 | 266 |
| 819 | 3300047321 | Ga0495676_0299706 | Ga0495676_0299706_13_831 | 266 |
| 820 | 3300047322 | Ga0495680_0005564 | Ga0495680_0005564_418_1242 | 266 |
| 821 | 3300047322 | Ga0495680_0008253 | Ga0495680_0008253_499_1437 | 266 |
| 822 | 3300047444 | Ga0495675_0000532 | Ga0495675_0000532_19852_20790 | 266 |
| 823 | 3300047447 | Ga0495685_004853 | Ga0495685_004853_1345_2151 | 266 |
| 824 | 3300047471 | Ga0495684_0000987 | Ga0495684_0000987_7847_8734 | 266 |
| 825 | 3300047471 | Ga0495684_0009836 | Ga0495684_0009836_2161_2979 | 266 |
| 826 | 3300047673 | Ga0495593_0082439 | Ga0495593_0082439_754_1641 | 266 |
| 827 | 3300048088 | Ga0495602_0005750 | Ga0495602_0005750_4798_5736 | 266 |
| 828 | 3300048090 | Ga0495615_0009209 | Ga0495615_0009209_141_947 | 266 |
| 829 | 3300048903 | Ga0496100_0000842 | Ga0496100_0000842_494_1297 | 266 |
| 830 | 3300048903 | Ga0496100_0073931 | Ga0496100_0073931_1260_2060 | 266 |
| 831 | 3300048904 | Ga0496101_0007404 | Ga0496101_0007404_5654_6457 | 266 |
| 832 | 3300048904 | Ga0496101_0017864 | Ga0496101_0017864_307_1245 | 266 |
| 833 | 3300048904 | Ga0496101_0077127 | Ga0496101_0077127_1321_2121 | 266 |
| 834 | 3300048904 | Ga0496101_0135469 | Ga0496101_0135469_695_1501 | 266 |
| 835 | 3300048904 | Ga0496101_0160773 | Ga0496101_0160773_385_1185 | 266 |
| 836 | 3300048905 | Ga0496102_0001935 | Ga0496102_0001935_12194_12997 | 266 |
| 837 | 3300048905 | Ga0496102_0011713 | Ga0496102_0011713_3187_3987 | 266 |
| 838 | 3300048905 | Ga0496102_0051622 | Ga0496102_0051622_2929_3729 | 266 |
| 839 | 3300048906 | Ga0496103_0004653 | Ga0496103_0004653_4077_4877 | 266 |
| 840 | 3300048906 | Ga0496103_0010777 | Ga0496103_0010777_4063_5001 | 266 |
| 841 | 3300048907 | Ga0496104_0011266 | Ga0496104_0011266_7118_7921 | 266 |
| 842 | 3300048907 | Ga0496104_0084266 | Ga0496104_0084266_941_1741 | 266 |
| 843 | 3300048907 | Ga0496104_0172235 | Ga0496104_0172235_874_1680 | 266 |
| 844 | 3300048907 | Ga0496104_0230375 | Ga0496104_0230375_307_1245 | 266 |
| 845 | 3300048907 | Ga0496104_0642583 | Ga0496104_0642583_119_925 | 266 |
| 846 | 3300048908 | Ga0496105_0041290 | Ga0496105_0041290_2786_3592 | 266 |
| 847 | 3300048908 | Ga0496105_0186660 | Ga0496105_0186660_210_1010 | 266 |
| 848 | 3300048909 | Ga0496106_0000405 | Ga0496106_0000405_11505_12308 | 266 |
| 849 | 3300048909 | Ga0496106_0055867 | Ga0496106_0055867_1513_2313 | 266 |
| 850 | 3300048910 | Ga0496107_0004066 | Ga0496107_0004066_6098_7036 | 266 |
| 851 | 3300048910 | Ga0496107_0005799 | Ga0496107_0005799_3128_3928 | 266 |
| 852 | 3300048910 | Ga0496107_0034287 | Ga0496107_0034287_2152_2955 | 266 |
| 853 | 3300048910 | Ga0496107_0050462 | Ga0496107_0050462_886_1692 | 266 |
| 854 | 3300048911 | Ga0496108_0001198 | Ga0496108_0001198_4344_5147 | 266 |
| 855 | 3300048911 | Ga0496108_0025837 | Ga0496108_0025837_21_824 | 266 |
| 856 | 3300048911 | Ga0496108_0032267 | Ga0496108_0032267_1023_1961 | 266 |
| 857 | 3300048911 | Ga0496108_0034437 | Ga0496108_0034437_2345_3145 | 266 |
| 858 | 3300048911 | Ga0496108_0049561 | Ga0496108_0049561_1377_2177 | 266 |
| 859 | 3300048912 | Ga0496109_0151200 | Ga0496109_0151200_60_860 | 266 |
| 860 | 3300048913 | Ga0496110_0010646 | Ga0496110_0010646_4820_5623 | 266 |
| 861 | 3300048913 | Ga0496110_0041865 | Ga0496110_0041865_2926_3726 | 266 |
| 862 | 3300048913 | Ga0496110_0070107 | Ga0496110_0070107_519_1319 | 266 |
| 863 | 3300048913 | Ga0496110_0494729 | Ga0496110_0494729_290_1093 | 266 |
| 864 | 3300048914 | Ga0496111_0004338 | Ga0496111_0004338_380_1183 | 266 |
| 865 | 3300048914 | Ga0496111_0009762 | Ga0496111_0009762_4352_5155 | 266 |
| 866 | 3300048914 | Ga0496111_0069131 | Ga0496111_0069131_24_824 | 266 |
| 867 | 3300048914 | Ga0496111_0194583 | Ga0496111_0194583_659_1465 | 266 |
| 868 | 3300048915 | Ga0496112_0047842 | Ga0496112_0047842_1982_2785 | 266 |
| 869 | 3300048915 | Ga0496112_0143557 | Ga0496112_0143557_888_1688 | 266 |
| 870 | 3300048916 | Ga0496113_0002604 | Ga0496113_0002604_6125_6925 | 266 |
| 871 | 3300048916 | Ga0496113_0079720 | Ga0496113_0079720_1290_2096 | 266 |
| 872 | 3300048916 | Ga0496113_0150213 | Ga0496113_0150213_243_1043 | 266 |
| 873 | 3300048916 | Ga0496113_0170106 | Ga0496113_0170106_215_1018 | 266 |
| 874 | 3300048917 | Ga0496114_0005575 | Ga0496114_0005575_6236_7036 | 266 |
| 875 | 3300048917 | Ga0496114_0016691 | Ga0496114_0016691_4408_5346 | 266 |
| 876 | 3300048917 | Ga0496114_0018204 | Ga0496114_0018204_2384_3184 | 266 |
| 877 | 3300048917 | Ga0496114_0071524 | Ga0496114_0071524_1010_1816 | 266 |
| 878 | 3300048917 | Ga0496114_0147538 | Ga0496114_0147538_1179_1982 | 266 |
| 879 | 3300048918 | Ga0496115_0053006 | Ga0496115_0053006_1923_2747 | 266 |
| 880 | 3300048918 | Ga0496115_0067368 | Ga0496115_0067368_982_1920 | 266 |
| 881 | 3300048918 | Ga0496115_0191993 | Ga0496115_0191993_548_1366 | 266 |
| 882 | 3300048918 | Ga0496115_0211939 | Ga0496115_0211939_327_1130 | 266 |
| 883 | 3300049568 | Ga0501031_0228033 | Ga0501031_0228033_308_1117 | 266 |
| 884 | 3300049569 | Ga0501032_0005175 | Ga0501032_0005175_749_1558 | 266 |
| 885 | 3300049570 | Ga0501033_0029607 | Ga0501033_0029607_1958_2767 | 266 |
| 886 | 3300049570 | Ga0501033_0083303 | Ga0501033_0083303_259_1068 | 266 |
| 887 | 3300049570 | Ga0501033_0129315 | Ga0501033_0129315_128_934 | 266 |
| 888 | 3300049571 | Ga0501034_0184946 | Ga0501034_0184946_618_1427 | 266 |
| 889 | 3300049572 | Ga0501036_0009276 | Ga0501036_0009276_2305_3114 | 266 |
| 890 | 3300049572 | Ga0501036_0327333 | Ga0501036_0327333_352_1152 | 266 |
| 891 | 3300049573 | Ga0501037_0001340 | Ga0501037_0001340_10119_10928 | 266 |
| 892 | 3300049574 | Ga0501038_0001023 | Ga0501038_0001023_19840_20649 | 266 |
| 893 | 3300049575 | Ga0501039_0015388 | Ga0501039_0015388_3594_4403 | 266 |
| 894 | 3300049575 | Ga0501039_0529808 | Ga0501039_0529808_40_864 | 266 |
| 895 | 3300049578 | Ga0501042_0299785 | Ga0501042_0299785_77_886 | 266 |
| 896 | 3300049579 | Ga0501043_0025349 | Ga0501043_0025349_3180_3989 | 266 |
| 897 | 3300049579 | Ga0501043_0192196 | Ga0501043_0192196_741_1547 | 266 |
| 898 | 3300049580 | Ga0501046_0008699 | Ga0501046_0008699_3398_4207 | 266 |
| 899 | 3300049581 | Ga0501047_0055872 | Ga0501047_0055872_1556_2362 | 266 |
| 900 | 3300049581 | Ga0501047_0061462 | Ga0501047_0061462_1277_2086 | 266 |
| 901 | 3300049582 | Ga0501048_0002666 | Ga0501048_0002666_4646_5455 | 266 |
| 902 | 3300049582 | Ga0501048_0087158 | Ga0501048_0087158_52_852 | 266 |
| 903 | 3300049582 | Ga0501048_0335918 | Ga0501048_0335918_141_944 | 266 |
| 904 | 3300049583 | Ga0501067_0083621 | Ga0501067_0083621_230_1033 | 266 |
| 905 | 3300049585 | Ga0501069_0005453 | Ga0501069_0005453_4645_5454 | 266 |
| 906 | 3300049586 | Ga0501070_0025730 | Ga0501070_0025730_2966_3775 | 266 |
| 907 | 3300049586 | Ga0501070_0043988 | Ga0501070_0043988_1338_2144 | 266 |
| 908 | 3300049586 | Ga0501070_0063526 | Ga0501070_0063526_802_1608 | 266 |
| 909 | 3300049587 | Ga0501071_0021832 | Ga0501071_0021832_2313_3122 | 266 |
| 910 | 3300049588 | Ga0501072_0313549 | Ga0501072_0313549_19_840 | 266 |
| 911 | 3300049588 | Ga0501072_0374429 | Ga0501072_0374429_296_1102 | 266 |
| 912 | 3300049589 | Ga0501073_0017253 | Ga0501073_0017253_2966_3775 | 266 |
| 913 | 3300049589 | Ga0501073_0142636 | Ga0501073_0142636_81_947 | 266 |
| 914 | 3300049590 | Ga0501074_0060646 | Ga0501074_0060646_1455_2264 | 266 |
| 915 | 3300049590 | Ga0501074_0212813 | Ga0501074_0212813_92_895 | 266 |
| 916 | 3300049591 | Ga0501075_0274824 | Ga0501075_0274824_340_1143 | 266 |
| 917 | 3300049593 | Ga0501077_0046198 | Ga0501077_0046198_1910_2710 | 266 |
| 918 | 3300049741 | Ga0501079_0006545 | Ga0501079_0006545_1438_2247 | 266 |
| 919 | 3300049741 | Ga0501079_0086067 | Ga0501079_0086067_741_1541 | 266 |
| 920 | 3300049741 | Ga0501079_0426513 | Ga0501079_0426513_219_1022 | 266 |
| 921 | 3300049742 | Ga0501080_0099237 | Ga0501080_0099237_489_1298 | 266 |
| 922 | 3300049742 | Ga0501080_0254987 | Ga0501080_0254987_202_1008 | 266 |
| 923 | 3300049822 | Ga0501035_0206329 | Ga0501035_0206329_852_1658 | 266 |
| 924 | 3300049822 | Ga0501035_0352720 | Ga0501035_0352720_236_1042 | 266 |
| 925 | 3300049823 | Ga0501044_0000260 | Ga0501044_0000260_46932_47741 | 266 |
| 926 | 3300049823 | Ga0501044_0008573 | Ga0501044_0008573_3768_4577 | 266 |
| 927 | 3300049823 | Ga0501044_0010896 | Ga0501044_0010896_2224_3030 | 266 |
| 928 | 3300049823 | Ga0501044_0487609 | Ga0501044_0487609_68_874 | 266 |
| 929 | 3300049824 | Ga0501045_0490490 | Ga0501045_0490490_34_843 | 266 |
| 930 | 3300050489 | nmdc:mga03683_41279_c1 | nmdc:mga03683_41279_c1_542_1345 | 266 |
| 931 | 3300050490 | nmdc:mga03n38_79548_c1 | nmdc:mga03n38_79548_c1_679_1482 | 266 |
| 932 | 3300050491 | nmdc:mga00v17_19362_c1 | nmdc:mga00v17_19362_c1_1839_2645 | 266 |
| 933 | 3300050492 | nmdc:mga0yw44_383517_c1 | nmdc:mga0yw44_383517_c1_24_827 | 266 |
| 934 | 3300050492 | nmdc:mga0yw44_63367_c1 | nmdc:mga0yw44_63367_c1_1270_2073 | 266 |
| 935 | 3300050492 | nmdc:mga0yw44_75835_c1 | nmdc:mga0yw44_75835_c1_213_1019 | 266 |
| 936 | 3300050493 | nmdc:mga0k408_55917_c1 | nmdc:mga0k408_55917_c1_30_833 | 266 |
| 937 | 3300050494 | nmdc:mga06z11_113993_c1 | nmdc:mga06z11_113993_c1_155_958 | 266 |
| 938 | 3300050494 | nmdc:mga06z11_53313_c1 | nmdc:mga06z11_53313_c1_1080_1886 | 266 |
| 939 | 3300050495 | nmdc:mga04h51_29994_c1 | nmdc:mga04h51_29994_c1_505_1305 | 266 |
| 940 | 3300050496 | nmdc:mga07m45_147397_c1 | nmdc:mga07m45_147397_c1_492_1292 | 266 |
| 941 | 3300050496 | nmdc:mga07m45_15773_c1 | nmdc:mga07m45_15773_c1_306_1127 | 266 |
| 942 | 3300050496 | nmdc:mga07m45_26560_c1 | nmdc:mga07m45_26560_c1_2352_3158 | 266 |
| 943 | 3300050496 | nmdc:mga07m45_27289_c1 | nmdc:mga07m45_27289_c1_39_842 | 266 |
| 944 | 3300050507 | nmdc:mga05p37_163552_c1 | nmdc:mga05p37_163552_c1_1043_1846 | 266 |
| 945 | 3300050507 | nmdc:mga05p37_354142_c1 | nmdc:mga05p37_354142_c1_28_954 | 266 |
| 946 | 3300050507 | nmdc:mga05p37_5377_c1 | nmdc:mga05p37_5377_c1_10214_11020 | 266 |
| 947 | 3300050508 | nmdc:mga09592_170167_c1 | nmdc:mga09592_170167_c1_877_1680 | 266 |
| 948 | 3300050508 | nmdc:mga09592_29378_c1 | nmdc:mga09592_29378_c1_947_1753 | 266 |
| 949 | 3300050509 | nmdc:mga0qj67_151963_c1 | nmdc:mga0qj67_151963_c1_429_1232 | 266 |
| 950 | 3300050509 | nmdc:mga0qj67_28_c1 | nmdc:mga0qj67_28_c1_83144_83947 | 266 |
| 951 | 3300050509 | nmdc:mga0qj67_341240_c1 | nmdc:mga0qj67_341240_c1_220_1023 | 266 |
| 952 | 3300050509 | nmdc:mga0qj67_97253_c1 | nmdc:mga0qj67_97253_c1_746_1549 | 266 |
| 953 | 3300050510 | nmdc:mga06r32_322976_c1 | nmdc:mga06r32_322976_c1_397_1200 | 266 |
| 954 | 3300050510 | nmdc:mga06r32_383161_c1 | nmdc:mga06r32_383161_c1_132_935 | 266 |
| 955 | 3300050510 | nmdc:mga06r32_507731_c1 | nmdc:mga06r32_507731_c1_35_907 | 266 |
| 956 | 3300050510 | nmdc:mga06r32_752703_c1 | nmdc:mga06r32_752703_c1_30_833 | 266 |
| 957 | 3300050511 | nmdc:mga08y16_409669_c1 | nmdc:mga08y16_409669_c1_206_1006 | 266 |
| 958 | 3300050511 | nmdc:mga08y16_590_c1 | nmdc:mga08y16_590_c1_8572_9378 | 266 |
| 959 | 3300050512 | nmdc:mga0n895_33397_c1 | nmdc:mga0n895_33397_c1_2409_3284 | 266 |
| 960 | 3300050512 | nmdc:mga0n895_425283_c1 | nmdc:mga0n895_425283_c1_164_1003 | 266 |
| 961 | 3300050512 | nmdc:mga0n895_4459_c1 | nmdc:mga0n895_4459_c1_6107_6907 | 266 |
| 962 | 3300050512 | nmdc:mga0n895_947751_c1 | nmdc:mga0n895_947751_c1_23_826 | 266 |
| 963 | 3300050513 | nmdc:mga0rr50_39320_c1 | nmdc:mga0rr50_39320_c1_1692_2492 | 266 |
| 964 | 3300050513 | nmdc:mga0rr50_8026_c1 | nmdc:mga0rr50_8026_c1_1406_2332 | 266 |
| 965 | 3300050513 | nmdc:mga0rr50_85462_c1 | nmdc:mga0rr50_85462_c1_757_1575 | 266 |
| 966 | 3300050515 | nmdc:mga0a205_3619_c1 | nmdc:mga0a205_3619_c1_353_1279 | 266 |
| 967 | 3300050515 | nmdc:mga0a205_733_c2 | nmdc:mga0a205_733_c2_5293_6093 | 266 |
| 968 | 3300050516 | nmdc:mga0sz30_4070_c1 | nmdc:mga0sz30_4070_c1_1483_2289 | 266 |
| 969 | 3300053077 | Ga0495601_0000418 | Ga0495601_0000418_13941_14765 | 266 |
| 970 | 3300053077 | Ga0495601_0010781 | Ga0495601_0010781_3771_4709 | 266 |
| 971 | 3300053077 | Ga0495601_0012231 | Ga0495601_0012231_2901_3719 | 266 |
| 972 | 3300053077 | Ga0495601_0039644 | Ga0495601_0039644_1892_2698 | 266 |
| 973 | 3300053078 | Ga0495612_0000251 | Ga0495612_0000251_6965_7783 | 266 |
| 974 | 3300053078 | Ga0495612_0003654 | Ga0495612_0003654_4694_5632 | 266 |
| 975 | 3300053078 | Ga0495612_0138888 | Ga0495612_0138888_54_860 | 266 |
| 976 | 3300053084 | Ga0495595_0002778 | Ga0495595_0002778_2148_3086 | 266 |
| 977 | 3300053085 | Ga0495619_0002566 | Ga0495619_0002566_5987_6925 | 266 |
| 978 | 3300053085 | Ga0495619_0037784 | Ga0495619_0037784_156_1034 | 266 |
| 979 | 3300053085 | Ga0495619_0090917 | Ga0495619_0090917_964_1851 | 266 |
| 980 | 3300053085 | Ga0495619_0165320 | Ga0495619_0165320_626_1432 | 266 |
| 981 | 3300053730 | Ga0500645_024021 | Ga0500645_024021_197_1000 | 266 |
| 982 | 3300054114 | Ga0501084_0208885 | Ga0501084_0208885_763_1572 | 266 |
| 983 | 3300059492 | Ga0587073_0039083 | Ga0587073_0039083_59_859 | 266 |
| 984 | 3300059492 | Ga0587073_0044354 | Ga0587073_0044354_18_824 | 266 |
| 985 | 3300059492 | Ga0587073_0054520 | Ga0587073_0054520_40_858 | 266 |
| 986 | 3300059505 | Ga0587083_0049489 | Ga0587083_0049489_58_858 | 266 |
| 987 | 3300059644 | Ga0587075_017536 | Ga0587075_017536_58_858 | 266 |
| 988 | 3300060353 | Ga0501082_0007563 | Ga0501082_0007563_3274_4083 | 266 |
| 989 | 3300060353 | Ga0501082_0231755 | Ga0501082_0231755_783_1583 | 266 |
| 990 | 3300060353 | Ga0501082_0259670 | Ga0501082_0259670_217_1023 | 266 |
| 991 | 3300060353 | Ga0501082_0317955 | Ga0501082_0317955_197_1000 | 266 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2o8x-assembly1.cif.gz_A | "crystal structure of the ""-35 element"" promoter recognition domain of mycobacterium tuberculosis sigc" | 0.9718 | 93 | 130 |
| 7bhy-assembly1.cif.gz_A | dna-binding domain of deor in complex with the dna operator | 0.9706 | 93 | 131 |
| 4g97-assembly1.cif.gz_A | crystal structure of the response regulator phyr from brucella abortus | 0.9697 | 1 | 266 |
| 2o8x-assembly1.cif.gz_B | "crystal structure of the ""-35 element"" promoter recognition domain of mycobacterium tuberculosis sigc" | 0.9675 | 93 | 130 |
| 4g97-assembly1.cif.gz_A | crystal structure of the response regulator phyr from brucella abortus | 0.9658 | 1 | 266 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2o8xA00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9718 | 93 | 130 | 1.10.10.10 |
| 2o8xB00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9675 | 93 | 130 | 1.10.10.10 |
| 3t0yA02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9564 | 91 | 135 | 1.10.10.10 |
| 1or7A02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9538 | 90 | 130 | 1.10.10.10 |
| 3n0rA02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9511 | 135 | 254 | 3.40.50.2300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A530R2W7-F1-model_v4 | Response regulator | 0.9856 | 157 | 260 |
GO:0000160
|
| AF-X2FNI5-F1-model_v4 | Two-component response regulator | 0.9833 | 111 | 247 |
GO:0000160
|
| AF-Q98FM8-F1-model_v4 | Sensory transduction regulatory protein | 0.9735 | 136 | 260 |
GO:0000160
|
| AF-A0A6B2NSG7-F1-model_v4 | Response regulator | 0.9716 | 141 | 259 |
GO:0000160
|
| AF-A0A257G5H4-F1-model_v4 | Response regulator | 0.9703 | 1 | 262 |
GO:0000160
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar