F487584
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 989 | 357 | 983 | 133 |
Family's Representative Sequence
| Representative Sequence | 3300005614|Ga0068856_100742533|Ga0068856_1007425332 |
| Length | 150 |
| Sequence | MAMSSGGAGGLSNDINVTPMIDVLLVLLIIFMAVLPSMRKAIDIQLPDPNPTVQPANANSNQIVLEVKPGGQFVINTKEVLNRNQLATRLKEIYDPRPEKIIFVKGAPGVPYGDVIFAMDVARGAGVKIIGIPPKDTPGATPAGAAPAAK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 2 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 3 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 4 | 3300003163 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 5 | 3300003308 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 6 | 3300003544 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 7 | 3300003574 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 8 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 9 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 10 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 11 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 12 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 13 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 14 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 15 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 16 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 17 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 18 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 25 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 29 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 42 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 55 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 61 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 64 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 66 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 71 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 73 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 74 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 75 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 77 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 78 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 79 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 80 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 81 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 82 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 83 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 84 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 85 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 86 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 87 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 89 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 90 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 91 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 92 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 93 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 95 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300012485 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 | Metagenome | Rhizosphere |
| 110 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 125 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 127 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 128 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 129 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 130 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 131 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 132 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 133 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 203 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 207 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 208 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 209 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 210 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 211 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 212 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 213 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 214 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 215 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 216 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 217 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 218 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 219 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 220 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 221 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 222 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 223 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 224 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 225 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 226 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 227 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 228 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 229 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 230 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 231 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 232 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 233 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 234 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 235 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 236 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 237 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 238 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 239 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 240 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 241 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 242 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 243 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 244 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 245 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 246 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 247 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 248 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 292 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 293 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 294 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 295 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 296 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 297 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 298 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 299 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 300 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 301 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 302 | 3300049526 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control | Metagenome | Rhizosphere |
| 303 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 304 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 309 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 310 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 311 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 312 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 313 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 314 | 3300049666 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control | Metagenome | Rhizosphere |
| 315 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 316 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 317 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 318 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 319 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 320 | 3300049677 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control | Metagenome | Rhizosphere |
| 321 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 322 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 323 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 324 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 325 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 326 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 327 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 328 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 329 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 330 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 331 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 332 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 333 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 334 | 3300049768 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought | Metagenome | Rhizosphere |
| 335 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 336 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 337 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 338 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 339 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 340 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 341 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 342 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 346 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 347 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 348 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 349 | 3300059625 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 350 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 351 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 352 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 353 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 354 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 355 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 356 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 357 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.44 |
| Metatranscriptomes | 5.56 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 1.82 |
| Rhizosphere | 97.27 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.91 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24737J22298_10024842 | 3300001990 | Unclassified | 1896 |
| 2 | JGI24743J22301_10124862 | 3300001991 | Bacteria | 566 |
| 3 | JGI24738J21930_10008993 | 3300002075 | Unclassified | 2261 |
| 4 | Ga0006759J45824_1040862 | 3300003163 | Bacteria | 1096 |
| 5 | Ga0006777J48905_1058895 | 3300003308 | Unclassified | 2426 |
| 6 | Ga0007417J51691_1054800 | 3300003544 | Bacteria | 995 |
| 7 | Ga0007410J51695_1062182 | 3300003574 | Bacteria | 976 |
| 8 | Ga0007409J51694_1022942 | 3300003575 | Bacteria | 532 |
| 9 | Ga0007429J51699_1023882 | 3300003579 | Bacteria | 1049 |
| 10 | Ga0032354_1021933 | 3300003693 | Bacteria | 896 |
| 11 | Ga0032354_1035115 | 3300003693 | Bacteria | 934 |
| 12 | Ga0058859_11510136 | 3300004798 | Unclassified | 607 |
| 13 | Ga0058859_11715218 | 3300004798 | Bacteria | 644 |
| 14 | Ga0058859_11806325 | 3300004798 | Bacteria | 2540 |
| 15 | Ga0058859_11821740 | 3300004798 | Bacteria | 674 |
| 16 | Ga0058863_10030836 | 3300004799 | Bacteria | 2476 |
| 17 | Ga0058863_10042616 | 3300004799 | Bacteria | 1201 |
| 18 | Ga0058863_11749764 | 3300004799 | Bacteria | 1317 |
| 19 | Ga0058863_11955260 | 3300004799 | Bacteria | 599 |
| 20 | Ga0058863_11961663 | 3300004799 | Bacteria | 2637 |
| 21 | Ga0058861_10094474 | 3300004800 | Bacteria | 876 |
| 22 | Ga0058861_10100634 | 3300004800 | Bacteria | 2520 |
| 23 | Ga0058861_11820445 | 3300004800 | Bacteria | 631 |
| 24 | Ga0058861_11988692 | 3300004800 | Bacteria | 844 |
| 25 | Ga0058861_12072470 | 3300004800 | Bacteria | 2504 |
| 26 | Ga0058860_11737710 | 3300004801 | Bacteria | 694 |
| 27 | Ga0058860_12061530 | 3300004801 | Bacteria | 676 |
| 28 | Ga0058862_10121865 | 3300004803 | Bacteria | 1198 |
| 29 | Ga0058862_10180327 | 3300004803 | Bacteria | 1000 |
| 30 | Ga0058862_10264261 | 3300004803 | Bacteria | 2739 |
| 31 | Ga0058862_12705347 | 3300004803 | Bacteria | 1390 |
| 32 | Ga0058862_12775103 | 3300004803 | Bacteria | 1374 |
| 33 | Ga0058862_12870049 | 3300004803 | Bacteria | 1881 |
| 34 | Ga0058862_12887040 | 3300004803 | Bacteria | 2376 |
| 35 | Ga0065712_10105869 | 3300005290 | Bacteria | 1930 |
| 36 | Ga0065715_10219187 | 3300005293 | Bacteria | 1279 |
| 37 | Ga0065715_10287769 | 3300005293 | Bacteria | 1067 |
| 38 | Ga0065715_10443454 | 3300005293 | Bacteria | 808 |
| 39 | Ga0070658_10002530 | 3300005327 | Bacteria | 15260 |
| 40 | Ga0070658_10027578 | 3300005327 | Bacteria | 4555 |
| 41 | Ga0070658_10067868 | 3300005327 | Bacteria | 2914 |
| 42 | Ga0070658_10089531 | 3300005327 | Bacteria | 2534 |
| 43 | Ga0070658_10116648 | 3300005327 | Bacteria | 2216 |
| 44 | Ga0070658_10133803 | 3300005327 | Bacteria | 2067 |
| 45 | Ga0070658_10268770 | 3300005327 | Bacteria | 1450 |
| 46 | Ga0070658_10372861 | 3300005327 | Bacteria | 1223 |
| 47 | Ga0070676_10046897 | 3300005328 | Bacteria | 2521 |
| 48 | Ga0070676_10132340 | 3300005328 | Bacteria | 1579 |
| 49 | Ga0070676_10404908 | 3300005328 | Bacteria | 950 |
| 50 | Ga0070683_100000565 | 3300005329 | Bacteria | 26354 |
| 51 | Ga0070683_100000662 | 3300005329 | Bacteria | 24891 |
| 52 | Ga0070683_100017034 | 3300005329 | Bacteria | 6414 |
| 53 | Ga0070683_100052721 | 3300005329 | Bacteria | 3770 |
| 54 | Ga0070683_100057123 | 3300005329 | Bacteria | 3625 |
| 55 | Ga0070683_100069251 | 3300005329 | Bacteria | 3289 |
| 56 | Ga0070683_100171623 | 3300005329 | Bacteria | 2059 |
| 57 | Ga0070683_100322487 | 3300005329 | Bacteria | 1470 |
| 58 | Ga0070683_100409308 | 3300005329 | Bacteria | 1294 |
| 59 | Ga0070683_100477452 | 3300005329 | Bacteria | 1190 |
| 60 | Ga0070683_100954592 | 3300005329 | Bacteria | 823 |
| 61 | Ga0070683_101555253 | 3300005329 | Bacteria | 636 |
| 62 | Ga0070690_100075352 | 3300005330 | Bacteria | 2199 |
| 63 | Ga0070690_100108436 | 3300005330 | Bacteria | 1850 |
| 64 | Ga0070690_100114633 | 3300005330 | Bacteria | 1802 |
| 65 | Ga0070690_100128365 | 3300005330 | Bacteria | 1710 |
| 66 | Ga0070670_100008774 | 3300005331 | Bacteria | 8628 |
| 67 | Ga0070670_100084678 | 3300005331 | Bacteria | 2724 |
| 68 | Ga0070670_100146703 | 3300005331 | Bacteria | 2041 |
| 69 | Ga0070670_100290046 | 3300005331 | Bacteria | 1430 |
| 70 | Ga0070670_100674750 | 3300005331 | Unclassified | 928 |
| 71 | Ga0070670_100902962 | 3300005331 | Bacteria | 801 |
| 72 | Ga0070670_100986370 | 3300005331 | Bacteria | 766 |
| 73 | Ga0070677_10093995 | 3300005333 | Bacteria | 1309 |
| 74 | Ga0070677_10094646 | 3300005333 | Bacteria | 1306 |
| 75 | Ga0068869_100006227 | 3300005334 | Bacteria | 7556 |
| 76 | Ga0068869_100167264 | 3300005334 | Bacteria | 1715 |
| 77 | Ga0068869_100187758 | 3300005334 | Bacteria | 1623 |
| 78 | Ga0070666_10084739 | 3300005335 | Bacteria | 2170 |
| 79 | Ga0070666_10489953 | 3300005335 | Unclassified | 890 |
| 80 | Ga0070666_10561459 | 3300005335 | Bacteria | 831 |
| 81 | Ga0070680_100006760 | 3300005336 | Bacteria | 8739 |
| 82 | Ga0070680_100016292 | 3300005336 | Bacteria | 5847 |
| 83 | Ga0070680_100046871 | 3300005336 | Bacteria | 3517 |
| 84 | Ga0070680_100182134 | 3300005336 | Bacteria | 1769 |
| 85 | Ga0070680_100213568 | 3300005336 | Bacteria | 1628 |
| 86 | Ga0070680_100251561 | 3300005336 | Bacteria | 1494 |
| 87 | Ga0070680_100473624 | 3300005336 | Bacteria | 1070 |
| 88 | Ga0070680_100561467 | 3300005336 | Bacteria | 979 |
| 89 | Ga0070680_101019242 | 3300005336 | Unclassified | 715 |
| 90 | Ga0070680_101323455 | 3300005336 | Bacteria | 624 |
| 91 | Ga0070682_100000275 | 3300005337 | Bacteria | 36886 |
| 92 | Ga0070682_100002639 | 3300005337 | Bacteria | 9906 |
| 93 | Ga0068868_100066722 | 3300005338 | Bacteria | 2862 |
| 94 | Ga0068868_100154703 | 3300005338 | Bacteria | 1890 |
| 95 | Ga0068868_100404258 | 3300005338 | Bacteria | 1179 |
| 96 | Ga0070660_100205577 | 3300005339 | Bacteria | 1598 |
| 97 | Ga0070660_100423221 | 3300005339 | Bacteria | 1103 |
| 98 | Ga0070660_100718842 | 3300005339 | Unclassified | 838 |
| 99 | Ga0070660_100748471 | 3300005339 | Bacteria | 821 |
| 100 | Ga0070689_100057246 | 3300005340 | Bacteria | 3025 |
| 101 | Ga0070689_100129319 | 3300005340 | Bacteria | 2024 |
| 102 | Ga0070689_100783143 | 3300005340 | Bacteria | 838 |
| 103 | Ga0070691_10013009 | 3300005341 | Bacteria | 3810 |
| 104 | Ga0070691_10227759 | 3300005341 | Bacteria | 991 |
| 105 | Ga0070691_10235550 | 3300005341 | Bacteria | 976 |
| 106 | Ga0070691_10782145 | 3300005341 | Bacteria | 580 |
| 107 | Ga0070687_100095487 | 3300005343 | Bacteria | 1653 |
| 108 | Ga0070687_100199314 | 3300005343 | Bacteria | 1212 |
| 109 | Ga0070661_100022554 | 3300005344 | Bacteria | 4507 |
| 110 | Ga0070661_100027604 | 3300005344 | Bacteria | 4089 |
| 111 | Ga0070661_100086675 | 3300005344 | Bacteria | 2315 |
| 112 | Ga0070661_100216428 | 3300005344 | Bacteria | 1468 |
| 113 | Ga0070692_10040375 | 3300005345 | Bacteria | 2386 |
| 114 | Ga0070668_100021730 | 3300005347 | Bacteria | 4848 |
| 115 | Ga0070668_100045342 | 3300005347 | Bacteria | 3374 |
| 116 | Ga0070668_100076225 | 3300005347 | Bacteria | 2619 |
| 117 | Ga0070668_100106143 | 3300005347 | Bacteria | 2231 |
| 118 | Ga0070668_100582769 | 3300005347 | Bacteria | 977 |
| 119 | Ga0070669_100014167 | 3300005353 | Bacteria | 5674 |
| 120 | Ga0070669_100156457 | 3300005353 | Bacteria | 1768 |
| 121 | Ga0070669_100162182 | 3300005353 | Bacteria | 1738 |
| 122 | Ga0070669_100277876 | 3300005353 | Bacteria | 1341 |
| 123 | Ga0070669_100308127 | 3300005353 | Bacteria | 1275 |
| 124 | Ga0070669_101660228 | 3300005353 | Bacteria | 557 |
| 125 | Ga0070675_100001662 | 3300005354 | Bacteria | 16436 |
| 126 | Ga0070675_100116171 | 3300005354 | Bacteria | 2269 |
| 127 | Ga0070675_100142732 | 3300005354 | Bacteria | 2048 |
| 128 | Ga0070675_100246948 | 3300005354 | Bacteria | 1561 |
| 129 | Ga0070675_100266424 | 3300005354 | Unclassified | 1502 |
| 130 | Ga0070675_100297251 | 3300005354 | Bacteria | 1422 |
| 131 | Ga0070671_100131468 | 3300005355 | Bacteria | 2108 |
| 132 | Ga0070671_100168965 | 3300005355 | Bacteria | 1849 |
| 133 | Ga0070671_100774132 | 3300005355 | Bacteria | 835 |
| 134 | Ga0070674_100231784 | 3300005356 | Bacteria | 1441 |
| 135 | Ga0070674_100792775 | 3300005356 | Bacteria | 817 |
| 136 | Ga0070674_100960724 | 3300005356 | Bacteria | 748 |
| 137 | Ga0070673_100118119 | 3300005364 | Bacteria | 2208 |
| 138 | Ga0070673_100189519 | 3300005364 | Bacteria | 1765 |
| 139 | Ga0070673_100207421 | 3300005364 | Bacteria | 1690 |
| 140 | Ga0070673_100216471 | 3300005364 | Bacteria | 1656 |
| 141 | Ga0070673_100292825 | 3300005364 | Bacteria | 1431 |
| 142 | Ga0070673_100295875 | 3300005364 | Bacteria | 1424 |
| 143 | Ga0070688_100004495 | 3300005365 | Bacteria | 7269 |
| 144 | Ga0070659_100045299 | 3300005366 | Bacteria | 3445 |
| 145 | Ga0070659_100259581 | 3300005366 | Bacteria | 1441 |
| 146 | Ga0070667_100054612 | 3300005367 | Bacteria | 3373 |
| 147 | Ga0070667_100067489 | 3300005367 | Unclassified | 3041 |
| 148 | Ga0070667_100287263 | 3300005367 | Bacteria | 1478 |
| 149 | Ga0070667_100316185 | 3300005367 | Bacteria | 1408 |
| 150 | Ga0070667_100637411 | 3300005367 | Unclassified | 983 |
| 151 | Ga0070709_10004433 | 3300005434 | Bacteria | 7573 |
| 152 | Ga0070713_100045324 | 3300005436 | Bacteria | 3603 |
| 153 | Ga0070713_101014870 | 3300005436 | Bacteria | 801 |
| 154 | Ga0070713_101396839 | 3300005436 | Bacteria | 679 |
| 155 | Ga0070710_10357910 | 3300005437 | Unclassified | 968 |
| 156 | Ga0070701_10070010 | 3300005438 | Unclassified | 1873 |
| 157 | Ga0070711_100222579 | 3300005439 | Bacteria | 1468 |
| 158 | Ga0070711_100931222 | 3300005439 | Bacteria | 743 |
| 159 | Ga0070708_100000052 | 3300005445 | Bacteria | 78944 |
| 160 | Ga0070708_100017280 | 3300005445 | Bacteria | 6012 |
| 161 | Ga0070708_101134503 | 3300005445 | Bacteria | 732 |
| 162 | Ga0070663_100507881 | 3300005455 | Bacteria | 1002 |
| 163 | Ga0070678_100137185 | 3300005456 | Bacteria | 1952 |
| 164 | Ga0070678_100300037 | 3300005456 | Bacteria | 1365 |
| 165 | Ga0070678_100779600 | 3300005456 | Bacteria | 867 |
| 166 | Ga0070662_100027228 | 3300005457 | Bacteria | 3965 |
| 167 | Ga0070662_100137636 | 3300005457 | Bacteria | 1889 |
| 168 | Ga0070662_100161194 | 3300005457 | Bacteria | 1754 |
| 169 | Ga0070662_100238195 | 3300005457 | Bacteria | 1458 |
| 170 | Ga0070681_10007180 | 3300005458 | Bacteria | 10853 |
| 171 | Ga0070681_10026256 | 3300005458 | Bacteria | 5854 |
| 172 | Ga0070681_10028042 | 3300005458 | Bacteria | 5660 |
| 173 | Ga0070681_10054797 | 3300005458 | Bacteria | 3973 |
| 174 | Ga0070681_10055681 | 3300005458 | Bacteria | 3937 |
| 175 | Ga0070681_10135556 | 3300005458 | Bacteria | 2393 |
| 176 | Ga0070681_10298269 | 3300005458 | Unclassified | 1522 |
| 177 | Ga0068867_100023307 | 3300005459 | Bacteria | 4432 |
| 178 | Ga0068867_100141930 | 3300005459 | Bacteria | 1878 |
| 179 | Ga0068867_100292903 | 3300005459 | Bacteria | 1339 |
| 180 | Ga0070685_10033578 | 3300005466 | Bacteria | 2884 |
| 181 | Ga0070685_10109256 | 3300005466 | Bacteria | 1701 |
| 182 | Ga0070685_10167664 | 3300005466 | Bacteria | 1405 |
| 183 | Ga0070685_10850856 | 3300005466 | Bacteria | 676 |
| 184 | Ga0070706_100031470 | 3300005467 | Bacteria | 4892 |
| 185 | Ga0070706_100045503 | 3300005467 | Bacteria | 4054 |
| 186 | Ga0070706_100116838 | 3300005467 | Bacteria | 2485 |
| 187 | Ga0070706_100488462 | 3300005467 | Bacteria | 1146 |
| 188 | Ga0070707_100000643 | 3300005468 | Bacteria | 34864 |
| 189 | Ga0070707_100103516 | 3300005468 | Bacteria | 2759 |
| 190 | Ga0070698_100006166 | 3300005471 | Bacteria | 13057 |
| 191 | Ga0070698_100104207 | 3300005471 | Bacteria | 2806 |
| 192 | Ga0070698_100893206 | 3300005471 | Bacteria | 834 |
| 193 | Ga0070699_100142924 | 3300005518 | Bacteria | 2114 |
| 194 | Ga0070699_100295801 | 3300005518 | Bacteria | 1452 |
| 195 | Ga0070699_100406117 | 3300005518 | Bacteria | 1232 |
| 196 | Ga0070679_100000771 | 3300005530 | Bacteria | 27790 |
| 197 | Ga0070679_100005023 | 3300005530 | Bacteria | 12209 |
| 198 | Ga0070679_100082272 | 3300005530 | Bacteria | 3209 |
| 199 | Ga0070679_100087543 | 3300005530 | Bacteria | 3102 |
| 200 | Ga0070679_100121391 | 3300005530 | Bacteria | 2598 |
| 201 | Ga0070679_100253998 | 3300005530 | Bacteria | 1714 |
| 202 | Ga0070679_100484767 | 3300005530 | Bacteria | 1181 |
| 203 | Ga0070679_100918881 | 3300005530 | Bacteria | 819 |
| 204 | Ga0070679_100949180 | 3300005530 | Unclassified | 804 |
| 205 | Ga0070684_100004296 | 3300005535 | Bacteria | 10813 |
| 206 | Ga0070684_100006014 | 3300005535 | Bacteria | 9347 |
| 207 | Ga0070684_100015882 | 3300005535 | Bacteria | 6145 |
| 208 | Ga0070684_100033315 | 3300005535 | Bacteria | 4398 |
| 209 | Ga0070684_100112014 | 3300005535 | Bacteria | 2448 |
| 210 | Ga0070684_100178147 | 3300005535 | Bacteria | 1932 |
| 211 | Ga0070684_100693986 | 3300005535 | Bacteria | 949 |
| 212 | Ga0070684_100733610 | 3300005535 | Bacteria | 922 |
| 213 | Ga0070684_101458084 | 3300005535 | Bacteria | 645 |
| 214 | Ga0070697_100213740 | 3300005536 | Bacteria | 1642 |
| 215 | Ga0068853_100417091 | 3300005539 | Bacteria | 1258 |
| 216 | Ga0070672_100035408 | 3300005543 | Bacteria | 3795 |
| 217 | Ga0070672_100083137 | 3300005543 | Bacteria | 2569 |
| 218 | Ga0070672_100188977 | 3300005543 | Bacteria | 1719 |
| 219 | Ga0070672_100275162 | 3300005543 | Bacteria | 1422 |
| 220 | Ga0070686_100031501 | 3300005544 | Bacteria | 3243 |
| 221 | Ga0070695_100128172 | 3300005545 | Bacteria | 1746 |
| 222 | Ga0070695_100217178 | 3300005545 | Bacteria | 1376 |
| 223 | Ga0070696_100000641 | 3300005546 | Bacteria | 22352 |
| 224 | Ga0070696_100021816 | 3300005546 | Bacteria | 4344 |
| 225 | Ga0070696_100239800 | 3300005546 | Bacteria | 1367 |
| 226 | Ga0070693_100001153 | 3300005547 | Bacteria | 11862 |
| 227 | Ga0070693_100026362 | 3300005547 | Bacteria | 3137 |
| 228 | Ga0070693_100149541 | 3300005547 | Bacteria | 1478 |
| 229 | Ga0070665_100141300 | 3300005548 | Bacteria | 2411 |
| 230 | Ga0070665_100354768 | 3300005548 | Unclassified | 1472 |
| 231 | Ga0070665_100504064 | 3300005548 | Bacteria | 1222 |
| 232 | Ga0068855_100114484 | 3300005563 | Bacteria | 3092 |
| 233 | Ga0068855_100128332 | 3300005563 | Bacteria | 2898 |
| 234 | Ga0068855_100233362 | 3300005563 | Bacteria | 2059 |
| 235 | Ga0070664_100016606 | 3300005564 | Bacteria | 6039 |
| 236 | Ga0070664_100016816 | 3300005564 | Bacteria | 6004 |
| 237 | Ga0070664_100056972 | 3300005564 | Bacteria | 3321 |
| 238 | Ga0070664_100081410 | 3300005564 | Bacteria | 2790 |
| 239 | Ga0070664_100215244 | 3300005564 | Bacteria | 1717 |
| 240 | Ga0070664_100379717 | 3300005564 | Bacteria | 1290 |
| 241 | Ga0070664_100436393 | 3300005564 | Bacteria | 1201 |
| 242 | Ga0070664_101442531 | 3300005564 | Bacteria | 651 |
| 243 | Ga0068857_100004677 | 3300005577 | Bacteria | 11598 |
| 244 | Ga0068857_100009564 | 3300005577 | Bacteria | 8419 |
| 245 | Ga0068857_100022826 | 3300005577 | Bacteria | 5505 |
| 246 | Ga0068857_100094341 | 3300005577 | Bacteria | 2679 |
| 247 | Ga0068857_102098703 | 3300005577 | Unclassified | 554 |
| 248 | Ga0068854_100747947 | 3300005578 | Bacteria | 848 |
| 249 | Ga0068854_101411342 | 3300005578 | Bacteria | 630 |
| 250 | Ga0068856_100037691 | 3300005614 | Bacteria | 4744 |
| 251 | Ga0068856_100092780 | 3300005614 | Bacteria | 3005 |
| 252 | Ga0068856_100742533 | 3300005614 | Bacteria | 1001 |
| 253 | Ga0070702_100006432 | 3300005615 | Bacteria | 5558 |
| 254 | Ga0070702_100246896 | 3300005615 | Bacteria | 1208 |
| 255 | Ga0070702_100258889 | 3300005615 | Bacteria | 1184 |
| 256 | Ga0070702_100285054 | 3300005615 | Bacteria | 1136 |
| 257 | Ga0068852_100215707 | 3300005616 | Bacteria | 1823 |
| 258 | Ga0068852_100228468 | 3300005616 | Bacteria | 1773 |
| 259 | Ga0068852_100347488 | 3300005616 | Bacteria | 1447 |
| 260 | Ga0068859_100088363 | 3300005617 | Bacteria | 3148 |
| 261 | Ga0068859_100112215 | 3300005617 | Bacteria | 2789 |
| 262 | Ga0068864_100024854 | 3300005618 | Bacteria | 5039 |
| 263 | Ga0068864_100137544 | 3300005618 | Bacteria | 2201 |
| 264 | Ga0068864_100231053 | 3300005618 | Bacteria | 1711 |
| 265 | Ga0068864_100684623 | 3300005618 | Bacteria | 1000 |
| 266 | Ga0068864_100715651 | 3300005618 | Bacteria | 979 |
| 267 | Ga0068864_101006439 | 3300005618 | Bacteria | 827 |
| 268 | Ga0068866_10094671 | 3300005718 | Bacteria | 1634 |
| 269 | Ga0068866_10104228 | 3300005718 | Unclassified | 1571 |
| 270 | Ga0068866_10696026 | 3300005718 | Bacteria | 697 |
| 271 | Ga0068861_100985368 | 3300005719 | Unclassified | 804 |
| 272 | Ga0068870_10012644 | 3300005840 | Bacteria | 3948 |
| 273 | Ga0068870_10020135 | 3300005840 | Bacteria | 3244 |
| 274 | Ga0068870_10119928 | 3300005840 | Bacteria | 1514 |
| 275 | Ga0068863_100029136 | 3300005841 | Bacteria | 5271 |
| 276 | Ga0068863_100069225 | 3300005841 | Bacteria | 3337 |
| 277 | Ga0068858_100147199 | 3300005842 | Bacteria | 2212 |
| 278 | Ga0068858_100192377 | 3300005842 | Bacteria | 1928 |
| 279 | Ga0068858_100231828 | 3300005842 | Bacteria | 1751 |
| 280 | Ga0068858_101271932 | 3300005842 | Bacteria | 724 |
| 281 | Ga0068860_100021657 | 3300005843 | Bacteria | 6223 |
| 282 | Ga0068860_100117268 | 3300005843 | Bacteria | 2547 |
| 283 | Ga0068860_100321849 | 3300005843 | Bacteria | 1518 |
| 284 | Ga0068860_100954314 | 3300005843 | Bacteria | 875 |
| 285 | Ga0068862_100423028 | 3300005844 | Bacteria | 1250 |
| 286 | Ga0068862_100581222 | 3300005844 | Bacteria | 1073 |
| 287 | Ga0068862_100660953 | 3300005844 | Bacteria | 1009 |
| 288 | Ga0070712_100743287 | 3300006175 | Bacteria | 839 |
| 289 | Ga0097621_100010975 | 3300006237 | Bacteria | 6653 |
| 290 | Ga0097621_100418306 | 3300006237 | Unclassified | 1202 |
| 291 | Ga0097621_100518440 | 3300006237 | Unclassified | 1082 |
| 292 | Ga0068871_100284792 | 3300006358 | Bacteria | 1446 |
| 293 | Ga0068871_100498274 | 3300006358 | Unclassified | 1097 |
| 294 | Ga0075430_100026576 | 3300006846 | Bacteria | 4922 |
| 295 | Ga0075431_100022910 | 3300006847 | Bacteria | 6383 |
| 296 | Ga0075431_100903771 | 3300006847 | Bacteria | 852 |
| 297 | Ga0075429_100155646 | 3300006880 | Bacteria | 2001 |
| 298 | Ga0075429_100303956 | 3300006880 | Bacteria | 1397 |
| 299 | Ga0075429_101074913 | 3300006880 | Bacteria | 703 |
| 300 | Ga0068865_100005638 | 3300006881 | Bacteria | 7598 |
| 301 | Ga0097620_100088359 | 3300006931 | Bacteria | 3148 |
| 302 | Ga0097620_100112208 | 3300006931 | Bacteria | 2789 |
| 303 | Ga0075435_100307287 | 3300007076 | Unclassified | 1357 |
| 304 | Ga0105244_10309066 | 3300009036 | Bacteria | 731 |
| 305 | Ga0105240_10062939 | 3300009093 | Bacteria | 4617 |
| 306 | Ga0105240_10640993 | 3300009093 | Bacteria | 1166 |
| 307 | Ga0111539_10187731 | 3300009094 | Bacteria | 2413 |
| 308 | Ga0111539_10233831 | 3300009094 | Bacteria | 2140 |
| 309 | Ga0111539_13044491 | 3300009094 | Bacteria | 541 |
| 310 | Ga0105245_10101021 | 3300009098 | Bacteria | 2669 |
| 311 | Ga0105245_10231568 | 3300009098 | Unclassified | 1787 |
| 312 | Ga0105245_10304012 | 3300009098 | Bacteria | 1566 |
| 313 | Ga0105245_10340875 | 3300009098 | Bacteria | 1482 |
| 314 | Ga0105247_10362961 | 3300009101 | Bacteria | 1022 |
| 315 | Ga0105247_10828089 | 3300009101 | Bacteria | 708 |
| 316 | Ga0105243_10051387 | 3300009148 | Bacteria | 3260 |
| 317 | Ga0105243_10705426 | 3300009148 | Bacteria | 984 |
| 318 | Ga0105243_10766648 | 3300009148 | Bacteria | 947 |
| 319 | Ga0105243_10773134 | 3300009148 | Bacteria | 944 |
| 320 | Ga0105241_10008171 | 3300009174 | Bacteria | 7705 |
| 321 | Ga0105241_10141303 | 3300009174 | Bacteria | 1961 |
| 322 | Ga0105242_10101363 | 3300009176 | Bacteria | 2440 |
| 323 | Ga0105242_10489620 | 3300009176 | Bacteria | 1167 |
| 324 | Ga0105242_10924669 | 3300009176 | Bacteria | 874 |
| 325 | Ga0105242_11741771 | 3300009176 | Bacteria | 660 |
| 326 | Ga0105242_13249191 | 3300009176 | Unclassified | 505 |
| 327 | Ga0105248_10101948 | 3300009177 | Bacteria | 3235 |
| 328 | Ga0105248_10325266 | 3300009177 | Bacteria | 1732 |
| 329 | Ga0105248_10408669 | 3300009177 | Bacteria | 1528 |
| 330 | Ga0105237_10197173 | 3300009545 | Bacteria | 2013 |
| 331 | Ga0105237_10320891 | 3300009545 | Bacteria | 1552 |
| 332 | Ga0105237_10445491 | 3300009545 | Bacteria | 1301 |
| 333 | Ga0105237_10553013 | 3300009545 | Bacteria | 1157 |
| 334 | Ga0105237_11487973 | 3300009545 | Bacteria | 684 |
| 335 | Ga0105237_11764798 | 3300009545 | Unclassified | 626 |
| 336 | Ga0105238_10069130 | 3300009551 | Bacteria | 3532 |
| 337 | Ga0105238_10173727 | 3300009551 | Bacteria | 2131 |
| 338 | Ga0105238_10493845 | 3300009551 | Bacteria | 1224 |
| 339 | Ga0105238_10589861 | 3300009551 | Bacteria | 1118 |
| 340 | Ga0105238_10895881 | 3300009551 | Bacteria | 905 |
| 341 | Ga0105249_10000089 | 3300009553 | Bacteria | 131175 |
| 342 | Ga0105249_10130805 | 3300009553 | Bacteria | 2396 |
| 343 | Ga0105249_10175344 | 3300009553 | Bacteria | 2082 |
| 344 | Ga0105249_10837042 | 3300009553 | Bacteria | 985 |
| 345 | Ga0105249_12911401 | 3300009553 | Bacteria | 549 |
| 346 | Ga0105239_10025248 | 3300010375 | Bacteria | 6544 |
| 347 | Ga0105239_10427565 | 3300010375 | Bacteria | 1501 |
| 348 | Ga0105246_10001421 | 3300011119 | Bacteria | 14186 |
| 349 | Ga0105246_10638675 | 3300011119 | Bacteria | 925 |
| 350 | Ga0157325_1029447 | 3300012485 | Bacteria | 542 |
| 351 | Ga0157373_10135434 | 3300013100 | Bacteria | 1732 |
| 352 | Ga0157373_10338204 | 3300013100 | Bacteria | 1072 |
| 353 | Ga0157373_10365855 | 3300013100 | Bacteria | 1030 |
| 354 | Ga0157371_10018782 | 3300013102 | Bacteria | 5108 |
| 355 | Ga0157371_10066051 | 3300013102 | Bacteria | 2562 |
| 356 | Ga0157371_11588181 | 3300013102 | Bacteria | 512 |
| 357 | Ga0157370_10007324 | 3300013104 | Bacteria | 12042 |
| 358 | Ga0157370_10310553 | 3300013104 | Bacteria | 1455 |
| 359 | Ga0157370_10311764 | 3300013104 | Bacteria | 1452 |
| 360 | Ga0157370_10389222 | 3300013104 | Bacteria | 1284 |
| 361 | Ga0157370_11949586 | 3300013104 | Bacteria | 527 |
| 362 | Ga0157369_10049701 | 3300013105 | Bacteria | 4545 |
| 363 | Ga0157369_10059499 | 3300013105 | Bacteria | 4120 |
| 364 | Ga0157369_10914683 | 3300013105 | Unclassified | 899 |
| 365 | Ga0157369_10969548 | 3300013105 | Bacteria | 871 |
| 366 | Ga0157374_10251765 | 3300013296 | Bacteria | 1738 |
| 367 | Ga0157374_10422228 | 3300013296 | Bacteria | 1332 |
| 368 | Ga0157374_10827102 | 3300013296 | Unclassified | 942 |
| 369 | Ga0157374_11752178 | 3300013296 | Unclassified | 646 |
| 370 | Ga0157378_10040562 | 3300013297 | Bacteria | 4128 |
| 371 | Ga0157378_10135032 | 3300013297 | Bacteria | 2287 |
| 372 | Ga0157378_10171220 | 3300013297 | Bacteria | 2036 |
| 373 | Ga0157378_10367449 | 3300013297 | Bacteria | 1409 |
| 374 | Ga0157378_10608509 | 3300013297 | Bacteria | 1105 |
| 375 | Ga0163162_10025211 | 3300013306 | Bacteria | 5876 |
| 376 | Ga0163162_10041886 | 3300013306 | Bacteria | 4582 |
| 377 | Ga0163162_10199142 | 3300013306 | Bacteria | 2131 |
| 378 | Ga0163162_10397847 | 3300013306 | Bacteria | 1510 |
| 379 | Ga0163162_10894075 | 3300013306 | Bacteria | 1002 |
| 380 | Ga0163162_11788542 | 3300013306 | Bacteria | 702 |
| 381 | Ga0163162_13401403 | 3300013306 | Unclassified | 508 |
| 382 | Ga0157372_10009653 | 3300013307 | Bacteria | 10257 |
| 383 | Ga0157372_10057854 | 3300013307 | Bacteria | 4334 |
| 384 | Ga0157372_10194884 | 3300013307 | Bacteria | 2347 |
| 385 | Ga0157372_10214535 | 3300013307 | Bacteria | 2230 |
| 386 | Ga0157372_10405406 | 3300013307 | Bacteria | 1589 |
| 387 | Ga0157372_10809219 | 3300013307 | Bacteria | 1088 |
| 388 | Ga0157372_10918018 | 3300013307 | Bacteria | 1015 |
| 389 | Ga0157372_11309762 | 3300013307 | Bacteria | 836 |
| 390 | Ga0157372_12338893 | 3300013307 | Bacteria | 614 |
| 391 | Ga0157375_10012517 | 3300013308 | Bacteria | 7529 |
| 392 | Ga0157375_10016467 | 3300013308 | Bacteria | 6644 |
| 393 | Ga0157375_10077385 | 3300013308 | Bacteria | 3356 |
| 394 | Ga0157375_10090441 | 3300013308 | Bacteria | 3119 |
| 395 | Ga0157375_10700923 | 3300013308 | Bacteria | 1166 |
| 396 | Ga0157375_10735713 | 3300013308 | Bacteria | 1138 |
| 397 | Ga0157375_10792836 | 3300013308 | Bacteria | 1096 |
| 398 | Ga0163163_10458713 | 3300014325 | Bacteria | 1335 |
| 399 | Ga0163163_10514615 | 3300014325 | Bacteria | 1259 |
| 400 | Ga0163163_10754234 | 3300014325 | Bacteria | 1037 |
| 401 | Ga0157380_10177783 | 3300014326 | Bacteria | 1867 |
| 402 | Ga0157377_10006216 | 3300014745 | Bacteria | 5680 |
| 403 | Ga0157377_10286177 | 3300014745 | Bacteria | 1082 |
| 404 | Ga0157377_10654553 | 3300014745 | Bacteria | 757 |
| 405 | Ga0157379_10208245 | 3300014968 | Bacteria | 1769 |
| 406 | Ga0157379_10214043 | 3300014968 | Bacteria | 1745 |
| 407 | Ga0157379_10692149 | 3300014968 | Bacteria | 956 |
| 408 | Ga0157376_10060490 | 3300014969 | Bacteria | 3181 |
| 409 | Ga0157376_10328044 | 3300014969 | Bacteria | 1457 |
| 410 | Ga0157376_10386634 | 3300014969 | Bacteria | 1349 |
| 411 | Ga0157376_10993582 | 3300014969 | Bacteria | 861 |
| 412 | Ga0182007_10196697 | 3300015262 | Bacteria | 703 |
| 413 | Ga0163161_10106798 | 3300017792 | Bacteria | 2089 |
| 414 | Ga0163161_10174469 | 3300017792 | Bacteria | 1645 |
| 415 | Ga0163161_10526949 | 3300017792 | Bacteria | 965 |
| 416 | Ga0197907_11487050 | 3300020069 | Bacteria | 728 |
| 417 | Ga0206356_10071443 | 3300020070 | Bacteria | 2469 |
| 418 | Ga0206349_1665041 | 3300020075 | Bacteria | 733 |
| 419 | Ga0206352_10170617 | 3300020078 | Bacteria | 1605 |
| 420 | Ga0206352_11132655 | 3300020078 | Bacteria | 937 |
| 421 | Ga0206353_11117605 | 3300020082 | Bacteria | 889 |
| 422 | Ga0206353_11922409 | 3300020082 | Bacteria | 1234 |
| 423 | Ga0213876_10083965 | 3300021384 | Bacteria | 1685 |
| 424 | Ga0224712_10206475 | 3300022467 | Bacteria | 894 |
| 425 | Ga0224712_10489652 | 3300022467 | Bacteria | 593 |
| 426 | Ga0207697_10206478 | 3300025315 | Bacteria | 865 |
| 427 | Ga0207656_10025013 | 3300025321 | Bacteria | 2421 |
| 428 | Ga0207682_10106266 | 3300025893 | Bacteria | 1232 |
| 429 | Ga0207682_10165341 | 3300025893 | Bacteria | 1005 |
| 430 | Ga0207692_10264035 | 3300025898 | Unclassified | 1036 |
| 431 | Ga0207642_10037832 | 3300025899 | Bacteria | 2082 |
| 432 | Ga0207688_10087613 | 3300025901 | Bacteria | 1785 |
| 433 | Ga0207680_10110282 | 3300025903 | Bacteria | 1783 |
| 434 | Ga0207680_10538310 | 3300025903 | Bacteria | 833 |
| 435 | Ga0207699_10031799 | 3300025906 | Bacteria | 2967 |
| 436 | Ga0207645_10003859 | 3300025907 | Bacteria | 11218 |
| 437 | Ga0207645_10004100 | 3300025907 | Bacteria | 10844 |
| 438 | Ga0207645_10111453 | 3300025907 | Bacteria | 1772 |
| 439 | Ga0207645_10505950 | 3300025907 | Bacteria | 818 |
| 440 | Ga0207643_10024386 | 3300025908 | Bacteria | 3338 |
| 441 | Ga0207705_10054893 | 3300025909 | Bacteria | 2871 |
| 442 | Ga0207705_10090089 | 3300025909 | Bacteria | 2245 |
| 443 | Ga0207705_10114841 | 3300025909 | Bacteria | 1992 |
| 444 | Ga0207705_10224468 | 3300025909 | Bacteria | 1428 |
| 445 | Ga0207705_10799216 | 3300025909 | Bacteria | 732 |
| 446 | Ga0207684_10027668 | 3300025910 | Bacteria | 4829 |
| 447 | Ga0207684_10524582 | 3300025910 | Bacteria | 1014 |
| 448 | Ga0207684_10725513 | 3300025910 | Bacteria | 843 |
| 449 | Ga0207654_10057461 | 3300025911 | Bacteria | 2261 |
| 450 | Ga0207707_10006540 | 3300025912 | Bacteria | 10171 |
| 451 | Ga0207707_10009547 | 3300025912 | Bacteria | 8417 |
| 452 | Ga0207707_10011937 | 3300025912 | Bacteria | 7558 |
| 453 | Ga0207707_10107250 | 3300025912 | Bacteria | 2442 |
| 454 | Ga0207707_10119834 | 3300025912 | Bacteria | 2300 |
| 455 | Ga0207707_10847738 | 3300025912 | Bacteria | 758 |
| 456 | Ga0207695_10012644 | 3300025913 | Bacteria | 10111 |
| 457 | Ga0207671_10479321 | 3300025914 | Bacteria | 991 |
| 458 | Ga0207671_10871903 | 3300025914 | Bacteria | 712 |
| 459 | Ga0207693_11133062 | 3300025915 | Bacteria | 593 |
| 460 | Ga0207663_10036893 | 3300025916 | Bacteria | 2943 |
| 461 | Ga0207663_10038395 | 3300025916 | Bacteria | 2894 |
| 462 | Ga0207663_10355872 | 3300025916 | Bacteria | 1109 |
| 463 | Ga0207660_10000818 | 3300025917 | Bacteria | 20531 |
| 464 | Ga0207660_10008227 | 3300025917 | Bacteria | 6749 |
| 465 | Ga0207660_10009120 | 3300025917 | Bacteria | 6424 |
| 466 | Ga0207660_10052123 | 3300025917 | Bacteria | 2912 |
| 467 | Ga0207660_10140041 | 3300025917 | Bacteria | 1849 |
| 468 | Ga0207660_10521181 | 3300025917 | Unclassified | 965 |
| 469 | Ga0207660_10897041 | 3300025917 | Bacteria | 723 |
| 470 | Ga0207660_10998494 | 3300025917 | Unclassified | 683 |
| 471 | Ga0207660_11050119 | 3300025917 | Bacteria | 664 |
| 472 | Ga0207662_10001709 | 3300025918 | Bacteria | 10752 |
| 473 | Ga0207662_10015019 | 3300025918 | Bacteria | 4351 |
| 474 | Ga0207662_10146004 | 3300025918 | Bacteria | 1501 |
| 475 | Ga0207657_10041175 | 3300025919 | Bacteria | 4086 |
| 476 | Ga0207657_10062737 | 3300025919 | Bacteria | 3180 |
| 477 | Ga0207657_10126471 | 3300025919 | Bacteria | 2099 |
| 478 | Ga0207649_10034288 | 3300025920 | Bacteria | 3040 |
| 479 | Ga0207649_10112676 | 3300025920 | Bacteria | 1820 |
| 480 | Ga0207649_10314641 | 3300025920 | Bacteria | 1148 |
| 481 | Ga0207649_10880002 | 3300025920 | Unclassified | 702 |
| 482 | Ga0207649_11085095 | 3300025920 | Bacteria | 631 |
| 483 | Ga0207652_10003240 | 3300025921 | Bacteria | 13498 |
| 484 | Ga0207652_10013086 | 3300025921 | Bacteria | 6716 |
| 485 | Ga0207652_10055753 | 3300025921 | Bacteria | 3400 |
| 486 | Ga0207652_10070046 | 3300025921 | Bacteria | 3045 |
| 487 | Ga0207652_10175589 | 3300025921 | Bacteria | 1924 |
| 488 | Ga0207652_10199467 | 3300025921 | Bacteria | 1801 |
| 489 | Ga0207652_10380513 | 3300025921 | Bacteria | 1274 |
| 490 | Ga0207652_10585521 | 3300025921 | Bacteria | 1001 |
| 491 | Ga0207652_11421292 | 3300025921 | Unclassified | 597 |
| 492 | Ga0207646_10004321 | 3300025922 | Bacteria | 15503 |
| 493 | Ga0207646_10286877 | 3300025922 | Bacteria | 1487 |
| 494 | Ga0207646_10370362 | 3300025922 | Bacteria | 1294 |
| 495 | Ga0207681_10004359 | 3300025923 | Bacteria | 8728 |
| 496 | Ga0207681_10078694 | 3300025923 | Bacteria | 2321 |
| 497 | Ga0207694_11462461 | 3300025924 | Bacteria | 577 |
| 498 | Ga0207650_10002341 | 3300025925 | Bacteria | 13193 |
| 499 | Ga0207650_10049790 | 3300025925 | Bacteria | 3095 |
| 500 | Ga0207650_10626529 | 3300025925 | Unclassified | 906 |
| 501 | Ga0207650_11376636 | 3300025925 | Unclassified | 600 |
| 502 | Ga0207659_10005988 | 3300025926 | Bacteria | 7419 |
| 503 | Ga0207659_10027390 | 3300025926 | Bacteria | 3858 |
| 504 | Ga0207659_10219174 | 3300025926 | Bacteria | 1529 |
| 505 | Ga0207659_10421588 | 3300025926 | Bacteria | 1119 |
| 506 | Ga0207687_10021571 | 3300025927 | Bacteria | 4280 |
| 507 | Ga0207687_10166331 | 3300025927 | Bacteria | 1697 |
| 508 | Ga0207700_10024941 | 3300025928 | Bacteria | 4145 |
| 509 | Ga0207664_10737295 | 3300025929 | Bacteria | 886 |
| 510 | Ga0207644_10238659 | 3300025931 | Bacteria | 1446 |
| 511 | Ga0207644_10838691 | 3300025931 | Bacteria | 769 |
| 512 | Ga0207690_10008263 | 3300025932 | Bacteria | 6173 |
| 513 | Ga0207690_10036856 | 3300025932 | Bacteria | 3170 |
| 514 | Ga0207690_10071868 | 3300025932 | Bacteria | 2388 |
| 515 | Ga0207706_10027416 | 3300025933 | Bacteria | 5093 |
| 516 | Ga0207706_10103141 | 3300025933 | Bacteria | 2509 |
| 517 | Ga0207706_10110685 | 3300025933 | Bacteria | 2416 |
| 518 | Ga0207706_10453325 | 3300025933 | Bacteria | 1109 |
| 519 | Ga0207686_10021294 | 3300025934 | Bacteria | 3719 |
| 520 | Ga0207686_10142532 | 3300025934 | Bacteria | 1658 |
| 521 | Ga0207686_10638804 | 3300025934 | Bacteria | 841 |
| 522 | Ga0207670_10038897 | 3300025936 | Bacteria | 3110 |
| 523 | Ga0207670_10131140 | 3300025936 | Bacteria | 1836 |
| 524 | Ga0207704_10007324 | 3300025938 | Bacteria | 5206 |
| 525 | Ga0207704_10050315 | 3300025938 | Bacteria | 2513 |
| 526 | Ga0207704_10136439 | 3300025938 | Bacteria | 1708 |
| 527 | Ga0207691_10036983 | 3300025940 | Bacteria | 4522 |
| 528 | Ga0207691_10054622 | 3300025940 | Bacteria | 3643 |
| 529 | Ga0207691_10300556 | 3300025940 | Bacteria | 1379 |
| 530 | Ga0207691_10330784 | 3300025940 | Bacteria | 1305 |
| 531 | Ga0207691_10844276 | 3300025940 | Bacteria | 768 |
| 532 | Ga0207691_11654504 | 3300025940 | Bacteria | 519 |
| 533 | Ga0207711_10140777 | 3300025941 | Bacteria | 2170 |
| 534 | Ga0207711_10153499 | 3300025941 | Unclassified | 2079 |
| 535 | Ga0207711_10250156 | 3300025941 | Bacteria | 1627 |
| 536 | Ga0207689_10002618 | 3300025942 | Bacteria | 16653 |
| 537 | Ga0207689_10077332 | 3300025942 | Bacteria | 2736 |
| 538 | Ga0207689_10163820 | 3300025942 | Bacteria | 1832 |
| 539 | Ga0207689_10633336 | 3300025942 | Bacteria | 900 |
| 540 | Ga0207661_10000873 | 3300025944 | Bacteria | 19816 |
| 541 | Ga0207661_10003817 | 3300025944 | Bacteria | 10503 |
| 542 | Ga0207661_10047755 | 3300025944 | Bacteria | 3400 |
| 543 | Ga0207661_10063636 | 3300025944 | Bacteria | 2988 |
| 544 | Ga0207661_10068651 | 3300025944 | Bacteria | 2887 |
| 545 | Ga0207661_10101431 | 3300025944 | Bacteria | 2418 |
| 546 | Ga0207661_10111017 | 3300025944 | Bacteria | 2319 |
| 547 | Ga0207661_10135219 | 3300025944 | Bacteria | 2116 |
| 548 | Ga0207661_10210766 | 3300025944 | Bacteria | 1712 |
| 549 | Ga0207661_10216907 | 3300025944 | Bacteria | 1689 |
| 550 | Ga0207661_10401775 | 3300025944 | Bacteria | 1242 |
| 551 | Ga0207661_11139976 | 3300025944 | Bacteria | 718 |
| 552 | Ga0207679_10001825 | 3300025945 | Bacteria | 13268 |
| 553 | Ga0207679_10010401 | 3300025945 | Bacteria | 5989 |
| 554 | Ga0207679_10095638 | 3300025945 | Bacteria | 2309 |
| 555 | Ga0207679_10162540 | 3300025945 | Bacteria | 1829 |
| 556 | Ga0207679_10264993 | 3300025945 | Bacteria | 1467 |
| 557 | Ga0207679_10552027 | 3300025945 | Bacteria | 1034 |
| 558 | Ga0207679_10571381 | 3300025945 | Bacteria | 1016 |
| 559 | Ga0207667_10058152 | 3300025949 | Bacteria | 4057 |
| 560 | Ga0207667_10117398 | 3300025949 | Bacteria | 2742 |
| 561 | Ga0207651_10076222 | 3300025960 | Bacteria | 2396 |
| 562 | Ga0207651_10135290 | 3300025960 | Bacteria | 1894 |
| 563 | Ga0207651_10380178 | 3300025960 | Bacteria | 1196 |
| 564 | Ga0207651_10533315 | 3300025960 | Bacteria | 1019 |
| 565 | Ga0207712_10000181 | 3300025961 | Bacteria | 65253 |
| 566 | Ga0207712_10229074 | 3300025961 | Bacteria | 1490 |
| 567 | Ga0207712_10430976 | 3300025961 | Bacteria | 1114 |
| 568 | Ga0207668_10015561 | 3300025972 | Bacteria | 4728 |
| 569 | Ga0207668_10033958 | 3300025972 | Bacteria | 3383 |
| 570 | Ga0207668_10529546 | 3300025972 | Unclassified | 1018 |
| 571 | Ga0207668_10828199 | 3300025972 | Bacteria | 820 |
| 572 | Ga0207668_11065834 | 3300025972 | Bacteria | 724 |
| 573 | Ga0207640_10450020 | 3300025981 | Unclassified | 1061 |
| 574 | Ga0207640_10505222 | 3300025981 | Bacteria | 1007 |
| 575 | Ga0207640_10708745 | 3300025981 | Bacteria | 864 |
| 576 | Ga0207658_10166681 | 3300025986 | Bacteria | 1810 |
| 577 | Ga0207658_10333550 | 3300025986 | Bacteria | 1316 |
| 578 | Ga0207658_10350463 | 3300025986 | Bacteria | 1285 |
| 579 | Ga0207658_11065008 | 3300025986 | Bacteria | 738 |
| 580 | Ga0207677_10009848 | 3300026023 | Bacteria | 5387 |
| 581 | Ga0207677_10327605 | 3300026023 | Bacteria | 1275 |
| 582 | Ga0207677_10662902 | 3300026023 | Bacteria | 922 |
| 583 | Ga0207703_10067549 | 3300026035 | Bacteria | 2942 |
| 584 | Ga0207703_10068730 | 3300026035 | Bacteria | 2919 |
| 585 | Ga0207639_10180597 | 3300026041 | Bacteria | 1795 |
| 586 | Ga0207639_10227883 | 3300026041 | Bacteria | 1613 |
| 587 | Ga0207639_11148082 | 3300026041 | Unclassified | 729 |
| 588 | Ga0207678_10151545 | 3300026067 | Bacteria | 1980 |
| 589 | Ga0207708_10046969 | 3300026075 | Bacteria | 3288 |
| 590 | Ga0207708_10277693 | 3300026075 | Bacteria | 1357 |
| 591 | Ga0207702_10228532 | 3300026078 | Bacteria | 1738 |
| 592 | Ga0207702_10265467 | 3300026078 | Bacteria | 1617 |
| 593 | Ga0207641_10043525 | 3300026088 | Bacteria | 3771 |
| 594 | Ga0207648_10007649 | 3300026089 | Bacteria | 10578 |
| 595 | Ga0207648_10101436 | 3300026089 | Bacteria | 2522 |
| 596 | Ga0207648_10235651 | 3300026089 | Bacteria | 1629 |
| 597 | Ga0207648_10290183 | 3300026089 | Bacteria | 1465 |
| 598 | Ga0207648_10733541 | 3300026089 | Bacteria | 917 |
| 599 | Ga0207676_10016488 | 3300026095 | Bacteria | 5350 |
| 600 | Ga0207676_10178562 | 3300026095 | Bacteria | 1857 |
| 601 | Ga0207676_10687474 | 3300026095 | Bacteria | 990 |
| 602 | Ga0207674_10002535 | 3300026116 | Bacteria | 23011 |
| 603 | Ga0207674_10012973 | 3300026116 | Bacteria | 9291 |
| 604 | Ga0207674_10026110 | 3300026116 | Bacteria | 6213 |
| 605 | Ga0207674_10026159 | 3300026116 | Bacteria | 6207 |
| 606 | Ga0207674_10494805 | 3300026116 | Bacteria | 1181 |
| 607 | Ga0207674_11127752 | 3300026116 | Bacteria | 754 |
| 608 | Ga0207674_11411031 | 3300026116 | Unclassified | 666 |
| 609 | Ga0207675_100132057 | 3300026118 | Bacteria | 2368 |
| 610 | Ga0207683_10136608 | 3300026121 | Bacteria | 2207 |
| 611 | Ga0207683_10633121 | 3300026121 | Bacteria | 991 |
| 612 | Ga0207683_10696966 | 3300026121 | Bacteria | 941 |
| 613 | Ga0207698_10100267 | 3300026142 | Bacteria | 2398 |
| 614 | Ga0207698_10264691 | 3300026142 | Bacteria | 1581 |
| 615 | Ga0207698_11041544 | 3300026142 | Bacteria | 830 |
| 616 | Ga0209969_1011738 | 3300027360 | Bacteria | 1260 |
| 617 | Ga0209981_1039614 | 3300027378 | Bacteria | 703 |
| 618 | Ga0209995_1009374 | 3300027471 | Bacteria | 1582 |
| 619 | Ga0209968_1010342 | 3300027526 | Bacteria | 1434 |
| 620 | Ga0209999_1029098 | 3300027543 | Bacteria | 1025 |
| 621 | Ga0209971_1020035 | 3300027682 | Bacteria | 1589 |
| 622 | Ga0209966_1000840 | 3300027695 | Bacteria | 5986 |
| 623 | Ga0209974_10016968 | 3300027876 | Bacteria | 2416 |
| 624 | Ga0207428_10201907 | 3300027907 | Bacteria | 1496 |
| 625 | Ga0268266_10108358 | 3300028379 | Bacteria | 2458 |
| 626 | Ga0268266_10124108 | 3300028379 | Bacteria | 2302 |
| 627 | Ga0268266_11032177 | 3300028379 | Bacteria | 796 |
| 628 | Ga0268266_11050400 | 3300028379 | Unclassified | 788 |
| 629 | Ga0268265_12196377 | 3300028380 | Bacteria | 559 |
| 630 | Ga0268264_10090869 | 3300028381 | Bacteria | 2632 |
| 631 | Ga0268264_10091803 | 3300028381 | Bacteria | 2620 |
| 632 | Ga0268264_10224201 | 3300028381 | Bacteria | 1732 |
| 633 | Ga0268264_11677734 | 3300028381 | Bacteria | 646 |
| 634 | Ga0265763_1025246 | 3300030763 | Bacteria | 648 |
| 635 | Ga0307408_100011913 | 3300031548 | Bacteria | 5754 |
| 636 | Ga0307408_100022367 | 3300031548 | Bacteria | 4295 |
| 637 | Ga0307408_100432718 | 3300031548 | Bacteria | 1137 |
| 638 | Ga0307408_100776084 | 3300031548 | Unclassified | 868 |
| 639 | Ga0307408_101667969 | 3300031548 | Bacteria | 607 |
| 640 | Ga0307405_10002332 | 3300031731 | Bacteria | 8346 |
| 641 | Ga0307405_10006748 | 3300031731 | Bacteria | 5675 |
| 642 | Ga0307405_10059531 | 3300031731 | Bacteria | 2407 |
| 643 | Ga0307405_10174691 | 3300031731 | Bacteria | 1536 |
| 644 | Ga0307405_10243046 | 3300031731 | Bacteria | 1335 |
| 645 | Ga0307405_10401024 | 3300031731 | Bacteria | 1074 |
| 646 | Ga0307405_11178038 | 3300031731 | Unclassified | 662 |
| 647 | Ga0307413_10003318 | 3300031824 | Bacteria | 6759 |
| 648 | Ga0307413_10007021 | 3300031824 | Bacteria | 5193 |
| 649 | Ga0307413_10009506 | 3300031824 | Bacteria | 4658 |
| 650 | Ga0307413_10012801 | 3300031824 | Bacteria | 4189 |
| 651 | Ga0307413_10079566 | 3300031824 | Bacteria | 2095 |
| 652 | Ga0307413_10191247 | 3300031824 | Bacteria | 1470 |
| 653 | Ga0307413_10372172 | 3300031824 | Bacteria | 1110 |
| 654 | Ga0307413_10715697 | 3300031824 | Bacteria | 833 |
| 655 | Ga0307410_10003426 | 3300031852 | Bacteria | 7957 |
| 656 | Ga0307410_10009102 | 3300031852 | Bacteria | 5551 |
| 657 | Ga0307410_10030194 | 3300031852 | Bacteria | 3461 |
| 658 | Ga0307410_10030636 | 3300031852 | Bacteria | 3440 |
| 659 | Ga0307410_10032064 | 3300031852 | Bacteria | 3377 |
| 660 | Ga0307410_10035924 | 3300031852 | Bacteria | 3223 |
| 661 | Ga0307410_10173984 | 3300031852 | Bacteria | 1625 |
| 662 | Ga0307410_10174202 | 3300031852 | Bacteria | 1624 |
| 663 | Ga0307410_10217083 | 3300031852 | Unclassified | 1469 |
| 664 | Ga0307410_10249149 | 3300031852 | Bacteria | 1380 |
| 665 | Ga0307410_10318583 | 3300031852 | Bacteria | 1233 |
| 666 | Ga0307410_10322835 | 3300031852 | Bacteria | 1225 |
| 667 | Ga0307406_10000977 | 3300031901 | Bacteria | 15953 |
| 668 | Ga0307406_10009401 | 3300031901 | Bacteria | 5481 |
| 669 | Ga0307406_10020394 | 3300031901 | Bacteria | 3902 |
| 670 | Ga0307406_10025247 | 3300031901 | Bacteria | 3556 |
| 671 | Ga0307406_10074765 | 3300031901 | Bacteria | 2232 |
| 672 | Ga0307406_10103327 | 3300031901 | Bacteria | 1946 |
| 673 | Ga0307406_11328512 | 3300031901 | Bacteria | 628 |
| 674 | Ga0307407_10000229 | 3300031903 | Bacteria | 16687 |
| 675 | Ga0307407_10013219 | 3300031903 | Bacteria | 3997 |
| 676 | Ga0307407_10015557 | 3300031903 | Bacteria | 3765 |
| 677 | Ga0307407_10049044 | 3300031903 | Bacteria | 2407 |
| 678 | Ga0307407_10170889 | 3300031903 | Bacteria | 1431 |
| 679 | Ga0307407_10488845 | 3300031903 | Bacteria | 900 |
| 680 | Ga0307407_10632672 | 3300031903 | Bacteria | 800 |
| 681 | Ga0307407_11554464 | 3300031903 | Bacteria | 524 |
| 682 | Ga0307412_10000533 | 3300031911 | Bacteria | 22669 |
| 683 | Ga0307412_10005145 | 3300031911 | Bacteria | 7324 |
| 684 | Ga0307412_10129807 | 3300031911 | Bacteria | 1829 |
| 685 | Ga0307412_10181271 | 3300031911 | Bacteria | 1584 |
| 686 | Ga0307412_10222875 | 3300031911 | Bacteria | 1447 |
| 687 | Ga0307412_10323927 | 3300031911 | Bacteria | 1227 |
| 688 | Ga0307412_10326896 | 3300031911 | Bacteria | 1222 |
| 689 | Ga0307412_10445478 | 3300031911 | Bacteria | 1065 |
| 690 | Ga0307412_10647308 | 3300031911 | Bacteria | 901 |
| 691 | Ga0307409_100002735 | 3300031995 | Bacteria | 9312 |
| 692 | Ga0307409_100021235 | 3300031995 | Bacteria | 4447 |
| 693 | Ga0307409_100028499 | 3300031995 | Bacteria | 3980 |
| 694 | Ga0307409_100074986 | 3300031995 | Bacteria | 2706 |
| 695 | Ga0307409_100079525 | 3300031995 | Bacteria | 2642 |
| 696 | Ga0307409_100083082 | 3300031995 | Bacteria | 2595 |
| 697 | Ga0307409_101253210 | 3300031995 | Bacteria | 766 |
| 698 | Ga0307416_100005742 | 3300032002 | Bacteria | 7681 |
| 699 | Ga0307416_100008465 | 3300032002 | Bacteria | 6642 |
| 700 | Ga0307416_100008817 | 3300032002 | Bacteria | 6542 |
| 701 | Ga0307416_100023776 | 3300032002 | Bacteria | 4456 |
| 702 | Ga0307416_100027093 | 3300032002 | Bacteria | 4237 |
| 703 | Ga0307416_100249875 | 3300032002 | Bacteria | 1725 |
| 704 | Ga0307416_100317222 | 3300032002 | Bacteria | 1559 |
| 705 | Ga0307416_100381702 | 3300032002 | Bacteria | 1439 |
| 706 | Ga0307416_100839885 | 3300032002 | Bacteria | 1016 |
| 707 | Ga0307416_101079108 | 3300032002 | Bacteria | 907 |
| 708 | Ga0307416_101222220 | 3300032002 | Bacteria | 857 |
| 709 | Ga0307416_101590681 | 3300032002 | Bacteria | 759 |
| 710 | Ga0307416_102850959 | 3300032002 | Unclassified | 578 |
| 711 | Ga0307414_10002477 | 3300032004 | Bacteria | 9677 |
| 712 | Ga0307414_10012566 | 3300032004 | Bacteria | 5012 |
| 713 | Ga0307414_10027140 | 3300032004 | Bacteria | 3696 |
| 714 | Ga0307414_10242345 | 3300032004 | Bacteria | 1493 |
| 715 | Ga0307414_10305415 | 3300032004 | Bacteria | 1348 |
| 716 | Ga0307414_11679842 | 3300032004 | Bacteria | 592 |
| 717 | Ga0307411_10001923 | 3300032005 | Bacteria | 8875 |
| 718 | Ga0307411_10015311 | 3300032005 | Bacteria | 4302 |
| 719 | Ga0307411_10040214 | 3300032005 | Bacteria | 2964 |
| 720 | Ga0307411_10227566 | 3300032005 | Bacteria | 1451 |
| 721 | Ga0307411_10697586 | 3300032005 | Bacteria | 884 |
| 722 | Ga0307411_10698073 | 3300032005 | Bacteria | 883 |
| 723 | Ga0307411_10760646 | 3300032005 | Unclassified | 849 |
| 724 | Ga0307411_10774329 | 3300032005 | Bacteria | 843 |
| 725 | Ga0307415_100000784 | 3300032126 | Bacteria | 14408 |
| 726 | Ga0307415_100003516 | 3300032126 | Bacteria | 7989 |
| 727 | Ga0307415_100028103 | 3300032126 | Bacteria | 3573 |
| 728 | Ga0307415_100184652 | 3300032126 | Bacteria | 1640 |
| 729 | Ga0307415_100236016 | 3300032126 | Bacteria | 1476 |
| 730 | Ga0307415_100247137 | 3300032126 | Bacteria | 1447 |
| 731 | Ga0307415_100345964 | 3300032126 | Unclassified | 1249 |
| 732 | Ga0307415_100445546 | 3300032126 | Bacteria | 1118 |
| 733 | Ga0307415_100454281 | 3300032126 | Bacteria | 1108 |
| 734 | Ga0307415_101056364 | 3300032126 | Bacteria | 758 |
| 735 | Ga0307415_101487650 | 3300032126 | Bacteria | 647 |
| 736 | Ga0307415_101747941 | 3300032126 | Bacteria | 601 |
| 737 | Ga0373926_0162822 | 3300035083 | Bacteria | 852 |
| 738 | Ga0373934_0013069 | 3300035086 | Bacteria | 3136 |
| 739 | Ga0373944_0209307 | 3300035089 | Bacteria | 708 |
| 740 | Ga0373923_0098131 | 3300035111 | Unclassified | 1289 |
| 741 | Ga0373923_0469586 | 3300035111 | Unclassified | 611 |
| 742 | Ga0373954_0045633 | 3300035118 | Bacteria | 2048 |
| 743 | Ga0373954_0404274 | 3300035118 | Bacteria | 675 |
| 744 | Ga0373956_0222514 | 3300035119 | Bacteria | 896 |
| 745 | Ga0373957_0126894 | 3300035120 | Bacteria | 1036 |
| 746 | Ga0373957_0234398 | 3300035120 | Unclassified | 770 |
| 747 | Ga0373943_0029448 | 3300035170 | Bacteria | 2594 |
| 748 | Ga0373946_0332237 | 3300035171 | Bacteria | 757 |
| 749 | Ga0373955_0016306 | 3300035172 | Bacteria | 3654 |
| 750 | Ga0373955_0088143 | 3300035172 | Bacteria | 1765 |
| 751 | Ga0373955_0141665 | 3300035172 | Bacteria | 1410 |
| 752 | Ga0373924_0062334 | 3300035410 | Bacteria | 1562 |
| 753 | Ga0373931_0023542 | 3300035691 | Bacteria | 3111 |
| 754 | Ga0373927_0033533 | 3300035695 | Bacteria | 3343 |
| 755 | Ga0373927_0068207 | 3300035695 | Bacteria | 2301 |
| 756 | Ga0373927_0565642 | 3300035695 | Unclassified | 751 |
| 757 | Ga0373933_0047772 | 3300035724 | Bacteria | 2547 |
| 758 | Ga0373933_0051813 | 3300035724 | Bacteria | 2454 |
| 759 | Ga0373937_0015856 | 3300036401 | Bacteria | 6679 |
| 760 | Ga0373937_0089316 | 3300036401 | Bacteria | 2853 |
| 761 | Ga0373937_0166609 | 3300036401 | Bacteria | 2066 |
| 762 | Ga0373937_1151606 | 3300036401 | Bacteria | 724 |
| 763 | Ga0373937_1503722 | 3300036401 | Unclassified | 621 |
| 764 | Ga0373925_0031465 | 3300037068 | Bacteria | 3900 |
| 765 | Ga0395900_0323581 | 3300037418 | Bacteria | 1522 |
| 766 | Ga0395905_0139084 | 3300037471 | Bacteria | 2285 |
| 767 | Ga0395901_0434478 | 3300038443 | Bacteria | 1345 |
| 768 | Ga0436365_0013958 | 3300039437 | Bacteria | 3877 |
| 769 | Ga0436365_0569575 | 3300039437 | Bacteria | 577 |
| 770 | Ga0439439_0046593 | 3300041406 | Bacteria | 1132 |
| 771 | Ga0451789_1178062 | 3300041443 | Unclassified | 560 |
| 772 | Ga0439434_0055395 | 3300042435 | Bacteria | 1234 |
| 773 | Ga0451577_0000016 | 3300042876 | Bacteria | 531002 |
| 774 | Ga0451577_0029491 | 3300042876 | Bacteria | 4959 |
| 775 | Ga0451577_0045162 | 3300042876 | Bacteria | 3943 |
| 776 | Ga0451577_0499227 | 3300042876 | Bacteria | 1105 |
| 777 | Ga0451577_0836999 | 3300042876 | Bacteria | 830 |
| 778 | Ga0466961_0509750 | 3300044693 | Bacteria | 726 |
| 779 | Ga0466964_0477592 | 3300044706 | Bacteria | 666 |
| 780 | Ga0453684_0000617 | 3300044712 | Bacteria | 130120 |
| 781 | Ga0451576_0054679 | 3300045051 | Bacteria | 4179 |
| 782 | Ga0451576_0591386 | 3300045051 | Bacteria | 1166 |
| 783 | Ga0466967_0026287 | 3300045976 | Bacteria | 4819 |
| 784 | Ga0466967_0353405 | 3300045976 | Bacteria | 1423 |
| 785 | Ga0495592_0188349 | 3300046454 | Bacteria | 1400 |
| 786 | Ga0495592_0358802 | 3300046454 | Bacteria | 933 |
| 787 | Ga0495651_0059950 | 3300046462 | Bacteria | 2916 |
| 788 | Ga0495653_0045292 | 3300046463 | Bacteria | 3411 |
| 789 | Ga0495653_0056836 | 3300046463 | Bacteria | 2981 |
| 790 | Ga0495580_0106064 | 3300046472 | Bacteria | 1952 |
| 791 | Ga0495580_0689714 | 3300046472 | Bacteria | 669 |
| 792 | Ga0495582_0076878 | 3300046473 | Bacteria | 1851 |
| 793 | Ga0495582_0165473 | 3300046473 | Bacteria | 1258 |
| 794 | Ga0495639_0398174 | 3300046475 | Bacteria | 695 |
| 795 | Ga0495662_0006513 | 3300046476 | Bacteria | 5833 |
| 796 | Ga0495662_0566138 | 3300046476 | Bacteria | 556 |
| 797 | Ga0495664_0009895 | 3300046477 | Bacteria | 5349 |
| 798 | Ga0495664_0194277 | 3300046477 | Bacteria | 1230 |
| 799 | Ga0495664_0320743 | 3300046477 | Bacteria | 934 |
| 800 | Ga0495585_0605674 | 3300046492 | Unclassified | 515 |
| 801 | Ga0495594_0002515 | 3300046499 | Bacteria | 9556 |
| 802 | Ga0495594_0012998 | 3300046499 | Bacteria | 4342 |
| 803 | Ga0495608_0018028 | 3300046511 | Bacteria | 4877 |
| 804 | Ga0495608_0022322 | 3300046511 | Bacteria | 4339 |
| 805 | Ga0495608_0126548 | 3300046511 | Bacteria | 1636 |
| 806 | Ga0495618_0084631 | 3300046514 | Bacteria | 2026 |
| 807 | Ga0495628_0038821 | 3300046516 | Bacteria | 3809 |
| 808 | Ga0495630_0011558 | 3300046517 | Bacteria | 6392 |
| 809 | Ga0495630_0017051 | 3300046517 | Bacteria | 5316 |
| 810 | Ga0495630_0089210 | 3300046517 | Bacteria | 2329 |
| 811 | Ga0495630_0608841 | 3300046517 | Bacteria | 837 |
| 812 | Ga0495630_0944108 | 3300046517 | Unclassified | 656 |
| 813 | Ga0495666_0364095 | 3300046526 | Bacteria | 651 |
| 814 | Ga0495652_0003351 | 3300046529 | Bacteria | 15872 |
| 815 | Ga0495652_0045072 | 3300046529 | Bacteria | 3795 |
| 816 | Ga0495652_0061826 | 3300046529 | Bacteria | 3160 |
| 817 | Ga0495652_0177164 | 3300046529 | Bacteria | 1640 |
| 818 | Ga0495652_0460804 | 3300046529 | Bacteria | 888 |
| 819 | Ga0495665_0020004 | 3300046531 | Bacteria | 3599 |
| 820 | Ga0495665_0072904 | 3300046531 | Bacteria | 1808 |
| 821 | Ga0495665_0213679 | 3300046531 | Bacteria | 998 |
| 822 | Ga0495665_0239780 | 3300046531 | Bacteria | 935 |
| 823 | Ga0495665_0401334 | 3300046531 | Bacteria | 695 |
| 824 | Ga0495640_0004624 | 3300046533 | Bacteria | 10981 |
| 825 | Ga0495586_0036821 | 3300046535 | Bacteria | 2626 |
| 826 | Ga0495586_0051997 | 3300046535 | Bacteria | 2217 |
| 827 | Ga0495586_0055944 | 3300046535 | Bacteria | 2139 |
| 828 | Ga0495586_0312172 | 3300046535 | Unclassified | 901 |
| 829 | Ga0495587_0000747 | 3300046536 | Bacteria | 21674 |
| 830 | Ga0495587_0023334 | 3300046536 | Bacteria | 3802 |
| 831 | Ga0495587_0026271 | 3300046536 | Bacteria | 3551 |
| 832 | Ga0495587_0116361 | 3300046536 | Bacteria | 1533 |
| 833 | Ga0495587_0309706 | 3300046536 | Bacteria | 882 |
| 834 | Ga0495621_0261692 | 3300046539 | Bacteria | 709 |
| 835 | Ga0495645_0000475 | 3300046543 | Bacteria | 27786 |
| 836 | Ga0495645_0000710 | 3300046543 | Bacteria | 22853 |
| 837 | Ga0495645_0094240 | 3300046543 | Bacteria | 2136 |
| 838 | Ga0495645_0094485 | 3300046543 | Bacteria | 2133 |
| 839 | Ga0495645_0184131 | 3300046543 | Bacteria | 1428 |
| 840 | Ga0495645_0223786 | 3300046543 | Bacteria | 1264 |
| 841 | Ga0495667_0001590 | 3300046559 | Bacteria | 15065 |
| 842 | Ga0495667_0012886 | 3300046559 | Bacteria | 5666 |
| 843 | Ga0495667_0045361 | 3300046559 | Bacteria | 2911 |
| 844 | Ga0495667_0170318 | 3300046559 | Bacteria | 1399 |
| 845 | Ga0495634_0023849 | 3300046642 | Bacteria | 4298 |
| 846 | Ga0495635_0032403 | 3300046663 | Bacteria | 3626 |
| 847 | Ga0495635_0045013 | 3300046663 | Bacteria | 3044 |
| 848 | Ga0495588_0110483 | 3300046674 | Bacteria | 1448 |
| 849 | Ga0495657_0003392 | 3300046675 | Bacteria | 13013 |
| 850 | Ga0495657_0062418 | 3300046675 | Bacteria | 2462 |
| 851 | Ga0495657_0151763 | 3300046675 | Bacteria | 1438 |
| 852 | Ga0495599_0003240 | 3300046678 | Bacteria | 9475 |
| 853 | Ga0495599_0003716 | 3300046678 | Bacteria | 8938 |
| 854 | Ga0495599_0096910 | 3300046678 | Bacteria | 1839 |
| 855 | Ga0495599_0153740 | 3300046678 | Bacteria | 1424 |
| 856 | Ga0495623_0032621 | 3300046679 | Bacteria | 3347 |
| 857 | Ga0495623_0072470 | 3300046679 | Bacteria | 2142 |
| 858 | Ga0495623_0088946 | 3300046679 | Bacteria | 1899 |
| 859 | Ga0495646_0037731 | 3300046680 | Bacteria | 2987 |
| 860 | Ga0495646_0265266 | 3300046680 | Bacteria | 916 |
| 861 | Ga0495658_0424212 | 3300046683 | Bacteria | 849 |
| 862 | Ga0495669_0166659 | 3300046684 | Bacteria | 1047 |
| 863 | Ga0495613_0029323 | 3300046689 | Bacteria | 4091 |
| 864 | Ga0495613_0043113 | 3300046689 | Bacteria | 3338 |
| 865 | Ga0495613_0696688 | 3300046689 | Bacteria | 669 |
| 866 | Ga0495600_0069926 | 3300046809 | Bacteria | 2294 |
| 867 | Ga0495600_0505136 | 3300046809 | Bacteria | 742 |
| 868 | Ga0495581_0033867 | 3300047315 | Bacteria | 2956 |
| 869 | Ga0495581_0163615 | 3300047315 | Bacteria | 1301 |
| 870 | Ga0495581_0208474 | 3300047315 | Bacteria | 1143 |
| 871 | Ga0495604_0054807 | 3300047317 | Bacteria | 3075 |
| 872 | Ga0495604_0459656 | 3300047317 | Unclassified | 831 |
| 873 | Ga0495604_0843355 | 3300047317 | Bacteria | 575 |
| 874 | Ga0495674_0048052 | 3300047319 | Bacteria | 3779 |
| 875 | Ga0495674_0172434 | 3300047319 | Bacteria | 1804 |
| 876 | Ga0495674_0186240 | 3300047319 | Bacteria | 1727 |
| 877 | Ga0495674_0210436 | 3300047319 | Bacteria | 1611 |
| 878 | Ga0495672_0007750 | 3300047320 | Bacteria | 8036 |
| 879 | Ga0495680_0033583 | 3300047322 | Bacteria | 4151 |
| 880 | Ga0495680_0531580 | 3300047322 | Unclassified | 794 |
| 881 | Ga0495675_0041679 | 3300047444 | Bacteria | 2925 |
| 882 | Ga0495675_0068082 | 3300047444 | Bacteria | 2249 |
| 883 | Ga0495675_0084915 | 3300047444 | Bacteria | 1991 |
| 884 | Ga0495684_0006808 | 3300047471 | Bacteria | 8877 |
| 885 | Ga0495684_0016565 | 3300047471 | Bacteria | 5677 |
| 886 | Ga0495684_0025329 | 3300047471 | Bacteria | 4561 |
| 887 | Ga0495684_0143558 | 3300047471 | Bacteria | 1789 |
| 888 | Ga0495593_0038393 | 3300047673 | Bacteria | 2587 |
| 889 | Ga0495593_0121161 | 3300047673 | Bacteria | 1331 |
| 890 | Ga0495602_0015244 | 3300048088 | Bacteria | 7764 |
| 891 | Ga0495602_0035269 | 3300048088 | Bacteria | 4666 |
| 892 | Ga0495602_0186071 | 3300048088 | Unclassified | 1597 |
| 893 | Ga0496100_0139361 | 3300048903 | Bacteria | 1717 |
| 894 | Ga0496101_0253254 | 3300048904 | Bacteria | 1372 |
| 895 | Ga0496104_0165984 | 3300048907 | Bacteria | 2117 |
| 896 | Ga0496104_1453739 | 3300048907 | Bacteria | 588 |
| 897 | Ga0496105_0393646 | 3300048908 | Bacteria | 1101 |
| 898 | Ga0496106_0189528 | 3300048909 | Bacteria | 1635 |
| 899 | Ga0496108_0085778 | 3300048911 | Bacteria | 2673 |
| 900 | Ga0496108_0849839 | 3300048911 | Bacteria | 785 |
| 901 | Ga0496110_0167276 | 3300048913 | Bacteria | 1994 |
| 902 | Ga0496110_0815835 | 3300048913 | Bacteria | 838 |
| 903 | Ga0496112_0014015 | 3300048915 | Bacteria | 7418 |
| 904 | Ga0496112_0024153 | 3300048915 | Bacteria | 5817 |
| 905 | Ga0496113_1418816 | 3300048916 | Bacteria | 537 |
| 906 | Ga0496114_0491060 | 3300048917 | Bacteria | 1086 |
| 907 | Ga0496115_0485705 | 3300048918 | Bacteria | 994 |
| 908 | Ga0496115_0550406 | 3300048918 | Unclassified | 922 |
| 909 | Ga0496115_0709077 | 3300048918 | Bacteria | 790 |
| 910 | Ga0501303_025790 | 3300049526 | Unclassified | 656 |
| 911 | Ga0501323_088717 | 3300049539 | Bacteria | 513 |
| 912 | Ga0501034_1069209 | 3300049571 | Bacteria | 689 |
| 913 | Ga0501067_0389274 | 3300049583 | Bacteria | 777 |
| 914 | Ga0501069_0511299 | 3300049585 | Bacteria | 717 |
| 915 | Ga0501071_1254614 | 3300049587 | Bacteria | 573 |
| 916 | Ga0501073_0175852 | 3300049589 | Bacteria | 1482 |
| 917 | Ga0501198_161236 | 3300049649 | Bacteria | 501 |
| 918 | Ga0501207_011481 | 3300049654 | Bacteria | 1320 |
| 919 | Ga0501216_005790 | 3300049660 | Bacteria | 1874 |
| 920 | Ga0501217_020816 | 3300049661 | Bacteria | 1544 |
| 921 | Ga0501224_002274 | 3300049664 | Bacteria | 2601 |
| 922 | Ga0501228_070032 | 3300049666 | Unclassified | 511 |
| 923 | Ga0501230_016822 | 3300049667 | Bacteria | 1231 |
| 924 | Ga0501233_002061 | 3300049668 | Bacteria | 3507 |
| 925 | Ga0501233_222767 | 3300049668 | Bacteria | 557 |
| 926 | Ga0501235_003188 | 3300049669 | Bacteria | 3535 |
| 927 | Ga0501235_122109 | 3300049669 | Unclassified | 653 |
| 928 | Ga0501242_010215 | 3300049674 | Bacteria | 1119 |
| 929 | Ga0501243_027043 | 3300049675 | Bacteria | 967 |
| 930 | Ga0501243_037291 | 3300049675 | Bacteria | 845 |
| 931 | Ga0501247_014257 | 3300049677 | Bacteria | 984 |
| 932 | Ga0501247_034840 | 3300049677 | Bacteria | 701 |
| 933 | Ga0501247_051939 | 3300049677 | Bacteria | 610 |
| 934 | Ga0501249_045259 | 3300049679 | Bacteria | 1004 |
| 935 | Ga0501249_080489 | 3300049679 | Bacteria | 766 |
| 936 | Ga0501252_000489 | 3300049682 | Bacteria | 3052 |
| 937 | Ga0501252_042749 | 3300049682 | Bacteria | 663 |
| 938 | Ga0501252_052816 | 3300049682 | Bacteria | 618 |
| 939 | Ga0501257_119078 | 3300049686 | Bacteria | 706 |
| 940 | Ga0501261_007497 | 3300049690 | Bacteria | 1401 |
| 941 | Ga0501221_003414 | 3300049704 | Bacteria | 2612 |
| 942 | Ga0501225_0013296 | 3300049705 | Bacteria | 2305 |
| 943 | Ga0501229_080776 | 3300049706 | Bacteria | 520 |
| 944 | Ga0501234_042886 | 3300049707 | Bacteria | 743 |
| 945 | Ga0501245_005236 | 3300049708 | Bacteria | 1795 |
| 946 | Ga0501245_052400 | 3300049708 | Unclassified | 727 |
| 947 | Ga0501262_006240 | 3300049759 | Bacteria | 1422 |
| 948 | Ga0501266_002003 | 3300049763 | Bacteria | 2567 |
| 949 | Ga0501266_089569 | 3300049763 | Unclassified | 532 |
| 950 | Ga0501268_005281 | 3300049765 | Bacteria | 1852 |
| 951 | Ga0501270_008782 | 3300049767 | Bacteria | 1288 |
| 952 | Ga0501271_035135 | 3300049768 | Bacteria | 634 |
| 953 | Ga0501273_057980 | 3300049770 | Bacteria | 605 |
| 954 | nmdc:mga09592_17631_c1 | 3300050508 | Bacteria | 5851 |
| 955 | nmdc:mga09592_264993_c1 | 3300050508 | Bacteria | 1490 |
| 956 | nmdc:mga09592_580235_c1 | 3300050508 | Bacteria | 962 |
| 957 | nmdc:mga09592_817718_c1 | 3300050508 | Bacteria | 787 |
| 958 | nmdc:mga0qj67_346845_c1 | 3300050509 | Bacteria | 1201 |
| 959 | nmdc:mga0qj67_844301_c1 | 3300050509 | Unclassified | 724 |
| 960 | nmdc:mga06r32_1823380_c1 | 3300050510 | Bacteria | 544 |
| 961 | nmdc:mga06r32_30321_c1 | 3300050510 | Bacteria | 5075 |
| 962 | nmdc:mga06r32_364956_c1 | 3300050510 | Bacteria | 1428 |
| 963 | nmdc:mga08y16_168621_c1 | 3300050511 | Bacteria | 2274 |
| 964 | nmdc:mga08y16_307808_c1 | 3300050511 | Bacteria | 1632 |
| 965 | nmdc:mga0n895_71244_c1 | 3300050512 | Bacteria | 3446 |
| 966 | nmdc:mga0rr50_394144_c1 | 3300050513 | Bacteria | 1169 |
| 967 | Ga0495612_0024300 | 3300053078 | Bacteria | 2432 |
| 968 | Ga0495595_0109202 | 3300053084 | Bacteria | 1340 |
| 969 | Ga0495619_0380228 | 3300053085 | Bacteria | 976 |
| 970 | Ga0587070_016939 | 3300059491 | Bacteria | 1174 |
| 971 | Ga0587073_0187586 | 3300059492 | Bacteria | 611 |
| 972 | Ga0587082_049144 | 3300059504 | Unclassified | 799 |
| 973 | Ga0587091_020731 | 3300059511 | Bacteria | 1144 |
| 974 | Ga0587091_165143 | 3300059511 | Bacteria | 572 |
| 975 | Ga0587113_050434 | 3300059625 | Bacteria | 518 |
| 976 | Ga0587067_138613 | 3300059640 | Bacteria | 601 |
| 977 | Ga0587072_121028 | 3300059643 | Bacteria | 607 |
| 978 | Ga0587075_048258 | 3300059644 | Bacteria | 735 |
| 979 | Ga0587076_191070 | 3300059645 | Bacteria | 521 |
| 980 | Ga0587078_008240 | 3300059646 | Bacteria | 1165 |
| 981 | Ga0587071_004892 | 3300060344 | Bacteria | 2021 |
| 982 | Ga0587111_0181018 | 3300060346 | Viruses | 586 |
| 983 | Ga0501082_1268943 | 3300060353 | Bacteria | 644 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049765 | Ga0501268_005281 | Ga0501268_005281_1519_1842 | 89 |
| 2 | 3300046472 | Ga0495580_0689714 | Ga0495580_0689714_143_604 | 94 |
| 3 | 3300005341 | Ga0070691_10013009 | Ga0070691_100130092 | 95 |
| 4 | 3300005353 | Ga0070669_100277876 | Ga0070669_1002778761 | 95 |
| 5 | 3300009094 | Ga0111539_10233831 | Ga0111539_102338312 | 95 |
| 6 | 3300009545 | Ga0105237_10197173 | Ga0105237_101971731 | 95 |
| 7 | 3300009551 | Ga0105238_10069130 | Ga0105238_100691303 | 95 |
| 8 | 3300013307 | Ga0157372_12338893 | Ga0157372_123388932 | 95 |
| 9 | 3300025961 | Ga0207712_10430976 | Ga0207712_104309761 | 95 |
| 10 | 3300042876 | Ga0451577_0836999 | Ga0451577_0836999_296_712 | 95 |
| 11 | 3300045051 | Ga0451576_0591386 | Ga0451576_0591386_424_840 | 95 |
| 12 | 3300042876 | Ga0451577_0499227 | Ga0451577_0499227_450_851 | 96 |
| 13 | 3300003308 | Ga0006777J48905_1058895 | Ga0006777J48905_10588954 | 97 |
| 14 | 3300005437 | Ga0070710_10357910 | Ga0070710_103579101 | 97 |
| 15 | 3300005439 | Ga0070711_100222579 | Ga0070711_1002225791 | 97 |
| 16 | 3300025898 | Ga0207692_10264035 | Ga0207692_102640352 | 97 |
| 17 | 3300025916 | Ga0207663_10038395 | Ga0207663_100383952 | 97 |
| 18 | 3300045051 | Ga0451576_0054679 | Ga0451576_0054679_210_644 | 97 |
| 19 | 3300046475 | Ga0495639_0398174 | Ga0495639_0398174_198_662 | 97 |
| 20 | 3300046531 | Ga0495665_0020004 | Ga0495665_0020004_3106_3570 | 97 |
| 21 | 3300046535 | Ga0495586_0055944 | Ga0495586_0055944_671_1135 | 97 |
| 22 | 3300047319 | Ga0495674_0210436 | Ga0495674_0210436_1076_1540 | 97 |
| 23 | 3300048907 | Ga0496104_1453739 | Ga0496104_1453739_70_534 | 97 |
| 24 | 3300050511 | nmdc:mga08y16_168621_c1 | nmdc:mga08y16_168621_c1_1332_1766 | 97 |
| 25 | 3300005329 | Ga0070683_100954592 | Ga0070683_1009545921 | 98 |
| 26 | 3300035119 | Ga0373956_0222514 | Ga0373956_0222514_148_612 | 98 |
| 27 | 3300035172 | Ga0373955_0141665 | Ga0373955_0141665_687_1151 | 98 |
| 28 | 3300046511 | Ga0495608_0018028 | Ga0495608_0018028_1939_2403 | 98 |
| 29 | 3300046559 | Ga0495667_0001590 | Ga0495667_0001590_5351_5815 | 98 |
| 30 | 3300046675 | Ga0495657_0062418 | Ga0495657_0062418_664_1128 | 98 |
| 31 | 3300048088 | Ga0495602_0035269 | Ga0495602_0035269_4184_4648 | 98 |
| 32 | 3300032126 | Ga0307415_100236016 | Ga0307415_1002360162 | 99 |
| 33 | 3300048918 | Ga0496115_0550406 | Ga0496115_0550406_19_378 | 100 |
| 34 | 3300050510 | nmdc:mga06r32_1823380_c1 | nmdc:mga06r32_1823380_c1_157_516 | 100 |
| 35 | 3300031731 | Ga0307405_10401024 | Ga0307405_104010242 | 101 |
| 36 | 3300049706 | Ga0501229_080776 | Ga0501229_080776_21_380 | 101 |
| 37 | 3300060353 | Ga0501082_1268943 | Ga0501082_1268943_47_406 | 101 |
| 38 | 3300042876 | Ga0451577_0000016 | Ga0451577_0000016_474297_474713 | 102 |
| 39 | 3300049571 | Ga0501034_1069209 | Ga0501034_1069209_235_660 | 102 |
| 40 | 3300049675 | Ga0501243_027043 | Ga0501243_027043_77_484 | 102 |
| 41 | 3300042876 | Ga0451577_0045162 | Ga0451577_0045162_860_1285 | 103 |
| 42 | 3300044712 | Ga0453684_0000617 | Ga0453684_0000617_20797_21222 | 103 |
| 43 | 3300049682 | Ga0501252_052816 | Ga0501252_052816_16_426 | 103 |
| 44 | 3300013306 | Ga0163162_13401403 | Ga0163162_134014031 | 105 |
| 45 | 3300031824 | Ga0307413_10007021 | Ga0307413_100070213 | 105 |
| 46 | 3300031852 | Ga0307410_10009102 | Ga0307410_100091025 | 105 |
| 47 | 3300031852 | Ga0307410_10318583 | Ga0307410_103185831 | 105 |
| 48 | 3300031901 | Ga0307406_10009401 | Ga0307406_100094013 | 105 |
| 49 | 3300031903 | Ga0307407_10000229 | Ga0307407_100002299 | 105 |
| 50 | 3300031911 | Ga0307412_10005145 | Ga0307412_100051455 | 105 |
| 51 | 3300032002 | Ga0307416_100005742 | Ga0307416_1000057427 | 105 |
| 52 | 3300032004 | Ga0307414_10305415 | Ga0307414_103054152 | 105 |
| 53 | 3300032005 | Ga0307411_10040214 | Ga0307411_100402144 | 105 |
| 54 | 3300032126 | Ga0307415_100000784 | Ga0307415_10000078413 | 105 |
| 55 | 3300046543 | Ga0495645_0094485 | Ga0495645_0094485_232_696 | 105 |
| 56 | 3300049668 | Ga0501233_222767 | Ga0501233_222767_66_479 | 105 |
| 57 | 3300005339 | Ga0070660_100205577 | Ga0070660_1002055772 | 106 |
| 58 | 3300031911 | Ga0307412_10222875 | Ga0307412_102228752 | 106 |
| 59 | 3300060344 | Ga0587071_004892 | Ga0587071_004892_1101_1580 | 106 |
| 60 | 3300005328 | Ga0070676_10404908 | Ga0070676_104049082 | 107 |
| 61 | 3300013307 | Ga0157372_10405406 | Ga0157372_104054062 | 107 |
| 62 | 3300027360 | Ga0209969_1011738 | Ga0209969_10117383 | 107 |
| 63 | 3300027378 | Ga0209981_1039614 | Ga0209981_10396142 | 107 |
| 64 | 3300027471 | Ga0209995_1009374 | Ga0209995_10093743 | 107 |
| 65 | 3300027526 | Ga0209968_1010342 | Ga0209968_10103423 | 107 |
| 66 | 3300027543 | Ga0209999_1029098 | Ga0209999_10290981 | 107 |
| 67 | 3300027682 | Ga0209971_1020035 | Ga0209971_10200353 | 107 |
| 68 | 3300027695 | Ga0209966_1000840 | Ga0209966_10008404 | 107 |
| 69 | 3300027876 | Ga0209974_10016968 | Ga0209974_100169681 | 107 |
| 70 | 3300049708 | Ga0501245_052400 | Ga0501245_052400_233_643 | 107 |
| 71 | 3300005331 | Ga0070670_100902962 | Ga0070670_1009029621 | 108 |
| 72 | 3300005364 | Ga0070673_100216471 | Ga0070673_1002164712 | 108 |
| 73 | 3300005536 | Ga0070697_100213740 | Ga0070697_1002137402 | 108 |
| 74 | 3300006846 | Ga0075430_100026576 | Ga0075430_1000265765 | 108 |
| 75 | 3300006847 | Ga0075431_100022910 | Ga0075431_1000229105 | 108 |
| 76 | 3300006880 | Ga0075429_100155646 | Ga0075429_1001556462 | 108 |
| 77 | 3300009553 | Ga0105249_10837042 | Ga0105249_108370422 | 108 |
| 78 | 3300035086 | Ga0373934_0013069 | Ga0373934_0013069_1830_2294 | 108 |
| 79 | 3300035111 | Ga0373923_0098131 | Ga0373923_0098131_532_996 | 108 |
| 80 | 3300035120 | Ga0373957_0234398 | Ga0373957_0234398_283_747 | 108 |
| 81 | 3300035724 | Ga0373933_0051813 | Ga0373933_0051813_1071_1535 | 108 |
| 82 | 3300046463 | Ga0495653_0045292 | Ga0495653_0045292_71_535 | 108 |
| 83 | 3300046477 | Ga0495664_0009895 | Ga0495664_0009895_31_495 | 108 |
| 84 | 3300046529 | Ga0495652_0003351 | Ga0495652_0003351_8808_9272 | 108 |
| 85 | 3300046536 | Ga0495587_0000747 | Ga0495587_0000747_19822_20286 | 108 |
| 86 | 3300046543 | Ga0495645_0000475 | Ga0495645_0000475_19834_20298 | 108 |
| 87 | 3300046663 | Ga0495635_0032403 | Ga0495635_0032403_1078_1542 | 108 |
| 88 | 3300046678 | Ga0495599_0003716 | Ga0495599_0003716_1366_1830 | 108 |
| 89 | 3300046679 | Ga0495623_0088946 | Ga0495623_0088946_214_678 | 108 |
| 90 | 3300047317 | Ga0495604_0459656 | Ga0495604_0459656_331_795 | 108 |
| 91 | 3300047322 | Ga0495680_0531580 | Ga0495680_0531580_48_512 | 108 |
| 92 | 3300047444 | Ga0495675_0041679 | Ga0495675_0041679_1162_1626 | 108 |
| 93 | 3300047471 | Ga0495684_0006808 | Ga0495684_0006808_1137_1601 | 108 |
| 94 | 3300049583 | Ga0501067_0389274 | Ga0501067_0389274_92_508 | 108 |
| 95 | 3300049585 | Ga0501069_0511299 | Ga0501069_0511299_11_427 | 108 |
| 96 | 3300049763 | Ga0501266_089569 | Ga0501266_089569_16_426 | 108 |
| 97 | 3300050508 | nmdc:mga09592_17631_c1 | nmdc:mga09592_17631_c1_2749_3168 | 108 |
| 98 | 3300050509 | nmdc:mga0qj67_844301_c1 | nmdc:mga0qj67_844301_c1_233_652 | 108 |
| 99 | 3300050510 | nmdc:mga06r32_30321_c1 | nmdc:mga06r32_30321_c1_2891_3310 | 108 |
| 100 | 3300053078 | Ga0495612_0024300 | Ga0495612_0024300_323_787 | 108 |
| 101 | 3300001991 | JGI24743J22301_10124862 | JGI24743J22301_101248621 | 109 |
| 102 | 3300004803 | Ga0058862_12870049 | Ga0058862_128700493 | 109 |
| 103 | 3300004803 | Ga0058862_12887040 | Ga0058862_128870404 | 109 |
| 104 | 3300005328 | Ga0070676_10046897 | Ga0070676_100468973 | 109 |
| 105 | 3300005329 | Ga0070683_100000565 | Ga0070683_1000005653 | 109 |
| 106 | 3300005329 | Ga0070683_100069251 | Ga0070683_1000692513 | 109 |
| 107 | 3300005330 | Ga0070690_100075352 | Ga0070690_1000753521 | 109 |
| 108 | 3300005331 | Ga0070670_100008774 | Ga0070670_1000087746 | 109 |
| 109 | 3300005334 | Ga0068869_100006227 | Ga0068869_1000062273 | 109 |
| 110 | 3300005336 | Ga0070680_100006760 | Ga0070680_1000067603 | 109 |
| 111 | 3300005336 | Ga0070680_100213568 | Ga0070680_1002135683 | 109 |
| 112 | 3300005337 | Ga0070682_100000275 | Ga0070682_1000002753 | 109 |
| 113 | 3300005337 | Ga0070682_100002639 | Ga0070682_1000026393 | 109 |
| 114 | 3300005338 | Ga0068868_100066722 | Ga0068868_1000667224 | 109 |
| 115 | 3300005338 | Ga0068868_100154703 | Ga0068868_1001547032 | 109 |
| 116 | 3300005339 | Ga0070660_100423221 | Ga0070660_1004232212 | 109 |
| 117 | 3300005340 | Ga0070689_100783143 | Ga0070689_1007831432 | 109 |
| 118 | 3300005341 | Ga0070691_10235550 | Ga0070691_102355502 | 109 |
| 119 | 3300005343 | Ga0070687_100095487 | Ga0070687_1000954872 | 109 |
| 120 | 3300005344 | Ga0070661_100022554 | Ga0070661_1000225545 | 109 |
| 121 | 3300005344 | Ga0070661_100027604 | Ga0070661_1000276043 | 109 |
| 122 | 3300005345 | Ga0070692_10040375 | Ga0070692_100403752 | 109 |
| 123 | 3300005354 | Ga0070675_100001662 | Ga0070675_10000166212 | 109 |
| 124 | 3300005355 | Ga0070671_100774132 | Ga0070671_1007741321 | 109 |
| 125 | 3300005356 | Ga0070674_100792775 | Ga0070674_1007927751 | 109 |
| 126 | 3300005364 | Ga0070673_100118119 | Ga0070673_1001181193 | 109 |
| 127 | 3300005364 | Ga0070673_100292825 | Ga0070673_1002928252 | 109 |
| 128 | 3300005366 | Ga0070659_100045299 | Ga0070659_1000452993 | 109 |
| 129 | 3300005457 | Ga0070662_100027228 | Ga0070662_1000272282 | 109 |
| 130 | 3300005457 | Ga0070662_100238195 | Ga0070662_1002381953 | 109 |
| 131 | 3300005458 | Ga0070681_10007180 | Ga0070681_100071808 | 109 |
| 132 | 3300005458 | Ga0070681_10026256 | Ga0070681_100262564 | 109 |
| 133 | 3300005459 | Ga0068867_100141930 | Ga0068867_1001419302 | 109 |
| 134 | 3300005466 | Ga0070685_10850856 | Ga0070685_108508562 | 109 |
| 135 | 3300005471 | Ga0070698_100893206 | Ga0070698_1008932061 | 109 |
| 136 | 3300005530 | Ga0070679_100000771 | Ga0070679_1000007713 | 109 |
| 137 | 3300005530 | Ga0070679_100949180 | Ga0070679_1009491802 | 109 |
| 138 | 3300005535 | Ga0070684_100006014 | Ga0070684_1000060145 | 109 |
| 139 | 3300005535 | Ga0070684_100178147 | Ga0070684_1001781472 | 109 |
| 140 | 3300005544 | Ga0070686_100031501 | Ga0070686_1000315014 | 109 |
| 141 | 3300005545 | Ga0070695_100128172 | Ga0070695_1001281722 | 109 |
| 142 | 3300005545 | Ga0070695_100217178 | Ga0070695_1002171783 | 109 |
| 143 | 3300005547 | Ga0070693_100026362 | Ga0070693_1000263623 | 109 |
| 144 | 3300005563 | Ga0068855_100128332 | Ga0068855_1001283322 | 109 |
| 145 | 3300005564 | Ga0070664_100016606 | Ga0070664_1000166064 | 109 |
| 146 | 3300005564 | Ga0070664_100016816 | Ga0070664_1000168163 | 109 |
| 147 | 3300005577 | Ga0068857_100004677 | Ga0068857_1000046776 | 109 |
| 148 | 3300005577 | Ga0068857_100009564 | Ga0068857_1000095645 | 109 |
| 149 | 3300005578 | Ga0068854_101411342 | Ga0068854_1014113421 | 109 |
| 150 | 3300005614 | Ga0068856_100037691 | Ga0068856_1000376913 | 109 |
| 151 | 3300005614 | Ga0068856_100092780 | Ga0068856_1000927803 | 109 |
| 152 | 3300005615 | Ga0070702_100006432 | Ga0070702_1000064324 | 109 |
| 153 | 3300005616 | Ga0068852_100228468 | Ga0068852_1002284683 | 109 |
| 154 | 3300005617 | Ga0068859_100112215 | Ga0068859_1001122152 | 109 |
| 155 | 3300005618 | Ga0068864_100024854 | Ga0068864_1000248545 | 109 |
| 156 | 3300005718 | Ga0068866_10094671 | Ga0068866_100946712 | 109 |
| 157 | 3300005840 | Ga0068870_10012644 | Ga0068870_100126442 | 109 |
| 158 | 3300005841 | Ga0068863_100029136 | Ga0068863_1000291363 | 109 |
| 159 | 3300005842 | Ga0068858_100192377 | Ga0068858_1001923772 | 109 |
| 160 | 3300005843 | Ga0068860_100021657 | Ga0068860_1000216576 | 109 |
| 161 | 3300006237 | Ga0097621_100010975 | Ga0097621_1000109752 | 109 |
| 162 | 3300006358 | Ga0068871_100284792 | Ga0068871_1002847923 | 109 |
| 163 | 3300006931 | Ga0097620_100112208 | Ga0097620_1001122083 | 109 |
| 164 | 3300009098 | Ga0105245_10340875 | Ga0105245_103408752 | 109 |
| 165 | 3300009174 | Ga0105241_10008171 | Ga0105241_100081716 | 109 |
| 166 | 3300009176 | Ga0105242_10101363 | Ga0105242_101013632 | 109 |
| 167 | 3300009176 | Ga0105242_11741771 | Ga0105242_117417711 | 109 |
| 168 | 3300009177 | Ga0105248_10325266 | Ga0105248_103252663 | 109 |
| 169 | 3300009551 | Ga0105238_10173727 | Ga0105238_101737273 | 109 |
| 170 | 3300010375 | Ga0105239_10025248 | Ga0105239_100252483 | 109 |
| 171 | 3300011119 | Ga0105246_10001421 | Ga0105246_100014217 | 109 |
| 172 | 3300013100 | Ga0157373_10338204 | Ga0157373_103382042 | 109 |
| 173 | 3300013102 | Ga0157371_10018782 | Ga0157371_100187824 | 109 |
| 174 | 3300013296 | Ga0157374_10251765 | Ga0157374_102517652 | 109 |
| 175 | 3300013297 | Ga0157378_10040562 | Ga0157378_100405623 | 109 |
| 176 | 3300013307 | Ga0157372_10057854 | Ga0157372_100578542 | 109 |
| 177 | 3300013308 | Ga0157375_10735713 | Ga0157375_107357132 | 109 |
| 178 | 3300014325 | Ga0163163_10514615 | Ga0163163_105146153 | 109 |
| 179 | 3300014745 | Ga0157377_10006216 | Ga0157377_100062164 | 109 |
| 180 | 3300014968 | Ga0157379_10214043 | Ga0157379_102140431 | 109 |
| 181 | 3300014969 | Ga0157376_10328044 | Ga0157376_103280442 | 109 |
| 182 | 3300025315 | Ga0207697_10206478 | Ga0207697_102064782 | 109 |
| 183 | 3300025907 | Ga0207645_10004100 | Ga0207645_100041008 | 109 |
| 184 | 3300025908 | Ga0207643_10024386 | Ga0207643_100243863 | 109 |
| 185 | 3300025911 | Ga0207654_10057461 | Ga0207654_100574613 | 109 |
| 186 | 3300025912 | Ga0207707_10006540 | Ga0207707_100065404 | 109 |
| 187 | 3300025912 | Ga0207707_10011937 | Ga0207707_100119374 | 109 |
| 188 | 3300025917 | Ga0207660_10009120 | Ga0207660_100091203 | 109 |
| 189 | 3300025917 | Ga0207660_10052123 | Ga0207660_100521234 | 109 |
| 190 | 3300025919 | Ga0207657_10126471 | Ga0207657_101264714 | 109 |
| 191 | 3300025920 | Ga0207649_10034288 | Ga0207649_100342884 | 109 |
| 192 | 3300025920 | Ga0207649_10112676 | Ga0207649_101126762 | 109 |
| 193 | 3300025921 | Ga0207652_10003240 | Ga0207652_100032403 | 109 |
| 194 | 3300025921 | Ga0207652_11421292 | Ga0207652_114212922 | 109 |
| 195 | 3300025925 | Ga0207650_10002341 | Ga0207650_100023417 | 109 |
| 196 | 3300025926 | Ga0207659_10005988 | Ga0207659_100059887 | 109 |
| 197 | 3300025927 | Ga0207687_10021571 | Ga0207687_100215712 | 109 |
| 198 | 3300025932 | Ga0207690_10008263 | Ga0207690_100082633 | 109 |
| 199 | 3300025933 | Ga0207706_10027416 | Ga0207706_100274164 | 109 |
| 200 | 3300025933 | Ga0207706_10103141 | Ga0207706_101031413 | 109 |
| 201 | 3300025934 | Ga0207686_10142532 | Ga0207686_101425323 | 109 |
| 202 | 3300025936 | Ga0207670_10131140 | Ga0207670_101311402 | 109 |
| 203 | 3300025938 | Ga0207704_10050315 | Ga0207704_100503153 | 109 |
| 204 | 3300025941 | Ga0207711_10140777 | Ga0207711_101407772 | 109 |
| 205 | 3300025942 | Ga0207689_10002618 | Ga0207689_100026183 | 109 |
| 206 | 3300025944 | Ga0207661_10000873 | Ga0207661_100008734 | 109 |
| 207 | 3300025944 | Ga0207661_10003817 | Ga0207661_100038173 | 109 |
| 208 | 3300025945 | Ga0207679_10001825 | Ga0207679_100018257 | 109 |
| 209 | 3300025945 | Ga0207679_10010401 | Ga0207679_100104014 | 109 |
| 210 | 3300025949 | Ga0207667_10058152 | Ga0207667_100581523 | 109 |
| 211 | 3300025960 | Ga0207651_10076222 | Ga0207651_100762223 | 109 |
| 212 | 3300025972 | Ga0207668_11065834 | Ga0207668_110658342 | 109 |
| 213 | 3300026023 | Ga0207677_10009848 | Ga0207677_100098484 | 109 |
| 214 | 3300026023 | Ga0207677_10662902 | Ga0207677_106629021 | 109 |
| 215 | 3300026035 | Ga0207703_10068730 | Ga0207703_100687303 | 109 |
| 216 | 3300026041 | Ga0207639_10180597 | Ga0207639_101805972 | 109 |
| 217 | 3300026041 | Ga0207639_10227883 | Ga0207639_102278832 | 109 |
| 218 | 3300026075 | Ga0207708_10046969 | Ga0207708_100469694 | 109 |
| 219 | 3300026078 | Ga0207702_10228532 | Ga0207702_102285323 | 109 |
| 220 | 3300026078 | Ga0207702_10265467 | Ga0207702_102654671 | 109 |
| 221 | 3300026088 | Ga0207641_10043525 | Ga0207641_100435253 | 109 |
| 222 | 3300026089 | Ga0207648_10235651 | Ga0207648_102356513 | 109 |
| 223 | 3300026095 | Ga0207676_10016488 | Ga0207676_100164883 | 109 |
| 224 | 3300026116 | Ga0207674_10002535 | Ga0207674_1000253514 | 109 |
| 225 | 3300026116 | Ga0207674_10012973 | Ga0207674_100129736 | 109 |
| 226 | 3300026142 | Ga0207698_10100267 | Ga0207698_101002672 | 109 |
| 227 | 3300028381 | Ga0268264_10090869 | Ga0268264_100908692 | 109 |
| 228 | 3300028381 | Ga0268264_11677734 | Ga0268264_116777341 | 109 |
| 229 | 3300032002 | Ga0307416_100317222 | Ga0307416_1003172223 | 109 |
| 230 | 3300032005 | Ga0307411_10697586 | Ga0307411_106975861 | 109 |
| 231 | 3300059491 | Ga0587070_016939 | Ga0587070_016939_731_1147 | 109 |
| 232 | 3300059504 | Ga0587082_049144 | Ga0587082_049144_185_601 | 109 |
| 233 | 3300059511 | Ga0587091_020731 | Ga0587091_020731_705_1121 | 109 |
| 234 | 3300060346 | Ga0587111_0181018 | Ga0587111_0181018_142_558 | 109 |
| 235 | 3300005339 | Ga0070660_100718842 | Ga0070660_1007188422 | 110 |
| 236 | 3300005353 | Ga0070669_100156457 | Ga0070669_1001564573 | 110 |
| 237 | 3300005445 | Ga0070708_100000052 | Ga0070708_10000005243 | 110 |
| 238 | 3300005467 | Ga0070706_100116838 | Ga0070706_1001168383 | 110 |
| 239 | 3300005468 | Ga0070707_100000643 | Ga0070707_1000006435 | 110 |
| 240 | 3300005518 | Ga0070699_100295801 | Ga0070699_1002958011 | 110 |
| 241 | 3300005844 | Ga0068862_100581222 | Ga0068862_1005812222 | 110 |
| 242 | 3300006847 | Ga0075431_100903771 | Ga0075431_1009037712 | 110 |
| 243 | 3300009148 | Ga0105243_10773134 | Ga0105243_107731342 | 110 |
| 244 | 3300013306 | Ga0163162_10199142 | Ga0163162_101991421 | 110 |
| 245 | 3300014745 | Ga0157377_10654553 | Ga0157377_106545532 | 110 |
| 246 | 3300025922 | Ga0207646_10004321 | Ga0207646_100043215 | 110 |
| 247 | 3300025923 | Ga0207681_10078694 | Ga0207681_100786942 | 110 |
| 248 | 3300028380 | Ga0268265_12196377 | Ga0268265_121963772 | 110 |
| 249 | 3300031548 | Ga0307408_100022367 | Ga0307408_1000223672 | 110 |
| 250 | 3300031548 | Ga0307408_101667969 | Ga0307408_1016679692 | 110 |
| 251 | 3300031731 | Ga0307405_10006748 | Ga0307405_100067483 | 110 |
| 252 | 3300031731 | Ga0307405_10059531 | Ga0307405_100595312 | 110 |
| 253 | 3300031731 | Ga0307405_11178038 | Ga0307405_111780381 | 110 |
| 254 | 3300031824 | Ga0307413_10003318 | Ga0307413_100033182 | 110 |
| 255 | 3300031824 | Ga0307413_10009506 | Ga0307413_100095065 | 110 |
| 256 | 3300031824 | Ga0307413_10191247 | Ga0307413_101912472 | 110 |
| 257 | 3300031852 | Ga0307410_10030194 | Ga0307410_100301943 | 110 |
| 258 | 3300031852 | Ga0307410_10030636 | Ga0307410_100306365 | 110 |
| 259 | 3300031852 | Ga0307410_10322835 | Ga0307410_103228351 | 110 |
| 260 | 3300031901 | Ga0307406_10020394 | Ga0307406_100203942 | 110 |
| 261 | 3300031901 | Ga0307406_10025247 | Ga0307406_100252475 | 110 |
| 262 | 3300031903 | Ga0307407_10013219 | Ga0307407_100132195 | 110 |
| 263 | 3300031903 | Ga0307407_10015557 | Ga0307407_100155573 | 110 |
| 264 | 3300031903 | Ga0307407_10049044 | Ga0307407_100490442 | 110 |
| 265 | 3300031903 | Ga0307407_10632672 | Ga0307407_106326722 | 110 |
| 266 | 3300031911 | Ga0307412_10129807 | Ga0307412_101298072 | 110 |
| 267 | 3300031911 | Ga0307412_10181271 | Ga0307412_101812712 | 110 |
| 268 | 3300031911 | Ga0307412_10323927 | Ga0307412_103239273 | 110 |
| 269 | 3300031995 | Ga0307409_100002735 | Ga0307409_1000027358 | 110 |
| 270 | 3300031995 | Ga0307409_100079525 | Ga0307409_1000795253 | 110 |
| 271 | 3300032002 | Ga0307416_100008465 | Ga0307416_1000084656 | 110 |
| 272 | 3300032002 | Ga0307416_100008817 | Ga0307416_1000088172 | 110 |
| 273 | 3300032002 | Ga0307416_100381702 | Ga0307416_1003817021 | 110 |
| 274 | 3300032004 | Ga0307414_10012566 | Ga0307414_100125662 | 110 |
| 275 | 3300032004 | Ga0307414_10027140 | Ga0307414_100271402 | 110 |
| 276 | 3300032004 | Ga0307414_10242345 | Ga0307414_102423452 | 110 |
| 277 | 3300032005 | Ga0307411_10015311 | Ga0307411_100153113 | 110 |
| 278 | 3300032005 | Ga0307411_10698073 | Ga0307411_106980732 | 110 |
| 279 | 3300032005 | Ga0307411_10760646 | Ga0307411_107606461 | 110 |
| 280 | 3300032126 | Ga0307415_100028103 | Ga0307415_1000281035 | 110 |
| 281 | 3300032126 | Ga0307415_100247137 | Ga0307415_1002471371 | 110 |
| 282 | 3300032126 | Ga0307415_100345964 | Ga0307415_1003459641 | 110 |
| 283 | 3300032126 | Ga0307415_100454281 | Ga0307415_1004542812 | 110 |
| 284 | 3300035118 | Ga0373954_0404274 | Ga0373954_0404274_167_571 | 110 |
| 285 | 3300035172 | Ga0373955_0088143 | Ga0373955_0088143_1251_1655 | 110 |
| 286 | 3300035724 | Ga0373933_0047772 | Ga0373933_0047772_293_697 | 110 |
| 287 | 3300036401 | Ga0373937_0089316 | Ga0373937_0089316_296_700 | 110 |
| 288 | 3300046454 | Ga0495592_0188349 | Ga0495592_0188349_24_428 | 110 |
| 289 | 3300046462 | Ga0495651_0059950 | Ga0495651_0059950_407_811 | 110 |
| 290 | 3300046463 | Ga0495653_0056836 | Ga0495653_0056836_313_717 | 110 |
| 291 | 3300046476 | Ga0495662_0006513 | Ga0495662_0006513_3295_3699 | 110 |
| 292 | 3300046477 | Ga0495664_0194277 | Ga0495664_0194277_226_630 | 110 |
| 293 | 3300046511 | Ga0495608_0022322 | Ga0495608_0022322_2918_3322 | 110 |
| 294 | 3300046514 | Ga0495618_0084631 | Ga0495618_0084631_583_987 | 110 |
| 295 | 3300046516 | Ga0495628_0038821 | Ga0495628_0038821_834_1238 | 110 |
| 296 | 3300046517 | Ga0495630_0011558 | Ga0495630_0011558_3070_3474 | 110 |
| 297 | 3300046529 | Ga0495652_0177164 | Ga0495652_0177164_916_1320 | 110 |
| 298 | 3300046529 | Ga0495652_0460804 | Ga0495652_0460804_175_579 | 110 |
| 299 | 3300046531 | Ga0495665_0072904 | Ga0495665_0072904_410_814 | 110 |
| 300 | 3300046533 | Ga0495640_0004624 | Ga0495640_0004624_8367_8771 | 110 |
| 301 | 3300046535 | Ga0495586_0036821 | Ga0495586_0036821_936_1340 | 110 |
| 302 | 3300046536 | Ga0495587_0116361 | Ga0495587_0116361_504_908 | 110 |
| 303 | 3300046536 | Ga0495587_0309706 | Ga0495587_0309706_305_709 | 110 |
| 304 | 3300046543 | Ga0495645_0094240 | Ga0495645_0094240_901_1305 | 110 |
| 305 | 3300046559 | Ga0495667_0012886 | Ga0495667_0012886_227_631 | 110 |
| 306 | 3300046642 | Ga0495634_0023849 | Ga0495634_0023849_1234_1638 | 110 |
| 307 | 3300046663 | Ga0495635_0045013 | Ga0495635_0045013_480_884 | 110 |
| 308 | 3300046675 | Ga0495657_0003392 | Ga0495657_0003392_2542_2946 | 110 |
| 309 | 3300046679 | Ga0495623_0072470 | Ga0495623_0072470_1423_1827 | 110 |
| 310 | 3300046680 | Ga0495646_0037731 | Ga0495646_0037731_2200_2604 | 110 |
| 311 | 3300046689 | Ga0495613_0029323 | Ga0495613_0029323_995_1399 | 110 |
| 312 | 3300046809 | Ga0495600_0505136 | Ga0495600_0505136_76_480 | 110 |
| 313 | 3300047317 | Ga0495604_0054807 | Ga0495604_0054807_2070_2474 | 110 |
| 314 | 3300047319 | Ga0495674_0172434 | Ga0495674_0172434_399_803 | 110 |
| 315 | 3300047322 | Ga0495680_0033583 | Ga0495680_0033583_829_1233 | 110 |
| 316 | 3300047444 | Ga0495675_0084915 | Ga0495675_0084915_707_1111 | 110 |
| 317 | 3300047471 | Ga0495684_0016565 | Ga0495684_0016565_3089_3493 | 110 |
| 318 | 3300047673 | Ga0495593_0121161 | Ga0495593_0121161_424_828 | 110 |
| 319 | 3300048088 | Ga0495602_0015244 | Ga0495602_0015244_5275_5679 | 110 |
| 320 | 3300049677 | Ga0501247_051939 | Ga0501247_051939_171_590 | 110 |
| 321 | 3300049682 | Ga0501252_042749 | Ga0501252_042749_103_522 | 110 |
| 322 | 3300050508 | nmdc:mga09592_580235_c1 | nmdc:mga09592_580235_c1_504_923 | 110 |
| 323 | 3300050509 | nmdc:mga0qj67_346845_c1 | nmdc:mga0qj67_346845_c1_746_1165 | 110 |
| 324 | 3300050510 | nmdc:mga06r32_364956_c1 | nmdc:mga06r32_364956_c1_529_948 | 110 |
| 325 | 3300053084 | Ga0495595_0109202 | Ga0495595_0109202_523_927 | 110 |
| 326 | 3300053085 | Ga0495619_0380228 | Ga0495619_0380228_181_585 | 110 |
| 327 | 3300005330 | Ga0070690_100114633 | Ga0070690_1001146332 | 111 |
| 328 | 3300005335 | Ga0070666_10561459 | Ga0070666_105614591 | 111 |
| 329 | 3300005336 | Ga0070680_100016292 | Ga0070680_1000162927 | 111 |
| 330 | 3300005338 | Ga0068868_100404258 | Ga0068868_1004042582 | 111 |
| 331 | 3300005340 | Ga0070689_100129319 | Ga0070689_1001293193 | 111 |
| 332 | 3300005353 | Ga0070669_100162182 | Ga0070669_1001621823 | 111 |
| 333 | 3300005355 | Ga0070671_100168965 | Ga0070671_1001689652 | 111 |
| 334 | 3300005364 | Ga0070673_100207421 | Ga0070673_1002074212 | 111 |
| 335 | 3300005367 | Ga0070667_100287263 | Ga0070667_1002872631 | 111 |
| 336 | 3300005455 | Ga0070663_100507881 | Ga0070663_1005078812 | 111 |
| 337 | 3300005458 | Ga0070681_10028042 | Ga0070681_100280424 | 111 |
| 338 | 3300005530 | Ga0070679_100484767 | Ga0070679_1004847673 | 111 |
| 339 | 3300005546 | Ga0070696_100021816 | Ga0070696_1000218165 | 111 |
| 340 | 3300005547 | Ga0070693_100001153 | Ga0070693_1000011538 | 111 |
| 341 | 3300005564 | Ga0070664_100379717 | Ga0070664_1003797172 | 111 |
| 342 | 3300005615 | Ga0070702_100258889 | Ga0070702_1002588892 | 111 |
| 343 | 3300005618 | Ga0068864_100715651 | Ga0068864_1007156512 | 111 |
| 344 | 3300005842 | Ga0068858_101271932 | Ga0068858_1012719322 | 111 |
| 345 | 3300005843 | Ga0068860_100321849 | Ga0068860_1003218493 | 111 |
| 346 | 3300009177 | Ga0105248_10408669 | Ga0105248_104086692 | 111 |
| 347 | 3300009545 | Ga0105237_11487973 | Ga0105237_114879731 | 111 |
| 348 | 3300012485 | Ga0157325_1029447 | Ga0157325_10294471 | 111 |
| 349 | 3300013100 | Ga0157373_10365855 | Ga0157373_103658552 | 111 |
| 350 | 3300025903 | Ga0207680_10538310 | Ga0207680_105383102 | 111 |
| 351 | 3300025912 | Ga0207707_10107250 | Ga0207707_101072504 | 111 |
| 352 | 3300025917 | Ga0207660_10140041 | Ga0207660_101400412 | 111 |
| 353 | 3300025921 | Ga0207652_10013086 | Ga0207652_100130867 | 111 |
| 354 | 3300025931 | Ga0207644_10838691 | Ga0207644_108386911 | 111 |
| 355 | 3300025940 | Ga0207691_10330784 | Ga0207691_103307841 | 111 |
| 356 | 3300025945 | Ga0207679_10571381 | Ga0207679_105713812 | 111 |
| 357 | 3300025986 | Ga0207658_10333550 | Ga0207658_103335502 | 111 |
| 358 | 3300026023 | Ga0207677_10327605 | Ga0207677_103276051 | 111 |
| 359 | 3300028381 | Ga0268264_10224201 | Ga0268264_102242013 | 111 |
| 360 | 3300031911 | Ga0307412_10647308 | Ga0307412_106473081 | 111 |
| 361 | 3300059511 | Ga0587091_165143 | Ga0587091_165143_12_437 | 111 |
| 362 | 3300059640 | Ga0587067_138613 | Ga0587067_138613_25_450 | 111 |
| 363 | 3300059643 | Ga0587072_121028 | Ga0587072_121028_171_596 | 111 |
| 364 | 3300059645 | Ga0587076_191070 | Ga0587076_191070_76_495 | 111 |
| 365 | 3300005347 | Ga0070668_100045342 | Ga0070668_1000453424 | 112 |
| 366 | 3300005467 | Ga0070706_100045503 | Ga0070706_1000455031 | 112 |
| 367 | 3300005548 | Ga0070665_100141300 | Ga0070665_1001413003 | 112 |
| 368 | 3300009553 | Ga0105249_10000089 | Ga0105249_1000008985 | 112 |
| 369 | 3300025910 | Ga0207684_10725513 | Ga0207684_107255131 | 112 |
| 370 | 3300025920 | Ga0207649_10880002 | Ga0207649_108800021 | 112 |
| 371 | 3300025961 | Ga0207712_10000181 | Ga0207712_1000018158 | 112 |
| 372 | 3300025972 | Ga0207668_10033958 | Ga0207668_100339584 | 112 |
| 373 | 3300028379 | Ga0268266_10108358 | Ga0268266_101083583 | 112 |
| 374 | 3300030763 | Ga0265763_1025246 | Ga0265763_10252462 | 112 |
| 375 | 3300031548 | Ga0307408_100776084 | Ga0307408_1007760841 | 112 |
| 376 | 3300031824 | Ga0307413_10372172 | Ga0307413_103721721 | 112 |
| 377 | 3300031852 | Ga0307410_10035924 | Ga0307410_100359241 | 112 |
| 378 | 3300031852 | Ga0307410_10217083 | Ga0307410_102170832 | 112 |
| 379 | 3300031901 | Ga0307406_11328512 | Ga0307406_113285121 | 112 |
| 380 | 3300032002 | Ga0307416_102850959 | Ga0307416_1028509591 | 112 |
| 381 | 3300042435 | Ga0439434_0055395 | Ga0439434_0055395_51_467 | 112 |
| 382 | 3300005293 | Ga0065715_10287769 | Ga0065715_102877692 | 113 |
| 383 | 3300005293 | Ga0065715_10443454 | Ga0065715_104434541 | 113 |
| 384 | 3300005329 | Ga0070683_100409308 | Ga0070683_1004093081 | 113 |
| 385 | 3300005336 | Ga0070680_100473624 | Ga0070680_1004736241 | 113 |
| 386 | 3300005457 | Ga0070662_100137636 | Ga0070662_1001376363 | 113 |
| 387 | 3300005459 | Ga0068867_100292903 | Ga0068867_1002929033 | 113 |
| 388 | 3300005577 | Ga0068857_102098703 | Ga0068857_1020987032 | 113 |
| 389 | 3300009093 | Ga0105240_10640993 | Ga0105240_106409932 | 113 |
| 390 | 3300009551 | Ga0105238_10589861 | Ga0105238_105898613 | 113 |
| 391 | 3300013105 | Ga0157369_10049701 | Ga0157369_100497013 | 113 |
| 392 | 3300025917 | Ga0207660_10521181 | Ga0207660_105211812 | 113 |
| 393 | 3300025933 | Ga0207706_10110685 | Ga0207706_101106852 | 113 |
| 394 | 3300025981 | Ga0207640_10450020 | Ga0207640_104500202 | 113 |
| 395 | 3300026089 | Ga0207648_10290183 | Ga0207648_102901833 | 113 |
| 396 | 3300026116 | Ga0207674_11411031 | Ga0207674_114110312 | 113 |
| 397 | 3300031548 | Ga0307408_100432718 | Ga0307408_1004327183 | 113 |
| 398 | 3300031731 | Ga0307405_10174691 | Ga0307405_101746912 | 113 |
| 399 | 3300031824 | Ga0307413_10715697 | Ga0307413_107156972 | 113 |
| 400 | 3300031852 | Ga0307410_10174202 | Ga0307410_101742022 | 113 |
| 401 | 3300031901 | Ga0307406_10103327 | Ga0307406_101033273 | 113 |
| 402 | 3300031911 | Ga0307412_10326896 | Ga0307412_103268963 | 113 |
| 403 | 3300031995 | Ga0307409_100083082 | Ga0307409_1000830823 | 113 |
| 404 | 3300032002 | Ga0307416_100023776 | Ga0307416_1000237764 | 113 |
| 405 | 3300032005 | Ga0307411_10227566 | Ga0307411_102275663 | 113 |
| 406 | 3300032126 | Ga0307415_100184652 | Ga0307415_1001846521 | 113 |
| 407 | 3300032126 | Ga0307415_101747941 | Ga0307415_1017479411 | 113 |
| 408 | 3300036401 | Ga0373937_1151606 | Ga0373937_1151606_271_669 | 113 |
| 409 | 3300045976 | Ga0466967_0353405 | Ga0466967_0353405_619_1035 | 113 |
| 410 | 3300046476 | Ga0495662_0566138 | Ga0495662_0566138_55_453 | 113 |
| 411 | 3300046511 | Ga0495608_0126548 | Ga0495608_0126548_780_1178 | 113 |
| 412 | 3300046517 | Ga0495630_0089210 | Ga0495630_0089210_1846_2244 | 113 |
| 413 | 3300046529 | Ga0495652_0061826 | Ga0495652_0061826_132_530 | 113 |
| 414 | 3300046559 | Ga0495667_0170318 | Ga0495667_0170318_575_973 | 113 |
| 415 | 3300047315 | Ga0495581_0208474 | Ga0495581_0208474_486_884 | 113 |
| 416 | 3300047444 | Ga0495675_0068082 | Ga0495675_0068082_128_526 | 113 |
| 417 | 3300047471 | Ga0495684_0025329 | Ga0495684_0025329_386_784 | 113 |
| 418 | 3300049654 | Ga0501207_011481 | Ga0501207_011481_28_444 | 113 |
| 419 | 3300049660 | Ga0501216_005790 | Ga0501216_005790_337_753 | 113 |
| 420 | 3300049661 | Ga0501217_020816 | Ga0501217_020816_760_1176 | 113 |
| 421 | 3300049664 | Ga0501224_002274 | Ga0501224_002274_2040_2456 | 113 |
| 422 | 3300049667 | Ga0501230_016822 | Ga0501230_016822_83_499 | 113 |
| 423 | 3300049668 | Ga0501233_002061 | Ga0501233_002061_2435_2851 | 113 |
| 424 | 3300049669 | Ga0501235_003188 | Ga0501235_003188_107_523 | 113 |
| 425 | 3300049674 | Ga0501242_010215 | Ga0501242_010215_217_633 | 113 |
| 426 | 3300049677 | Ga0501247_014257 | Ga0501247_014257_489_905 | 113 |
| 427 | 3300049679 | Ga0501249_080489 | Ga0501249_080489_28_444 | 113 |
| 428 | 3300049682 | Ga0501252_000489 | Ga0501252_000489_115_531 | 113 |
| 429 | 3300049690 | Ga0501261_007497 | Ga0501261_007497_945_1361 | 113 |
| 430 | 3300049704 | Ga0501221_003414 | Ga0501221_003414_665_1081 | 113 |
| 431 | 3300049705 | Ga0501225_0013296 | Ga0501225_0013296_587_1003 | 113 |
| 432 | 3300049707 | Ga0501234_042886 | Ga0501234_042886_153_569 | 113 |
| 433 | 3300049708 | Ga0501245_005236 | Ga0501245_005236_806_1222 | 113 |
| 434 | 3300049759 | Ga0501262_006240 | Ga0501262_006240_425_841 | 113 |
| 435 | 3300049763 | Ga0501266_002003 | Ga0501266_002003_385_801 | 113 |
| 436 | 3300049767 | Ga0501270_008782 | Ga0501270_008782_827_1243 | 113 |
| 437 | 3300049768 | Ga0501271_035135 | Ga0501271_035135_136_552 | 113 |
| 438 | 3300049770 | Ga0501273_057980 | Ga0501273_057980_175_591 | 113 |
| 439 | 3300059492 | Ga0587073_0187586 | Ga0587073_0187586_163_585 | 113 |
| 440 | 3300059625 | Ga0587113_050434 | Ga0587113_050434_22_444 | 113 |
| 441 | 3300005336 | Ga0070680_100561467 | Ga0070680_1005614672 | 114 |
| 442 | 3300009553 | Ga0105249_12911401 | Ga0105249_129114011 | 114 |
| 443 | 3300013104 | Ga0157370_10311764 | Ga0157370_103117641 | 114 |
| 444 | 3300015262 | Ga0182007_10196697 | Ga0182007_101966972 | 114 |
| 445 | 3300032002 | Ga0307416_101222220 | Ga0307416_1012222201 | 114 |
| 446 | 3300044706 | Ga0466964_0477592 | Ga0466964_0477592_64_501 | 114 |
| 447 | 3300004799 | Ga0058863_10030836 | Ga0058863_100308361 | 115 |
| 448 | 3300004800 | Ga0058861_11988692 | Ga0058861_119886922 | 115 |
| 449 | 3300004800 | Ga0058861_12072470 | Ga0058861_120724701 | 115 |
| 450 | 3300005327 | Ga0070658_10116648 | Ga0070658_101166483 | 115 |
| 451 | 3300005354 | Ga0070675_100246948 | Ga0070675_1002469482 | 115 |
| 452 | 3300005364 | Ga0070673_100295875 | Ga0070673_1002958752 | 115 |
| 453 | 3300005471 | Ga0070698_100006166 | Ga0070698_10000616613 | 115 |
| 454 | 3300005518 | Ga0070699_100406117 | Ga0070699_1004061173 | 115 |
| 455 | 3300005535 | Ga0070684_100033315 | Ga0070684_1000333153 | 115 |
| 456 | 3300005564 | Ga0070664_101442531 | Ga0070664_1014425312 | 115 |
| 457 | 3300009545 | Ga0105237_10553013 | Ga0105237_105530133 | 115 |
| 458 | 3300009551 | Ga0105238_10493845 | Ga0105238_104938453 | 115 |
| 459 | 3300025909 | Ga0207705_10090089 | Ga0207705_100900892 | 115 |
| 460 | 3300025926 | Ga0207659_10219174 | Ga0207659_102191742 | 115 |
| 461 | 3300025944 | Ga0207661_10216907 | Ga0207661_102169072 | 115 |
| 462 | 3300025960 | Ga0207651_10135290 | Ga0207651_101352902 | 115 |
| 463 | 3300026116 | Ga0207674_10494805 | Ga0207674_104948053 | 115 |
| 464 | 3300046473 | Ga0495582_0076878 | Ga0495582_0076878_439_843 | 115 |
| 465 | 3300046477 | Ga0495664_0320743 | Ga0495664_0320743_435_839 | 115 |
| 466 | 3300046499 | Ga0495594_0012998 | Ga0495594_0012998_1108_1512 | 115 |
| 467 | 3300046531 | Ga0495665_0213679 | Ga0495665_0213679_481_885 | 115 |
| 468 | 3300046543 | Ga0495645_0223786 | Ga0495645_0223786_202_606 | 115 |
| 469 | 3300046674 | Ga0495588_0110483 | Ga0495588_0110483_26_430 | 115 |
| 470 | 3300046678 | Ga0495599_0096910 | Ga0495599_0096910_444_848 | 115 |
| 471 | 3300046678 | Ga0495599_0153740 | Ga0495599_0153740_400_807 | 115 |
| 472 | 3300046680 | Ga0495646_0265266 | Ga0495646_0265266_112_516 | 115 |
| 473 | 3300046683 | Ga0495658_0424212 | Ga0495658_0424212_293_697 | 115 |
| 474 | 3300047319 | Ga0495674_0048052 | Ga0495674_0048052_2385_2789 | 115 |
| 475 | 3300004803 | Ga0058862_12775103 | Ga0058862_127751033 | 116 |
| 476 | 3300005336 | Ga0070680_101323455 | Ga0070680_1013234551 | 116 |
| 477 | 3300005355 | Ga0070671_100131468 | Ga0070671_1001314682 | 116 |
| 478 | 3300005364 | Ga0070673_100189519 | Ga0070673_1001895193 | 116 |
| 479 | 3300005530 | Ga0070679_100087543 | Ga0070679_1000875433 | 116 |
| 480 | 3300005843 | Ga0068860_100954314 | Ga0068860_1009543142 | 116 |
| 481 | 3300006237 | Ga0097621_100518440 | Ga0097621_1005184402 | 116 |
| 482 | 3300011119 | Ga0105246_10638675 | Ga0105246_106386752 | 116 |
| 483 | 3300025917 | Ga0207660_11050119 | Ga0207660_110501192 | 116 |
| 484 | 3300025921 | Ga0207652_10175589 | Ga0207652_101755892 | 116 |
| 485 | 3300025931 | Ga0207644_10238659 | Ga0207644_102386592 | 116 |
| 486 | 3300025960 | Ga0207651_10380178 | Ga0207651_103801782 | 116 |
| 487 | 3300025981 | Ga0207640_10505222 | Ga0207640_105052222 | 116 |
| 488 | 3300035083 | Ga0373926_0162822 | Ga0373926_0162822_251_685 | 116 |
| 489 | 3300035089 | Ga0373944_0209307 | Ga0373944_0209307_52_486 | 116 |
| 490 | 3300035170 | Ga0373943_0029448 | Ga0373943_0029448_1148_1582 | 116 |
| 491 | 3300035171 | Ga0373946_0332237 | Ga0373946_0332237_164_598 | 116 |
| 492 | 3300037068 | Ga0373925_0031465 | Ga0373925_0031465_405_839 | 116 |
| 493 | 3300046473 | Ga0495582_0165473 | Ga0495582_0165473_306_743 | 116 |
| 494 | 3300046517 | Ga0495630_0017051 | Ga0495630_0017051_4486_4920 | 116 |
| 495 | 3300046526 | Ga0495666_0364095 | Ga0495666_0364095_79_513 | 116 |
| 496 | 3300046535 | Ga0495586_0051997 | Ga0495586_0051997_660_1094 | 116 |
| 497 | 3300046539 | Ga0495621_0261692 | Ga0495621_0261692_94_516 | 116 |
| 498 | 3300046689 | Ga0495613_0696688 | Ga0495613_0696688_145_579 | 116 |
| 499 | 3300047315 | Ga0495581_0033867 | Ga0495581_0033867_192_626 | 116 |
| 500 | 3300047673 | Ga0495593_0038393 | Ga0495593_0038393_82_516 | 116 |
| 501 | 3300059646 | Ga0587078_008240 | Ga0587078_008240_709_1146 | 116 |
| 502 | 3300005331 | Ga0070670_100674750 | Ga0070670_1006747502 | 117 |
| 503 | 3300005466 | Ga0070685_10167664 | Ga0070685_101676642 | 117 |
| 504 | 3300021384 | Ga0213876_10083965 | Ga0213876_100839653 | 117 |
| 505 | 3300025925 | Ga0207650_10626529 | Ga0207650_106265292 | 117 |
| 506 | 3300039437 | Ga0436365_0013958 | Ga0436365_0013958_717_1166 | 117 |
| 507 | 3300042876 | Ga0451577_0029491 | Ga0451577_0029491_2619_3032 | 117 |
| 508 | 3300004799 | Ga0058863_10042616 | Ga0058863_100426163 | 118 |
| 509 | 3300005327 | Ga0070658_10027578 | Ga0070658_100275783 | 118 |
| 510 | 3300005329 | Ga0070683_101555253 | Ga0070683_1015552532 | 118 |
| 511 | 3300005341 | Ga0070691_10227759 | Ga0070691_102277591 | 118 |
| 512 | 3300005434 | Ga0070709_10004433 | Ga0070709_100044333 | 118 |
| 513 | 3300005436 | Ga0070713_101396839 | Ga0070713_1013968392 | 118 |
| 514 | 3300005439 | Ga0070711_100931222 | Ga0070711_1009312221 | 118 |
| 515 | 3300005458 | Ga0070681_10135556 | Ga0070681_101355563 | 118 |
| 516 | 3300005467 | Ga0070706_100488462 | Ga0070706_1004884621 | 118 |
| 517 | 3300005535 | Ga0070684_101458084 | Ga0070684_1014580841 | 118 |
| 518 | 3300005546 | Ga0070696_100239800 | Ga0070696_1002398002 | 118 |
| 519 | 3300005578 | Ga0068854_100747947 | Ga0068854_1007479472 | 118 |
| 520 | 3300005616 | Ga0068852_100215707 | Ga0068852_1002157072 | 118 |
| 521 | 3300009093 | Ga0105240_10062939 | Ga0105240_100629396 | 118 |
| 522 | 3300009148 | Ga0105243_10051387 | Ga0105243_100513873 | 118 |
| 523 | 3300009174 | Ga0105241_10141303 | Ga0105241_101413034 | 118 |
| 524 | 3300009545 | Ga0105237_11764798 | Ga0105237_117647982 | 118 |
| 525 | 3300009553 | Ga0105249_10130805 | Ga0105249_101308053 | 118 |
| 526 | 3300013104 | Ga0157370_10389222 | Ga0157370_103892221 | 118 |
| 527 | 3300013105 | Ga0157369_10969548 | Ga0157369_109695481 | 118 |
| 528 | 3300013296 | Ga0157374_10827102 | Ga0157374_108271021 | 118 |
| 529 | 3300013306 | Ga0163162_10041886 | Ga0163162_100418863 | 118 |
| 530 | 3300013306 | Ga0163162_10894075 | Ga0163162_108940752 | 118 |
| 531 | 3300013307 | Ga0157372_10809219 | Ga0157372_108092193 | 118 |
| 532 | 3300013307 | Ga0157372_10918018 | Ga0157372_109180182 | 118 |
| 533 | 3300013308 | Ga0157375_10090441 | Ga0157375_100904413 | 118 |
| 534 | 3300020082 | Ga0206353_11117605 | Ga0206353_111176052 | 118 |
| 535 | 3300025906 | Ga0207699_10031799 | Ga0207699_100317995 | 118 |
| 536 | 3300025909 | Ga0207705_10114841 | Ga0207705_101148413 | 118 |
| 537 | 3300025912 | Ga0207707_10847738 | Ga0207707_108477382 | 118 |
| 538 | 3300025915 | Ga0207693_11133062 | Ga0207693_111330621 | 118 |
| 539 | 3300025916 | Ga0207663_10036893 | Ga0207663_100368932 | 118 |
| 540 | 3300025916 | Ga0207663_10355872 | Ga0207663_103558721 | 118 |
| 541 | 3300025918 | Ga0207662_10146004 | Ga0207662_101460042 | 118 |
| 542 | 3300025919 | Ga0207657_10062737 | Ga0207657_100627371 | 118 |
| 543 | 3300025920 | Ga0207649_11085095 | Ga0207649_110850952 | 118 |
| 544 | 3300025929 | Ga0207664_10737295 | Ga0207664_107372952 | 118 |
| 545 | 3300025932 | Ga0207690_10071868 | Ga0207690_100718682 | 118 |
| 546 | 3300025981 | Ga0207640_10708745 | Ga0207640_107087451 | 118 |
| 547 | 3300026041 | Ga0207639_11148082 | Ga0207639_111480822 | 118 |
| 548 | 3300026142 | Ga0207698_10264691 | Ga0207698_102646912 | 118 |
| 549 | 3300039437 | Ga0436365_0569575 | Ga0436365_0569575_44_475 | 118 |
| 550 | 3300041443 | Ga0451789_1178062 | Ga0451789_1178062_112_543 | 118 |
| 551 | 3300045976 | Ga0466967_0026287 | Ga0466967_0026287_1082_1507 | 118 |
| 552 | 3300047320 | Ga0495672_0007750 | Ga0495672_0007750_3032_3460 | 118 |
| 553 | 3300048907 | Ga0496104_0165984 | Ga0496104_0165984_574_1002 | 118 |
| 554 | 3300005327 | Ga0070658_10067868 | Ga0070658_100678683 | 119 |
| 555 | 3300005331 | Ga0070670_100290046 | Ga0070670_1002900462 | 119 |
| 556 | 3300005341 | Ga0070691_10782145 | Ga0070691_107821451 | 119 |
| 557 | 3300009176 | Ga0105242_10924669 | Ga0105242_109246692 | 119 |
| 558 | 3300025925 | Ga0207650_11376636 | Ga0207650_113766361 | 119 |
| 559 | 3300025944 | Ga0207661_10101431 | Ga0207661_101014312 | 119 |
| 560 | 3300035695 | Ga0373927_0033533 | Ga0373927_0033533_690_1121 | 119 |
| 561 | 3300035695 | Ga0373927_0068207 | Ga0373927_0068207_1243_1671 | 119 |
| 562 | 3300035695 | Ga0373927_0565642 | Ga0373927_0565642_219_647 | 119 |
| 563 | 3300036401 | Ga0373937_1503722 | Ga0373937_1503722_35_466 | 119 |
| 564 | 3300044693 | Ga0466961_0509750 | Ga0466961_0509750_193_630 | 119 |
| 565 | 3300046472 | Ga0495580_0106064 | Ga0495580_0106064_1032_1460 | 119 |
| 566 | 3300046499 | Ga0495594_0002515 | Ga0495594_0002515_1316_1744 | 119 |
| 567 | 3300046517 | Ga0495630_0944108 | Ga0495630_0944108_153_581 | 119 |
| 568 | 3300047319 | Ga0495674_0186240 | Ga0495674_0186240_149_580 | 119 |
| 569 | 3300049587 | Ga0501071_1254614 | Ga0501071_1254614_10_444 | 119 |
| 570 | 3300050508 | nmdc:mga09592_817718_c1 | nmdc:mga09592_817718_c1_104_538 | 119 |
| 571 | 3300004798 | Ga0058859_11806325 | Ga0058859_118063251 | 120 |
| 572 | 3300005290 | Ga0065712_10105869 | Ga0065712_101058691 | 120 |
| 573 | 3300005293 | Ga0065715_10219187 | Ga0065715_102191873 | 120 |
| 574 | 3300005327 | Ga0070658_10372861 | Ga0070658_103728611 | 120 |
| 575 | 3300005329 | Ga0070683_100017034 | Ga0070683_1000170347 | 120 |
| 576 | 3300005330 | Ga0070690_100108436 | Ga0070690_1001084363 | 120 |
| 577 | 3300005331 | Ga0070670_100084678 | Ga0070670_1000846783 | 120 |
| 578 | 3300005339 | Ga0070660_100748471 | Ga0070660_1007484711 | 120 |
| 579 | 3300005343 | Ga0070687_100199314 | Ga0070687_1001993142 | 120 |
| 580 | 3300005344 | Ga0070661_100086675 | Ga0070661_1000866752 | 120 |
| 581 | 3300005344 | Ga0070661_100216428 | Ga0070661_1002164282 | 120 |
| 582 | 3300005347 | Ga0070668_100045342 | Ga0070668_1000453422 | 120 |
| 583 | 3300005353 | Ga0070669_100014167 | Ga0070669_1000141674 | 120 |
| 584 | 3300005354 | Ga0070675_100116171 | Ga0070675_1001161712 | 120 |
| 585 | 3300005365 | Ga0070688_100004495 | Ga0070688_1000044953 | 120 |
| 586 | 3300005367 | Ga0070667_100316185 | Ga0070667_1003161853 | 120 |
| 587 | 3300005436 | Ga0070713_100045324 | Ga0070713_1000453244 | 120 |
| 588 | 3300005466 | Ga0070685_10109256 | Ga0070685_101092562 | 120 |
| 589 | 3300005535 | Ga0070684_100004296 | Ga0070684_1000042967 | 120 |
| 590 | 3300005535 | Ga0070684_100693986 | Ga0070684_1006939861 | 120 |
| 591 | 3300005543 | Ga0070672_100083137 | Ga0070672_1000831373 | 120 |
| 592 | 3300005548 | Ga0070665_100141300 | Ga0070665_1001413005 | 120 |
| 593 | 3300005548 | Ga0070665_100354768 | Ga0070665_1003547682 | 120 |
| 594 | 3300005563 | Ga0068855_100114484 | Ga0068855_1001144843 | 120 |
| 595 | 3300005577 | Ga0068857_100094341 | Ga0068857_1000943412 | 120 |
| 596 | 3300005617 | Ga0068859_100088363 | Ga0068859_1000883633 | 120 |
| 597 | 3300005618 | Ga0068864_100137544 | Ga0068864_1001375443 | 120 |
| 598 | 3300005618 | Ga0068864_101006439 | Ga0068864_1010064391 | 120 |
| 599 | 3300005840 | Ga0068870_10020135 | Ga0068870_100201353 | 120 |
| 600 | 3300006880 | Ga0075429_100303956 | Ga0075429_1003039563 | 120 |
| 601 | 3300006931 | Ga0097620_100088359 | Ga0097620_1000883593 | 120 |
| 602 | 3300009094 | Ga0111539_10187731 | Ga0111539_101877313 | 120 |
| 603 | 3300009101 | Ga0105247_10828089 | Ga0105247_108280892 | 120 |
| 604 | 3300009545 | Ga0105237_10320891 | Ga0105237_103208912 | 120 |
| 605 | 3300009545 | Ga0105237_10445491 | Ga0105237_104454912 | 120 |
| 606 | 3300009551 | Ga0105238_10895881 | Ga0105238_108958812 | 120 |
| 607 | 3300009553 | Ga0105249_10000089 | Ga0105249_1000008987 | 120 |
| 608 | 3300013105 | Ga0157369_10059499 | Ga0157369_100594991 | 120 |
| 609 | 3300013307 | Ga0157372_10194884 | Ga0157372_101948843 | 120 |
| 610 | 3300013307 | Ga0157372_10214535 | Ga0157372_102145353 | 120 |
| 611 | 3300013308 | Ga0157375_10016467 | Ga0157375_100164673 | 120 |
| 612 | 3300014969 | Ga0157376_10060490 | Ga0157376_100604903 | 120 |
| 613 | 3300020070 | Ga0206356_10071443 | Ga0206356_100714434 | 120 |
| 614 | 3300020075 | Ga0206349_1665041 | Ga0206349_16650412 | 120 |
| 615 | 3300020078 | Ga0206352_10170617 | Ga0206352_101706172 | 120 |
| 616 | 3300020082 | Ga0206353_11922409 | Ga0206353_119224092 | 120 |
| 617 | 3300022467 | Ga0224712_10206475 | Ga0224712_102064752 | 120 |
| 618 | 3300025901 | Ga0207688_10087613 | Ga0207688_100876133 | 120 |
| 619 | 3300025907 | Ga0207645_10505950 | Ga0207645_105059502 | 120 |
| 620 | 3300025913 | Ga0207695_10012644 | Ga0207695_100126448 | 120 |
| 621 | 3300025914 | Ga0207671_10479321 | Ga0207671_104793212 | 120 |
| 622 | 3300025914 | Ga0207671_10871903 | Ga0207671_108719032 | 120 |
| 623 | 3300025918 | Ga0207662_10001709 | Ga0207662_1000170911 | 120 |
| 624 | 3300025920 | Ga0207649_10314641 | Ga0207649_103146412 | 120 |
| 625 | 3300025923 | Ga0207681_10004359 | Ga0207681_100043591 | 120 |
| 626 | 3300025924 | Ga0207694_11462461 | Ga0207694_114624611 | 120 |
| 627 | 3300025925 | Ga0207650_10049790 | Ga0207650_100497903 | 120 |
| 628 | 3300025926 | Ga0207659_10027390 | Ga0207659_100273902 | 120 |
| 629 | 3300025928 | Ga0207700_10024941 | Ga0207700_100249413 | 120 |
| 630 | 3300025940 | Ga0207691_10300556 | Ga0207691_103005561 | 120 |
| 631 | 3300025944 | Ga0207661_10063636 | Ga0207661_100636363 | 120 |
| 632 | 3300025961 | Ga0207712_10000181 | Ga0207712_1000018160 | 120 |
| 633 | 3300025972 | Ga0207668_10033958 | Ga0207668_100339586 | 120 |
| 634 | 3300025986 | Ga0207658_11065008 | Ga0207658_110650082 | 120 |
| 635 | 3300026095 | Ga0207676_10178562 | Ga0207676_101785623 | 120 |
| 636 | 3300026116 | Ga0207674_10026159 | Ga0207674_100261597 | 120 |
| 637 | 3300027907 | Ga0207428_10201907 | Ga0207428_102019073 | 120 |
| 638 | 3300028379 | Ga0268266_10108358 | Ga0268266_101083581 | 120 |
| 639 | 3300028379 | Ga0268266_11050400 | Ga0268266_110504001 | 120 |
| 640 | 3300031548 | Ga0307408_100011913 | Ga0307408_1000119133 | 120 |
| 641 | 3300031731 | Ga0307405_10002332 | Ga0307405_100023325 | 120 |
| 642 | 3300031824 | Ga0307413_10079566 | Ga0307413_100795662 | 120 |
| 643 | 3300031852 | Ga0307410_10003426 | Ga0307410_100034268 | 120 |
| 644 | 3300031901 | Ga0307406_10000977 | Ga0307406_100009778 | 120 |
| 645 | 3300031903 | Ga0307407_11554464 | Ga0307407_115544641 | 120 |
| 646 | 3300031911 | Ga0307412_10000533 | Ga0307412_1000053320 | 120 |
| 647 | 3300031995 | Ga0307409_100021235 | Ga0307409_1000212353 | 120 |
| 648 | 3300032002 | Ga0307416_100027093 | Ga0307416_1000270932 | 120 |
| 649 | 3300032002 | Ga0307416_100839885 | Ga0307416_1008398852 | 120 |
| 650 | 3300032004 | Ga0307414_10002477 | Ga0307414_100024774 | 120 |
| 651 | 3300032005 | Ga0307411_10001923 | Ga0307411_100019238 | 120 |
| 652 | 3300032005 | Ga0307411_10774329 | Ga0307411_107743292 | 120 |
| 653 | 3300032126 | Ga0307415_100003516 | Ga0307415_1000035168 | 120 |
| 654 | 3300035691 | Ga0373931_0023542 | Ga0373931_0023542_233_664 | 120 |
| 655 | 3300048913 | Ga0496110_0815835 | Ga0496110_0815835_273_704 | 120 |
| 656 | 3300048916 | Ga0496113_1418816 | Ga0496113_1418816_31_450 | 120 |
| 657 | 3300049589 | Ga0501073_0175852 | Ga0501073_0175852_317_748 | 120 |
| 658 | 3300049677 | Ga0501247_034840 | Ga0501247_034840_111_530 | 120 |
| 659 | 3300049679 | Ga0501249_045259 | Ga0501249_045259_489_911 | 120 |
| 660 | 3300050508 | nmdc:mga09592_264993_c1 | nmdc:mga09592_264993_c1_760_1179 | 120 |
| 661 | 3300050511 | nmdc:mga08y16_307808_c1 | nmdc:mga08y16_307808_c1_439_858 | 120 |
| 662 | 3300050513 | nmdc:mga0rr50_394144_c1 | nmdc:mga0rr50_394144_c1_293_724 | 120 |
| 663 | 3300059644 | Ga0587075_048258 | Ga0587075_048258_294_725 | 120 |
| 664 | 3300003544 | Ga0007417J51691_1054800 | Ga0007417J51691_10548002 | 121 |
| 665 | 3300003574 | Ga0007410J51695_1062182 | Ga0007410J51695_10621822 | 121 |
| 666 | 3300004798 | Ga0058859_11510136 | Ga0058859_115101361 | 121 |
| 667 | 3300004799 | Ga0058863_11961663 | Ga0058863_119616634 | 121 |
| 668 | 3300004800 | Ga0058861_10100634 | Ga0058861_101006344 | 121 |
| 669 | 3300004800 | Ga0058861_11820445 | Ga0058861_118204452 | 121 |
| 670 | 3300004801 | Ga0058860_11737710 | Ga0058860_117377102 | 121 |
| 671 | 3300004803 | Ga0058862_10121865 | Ga0058862_101218653 | 121 |
| 672 | 3300004803 | Ga0058862_10180327 | Ga0058862_101803271 | 121 |
| 673 | 3300004803 | Ga0058862_10264261 | Ga0058862_102642614 | 121 |
| 674 | 3300005327 | Ga0070658_10268770 | Ga0070658_102687702 | 121 |
| 675 | 3300005328 | Ga0070676_10132340 | Ga0070676_101323403 | 121 |
| 676 | 3300005329 | Ga0070683_100052721 | Ga0070683_1000527213 | 121 |
| 677 | 3300005329 | Ga0070683_100171623 | Ga0070683_1001716232 | 121 |
| 678 | 3300005329 | Ga0070683_100322487 | Ga0070683_1003224872 | 121 |
| 679 | 3300005329 | Ga0070683_100477452 | Ga0070683_1004774521 | 121 |
| 680 | 3300005330 | Ga0070690_100128365 | Ga0070690_1001283652 | 121 |
| 681 | 3300005331 | Ga0070670_100146703 | Ga0070670_1001467032 | 121 |
| 682 | 3300005331 | Ga0070670_100986370 | Ga0070670_1009863702 | 121 |
| 683 | 3300005334 | Ga0068869_100167264 | Ga0068869_1001672642 | 121 |
| 684 | 3300005334 | Ga0068869_100187758 | Ga0068869_1001877582 | 121 |
| 685 | 3300005335 | Ga0070666_10489953 | Ga0070666_104899532 | 121 |
| 686 | 3300005336 | Ga0070680_100046871 | Ga0070680_1000468714 | 121 |
| 687 | 3300005336 | Ga0070680_100251561 | Ga0070680_1002515612 | 121 |
| 688 | 3300005336 | Ga0070680_101019242 | Ga0070680_1010192421 | 121 |
| 689 | 3300005340 | Ga0070689_100057246 | Ga0070689_1000572464 | 121 |
| 690 | 3300005347 | Ga0070668_100021730 | Ga0070668_1000217303 | 121 |
| 691 | 3300005347 | Ga0070668_100106143 | Ga0070668_1001061432 | 121 |
| 692 | 3300005347 | Ga0070668_100582769 | Ga0070668_1005827692 | 121 |
| 693 | 3300005353 | Ga0070669_100308127 | Ga0070669_1003081272 | 121 |
| 694 | 3300005353 | Ga0070669_101660228 | Ga0070669_1016602281 | 121 |
| 695 | 3300005354 | Ga0070675_100142732 | Ga0070675_1001427323 | 121 |
| 696 | 3300005354 | Ga0070675_100266424 | Ga0070675_1002664242 | 121 |
| 697 | 3300005354 | Ga0070675_100297251 | Ga0070675_1002972512 | 121 |
| 698 | 3300005356 | Ga0070674_100231784 | Ga0070674_1002317841 | 121 |
| 699 | 3300005356 | Ga0070674_100960724 | Ga0070674_1009607242 | 121 |
| 700 | 3300005367 | Ga0070667_100054612 | Ga0070667_1000546125 | 121 |
| 701 | 3300005367 | Ga0070667_100637411 | Ga0070667_1006374112 | 121 |
| 702 | 3300005445 | Ga0070708_100017280 | Ga0070708_1000172803 | 121 |
| 703 | 3300005456 | Ga0070678_100137185 | Ga0070678_1001371853 | 121 |
| 704 | 3300005456 | Ga0070678_100300037 | Ga0070678_1003000372 | 121 |
| 705 | 3300005458 | Ga0070681_10054797 | Ga0070681_100547973 | 121 |
| 706 | 3300005458 | Ga0070681_10298269 | Ga0070681_102982692 | 121 |
| 707 | 3300005466 | Ga0070685_10033578 | Ga0070685_100335781 | 121 |
| 708 | 3300005468 | Ga0070707_100103516 | Ga0070707_1001035162 | 121 |
| 709 | 3300005530 | Ga0070679_100005023 | Ga0070679_1000050233 | 121 |
| 710 | 3300005530 | Ga0070679_100082272 | Ga0070679_1000822722 | 121 |
| 711 | 3300005530 | Ga0070679_100121391 | Ga0070679_1001213912 | 121 |
| 712 | 3300005535 | Ga0070684_100112014 | Ga0070684_1001120144 | 121 |
| 713 | 3300005543 | Ga0070672_100188977 | Ga0070672_1001889772 | 121 |
| 714 | 3300005543 | Ga0070672_100275162 | Ga0070672_1002751622 | 121 |
| 715 | 3300005548 | Ga0070665_100504064 | Ga0070665_1005040642 | 121 |
| 716 | 3300005564 | Ga0070664_100081410 | Ga0070664_1000814103 | 121 |
| 717 | 3300005564 | Ga0070664_100215244 | Ga0070664_1002152443 | 121 |
| 718 | 3300005564 | Ga0070664_100436393 | Ga0070664_1004363933 | 121 |
| 719 | 3300005614 | Ga0068856_100742533 | Ga0068856_1007425332 | 121 |
| 720 | 3300005615 | Ga0070702_100246896 | Ga0070702_1002468961 | 121 |
| 721 | 3300005618 | Ga0068864_100231053 | Ga0068864_1002310532 | 121 |
| 722 | 3300005718 | Ga0068866_10696026 | Ga0068866_106960262 | 121 |
| 723 | 3300005840 | Ga0068870_10119928 | Ga0068870_101199281 | 121 |
| 724 | 3300005842 | Ga0068858_100231828 | Ga0068858_1002318283 | 121 |
| 725 | 3300005844 | Ga0068862_100660953 | Ga0068862_1006609532 | 121 |
| 726 | 3300006237 | Ga0097621_100418306 | Ga0097621_1004183062 | 121 |
| 727 | 3300006358 | Ga0068871_100498274 | Ga0068871_1004982741 | 121 |
| 728 | 3300006880 | Ga0075429_101074913 | Ga0075429_1010749132 | 121 |
| 729 | 3300009036 | Ga0105244_10309066 | Ga0105244_103090662 | 121 |
| 730 | 3300009098 | Ga0105245_10101021 | Ga0105245_101010212 | 121 |
| 731 | 3300009148 | Ga0105243_10766648 | Ga0105243_107666482 | 121 |
| 732 | 3300009176 | Ga0105242_13249191 | Ga0105242_132491911 | 121 |
| 733 | 3300009177 | Ga0105248_10101948 | Ga0105248_101019483 | 121 |
| 734 | 3300009553 | Ga0105249_10175344 | Ga0105249_101753442 | 121 |
| 735 | 3300013104 | Ga0157370_10007324 | Ga0157370_100073246 | 121 |
| 736 | 3300013104 | Ga0157370_11949586 | Ga0157370_119495861 | 121 |
| 737 | 3300013105 | Ga0157369_10914683 | Ga0157369_109146831 | 121 |
| 738 | 3300013297 | Ga0157378_10367449 | Ga0157378_103674492 | 121 |
| 739 | 3300013297 | Ga0157378_10608509 | Ga0157378_106085092 | 121 |
| 740 | 3300013306 | Ga0163162_10025211 | Ga0163162_100252115 | 121 |
| 741 | 3300013306 | Ga0163162_11788542 | Ga0163162_117885421 | 121 |
| 742 | 3300013308 | Ga0157375_10012517 | Ga0157375_100125172 | 121 |
| 743 | 3300013308 | Ga0157375_10792836 | Ga0157375_107928362 | 121 |
| 744 | 3300014326 | Ga0157380_10177783 | Ga0157380_101777833 | 121 |
| 745 | 3300014745 | Ga0157377_10286177 | Ga0157377_102861772 | 121 |
| 746 | 3300014969 | Ga0157376_10386634 | Ga0157376_103866342 | 121 |
| 747 | 3300017792 | Ga0163161_10174469 | Ga0163161_101744691 | 121 |
| 748 | 3300020069 | Ga0197907_11487050 | Ga0197907_114870502 | 121 |
| 749 | 3300022467 | Ga0224712_10489652 | Ga0224712_104896522 | 121 |
| 750 | 3300025893 | Ga0207682_10165341 | Ga0207682_101653411 | 121 |
| 751 | 3300025903 | Ga0207680_10110282 | Ga0207680_101102823 | 121 |
| 752 | 3300025907 | Ga0207645_10111453 | Ga0207645_101114531 | 121 |
| 753 | 3300025909 | Ga0207705_10799216 | Ga0207705_107992162 | 121 |
| 754 | 3300025910 | Ga0207684_10524582 | Ga0207684_105245822 | 121 |
| 755 | 3300025912 | Ga0207707_10009547 | Ga0207707_100095475 | 121 |
| 756 | 3300025912 | Ga0207707_10119834 | Ga0207707_101198343 | 121 |
| 757 | 3300025917 | Ga0207660_10008227 | Ga0207660_100082273 | 121 |
| 758 | 3300025917 | Ga0207660_10897041 | Ga0207660_108970412 | 121 |
| 759 | 3300025917 | Ga0207660_10998494 | Ga0207660_109984942 | 121 |
| 760 | 3300025918 | Ga0207662_10015019 | Ga0207662_100150193 | 121 |
| 761 | 3300025921 | Ga0207652_10055753 | Ga0207652_100557533 | 121 |
| 762 | 3300025921 | Ga0207652_10070046 | Ga0207652_100700463 | 121 |
| 763 | 3300025921 | Ga0207652_10199467 | Ga0207652_101994672 | 121 |
| 764 | 3300025922 | Ga0207646_10370362 | Ga0207646_103703622 | 121 |
| 765 | 3300025926 | Ga0207659_10421588 | Ga0207659_104215882 | 121 |
| 766 | 3300025934 | Ga0207686_10638804 | Ga0207686_106388042 | 121 |
| 767 | 3300025936 | Ga0207670_10038897 | Ga0207670_100388974 | 121 |
| 768 | 3300025938 | Ga0207704_10136439 | Ga0207704_101364392 | 121 |
| 769 | 3300025940 | Ga0207691_10036983 | Ga0207691_100369833 | 121 |
| 770 | 3300025940 | Ga0207691_10844276 | Ga0207691_108442761 | 121 |
| 771 | 3300025941 | Ga0207711_10153499 | Ga0207711_101534992 | 121 |
| 772 | 3300025942 | Ga0207689_10077332 | Ga0207689_100773323 | 121 |
| 773 | 3300025942 | Ga0207689_10163820 | Ga0207689_101638202 | 121 |
| 774 | 3300025942 | Ga0207689_10633336 | Ga0207689_106333361 | 121 |
| 775 | 3300025944 | Ga0207661_10047755 | Ga0207661_100477553 | 121 |
| 776 | 3300025944 | Ga0207661_10111017 | Ga0207661_101110173 | 121 |
| 777 | 3300025944 | Ga0207661_10135219 | Ga0207661_101352193 | 121 |
| 778 | 3300025944 | Ga0207661_10210766 | Ga0207661_102107662 | 121 |
| 779 | 3300025944 | Ga0207661_10401775 | Ga0207661_104017753 | 121 |
| 780 | 3300025945 | Ga0207679_10095638 | Ga0207679_100956383 | 121 |
| 781 | 3300025945 | Ga0207679_10264993 | Ga0207679_102649932 | 121 |
| 782 | 3300025945 | Ga0207679_10552027 | Ga0207679_105520272 | 121 |
| 783 | 3300025961 | Ga0207712_10229074 | Ga0207712_102290742 | 121 |
| 784 | 3300025972 | Ga0207668_10529546 | Ga0207668_105295462 | 121 |
| 785 | 3300025972 | Ga0207668_10828199 | Ga0207668_108281992 | 121 |
| 786 | 3300025986 | Ga0207658_10166681 | Ga0207658_101666811 | 121 |
| 787 | 3300026035 | Ga0207703_10067549 | Ga0207703_100675494 | 121 |
| 788 | 3300026089 | Ga0207648_10101436 | Ga0207648_101014364 | 121 |
| 789 | 3300026089 | Ga0207648_10733541 | Ga0207648_107335412 | 121 |
| 790 | 3300026095 | Ga0207676_10687474 | Ga0207676_106874742 | 121 |
| 791 | 3300026116 | Ga0207674_11127752 | Ga0207674_111277521 | 121 |
| 792 | 3300026121 | Ga0207683_10136608 | Ga0207683_101366082 | 121 |
| 793 | 3300026121 | Ga0207683_10696966 | Ga0207683_106969662 | 121 |
| 794 | 3300026142 | Ga0207698_11041544 | Ga0207698_110415441 | 121 |
| 795 | 3300028379 | Ga0268266_10124108 | Ga0268266_101241082 | 121 |
| 796 | 3300028379 | Ga0268266_11032177 | Ga0268266_110321772 | 121 |
| 797 | 3300031731 | Ga0307405_10243046 | Ga0307405_102430462 | 121 |
| 798 | 3300031995 | Ga0307409_100074986 | Ga0307409_1000749863 | 121 |
| 799 | 3300032004 | Ga0307414_11679842 | Ga0307414_116798421 | 121 |
| 800 | 3300035118 | Ga0373954_0045633 | Ga0373954_0045633_872_1306 | 121 |
| 801 | 3300035120 | Ga0373957_0126894 | Ga0373957_0126894_535_969 | 121 |
| 802 | 3300035172 | Ga0373955_0016306 | Ga0373955_0016306_3102_3536 | 121 |
| 803 | 3300035410 | Ga0373924_0062334 | Ga0373924_0062334_367_801 | 121 |
| 804 | 3300036401 | Ga0373937_0015856 | Ga0373937_0015856_2895_3329 | 121 |
| 805 | 3300046454 | Ga0495592_0358802 | Ga0495592_0358802_418_852 | 121 |
| 806 | 3300046492 | Ga0495585_0605674 | Ga0495585_0605674_73_495 | 121 |
| 807 | 3300046517 | Ga0495630_0608841 | Ga0495630_0608841_380_814 | 121 |
| 808 | 3300046529 | Ga0495652_0045072 | Ga0495652_0045072_1686_2120 | 121 |
| 809 | 3300046531 | Ga0495665_0239780 | Ga0495665_0239780_343_765 | 121 |
| 810 | 3300046531 | Ga0495665_0401334 | Ga0495665_0401334_44_481 | 121 |
| 811 | 3300046536 | Ga0495587_0026271 | Ga0495587_0026271_3087_3521 | 121 |
| 812 | 3300046543 | Ga0495645_0000710 | Ga0495645_0000710_18641_19075 | 121 |
| 813 | 3300046559 | Ga0495667_0045361 | Ga0495667_0045361_87_521 | 121 |
| 814 | 3300046678 | Ga0495599_0003240 | Ga0495599_0003240_5729_6163 | 121 |
| 815 | 3300046684 | Ga0495669_0166659 | Ga0495669_0166659_185_607 | 121 |
| 816 | 3300046809 | Ga0495600_0069926 | Ga0495600_0069926_71_505 | 121 |
| 817 | 3300047471 | Ga0495684_0143558 | Ga0495684_0143558_1319_1753 | 121 |
| 818 | 3300049675 | Ga0501243_037291 | Ga0501243_037291_218_640 | 121 |
| 819 | 3300003163 | Ga0006759J45824_1040862 | Ga0006759J45824_10408623 | 122 |
| 820 | 3300003575 | Ga0007409J51694_1022942 | Ga0007409J51694_10229421 | 122 |
| 821 | 3300003579 | Ga0007429J51699_1023882 | Ga0007429J51699_10238822 | 122 |
| 822 | 3300003693 | Ga0032354_1021933 | Ga0032354_10219332 | 122 |
| 823 | 3300003693 | Ga0032354_1035115 | Ga0032354_10351152 | 122 |
| 824 | 3300004798 | Ga0058859_11821740 | Ga0058859_118217401 | 122 |
| 825 | 3300004799 | Ga0058863_11749764 | Ga0058863_117497643 | 122 |
| 826 | 3300004801 | Ga0058860_12061530 | Ga0058860_120615302 | 122 |
| 827 | 3300004803 | Ga0058862_12705347 | Ga0058862_127053471 | 122 |
| 828 | 3300005327 | Ga0070658_10133803 | Ga0070658_101338033 | 122 |
| 829 | 3300005329 | Ga0070683_100057123 | Ga0070683_1000571233 | 122 |
| 830 | 3300005333 | Ga0070677_10093995 | Ga0070677_100939953 | 122 |
| 831 | 3300005333 | Ga0070677_10094646 | Ga0070677_100946462 | 122 |
| 832 | 3300005336 | Ga0070680_100182134 | Ga0070680_1001821342 | 122 |
| 833 | 3300005438 | Ga0070701_10070010 | Ga0070701_100700102 | 122 |
| 834 | 3300005445 | Ga0070708_101134503 | Ga0070708_1011345031 | 122 |
| 835 | 3300005456 | Ga0070678_100779600 | Ga0070678_1007796001 | 122 |
| 836 | 3300005467 | Ga0070706_100031470 | Ga0070706_1000314704 | 122 |
| 837 | 3300005471 | Ga0070698_100104207 | Ga0070698_1001042073 | 122 |
| 838 | 3300005518 | Ga0070699_100142924 | Ga0070699_1001429242 | 122 |
| 839 | 3300005546 | Ga0070696_100000641 | Ga0070696_1000006412 | 122 |
| 840 | 3300005563 | Ga0068855_100233362 | Ga0068855_1002333622 | 122 |
| 841 | 3300005564 | Ga0070664_100056972 | Ga0070664_1000569722 | 122 |
| 842 | 3300005719 | Ga0068861_100985368 | Ga0068861_1009853681 | 122 |
| 843 | 3300007076 | Ga0075435_100307287 | Ga0075435_1003072872 | 122 |
| 844 | 3300009094 | Ga0111539_13044491 | Ga0111539_130444911 | 122 |
| 845 | 3300009098 | Ga0105245_10304012 | Ga0105245_103040122 | 122 |
| 846 | 3300009101 | Ga0105247_10362961 | Ga0105247_103629611 | 122 |
| 847 | 3300009148 | Ga0105243_10705426 | Ga0105243_107054262 | 122 |
| 848 | 3300009176 | Ga0105242_10489620 | Ga0105242_104896201 | 122 |
| 849 | 3300013102 | Ga0157371_10066051 | Ga0157371_100660512 | 122 |
| 850 | 3300013102 | Ga0157371_11588181 | Ga0157371_115881811 | 122 |
| 851 | 3300013296 | Ga0157374_11752178 | Ga0157374_117521782 | 122 |
| 852 | 3300013297 | Ga0157378_10135032 | Ga0157378_101350323 | 122 |
| 853 | 3300013306 | Ga0163162_10397847 | Ga0163162_103978471 | 122 |
| 854 | 3300013307 | Ga0157372_10009653 | Ga0157372_100096537 | 122 |
| 855 | 3300013308 | Ga0157375_10077385 | Ga0157375_100773852 | 122 |
| 856 | 3300014325 | Ga0163163_10754234 | Ga0163163_107542342 | 122 |
| 857 | 3300014968 | Ga0157379_10692149 | Ga0157379_106921492 | 122 |
| 858 | 3300014969 | Ga0157376_10993582 | Ga0157376_109935822 | 122 |
| 859 | 3300017792 | Ga0163161_10106798 | Ga0163161_101067983 | 122 |
| 860 | 3300017792 | Ga0163161_10526949 | Ga0163161_105269492 | 122 |
| 861 | 3300020078 | Ga0206352_11132655 | Ga0206352_111326551 | 122 |
| 862 | 3300025321 | Ga0207656_10025013 | Ga0207656_100250133 | 122 |
| 863 | 3300025893 | Ga0207682_10106266 | Ga0207682_101062661 | 122 |
| 864 | 3300025909 | Ga0207705_10224468 | Ga0207705_102244682 | 122 |
| 865 | 3300025910 | Ga0207684_10027668 | Ga0207684_100276683 | 122 |
| 866 | 3300025917 | Ga0207660_10000818 | Ga0207660_100008185 | 122 |
| 867 | 3300025922 | Ga0207646_10286877 | Ga0207646_102868772 | 122 |
| 868 | 3300025927 | Ga0207687_10166331 | Ga0207687_101663313 | 122 |
| 869 | 3300025944 | Ga0207661_10068651 | Ga0207661_100686513 | 122 |
| 870 | 3300025944 | Ga0207661_11139976 | Ga0207661_111399762 | 122 |
| 871 | 3300025945 | Ga0207679_10162540 | Ga0207679_101625402 | 122 |
| 872 | 3300025949 | Ga0207667_10117398 | Ga0207667_101173983 | 122 |
| 873 | 3300025960 | Ga0207651_10533315 | Ga0207651_105333152 | 122 |
| 874 | 3300026075 | Ga0207708_10277693 | Ga0207708_102776933 | 122 |
| 875 | 3300026121 | Ga0207683_10633121 | Ga0207683_106331212 | 122 |
| 876 | 3300031824 | Ga0307413_10012801 | Ga0307413_100128014 | 122 |
| 877 | 3300031852 | Ga0307410_10032064 | Ga0307410_100320642 | 122 |
| 878 | 3300031852 | Ga0307410_10249149 | Ga0307410_102491491 | 122 |
| 879 | 3300031901 | Ga0307406_10074765 | Ga0307406_100747653 | 122 |
| 880 | 3300031903 | Ga0307407_10170889 | Ga0307407_101708892 | 122 |
| 881 | 3300031903 | Ga0307407_10488845 | Ga0307407_104888452 | 122 |
| 882 | 3300031911 | Ga0307412_10445478 | Ga0307412_104454782 | 122 |
| 883 | 3300031995 | Ga0307409_101253210 | Ga0307409_1012532102 | 122 |
| 884 | 3300032002 | Ga0307416_100249875 | Ga0307416_1002498752 | 122 |
| 885 | 3300032002 | Ga0307416_101590681 | Ga0307416_1015906811 | 122 |
| 886 | 3300032126 | Ga0307415_100445546 | Ga0307415_1004455463 | 122 |
| 887 | 3300032126 | Ga0307415_101487650 | Ga0307415_1014876502 | 122 |
| 888 | 3300035111 | Ga0373923_0469586 | Ga0373923_0469586_12_452 | 122 |
| 889 | 3300036401 | Ga0373937_0166609 | Ga0373937_0166609_1409_1834 | 122 |
| 890 | 3300041406 | Ga0439439_0046593 | Ga0439439_0046593_254_679 | 122 |
| 891 | 3300046535 | Ga0495586_0312172 | Ga0495586_0312172_267_707 | 122 |
| 892 | 3300046536 | Ga0495587_0023334 | Ga0495587_0023334_439_864 | 122 |
| 893 | 3300046543 | Ga0495645_0184131 | Ga0495645_0184131_331_771 | 122 |
| 894 | 3300046675 | Ga0495657_0151763 | Ga0495657_0151763_195_620 | 122 |
| 895 | 3300046679 | Ga0495623_0032621 | Ga0495623_0032621_2488_2913 | 122 |
| 896 | 3300046689 | Ga0495613_0043113 | Ga0495613_0043113_1133_1558 | 122 |
| 897 | 3300047315 | Ga0495581_0163615 | Ga0495581_0163615_155_580 | 122 |
| 898 | 3300047317 | Ga0495604_0843355 | Ga0495604_0843355_80_505 | 122 |
| 899 | 3300048088 | Ga0495602_0186071 | Ga0495602_0186071_1027_1452 | 122 |
| 900 | 3300048911 | Ga0496108_0849839 | Ga0496108_0849839_311_748 | 122 |
| 901 | 3300048915 | Ga0496112_0024153 | Ga0496112_0024153_5069_5506 | 122 |
| 902 | 3300048918 | Ga0496115_0709077 | Ga0496115_0709077_17_442 | 122 |
| 903 | 3300049526 | Ga0501303_025790 | Ga0501303_025790_184_636 | 122 |
| 904 | 3300049539 | Ga0501323_088717 | Ga0501323_088717_25_450 | 122 |
| 905 | 3300049649 | Ga0501198_161236 | Ga0501198_161236_46_471 | 122 |
| 906 | 3300049666 | Ga0501228_070032 | Ga0501228_070032_15_467 | 122 |
| 907 | 3300049669 | Ga0501235_122109 | Ga0501235_122109_73_507 | 122 |
| 908 | 3300049686 | Ga0501257_119078 | Ga0501257_119078_224_649 | 122 |
| 909 | 3300050512 | nmdc:mga0n895_71244_c1 | nmdc:mga0n895_71244_c1_594_1034 | 122 |
| 910 | 3300001990 | JGI24737J22298_10024842 | JGI24737J22298_100248421 | 123 |
| 911 | 3300002075 | JGI24738J21930_10008993 | JGI24738J21930_100089934 | 123 |
| 912 | 3300004798 | Ga0058859_11715218 | Ga0058859_117152181 | 123 |
| 913 | 3300004799 | Ga0058863_11955260 | Ga0058863_119552602 | 123 |
| 914 | 3300004800 | Ga0058861_10094474 | Ga0058861_100944742 | 123 |
| 915 | 3300005327 | Ga0070658_10002530 | Ga0070658_100025308 | 123 |
| 916 | 3300005327 | Ga0070658_10089531 | Ga0070658_100895313 | 123 |
| 917 | 3300005329 | Ga0070683_100000662 | Ga0070683_10000066221 | 123 |
| 918 | 3300005335 | Ga0070666_10084739 | Ga0070666_100847391 | 123 |
| 919 | 3300005347 | Ga0070668_100076225 | Ga0070668_1000762254 | 123 |
| 920 | 3300005366 | Ga0070659_100259581 | Ga0070659_1002595813 | 123 |
| 921 | 3300005367 | Ga0070667_100067489 | Ga0070667_1000674893 | 123 |
| 922 | 3300005436 | Ga0070713_101014870 | Ga0070713_1010148702 | 123 |
| 923 | 3300005457 | Ga0070662_100161194 | Ga0070662_1001611943 | 123 |
| 924 | 3300005458 | Ga0070681_10055681 | Ga0070681_100556815 | 123 |
| 925 | 3300005459 | Ga0068867_100023307 | Ga0068867_1000233074 | 123 |
| 926 | 3300005530 | Ga0070679_100253998 | Ga0070679_1002539981 | 123 |
| 927 | 3300005530 | Ga0070679_100918881 | Ga0070679_1009188811 | 123 |
| 928 | 3300005535 | Ga0070684_100015882 | Ga0070684_1000158824 | 123 |
| 929 | 3300005535 | Ga0070684_100733610 | Ga0070684_1007336101 | 123 |
| 930 | 3300005539 | Ga0068853_100417091 | Ga0068853_1004170912 | 123 |
| 931 | 3300005543 | Ga0070672_100035408 | Ga0070672_1000354083 | 123 |
| 932 | 3300005547 | Ga0070693_100149541 | Ga0070693_1001495412 | 123 |
| 933 | 3300005577 | Ga0068857_100022826 | Ga0068857_1000228263 | 123 |
| 934 | 3300005615 | Ga0070702_100285054 | Ga0070702_1002850542 | 123 |
| 935 | 3300005616 | Ga0068852_100347488 | Ga0068852_1003474883 | 123 |
| 936 | 3300005618 | Ga0068864_100684623 | Ga0068864_1006846231 | 123 |
| 937 | 3300005718 | Ga0068866_10104228 | Ga0068866_101042282 | 123 |
| 938 | 3300005841 | Ga0068863_100069225 | Ga0068863_1000692253 | 123 |
| 939 | 3300005842 | Ga0068858_100147199 | Ga0068858_1001471994 | 123 |
| 940 | 3300005843 | Ga0068860_100117268 | Ga0068860_1001172682 | 123 |
| 941 | 3300005844 | Ga0068862_100423028 | Ga0068862_1004230281 | 123 |
| 942 | 3300006175 | Ga0070712_100743287 | Ga0070712_1007432872 | 123 |
| 943 | 3300006881 | Ga0068865_100005638 | Ga0068865_1000056387 | 123 |
| 944 | 3300009098 | Ga0105245_10231568 | Ga0105245_102315683 | 123 |
| 945 | 3300010375 | Ga0105239_10427565 | Ga0105239_104275653 | 123 |
| 946 | 3300013100 | Ga0157373_10135434 | Ga0157373_101354342 | 123 |
| 947 | 3300013104 | Ga0157370_10310553 | Ga0157370_103105532 | 123 |
| 948 | 3300013296 | Ga0157374_10422228 | Ga0157374_104222283 | 123 |
| 949 | 3300013297 | Ga0157378_10171220 | Ga0157378_101712202 | 123 |
| 950 | 3300013307 | Ga0157372_11309762 | Ga0157372_113097622 | 123 |
| 951 | 3300013308 | Ga0157375_10700923 | Ga0157375_107009231 | 123 |
| 952 | 3300014325 | Ga0163163_10458713 | Ga0163163_104587131 | 123 |
| 953 | 3300014968 | Ga0157379_10208245 | Ga0157379_102082452 | 123 |
| 954 | 3300025899 | Ga0207642_10037832 | Ga0207642_100378321 | 123 |
| 955 | 3300025907 | Ga0207645_10003859 | Ga0207645_100038595 | 123 |
| 956 | 3300025909 | Ga0207705_10054893 | Ga0207705_100548933 | 123 |
| 957 | 3300025919 | Ga0207657_10041175 | Ga0207657_100411753 | 123 |
| 958 | 3300025921 | Ga0207652_10380513 | Ga0207652_103805131 | 123 |
| 959 | 3300025921 | Ga0207652_10585521 | Ga0207652_105855212 | 123 |
| 960 | 3300025932 | Ga0207690_10036856 | Ga0207690_100368565 | 123 |
| 961 | 3300025933 | Ga0207706_10453325 | Ga0207706_104533252 | 123 |
| 962 | 3300025934 | Ga0207686_10021294 | Ga0207686_100212945 | 123 |
| 963 | 3300025938 | Ga0207704_10007324 | Ga0207704_100073247 | 123 |
| 964 | 3300025940 | Ga0207691_10054622 | Ga0207691_100546223 | 123 |
| 965 | 3300025940 | Ga0207691_11654504 | Ga0207691_116545041 | 123 |
| 966 | 3300025941 | Ga0207711_10250156 | Ga0207711_102501562 | 123 |
| 967 | 3300025972 | Ga0207668_10015561 | Ga0207668_100155615 | 123 |
| 968 | 3300025986 | Ga0207658_10350463 | Ga0207658_103504632 | 123 |
| 969 | 3300026067 | Ga0207678_10151545 | Ga0207678_101515453 | 123 |
| 970 | 3300026089 | Ga0207648_10007649 | Ga0207648_100076492 | 123 |
| 971 | 3300026116 | Ga0207674_10026110 | Ga0207674_100261103 | 123 |
| 972 | 3300026118 | Ga0207675_100132057 | Ga0207675_1001320573 | 123 |
| 973 | 3300028381 | Ga0268264_10091803 | Ga0268264_100918034 | 123 |
| 974 | 3300031852 | Ga0307410_10173984 | Ga0307410_101739843 | 123 |
| 975 | 3300031995 | Ga0307409_100028499 | Ga0307409_1000284992 | 123 |
| 976 | 3300032002 | Ga0307416_101079108 | Ga0307416_1010791082 | 123 |
| 977 | 3300032126 | Ga0307415_101056364 | Ga0307415_1010563641 | 123 |
| 978 | 3300037418 | Ga0395900_0323581 | Ga0395900_0323581_556_984 | 123 |
| 979 | 3300037471 | Ga0395905_0139084 | Ga0395905_0139084_481_909 | 123 |
| 980 | 3300038443 | Ga0395901_0434478 | Ga0395901_0434478_55_483 | 123 |
| 981 | 3300048903 | Ga0496100_0139361 | Ga0496100_0139361_282_710 | 123 |
| 982 | 3300048904 | Ga0496101_0253254 | Ga0496101_0253254_61_489 | 123 |
| 983 | 3300048908 | Ga0496105_0393646 | Ga0496105_0393646_481_909 | 123 |
| 984 | 3300048909 | Ga0496106_0189528 | Ga0496106_0189528_291_719 | 123 |
| 985 | 3300048911 | Ga0496108_0085778 | Ga0496108_0085778_1156_1584 | 123 |
| 986 | 3300048913 | Ga0496110_0167276 | Ga0496110_0167276_969_1397 | 123 |
| 987 | 3300048915 | Ga0496112_0014015 | Ga0496112_0014015_2689_3117 | 123 |
| 988 | 3300048917 | Ga0496114_0491060 | Ga0496114_0491060_500_928 | 123 |
| 989 | 3300048918 | Ga0496115_0485705 | Ga0496115_0485705_16_444 | 123 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar