F487584

General Info

Members Datasets Scaffolds Average Seq Length
989 357 983 133

Family's Representative Sequence

Representative Sequence 3300005614|Ga0068856_100742533|Ga0068856_1007425332
Length 150
Sequence MAMSSGGAGGLSNDINVTPMIDVLLVLLIIFMAVLPSMRKAIDIQLPDPNPTVQPANANSNQIVLEVKPGGQFVINTKEVLNRNQLATRLKEIYDPRPEKIIFVKGAPGVPYGDVIFAMDVARGAGVKIIGIPPKDTPGATPAGAAPAAK

Samples

Sample ID Description Type Environment
1 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
8 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
9 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
10 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
11 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
12 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
13 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
14 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
15 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
16 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
17 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
24 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
27 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
31 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
32 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
33 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
34 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
35 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
36 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
37 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
38 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
39 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
40 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
41 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
42 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
43 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
44 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
45 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
46 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
47 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
48 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
49 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
50 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
51 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
52 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
53 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
54 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
55 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
56 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
57 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
58 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
59 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
60 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
61 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
62 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
63 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
64 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
65 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
66 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
67 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
68 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
69 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
70 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
71 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
72 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
73 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
74 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
75 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
76 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
77 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
78 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
79 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
80 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
81 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
82 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
83 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
84 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
85 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
86 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
87 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
89 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
90 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
91 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
92 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
93 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
95 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
96 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
97 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
99 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
100 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
101 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
102 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
103 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
104 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
105 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
106 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
107 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
108 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
109 3300012485 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 Metagenome Rhizosphere
110 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
111 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
112 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
113 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
114 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
115 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
116 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
117 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
118 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
119 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
120 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
121 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
122 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
123 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
124 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
125 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
126 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
127 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
128 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
129 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
130 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
131 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
132 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
133 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
203 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
207 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
208 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
209 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
210 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
211 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
212 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
213 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
214 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
215 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
216 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
217 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
218 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
219 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
220 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
221 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
222 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
223 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
224 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
225 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
226 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
227 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
228 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
229 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
230 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
231 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
232 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
233 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
234 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
235 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
236 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
237 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
238 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
239 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
240 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
241 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
242 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
243 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
244 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
245 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
246 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
247 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
248 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
249 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
250 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
251 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
252 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
253 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
254 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
255 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
256 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
257 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
258 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
259 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
260 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
261 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
262 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
263 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
264 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
265 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
266 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
267 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
268 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
269 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
270 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
271 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
272 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
273 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
274 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
275 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
276 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
277 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
278 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
279 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
280 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
281 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
282 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
283 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
284 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
285 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
286 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
287 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
288 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
289 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
290 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
291 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
292 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
293 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
294 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
295 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
296 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
297 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
298 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
299 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
300 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
301 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
302 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
303 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
304 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
305 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
306 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
307 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
308 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
309 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
310 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
311 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
312 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
313 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
314 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
315 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
316 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
317 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
318 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
319 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
320 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
321 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
322 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
323 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
324 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
325 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
326 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
327 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
328 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
329 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
330 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
331 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
332 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
333 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
334 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
335 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
336 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
337 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
338 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
339 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
340 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
341 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
342 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
343 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
344 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
345 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
346 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
347 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
348 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
349 3300059625 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
350 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
351 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
352 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
353 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
354 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
355 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
356 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
357 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.44
Metatranscriptomes 5.56
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.82
Rhizosphere 97.27
Stem 0
Stem Tuber 0
Unclassified 0.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10024842 3300001990 Unclassified 1896
2 JGI24743J22301_10124862 3300001991 Bacteria 566
3 JGI24738J21930_10008993 3300002075 Unclassified 2261
4 Ga0006759J45824_1040862 3300003163 Bacteria 1096
5 Ga0006777J48905_1058895 3300003308 Unclassified 2426
6 Ga0007417J51691_1054800 3300003544 Bacteria 995
7 Ga0007410J51695_1062182 3300003574 Bacteria 976
8 Ga0007409J51694_1022942 3300003575 Bacteria 532
9 Ga0007429J51699_1023882 3300003579 Bacteria 1049
10 Ga0032354_1021933 3300003693 Bacteria 896
11 Ga0032354_1035115 3300003693 Bacteria 934
12 Ga0058859_11510136 3300004798 Unclassified 607
13 Ga0058859_11715218 3300004798 Bacteria 644
14 Ga0058859_11806325 3300004798 Bacteria 2540
15 Ga0058859_11821740 3300004798 Bacteria 674
16 Ga0058863_10030836 3300004799 Bacteria 2476
17 Ga0058863_10042616 3300004799 Bacteria 1201
18 Ga0058863_11749764 3300004799 Bacteria 1317
19 Ga0058863_11955260 3300004799 Bacteria 599
20 Ga0058863_11961663 3300004799 Bacteria 2637
21 Ga0058861_10094474 3300004800 Bacteria 876
22 Ga0058861_10100634 3300004800 Bacteria 2520
23 Ga0058861_11820445 3300004800 Bacteria 631
24 Ga0058861_11988692 3300004800 Bacteria 844
25 Ga0058861_12072470 3300004800 Bacteria 2504
26 Ga0058860_11737710 3300004801 Bacteria 694
27 Ga0058860_12061530 3300004801 Bacteria 676
28 Ga0058862_10121865 3300004803 Bacteria 1198
29 Ga0058862_10180327 3300004803 Bacteria 1000
30 Ga0058862_10264261 3300004803 Bacteria 2739
31 Ga0058862_12705347 3300004803 Bacteria 1390
32 Ga0058862_12775103 3300004803 Bacteria 1374
33 Ga0058862_12870049 3300004803 Bacteria 1881
34 Ga0058862_12887040 3300004803 Bacteria 2376
35 Ga0065712_10105869 3300005290 Bacteria 1930
36 Ga0065715_10219187 3300005293 Bacteria 1279
37 Ga0065715_10287769 3300005293 Bacteria 1067
38 Ga0065715_10443454 3300005293 Bacteria 808
39 Ga0070658_10002530 3300005327 Bacteria 15260
40 Ga0070658_10027578 3300005327 Bacteria 4555
41 Ga0070658_10067868 3300005327 Bacteria 2914
42 Ga0070658_10089531 3300005327 Bacteria 2534
43 Ga0070658_10116648 3300005327 Bacteria 2216
44 Ga0070658_10133803 3300005327 Bacteria 2067
45 Ga0070658_10268770 3300005327 Bacteria 1450
46 Ga0070658_10372861 3300005327 Bacteria 1223
47 Ga0070676_10046897 3300005328 Bacteria 2521
48 Ga0070676_10132340 3300005328 Bacteria 1579
49 Ga0070676_10404908 3300005328 Bacteria 950
50 Ga0070683_100000565 3300005329 Bacteria 26354
51 Ga0070683_100000662 3300005329 Bacteria 24891
52 Ga0070683_100017034 3300005329 Bacteria 6414
53 Ga0070683_100052721 3300005329 Bacteria 3770
54 Ga0070683_100057123 3300005329 Bacteria 3625
55 Ga0070683_100069251 3300005329 Bacteria 3289
56 Ga0070683_100171623 3300005329 Bacteria 2059
57 Ga0070683_100322487 3300005329 Bacteria 1470
58 Ga0070683_100409308 3300005329 Bacteria 1294
59 Ga0070683_100477452 3300005329 Bacteria 1190
60 Ga0070683_100954592 3300005329 Bacteria 823
61 Ga0070683_101555253 3300005329 Bacteria 636
62 Ga0070690_100075352 3300005330 Bacteria 2199
63 Ga0070690_100108436 3300005330 Bacteria 1850
64 Ga0070690_100114633 3300005330 Bacteria 1802
65 Ga0070690_100128365 3300005330 Bacteria 1710
66 Ga0070670_100008774 3300005331 Bacteria 8628
67 Ga0070670_100084678 3300005331 Bacteria 2724
68 Ga0070670_100146703 3300005331 Bacteria 2041
69 Ga0070670_100290046 3300005331 Bacteria 1430
70 Ga0070670_100674750 3300005331 Unclassified 928
71 Ga0070670_100902962 3300005331 Bacteria 801
72 Ga0070670_100986370 3300005331 Bacteria 766
73 Ga0070677_10093995 3300005333 Bacteria 1309
74 Ga0070677_10094646 3300005333 Bacteria 1306
75 Ga0068869_100006227 3300005334 Bacteria 7556
76 Ga0068869_100167264 3300005334 Bacteria 1715
77 Ga0068869_100187758 3300005334 Bacteria 1623
78 Ga0070666_10084739 3300005335 Bacteria 2170
79 Ga0070666_10489953 3300005335 Unclassified 890
80 Ga0070666_10561459 3300005335 Bacteria 831
81 Ga0070680_100006760 3300005336 Bacteria 8739
82 Ga0070680_100016292 3300005336 Bacteria 5847
83 Ga0070680_100046871 3300005336 Bacteria 3517
84 Ga0070680_100182134 3300005336 Bacteria 1769
85 Ga0070680_100213568 3300005336 Bacteria 1628
86 Ga0070680_100251561 3300005336 Bacteria 1494
87 Ga0070680_100473624 3300005336 Bacteria 1070
88 Ga0070680_100561467 3300005336 Bacteria 979
89 Ga0070680_101019242 3300005336 Unclassified 715
90 Ga0070680_101323455 3300005336 Bacteria 624
91 Ga0070682_100000275 3300005337 Bacteria 36886
92 Ga0070682_100002639 3300005337 Bacteria 9906
93 Ga0068868_100066722 3300005338 Bacteria 2862
94 Ga0068868_100154703 3300005338 Bacteria 1890
95 Ga0068868_100404258 3300005338 Bacteria 1179
96 Ga0070660_100205577 3300005339 Bacteria 1598
97 Ga0070660_100423221 3300005339 Bacteria 1103
98 Ga0070660_100718842 3300005339 Unclassified 838
99 Ga0070660_100748471 3300005339 Bacteria 821
100 Ga0070689_100057246 3300005340 Bacteria 3025
101 Ga0070689_100129319 3300005340 Bacteria 2024
102 Ga0070689_100783143 3300005340 Bacteria 838
103 Ga0070691_10013009 3300005341 Bacteria 3810
104 Ga0070691_10227759 3300005341 Bacteria 991
105 Ga0070691_10235550 3300005341 Bacteria 976
106 Ga0070691_10782145 3300005341 Bacteria 580
107 Ga0070687_100095487 3300005343 Bacteria 1653
108 Ga0070687_100199314 3300005343 Bacteria 1212
109 Ga0070661_100022554 3300005344 Bacteria 4507
110 Ga0070661_100027604 3300005344 Bacteria 4089
111 Ga0070661_100086675 3300005344 Bacteria 2315
112 Ga0070661_100216428 3300005344 Bacteria 1468
113 Ga0070692_10040375 3300005345 Bacteria 2386
114 Ga0070668_100021730 3300005347 Bacteria 4848
115 Ga0070668_100045342 3300005347 Bacteria 3374
116 Ga0070668_100076225 3300005347 Bacteria 2619
117 Ga0070668_100106143 3300005347 Bacteria 2231
118 Ga0070668_100582769 3300005347 Bacteria 977
119 Ga0070669_100014167 3300005353 Bacteria 5674
120 Ga0070669_100156457 3300005353 Bacteria 1768
121 Ga0070669_100162182 3300005353 Bacteria 1738
122 Ga0070669_100277876 3300005353 Bacteria 1341
123 Ga0070669_100308127 3300005353 Bacteria 1275
124 Ga0070669_101660228 3300005353 Bacteria 557
125 Ga0070675_100001662 3300005354 Bacteria 16436
126 Ga0070675_100116171 3300005354 Bacteria 2269
127 Ga0070675_100142732 3300005354 Bacteria 2048
128 Ga0070675_100246948 3300005354 Bacteria 1561
129 Ga0070675_100266424 3300005354 Unclassified 1502
130 Ga0070675_100297251 3300005354 Bacteria 1422
131 Ga0070671_100131468 3300005355 Bacteria 2108
132 Ga0070671_100168965 3300005355 Bacteria 1849
133 Ga0070671_100774132 3300005355 Bacteria 835
134 Ga0070674_100231784 3300005356 Bacteria 1441
135 Ga0070674_100792775 3300005356 Bacteria 817
136 Ga0070674_100960724 3300005356 Bacteria 748
137 Ga0070673_100118119 3300005364 Bacteria 2208
138 Ga0070673_100189519 3300005364 Bacteria 1765
139 Ga0070673_100207421 3300005364 Bacteria 1690
140 Ga0070673_100216471 3300005364 Bacteria 1656
141 Ga0070673_100292825 3300005364 Bacteria 1431
142 Ga0070673_100295875 3300005364 Bacteria 1424
143 Ga0070688_100004495 3300005365 Bacteria 7269
144 Ga0070659_100045299 3300005366 Bacteria 3445
145 Ga0070659_100259581 3300005366 Bacteria 1441
146 Ga0070667_100054612 3300005367 Bacteria 3373
147 Ga0070667_100067489 3300005367 Unclassified 3041
148 Ga0070667_100287263 3300005367 Bacteria 1478
149 Ga0070667_100316185 3300005367 Bacteria 1408
150 Ga0070667_100637411 3300005367 Unclassified 983
151 Ga0070709_10004433 3300005434 Bacteria 7573
152 Ga0070713_100045324 3300005436 Bacteria 3603
153 Ga0070713_101014870 3300005436 Bacteria 801
154 Ga0070713_101396839 3300005436 Bacteria 679
155 Ga0070710_10357910 3300005437 Unclassified 968
156 Ga0070701_10070010 3300005438 Unclassified 1873
157 Ga0070711_100222579 3300005439 Bacteria 1468
158 Ga0070711_100931222 3300005439 Bacteria 743
159 Ga0070708_100000052 3300005445 Bacteria 78944
160 Ga0070708_100017280 3300005445 Bacteria 6012
161 Ga0070708_101134503 3300005445 Bacteria 732
162 Ga0070663_100507881 3300005455 Bacteria 1002
163 Ga0070678_100137185 3300005456 Bacteria 1952
164 Ga0070678_100300037 3300005456 Bacteria 1365
165 Ga0070678_100779600 3300005456 Bacteria 867
166 Ga0070662_100027228 3300005457 Bacteria 3965
167 Ga0070662_100137636 3300005457 Bacteria 1889
168 Ga0070662_100161194 3300005457 Bacteria 1754
169 Ga0070662_100238195 3300005457 Bacteria 1458
170 Ga0070681_10007180 3300005458 Bacteria 10853
171 Ga0070681_10026256 3300005458 Bacteria 5854
172 Ga0070681_10028042 3300005458 Bacteria 5660
173 Ga0070681_10054797 3300005458 Bacteria 3973
174 Ga0070681_10055681 3300005458 Bacteria 3937
175 Ga0070681_10135556 3300005458 Bacteria 2393
176 Ga0070681_10298269 3300005458 Unclassified 1522
177 Ga0068867_100023307 3300005459 Bacteria 4432
178 Ga0068867_100141930 3300005459 Bacteria 1878
179 Ga0068867_100292903 3300005459 Bacteria 1339
180 Ga0070685_10033578 3300005466 Bacteria 2884
181 Ga0070685_10109256 3300005466 Bacteria 1701
182 Ga0070685_10167664 3300005466 Bacteria 1405
183 Ga0070685_10850856 3300005466 Bacteria 676
184 Ga0070706_100031470 3300005467 Bacteria 4892
185 Ga0070706_100045503 3300005467 Bacteria 4054
186 Ga0070706_100116838 3300005467 Bacteria 2485
187 Ga0070706_100488462 3300005467 Bacteria 1146
188 Ga0070707_100000643 3300005468 Bacteria 34864
189 Ga0070707_100103516 3300005468 Bacteria 2759
190 Ga0070698_100006166 3300005471 Bacteria 13057
191 Ga0070698_100104207 3300005471 Bacteria 2806
192 Ga0070698_100893206 3300005471 Bacteria 834
193 Ga0070699_100142924 3300005518 Bacteria 2114
194 Ga0070699_100295801 3300005518 Bacteria 1452
195 Ga0070699_100406117 3300005518 Bacteria 1232
196 Ga0070679_100000771 3300005530 Bacteria 27790
197 Ga0070679_100005023 3300005530 Bacteria 12209
198 Ga0070679_100082272 3300005530 Bacteria 3209
199 Ga0070679_100087543 3300005530 Bacteria 3102
200 Ga0070679_100121391 3300005530 Bacteria 2598
201 Ga0070679_100253998 3300005530 Bacteria 1714
202 Ga0070679_100484767 3300005530 Bacteria 1181
203 Ga0070679_100918881 3300005530 Bacteria 819
204 Ga0070679_100949180 3300005530 Unclassified 804
205 Ga0070684_100004296 3300005535 Bacteria 10813
206 Ga0070684_100006014 3300005535 Bacteria 9347
207 Ga0070684_100015882 3300005535 Bacteria 6145
208 Ga0070684_100033315 3300005535 Bacteria 4398
209 Ga0070684_100112014 3300005535 Bacteria 2448
210 Ga0070684_100178147 3300005535 Bacteria 1932
211 Ga0070684_100693986 3300005535 Bacteria 949
212 Ga0070684_100733610 3300005535 Bacteria 922
213 Ga0070684_101458084 3300005535 Bacteria 645
214 Ga0070697_100213740 3300005536 Bacteria 1642
215 Ga0068853_100417091 3300005539 Bacteria 1258
216 Ga0070672_100035408 3300005543 Bacteria 3795
217 Ga0070672_100083137 3300005543 Bacteria 2569
218 Ga0070672_100188977 3300005543 Bacteria 1719
219 Ga0070672_100275162 3300005543 Bacteria 1422
220 Ga0070686_100031501 3300005544 Bacteria 3243
221 Ga0070695_100128172 3300005545 Bacteria 1746
222 Ga0070695_100217178 3300005545 Bacteria 1376
223 Ga0070696_100000641 3300005546 Bacteria 22352
224 Ga0070696_100021816 3300005546 Bacteria 4344
225 Ga0070696_100239800 3300005546 Bacteria 1367
226 Ga0070693_100001153 3300005547 Bacteria 11862
227 Ga0070693_100026362 3300005547 Bacteria 3137
228 Ga0070693_100149541 3300005547 Bacteria 1478
229 Ga0070665_100141300 3300005548 Bacteria 2411
230 Ga0070665_100354768 3300005548 Unclassified 1472
231 Ga0070665_100504064 3300005548 Bacteria 1222
232 Ga0068855_100114484 3300005563 Bacteria 3092
233 Ga0068855_100128332 3300005563 Bacteria 2898
234 Ga0068855_100233362 3300005563 Bacteria 2059
235 Ga0070664_100016606 3300005564 Bacteria 6039
236 Ga0070664_100016816 3300005564 Bacteria 6004
237 Ga0070664_100056972 3300005564 Bacteria 3321
238 Ga0070664_100081410 3300005564 Bacteria 2790
239 Ga0070664_100215244 3300005564 Bacteria 1717
240 Ga0070664_100379717 3300005564 Bacteria 1290
241 Ga0070664_100436393 3300005564 Bacteria 1201
242 Ga0070664_101442531 3300005564 Bacteria 651
243 Ga0068857_100004677 3300005577 Bacteria 11598
244 Ga0068857_100009564 3300005577 Bacteria 8419
245 Ga0068857_100022826 3300005577 Bacteria 5505
246 Ga0068857_100094341 3300005577 Bacteria 2679
247 Ga0068857_102098703 3300005577 Unclassified 554
248 Ga0068854_100747947 3300005578 Bacteria 848
249 Ga0068854_101411342 3300005578 Bacteria 630
250 Ga0068856_100037691 3300005614 Bacteria 4744
251 Ga0068856_100092780 3300005614 Bacteria 3005
252 Ga0068856_100742533 3300005614 Bacteria 1001
253 Ga0070702_100006432 3300005615 Bacteria 5558
254 Ga0070702_100246896 3300005615 Bacteria 1208
255 Ga0070702_100258889 3300005615 Bacteria 1184
256 Ga0070702_100285054 3300005615 Bacteria 1136
257 Ga0068852_100215707 3300005616 Bacteria 1823
258 Ga0068852_100228468 3300005616 Bacteria 1773
259 Ga0068852_100347488 3300005616 Bacteria 1447
260 Ga0068859_100088363 3300005617 Bacteria 3148
261 Ga0068859_100112215 3300005617 Bacteria 2789
262 Ga0068864_100024854 3300005618 Bacteria 5039
263 Ga0068864_100137544 3300005618 Bacteria 2201
264 Ga0068864_100231053 3300005618 Bacteria 1711
265 Ga0068864_100684623 3300005618 Bacteria 1000
266 Ga0068864_100715651 3300005618 Bacteria 979
267 Ga0068864_101006439 3300005618 Bacteria 827
268 Ga0068866_10094671 3300005718 Bacteria 1634
269 Ga0068866_10104228 3300005718 Unclassified 1571
270 Ga0068866_10696026 3300005718 Bacteria 697
271 Ga0068861_100985368 3300005719 Unclassified 804
272 Ga0068870_10012644 3300005840 Bacteria 3948
273 Ga0068870_10020135 3300005840 Bacteria 3244
274 Ga0068870_10119928 3300005840 Bacteria 1514
275 Ga0068863_100029136 3300005841 Bacteria 5271
276 Ga0068863_100069225 3300005841 Bacteria 3337
277 Ga0068858_100147199 3300005842 Bacteria 2212
278 Ga0068858_100192377 3300005842 Bacteria 1928
279 Ga0068858_100231828 3300005842 Bacteria 1751
280 Ga0068858_101271932 3300005842 Bacteria 724
281 Ga0068860_100021657 3300005843 Bacteria 6223
282 Ga0068860_100117268 3300005843 Bacteria 2547
283 Ga0068860_100321849 3300005843 Bacteria 1518
284 Ga0068860_100954314 3300005843 Bacteria 875
285 Ga0068862_100423028 3300005844 Bacteria 1250
286 Ga0068862_100581222 3300005844 Bacteria 1073
287 Ga0068862_100660953 3300005844 Bacteria 1009
288 Ga0070712_100743287 3300006175 Bacteria 839
289 Ga0097621_100010975 3300006237 Bacteria 6653
290 Ga0097621_100418306 3300006237 Unclassified 1202
291 Ga0097621_100518440 3300006237 Unclassified 1082
292 Ga0068871_100284792 3300006358 Bacteria 1446
293 Ga0068871_100498274 3300006358 Unclassified 1097
294 Ga0075430_100026576 3300006846 Bacteria 4922
295 Ga0075431_100022910 3300006847 Bacteria 6383
296 Ga0075431_100903771 3300006847 Bacteria 852
297 Ga0075429_100155646 3300006880 Bacteria 2001
298 Ga0075429_100303956 3300006880 Bacteria 1397
299 Ga0075429_101074913 3300006880 Bacteria 703
300 Ga0068865_100005638 3300006881 Bacteria 7598
301 Ga0097620_100088359 3300006931 Bacteria 3148
302 Ga0097620_100112208 3300006931 Bacteria 2789
303 Ga0075435_100307287 3300007076 Unclassified 1357
304 Ga0105244_10309066 3300009036 Bacteria 731
305 Ga0105240_10062939 3300009093 Bacteria 4617
306 Ga0105240_10640993 3300009093 Bacteria 1166
307 Ga0111539_10187731 3300009094 Bacteria 2413
308 Ga0111539_10233831 3300009094 Bacteria 2140
309 Ga0111539_13044491 3300009094 Bacteria 541
310 Ga0105245_10101021 3300009098 Bacteria 2669
311 Ga0105245_10231568 3300009098 Unclassified 1787
312 Ga0105245_10304012 3300009098 Bacteria 1566
313 Ga0105245_10340875 3300009098 Bacteria 1482
314 Ga0105247_10362961 3300009101 Bacteria 1022
315 Ga0105247_10828089 3300009101 Bacteria 708
316 Ga0105243_10051387 3300009148 Bacteria 3260
317 Ga0105243_10705426 3300009148 Bacteria 984
318 Ga0105243_10766648 3300009148 Bacteria 947
319 Ga0105243_10773134 3300009148 Bacteria 944
320 Ga0105241_10008171 3300009174 Bacteria 7705
321 Ga0105241_10141303 3300009174 Bacteria 1961
322 Ga0105242_10101363 3300009176 Bacteria 2440
323 Ga0105242_10489620 3300009176 Bacteria 1167
324 Ga0105242_10924669 3300009176 Bacteria 874
325 Ga0105242_11741771 3300009176 Bacteria 660
326 Ga0105242_13249191 3300009176 Unclassified 505
327 Ga0105248_10101948 3300009177 Bacteria 3235
328 Ga0105248_10325266 3300009177 Bacteria 1732
329 Ga0105248_10408669 3300009177 Bacteria 1528
330 Ga0105237_10197173 3300009545 Bacteria 2013
331 Ga0105237_10320891 3300009545 Bacteria 1552
332 Ga0105237_10445491 3300009545 Bacteria 1301
333 Ga0105237_10553013 3300009545 Bacteria 1157
334 Ga0105237_11487973 3300009545 Bacteria 684
335 Ga0105237_11764798 3300009545 Unclassified 626
336 Ga0105238_10069130 3300009551 Bacteria 3532
337 Ga0105238_10173727 3300009551 Bacteria 2131
338 Ga0105238_10493845 3300009551 Bacteria 1224
339 Ga0105238_10589861 3300009551 Bacteria 1118
340 Ga0105238_10895881 3300009551 Bacteria 905
341 Ga0105249_10000089 3300009553 Bacteria 131175
342 Ga0105249_10130805 3300009553 Bacteria 2396
343 Ga0105249_10175344 3300009553 Bacteria 2082
344 Ga0105249_10837042 3300009553 Bacteria 985
345 Ga0105249_12911401 3300009553 Bacteria 549
346 Ga0105239_10025248 3300010375 Bacteria 6544
347 Ga0105239_10427565 3300010375 Bacteria 1501
348 Ga0105246_10001421 3300011119 Bacteria 14186
349 Ga0105246_10638675 3300011119 Bacteria 925
350 Ga0157325_1029447 3300012485 Bacteria 542
351 Ga0157373_10135434 3300013100 Bacteria 1732
352 Ga0157373_10338204 3300013100 Bacteria 1072
353 Ga0157373_10365855 3300013100 Bacteria 1030
354 Ga0157371_10018782 3300013102 Bacteria 5108
355 Ga0157371_10066051 3300013102 Bacteria 2562
356 Ga0157371_11588181 3300013102 Bacteria 512
357 Ga0157370_10007324 3300013104 Bacteria 12042
358 Ga0157370_10310553 3300013104 Bacteria 1455
359 Ga0157370_10311764 3300013104 Bacteria 1452
360 Ga0157370_10389222 3300013104 Bacteria 1284
361 Ga0157370_11949586 3300013104 Bacteria 527
362 Ga0157369_10049701 3300013105 Bacteria 4545
363 Ga0157369_10059499 3300013105 Bacteria 4120
364 Ga0157369_10914683 3300013105 Unclassified 899
365 Ga0157369_10969548 3300013105 Bacteria 871
366 Ga0157374_10251765 3300013296 Bacteria 1738
367 Ga0157374_10422228 3300013296 Bacteria 1332
368 Ga0157374_10827102 3300013296 Unclassified 942
369 Ga0157374_11752178 3300013296 Unclassified 646
370 Ga0157378_10040562 3300013297 Bacteria 4128
371 Ga0157378_10135032 3300013297 Bacteria 2287
372 Ga0157378_10171220 3300013297 Bacteria 2036
373 Ga0157378_10367449 3300013297 Bacteria 1409
374 Ga0157378_10608509 3300013297 Bacteria 1105
375 Ga0163162_10025211 3300013306 Bacteria 5876
376 Ga0163162_10041886 3300013306 Bacteria 4582
377 Ga0163162_10199142 3300013306 Bacteria 2131
378 Ga0163162_10397847 3300013306 Bacteria 1510
379 Ga0163162_10894075 3300013306 Bacteria 1002
380 Ga0163162_11788542 3300013306 Bacteria 702
381 Ga0163162_13401403 3300013306 Unclassified 508
382 Ga0157372_10009653 3300013307 Bacteria 10257
383 Ga0157372_10057854 3300013307 Bacteria 4334
384 Ga0157372_10194884 3300013307 Bacteria 2347
385 Ga0157372_10214535 3300013307 Bacteria 2230
386 Ga0157372_10405406 3300013307 Bacteria 1589
387 Ga0157372_10809219 3300013307 Bacteria 1088
388 Ga0157372_10918018 3300013307 Bacteria 1015
389 Ga0157372_11309762 3300013307 Bacteria 836
390 Ga0157372_12338893 3300013307 Bacteria 614
391 Ga0157375_10012517 3300013308 Bacteria 7529
392 Ga0157375_10016467 3300013308 Bacteria 6644
393 Ga0157375_10077385 3300013308 Bacteria 3356
394 Ga0157375_10090441 3300013308 Bacteria 3119
395 Ga0157375_10700923 3300013308 Bacteria 1166
396 Ga0157375_10735713 3300013308 Bacteria 1138
397 Ga0157375_10792836 3300013308 Bacteria 1096
398 Ga0163163_10458713 3300014325 Bacteria 1335
399 Ga0163163_10514615 3300014325 Bacteria 1259
400 Ga0163163_10754234 3300014325 Bacteria 1037
401 Ga0157380_10177783 3300014326 Bacteria 1867
402 Ga0157377_10006216 3300014745 Bacteria 5680
403 Ga0157377_10286177 3300014745 Bacteria 1082
404 Ga0157377_10654553 3300014745 Bacteria 757
405 Ga0157379_10208245 3300014968 Bacteria 1769
406 Ga0157379_10214043 3300014968 Bacteria 1745
407 Ga0157379_10692149 3300014968 Bacteria 956
408 Ga0157376_10060490 3300014969 Bacteria 3181
409 Ga0157376_10328044 3300014969 Bacteria 1457
410 Ga0157376_10386634 3300014969 Bacteria 1349
411 Ga0157376_10993582 3300014969 Bacteria 861
412 Ga0182007_10196697 3300015262 Bacteria 703
413 Ga0163161_10106798 3300017792 Bacteria 2089
414 Ga0163161_10174469 3300017792 Bacteria 1645
415 Ga0163161_10526949 3300017792 Bacteria 965
416 Ga0197907_11487050 3300020069 Bacteria 728
417 Ga0206356_10071443 3300020070 Bacteria 2469
418 Ga0206349_1665041 3300020075 Bacteria 733
419 Ga0206352_10170617 3300020078 Bacteria 1605
420 Ga0206352_11132655 3300020078 Bacteria 937
421 Ga0206353_11117605 3300020082 Bacteria 889
422 Ga0206353_11922409 3300020082 Bacteria 1234
423 Ga0213876_10083965 3300021384 Bacteria 1685
424 Ga0224712_10206475 3300022467 Bacteria 894
425 Ga0224712_10489652 3300022467 Bacteria 593
426 Ga0207697_10206478 3300025315 Bacteria 865
427 Ga0207656_10025013 3300025321 Bacteria 2421
428 Ga0207682_10106266 3300025893 Bacteria 1232
429 Ga0207682_10165341 3300025893 Bacteria 1005
430 Ga0207692_10264035 3300025898 Unclassified 1036
431 Ga0207642_10037832 3300025899 Bacteria 2082
432 Ga0207688_10087613 3300025901 Bacteria 1785
433 Ga0207680_10110282 3300025903 Bacteria 1783
434 Ga0207680_10538310 3300025903 Bacteria 833
435 Ga0207699_10031799 3300025906 Bacteria 2967
436 Ga0207645_10003859 3300025907 Bacteria 11218
437 Ga0207645_10004100 3300025907 Bacteria 10844
438 Ga0207645_10111453 3300025907 Bacteria 1772
439 Ga0207645_10505950 3300025907 Bacteria 818
440 Ga0207643_10024386 3300025908 Bacteria 3338
441 Ga0207705_10054893 3300025909 Bacteria 2871
442 Ga0207705_10090089 3300025909 Bacteria 2245
443 Ga0207705_10114841 3300025909 Bacteria 1992
444 Ga0207705_10224468 3300025909 Bacteria 1428
445 Ga0207705_10799216 3300025909 Bacteria 732
446 Ga0207684_10027668 3300025910 Bacteria 4829
447 Ga0207684_10524582 3300025910 Bacteria 1014
448 Ga0207684_10725513 3300025910 Bacteria 843
449 Ga0207654_10057461 3300025911 Bacteria 2261
450 Ga0207707_10006540 3300025912 Bacteria 10171
451 Ga0207707_10009547 3300025912 Bacteria 8417
452 Ga0207707_10011937 3300025912 Bacteria 7558
453 Ga0207707_10107250 3300025912 Bacteria 2442
454 Ga0207707_10119834 3300025912 Bacteria 2300
455 Ga0207707_10847738 3300025912 Bacteria 758
456 Ga0207695_10012644 3300025913 Bacteria 10111
457 Ga0207671_10479321 3300025914 Bacteria 991
458 Ga0207671_10871903 3300025914 Bacteria 712
459 Ga0207693_11133062 3300025915 Bacteria 593
460 Ga0207663_10036893 3300025916 Bacteria 2943
461 Ga0207663_10038395 3300025916 Bacteria 2894
462 Ga0207663_10355872 3300025916 Bacteria 1109
463 Ga0207660_10000818 3300025917 Bacteria 20531
464 Ga0207660_10008227 3300025917 Bacteria 6749
465 Ga0207660_10009120 3300025917 Bacteria 6424
466 Ga0207660_10052123 3300025917 Bacteria 2912
467 Ga0207660_10140041 3300025917 Bacteria 1849
468 Ga0207660_10521181 3300025917 Unclassified 965
469 Ga0207660_10897041 3300025917 Bacteria 723
470 Ga0207660_10998494 3300025917 Unclassified 683
471 Ga0207660_11050119 3300025917 Bacteria 664
472 Ga0207662_10001709 3300025918 Bacteria 10752
473 Ga0207662_10015019 3300025918 Bacteria 4351
474 Ga0207662_10146004 3300025918 Bacteria 1501
475 Ga0207657_10041175 3300025919 Bacteria 4086
476 Ga0207657_10062737 3300025919 Bacteria 3180
477 Ga0207657_10126471 3300025919 Bacteria 2099
478 Ga0207649_10034288 3300025920 Bacteria 3040
479 Ga0207649_10112676 3300025920 Bacteria 1820
480 Ga0207649_10314641 3300025920 Bacteria 1148
481 Ga0207649_10880002 3300025920 Unclassified 702
482 Ga0207649_11085095 3300025920 Bacteria 631
483 Ga0207652_10003240 3300025921 Bacteria 13498
484 Ga0207652_10013086 3300025921 Bacteria 6716
485 Ga0207652_10055753 3300025921 Bacteria 3400
486 Ga0207652_10070046 3300025921 Bacteria 3045
487 Ga0207652_10175589 3300025921 Bacteria 1924
488 Ga0207652_10199467 3300025921 Bacteria 1801
489 Ga0207652_10380513 3300025921 Bacteria 1274
490 Ga0207652_10585521 3300025921 Bacteria 1001
491 Ga0207652_11421292 3300025921 Unclassified 597
492 Ga0207646_10004321 3300025922 Bacteria 15503
493 Ga0207646_10286877 3300025922 Bacteria 1487
494 Ga0207646_10370362 3300025922 Bacteria 1294
495 Ga0207681_10004359 3300025923 Bacteria 8728
496 Ga0207681_10078694 3300025923 Bacteria 2321
497 Ga0207694_11462461 3300025924 Bacteria 577
498 Ga0207650_10002341 3300025925 Bacteria 13193
499 Ga0207650_10049790 3300025925 Bacteria 3095
500 Ga0207650_10626529 3300025925 Unclassified 906
501 Ga0207650_11376636 3300025925 Unclassified 600
502 Ga0207659_10005988 3300025926 Bacteria 7419
503 Ga0207659_10027390 3300025926 Bacteria 3858
504 Ga0207659_10219174 3300025926 Bacteria 1529
505 Ga0207659_10421588 3300025926 Bacteria 1119
506 Ga0207687_10021571 3300025927 Bacteria 4280
507 Ga0207687_10166331 3300025927 Bacteria 1697
508 Ga0207700_10024941 3300025928 Bacteria 4145
509 Ga0207664_10737295 3300025929 Bacteria 886
510 Ga0207644_10238659 3300025931 Bacteria 1446
511 Ga0207644_10838691 3300025931 Bacteria 769
512 Ga0207690_10008263 3300025932 Bacteria 6173
513 Ga0207690_10036856 3300025932 Bacteria 3170
514 Ga0207690_10071868 3300025932 Bacteria 2388
515 Ga0207706_10027416 3300025933 Bacteria 5093
516 Ga0207706_10103141 3300025933 Bacteria 2509
517 Ga0207706_10110685 3300025933 Bacteria 2416
518 Ga0207706_10453325 3300025933 Bacteria 1109
519 Ga0207686_10021294 3300025934 Bacteria 3719
520 Ga0207686_10142532 3300025934 Bacteria 1658
521 Ga0207686_10638804 3300025934 Bacteria 841
522 Ga0207670_10038897 3300025936 Bacteria 3110
523 Ga0207670_10131140 3300025936 Bacteria 1836
524 Ga0207704_10007324 3300025938 Bacteria 5206
525 Ga0207704_10050315 3300025938 Bacteria 2513
526 Ga0207704_10136439 3300025938 Bacteria 1708
527 Ga0207691_10036983 3300025940 Bacteria 4522
528 Ga0207691_10054622 3300025940 Bacteria 3643
529 Ga0207691_10300556 3300025940 Bacteria 1379
530 Ga0207691_10330784 3300025940 Bacteria 1305
531 Ga0207691_10844276 3300025940 Bacteria 768
532 Ga0207691_11654504 3300025940 Bacteria 519
533 Ga0207711_10140777 3300025941 Bacteria 2170
534 Ga0207711_10153499 3300025941 Unclassified 2079
535 Ga0207711_10250156 3300025941 Bacteria 1627
536 Ga0207689_10002618 3300025942 Bacteria 16653
537 Ga0207689_10077332 3300025942 Bacteria 2736
538 Ga0207689_10163820 3300025942 Bacteria 1832
539 Ga0207689_10633336 3300025942 Bacteria 900
540 Ga0207661_10000873 3300025944 Bacteria 19816
541 Ga0207661_10003817 3300025944 Bacteria 10503
542 Ga0207661_10047755 3300025944 Bacteria 3400
543 Ga0207661_10063636 3300025944 Bacteria 2988
544 Ga0207661_10068651 3300025944 Bacteria 2887
545 Ga0207661_10101431 3300025944 Bacteria 2418
546 Ga0207661_10111017 3300025944 Bacteria 2319
547 Ga0207661_10135219 3300025944 Bacteria 2116
548 Ga0207661_10210766 3300025944 Bacteria 1712
549 Ga0207661_10216907 3300025944 Bacteria 1689
550 Ga0207661_10401775 3300025944 Bacteria 1242
551 Ga0207661_11139976 3300025944 Bacteria 718
552 Ga0207679_10001825 3300025945 Bacteria 13268
553 Ga0207679_10010401 3300025945 Bacteria 5989
554 Ga0207679_10095638 3300025945 Bacteria 2309
555 Ga0207679_10162540 3300025945 Bacteria 1829
556 Ga0207679_10264993 3300025945 Bacteria 1467
557 Ga0207679_10552027 3300025945 Bacteria 1034
558 Ga0207679_10571381 3300025945 Bacteria 1016
559 Ga0207667_10058152 3300025949 Bacteria 4057
560 Ga0207667_10117398 3300025949 Bacteria 2742
561 Ga0207651_10076222 3300025960 Bacteria 2396
562 Ga0207651_10135290 3300025960 Bacteria 1894
563 Ga0207651_10380178 3300025960 Bacteria 1196
564 Ga0207651_10533315 3300025960 Bacteria 1019
565 Ga0207712_10000181 3300025961 Bacteria 65253
566 Ga0207712_10229074 3300025961 Bacteria 1490
567 Ga0207712_10430976 3300025961 Bacteria 1114
568 Ga0207668_10015561 3300025972 Bacteria 4728
569 Ga0207668_10033958 3300025972 Bacteria 3383
570 Ga0207668_10529546 3300025972 Unclassified 1018
571 Ga0207668_10828199 3300025972 Bacteria 820
572 Ga0207668_11065834 3300025972 Bacteria 724
573 Ga0207640_10450020 3300025981 Unclassified 1061
574 Ga0207640_10505222 3300025981 Bacteria 1007
575 Ga0207640_10708745 3300025981 Bacteria 864
576 Ga0207658_10166681 3300025986 Bacteria 1810
577 Ga0207658_10333550 3300025986 Bacteria 1316
578 Ga0207658_10350463 3300025986 Bacteria 1285
579 Ga0207658_11065008 3300025986 Bacteria 738
580 Ga0207677_10009848 3300026023 Bacteria 5387
581 Ga0207677_10327605 3300026023 Bacteria 1275
582 Ga0207677_10662902 3300026023 Bacteria 922
583 Ga0207703_10067549 3300026035 Bacteria 2942
584 Ga0207703_10068730 3300026035 Bacteria 2919
585 Ga0207639_10180597 3300026041 Bacteria 1795
586 Ga0207639_10227883 3300026041 Bacteria 1613
587 Ga0207639_11148082 3300026041 Unclassified 729
588 Ga0207678_10151545 3300026067 Bacteria 1980
589 Ga0207708_10046969 3300026075 Bacteria 3288
590 Ga0207708_10277693 3300026075 Bacteria 1357
591 Ga0207702_10228532 3300026078 Bacteria 1738
592 Ga0207702_10265467 3300026078 Bacteria 1617
593 Ga0207641_10043525 3300026088 Bacteria 3771
594 Ga0207648_10007649 3300026089 Bacteria 10578
595 Ga0207648_10101436 3300026089 Bacteria 2522
596 Ga0207648_10235651 3300026089 Bacteria 1629
597 Ga0207648_10290183 3300026089 Bacteria 1465
598 Ga0207648_10733541 3300026089 Bacteria 917
599 Ga0207676_10016488 3300026095 Bacteria 5350
600 Ga0207676_10178562 3300026095 Bacteria 1857
601 Ga0207676_10687474 3300026095 Bacteria 990
602 Ga0207674_10002535 3300026116 Bacteria 23011
603 Ga0207674_10012973 3300026116 Bacteria 9291
604 Ga0207674_10026110 3300026116 Bacteria 6213
605 Ga0207674_10026159 3300026116 Bacteria 6207
606 Ga0207674_10494805 3300026116 Bacteria 1181
607 Ga0207674_11127752 3300026116 Bacteria 754
608 Ga0207674_11411031 3300026116 Unclassified 666
609 Ga0207675_100132057 3300026118 Bacteria 2368
610 Ga0207683_10136608 3300026121 Bacteria 2207
611 Ga0207683_10633121 3300026121 Bacteria 991
612 Ga0207683_10696966 3300026121 Bacteria 941
613 Ga0207698_10100267 3300026142 Bacteria 2398
614 Ga0207698_10264691 3300026142 Bacteria 1581
615 Ga0207698_11041544 3300026142 Bacteria 830
616 Ga0209969_1011738 3300027360 Bacteria 1260
617 Ga0209981_1039614 3300027378 Bacteria 703
618 Ga0209995_1009374 3300027471 Bacteria 1582
619 Ga0209968_1010342 3300027526 Bacteria 1434
620 Ga0209999_1029098 3300027543 Bacteria 1025
621 Ga0209971_1020035 3300027682 Bacteria 1589
622 Ga0209966_1000840 3300027695 Bacteria 5986
623 Ga0209974_10016968 3300027876 Bacteria 2416
624 Ga0207428_10201907 3300027907 Bacteria 1496
625 Ga0268266_10108358 3300028379 Bacteria 2458
626 Ga0268266_10124108 3300028379 Bacteria 2302
627 Ga0268266_11032177 3300028379 Bacteria 796
628 Ga0268266_11050400 3300028379 Unclassified 788
629 Ga0268265_12196377 3300028380 Bacteria 559
630 Ga0268264_10090869 3300028381 Bacteria 2632
631 Ga0268264_10091803 3300028381 Bacteria 2620
632 Ga0268264_10224201 3300028381 Bacteria 1732
633 Ga0268264_11677734 3300028381 Bacteria 646
634 Ga0265763_1025246 3300030763 Bacteria 648
635 Ga0307408_100011913 3300031548 Bacteria 5754
636 Ga0307408_100022367 3300031548 Bacteria 4295
637 Ga0307408_100432718 3300031548 Bacteria 1137
638 Ga0307408_100776084 3300031548 Unclassified 868
639 Ga0307408_101667969 3300031548 Bacteria 607
640 Ga0307405_10002332 3300031731 Bacteria 8346
641 Ga0307405_10006748 3300031731 Bacteria 5675
642 Ga0307405_10059531 3300031731 Bacteria 2407
643 Ga0307405_10174691 3300031731 Bacteria 1536
644 Ga0307405_10243046 3300031731 Bacteria 1335
645 Ga0307405_10401024 3300031731 Bacteria 1074
646 Ga0307405_11178038 3300031731 Unclassified 662
647 Ga0307413_10003318 3300031824 Bacteria 6759
648 Ga0307413_10007021 3300031824 Bacteria 5193
649 Ga0307413_10009506 3300031824 Bacteria 4658
650 Ga0307413_10012801 3300031824 Bacteria 4189
651 Ga0307413_10079566 3300031824 Bacteria 2095
652 Ga0307413_10191247 3300031824 Bacteria 1470
653 Ga0307413_10372172 3300031824 Bacteria 1110
654 Ga0307413_10715697 3300031824 Bacteria 833
655 Ga0307410_10003426 3300031852 Bacteria 7957
656 Ga0307410_10009102 3300031852 Bacteria 5551
657 Ga0307410_10030194 3300031852 Bacteria 3461
658 Ga0307410_10030636 3300031852 Bacteria 3440
659 Ga0307410_10032064 3300031852 Bacteria 3377
660 Ga0307410_10035924 3300031852 Bacteria 3223
661 Ga0307410_10173984 3300031852 Bacteria 1625
662 Ga0307410_10174202 3300031852 Bacteria 1624
663 Ga0307410_10217083 3300031852 Unclassified 1469
664 Ga0307410_10249149 3300031852 Bacteria 1380
665 Ga0307410_10318583 3300031852 Bacteria 1233
666 Ga0307410_10322835 3300031852 Bacteria 1225
667 Ga0307406_10000977 3300031901 Bacteria 15953
668 Ga0307406_10009401 3300031901 Bacteria 5481
669 Ga0307406_10020394 3300031901 Bacteria 3902
670 Ga0307406_10025247 3300031901 Bacteria 3556
671 Ga0307406_10074765 3300031901 Bacteria 2232
672 Ga0307406_10103327 3300031901 Bacteria 1946
673 Ga0307406_11328512 3300031901 Bacteria 628
674 Ga0307407_10000229 3300031903 Bacteria 16687
675 Ga0307407_10013219 3300031903 Bacteria 3997
676 Ga0307407_10015557 3300031903 Bacteria 3765
677 Ga0307407_10049044 3300031903 Bacteria 2407
678 Ga0307407_10170889 3300031903 Bacteria 1431
679 Ga0307407_10488845 3300031903 Bacteria 900
680 Ga0307407_10632672 3300031903 Bacteria 800
681 Ga0307407_11554464 3300031903 Bacteria 524
682 Ga0307412_10000533 3300031911 Bacteria 22669
683 Ga0307412_10005145 3300031911 Bacteria 7324
684 Ga0307412_10129807 3300031911 Bacteria 1829
685 Ga0307412_10181271 3300031911 Bacteria 1584
686 Ga0307412_10222875 3300031911 Bacteria 1447
687 Ga0307412_10323927 3300031911 Bacteria 1227
688 Ga0307412_10326896 3300031911 Bacteria 1222
689 Ga0307412_10445478 3300031911 Bacteria 1065
690 Ga0307412_10647308 3300031911 Bacteria 901
691 Ga0307409_100002735 3300031995 Bacteria 9312
692 Ga0307409_100021235 3300031995 Bacteria 4447
693 Ga0307409_100028499 3300031995 Bacteria 3980
694 Ga0307409_100074986 3300031995 Bacteria 2706
695 Ga0307409_100079525 3300031995 Bacteria 2642
696 Ga0307409_100083082 3300031995 Bacteria 2595
697 Ga0307409_101253210 3300031995 Bacteria 766
698 Ga0307416_100005742 3300032002 Bacteria 7681
699 Ga0307416_100008465 3300032002 Bacteria 6642
700 Ga0307416_100008817 3300032002 Bacteria 6542
701 Ga0307416_100023776 3300032002 Bacteria 4456
702 Ga0307416_100027093 3300032002 Bacteria 4237
703 Ga0307416_100249875 3300032002 Bacteria 1725
704 Ga0307416_100317222 3300032002 Bacteria 1559
705 Ga0307416_100381702 3300032002 Bacteria 1439
706 Ga0307416_100839885 3300032002 Bacteria 1016
707 Ga0307416_101079108 3300032002 Bacteria 907
708 Ga0307416_101222220 3300032002 Bacteria 857
709 Ga0307416_101590681 3300032002 Bacteria 759
710 Ga0307416_102850959 3300032002 Unclassified 578
711 Ga0307414_10002477 3300032004 Bacteria 9677
712 Ga0307414_10012566 3300032004 Bacteria 5012
713 Ga0307414_10027140 3300032004 Bacteria 3696
714 Ga0307414_10242345 3300032004 Bacteria 1493
715 Ga0307414_10305415 3300032004 Bacteria 1348
716 Ga0307414_11679842 3300032004 Bacteria 592
717 Ga0307411_10001923 3300032005 Bacteria 8875
718 Ga0307411_10015311 3300032005 Bacteria 4302
719 Ga0307411_10040214 3300032005 Bacteria 2964
720 Ga0307411_10227566 3300032005 Bacteria 1451
721 Ga0307411_10697586 3300032005 Bacteria 884
722 Ga0307411_10698073 3300032005 Bacteria 883
723 Ga0307411_10760646 3300032005 Unclassified 849
724 Ga0307411_10774329 3300032005 Bacteria 843
725 Ga0307415_100000784 3300032126 Bacteria 14408
726 Ga0307415_100003516 3300032126 Bacteria 7989
727 Ga0307415_100028103 3300032126 Bacteria 3573
728 Ga0307415_100184652 3300032126 Bacteria 1640
729 Ga0307415_100236016 3300032126 Bacteria 1476
730 Ga0307415_100247137 3300032126 Bacteria 1447
731 Ga0307415_100345964 3300032126 Unclassified 1249
732 Ga0307415_100445546 3300032126 Bacteria 1118
733 Ga0307415_100454281 3300032126 Bacteria 1108
734 Ga0307415_101056364 3300032126 Bacteria 758
735 Ga0307415_101487650 3300032126 Bacteria 647
736 Ga0307415_101747941 3300032126 Bacteria 601
737 Ga0373926_0162822 3300035083 Bacteria 852
738 Ga0373934_0013069 3300035086 Bacteria 3136
739 Ga0373944_0209307 3300035089 Bacteria 708
740 Ga0373923_0098131 3300035111 Unclassified 1289
741 Ga0373923_0469586 3300035111 Unclassified 611
742 Ga0373954_0045633 3300035118 Bacteria 2048
743 Ga0373954_0404274 3300035118 Bacteria 675
744 Ga0373956_0222514 3300035119 Bacteria 896
745 Ga0373957_0126894 3300035120 Bacteria 1036
746 Ga0373957_0234398 3300035120 Unclassified 770
747 Ga0373943_0029448 3300035170 Bacteria 2594
748 Ga0373946_0332237 3300035171 Bacteria 757
749 Ga0373955_0016306 3300035172 Bacteria 3654
750 Ga0373955_0088143 3300035172 Bacteria 1765
751 Ga0373955_0141665 3300035172 Bacteria 1410
752 Ga0373924_0062334 3300035410 Bacteria 1562
753 Ga0373931_0023542 3300035691 Bacteria 3111
754 Ga0373927_0033533 3300035695 Bacteria 3343
755 Ga0373927_0068207 3300035695 Bacteria 2301
756 Ga0373927_0565642 3300035695 Unclassified 751
757 Ga0373933_0047772 3300035724 Bacteria 2547
758 Ga0373933_0051813 3300035724 Bacteria 2454
759 Ga0373937_0015856 3300036401 Bacteria 6679
760 Ga0373937_0089316 3300036401 Bacteria 2853
761 Ga0373937_0166609 3300036401 Bacteria 2066
762 Ga0373937_1151606 3300036401 Bacteria 724
763 Ga0373937_1503722 3300036401 Unclassified 621
764 Ga0373925_0031465 3300037068 Bacteria 3900
765 Ga0395900_0323581 3300037418 Bacteria 1522
766 Ga0395905_0139084 3300037471 Bacteria 2285
767 Ga0395901_0434478 3300038443 Bacteria 1345
768 Ga0436365_0013958 3300039437 Bacteria 3877
769 Ga0436365_0569575 3300039437 Bacteria 577
770 Ga0439439_0046593 3300041406 Bacteria 1132
771 Ga0451789_1178062 3300041443 Unclassified 560
772 Ga0439434_0055395 3300042435 Bacteria 1234
773 Ga0451577_0000016 3300042876 Bacteria 531002
774 Ga0451577_0029491 3300042876 Bacteria 4959
775 Ga0451577_0045162 3300042876 Bacteria 3943
776 Ga0451577_0499227 3300042876 Bacteria 1105
777 Ga0451577_0836999 3300042876 Bacteria 830
778 Ga0466961_0509750 3300044693 Bacteria 726
779 Ga0466964_0477592 3300044706 Bacteria 666
780 Ga0453684_0000617 3300044712 Bacteria 130120
781 Ga0451576_0054679 3300045051 Bacteria 4179
782 Ga0451576_0591386 3300045051 Bacteria 1166
783 Ga0466967_0026287 3300045976 Bacteria 4819
784 Ga0466967_0353405 3300045976 Bacteria 1423
785 Ga0495592_0188349 3300046454 Bacteria 1400
786 Ga0495592_0358802 3300046454 Bacteria 933
787 Ga0495651_0059950 3300046462 Bacteria 2916
788 Ga0495653_0045292 3300046463 Bacteria 3411
789 Ga0495653_0056836 3300046463 Bacteria 2981
790 Ga0495580_0106064 3300046472 Bacteria 1952
791 Ga0495580_0689714 3300046472 Bacteria 669
792 Ga0495582_0076878 3300046473 Bacteria 1851
793 Ga0495582_0165473 3300046473 Bacteria 1258
794 Ga0495639_0398174 3300046475 Bacteria 695
795 Ga0495662_0006513 3300046476 Bacteria 5833
796 Ga0495662_0566138 3300046476 Bacteria 556
797 Ga0495664_0009895 3300046477 Bacteria 5349
798 Ga0495664_0194277 3300046477 Bacteria 1230
799 Ga0495664_0320743 3300046477 Bacteria 934
800 Ga0495585_0605674 3300046492 Unclassified 515
801 Ga0495594_0002515 3300046499 Bacteria 9556
802 Ga0495594_0012998 3300046499 Bacteria 4342
803 Ga0495608_0018028 3300046511 Bacteria 4877
804 Ga0495608_0022322 3300046511 Bacteria 4339
805 Ga0495608_0126548 3300046511 Bacteria 1636
806 Ga0495618_0084631 3300046514 Bacteria 2026
807 Ga0495628_0038821 3300046516 Bacteria 3809
808 Ga0495630_0011558 3300046517 Bacteria 6392
809 Ga0495630_0017051 3300046517 Bacteria 5316
810 Ga0495630_0089210 3300046517 Bacteria 2329
811 Ga0495630_0608841 3300046517 Bacteria 837
812 Ga0495630_0944108 3300046517 Unclassified 656
813 Ga0495666_0364095 3300046526 Bacteria 651
814 Ga0495652_0003351 3300046529 Bacteria 15872
815 Ga0495652_0045072 3300046529 Bacteria 3795
816 Ga0495652_0061826 3300046529 Bacteria 3160
817 Ga0495652_0177164 3300046529 Bacteria 1640
818 Ga0495652_0460804 3300046529 Bacteria 888
819 Ga0495665_0020004 3300046531 Bacteria 3599
820 Ga0495665_0072904 3300046531 Bacteria 1808
821 Ga0495665_0213679 3300046531 Bacteria 998
822 Ga0495665_0239780 3300046531 Bacteria 935
823 Ga0495665_0401334 3300046531 Bacteria 695
824 Ga0495640_0004624 3300046533 Bacteria 10981
825 Ga0495586_0036821 3300046535 Bacteria 2626
826 Ga0495586_0051997 3300046535 Bacteria 2217
827 Ga0495586_0055944 3300046535 Bacteria 2139
828 Ga0495586_0312172 3300046535 Unclassified 901
829 Ga0495587_0000747 3300046536 Bacteria 21674
830 Ga0495587_0023334 3300046536 Bacteria 3802
831 Ga0495587_0026271 3300046536 Bacteria 3551
832 Ga0495587_0116361 3300046536 Bacteria 1533
833 Ga0495587_0309706 3300046536 Bacteria 882
834 Ga0495621_0261692 3300046539 Bacteria 709
835 Ga0495645_0000475 3300046543 Bacteria 27786
836 Ga0495645_0000710 3300046543 Bacteria 22853
837 Ga0495645_0094240 3300046543 Bacteria 2136
838 Ga0495645_0094485 3300046543 Bacteria 2133
839 Ga0495645_0184131 3300046543 Bacteria 1428
840 Ga0495645_0223786 3300046543 Bacteria 1264
841 Ga0495667_0001590 3300046559 Bacteria 15065
842 Ga0495667_0012886 3300046559 Bacteria 5666
843 Ga0495667_0045361 3300046559 Bacteria 2911
844 Ga0495667_0170318 3300046559 Bacteria 1399
845 Ga0495634_0023849 3300046642 Bacteria 4298
846 Ga0495635_0032403 3300046663 Bacteria 3626
847 Ga0495635_0045013 3300046663 Bacteria 3044
848 Ga0495588_0110483 3300046674 Bacteria 1448
849 Ga0495657_0003392 3300046675 Bacteria 13013
850 Ga0495657_0062418 3300046675 Bacteria 2462
851 Ga0495657_0151763 3300046675 Bacteria 1438
852 Ga0495599_0003240 3300046678 Bacteria 9475
853 Ga0495599_0003716 3300046678 Bacteria 8938
854 Ga0495599_0096910 3300046678 Bacteria 1839
855 Ga0495599_0153740 3300046678 Bacteria 1424
856 Ga0495623_0032621 3300046679 Bacteria 3347
857 Ga0495623_0072470 3300046679 Bacteria 2142
858 Ga0495623_0088946 3300046679 Bacteria 1899
859 Ga0495646_0037731 3300046680 Bacteria 2987
860 Ga0495646_0265266 3300046680 Bacteria 916
861 Ga0495658_0424212 3300046683 Bacteria 849
862 Ga0495669_0166659 3300046684 Bacteria 1047
863 Ga0495613_0029323 3300046689 Bacteria 4091
864 Ga0495613_0043113 3300046689 Bacteria 3338
865 Ga0495613_0696688 3300046689 Bacteria 669
866 Ga0495600_0069926 3300046809 Bacteria 2294
867 Ga0495600_0505136 3300046809 Bacteria 742
868 Ga0495581_0033867 3300047315 Bacteria 2956
869 Ga0495581_0163615 3300047315 Bacteria 1301
870 Ga0495581_0208474 3300047315 Bacteria 1143
871 Ga0495604_0054807 3300047317 Bacteria 3075
872 Ga0495604_0459656 3300047317 Unclassified 831
873 Ga0495604_0843355 3300047317 Bacteria 575
874 Ga0495674_0048052 3300047319 Bacteria 3779
875 Ga0495674_0172434 3300047319 Bacteria 1804
876 Ga0495674_0186240 3300047319 Bacteria 1727
877 Ga0495674_0210436 3300047319 Bacteria 1611
878 Ga0495672_0007750 3300047320 Bacteria 8036
879 Ga0495680_0033583 3300047322 Bacteria 4151
880 Ga0495680_0531580 3300047322 Unclassified 794
881 Ga0495675_0041679 3300047444 Bacteria 2925
882 Ga0495675_0068082 3300047444 Bacteria 2249
883 Ga0495675_0084915 3300047444 Bacteria 1991
884 Ga0495684_0006808 3300047471 Bacteria 8877
885 Ga0495684_0016565 3300047471 Bacteria 5677
886 Ga0495684_0025329 3300047471 Bacteria 4561
887 Ga0495684_0143558 3300047471 Bacteria 1789
888 Ga0495593_0038393 3300047673 Bacteria 2587
889 Ga0495593_0121161 3300047673 Bacteria 1331
890 Ga0495602_0015244 3300048088 Bacteria 7764
891 Ga0495602_0035269 3300048088 Bacteria 4666
892 Ga0495602_0186071 3300048088 Unclassified 1597
893 Ga0496100_0139361 3300048903 Bacteria 1717
894 Ga0496101_0253254 3300048904 Bacteria 1372
895 Ga0496104_0165984 3300048907 Bacteria 2117
896 Ga0496104_1453739 3300048907 Bacteria 588
897 Ga0496105_0393646 3300048908 Bacteria 1101
898 Ga0496106_0189528 3300048909 Bacteria 1635
899 Ga0496108_0085778 3300048911 Bacteria 2673
900 Ga0496108_0849839 3300048911 Bacteria 785
901 Ga0496110_0167276 3300048913 Bacteria 1994
902 Ga0496110_0815835 3300048913 Bacteria 838
903 Ga0496112_0014015 3300048915 Bacteria 7418
904 Ga0496112_0024153 3300048915 Bacteria 5817
905 Ga0496113_1418816 3300048916 Bacteria 537
906 Ga0496114_0491060 3300048917 Bacteria 1086
907 Ga0496115_0485705 3300048918 Bacteria 994
908 Ga0496115_0550406 3300048918 Unclassified 922
909 Ga0496115_0709077 3300048918 Bacteria 790
910 Ga0501303_025790 3300049526 Unclassified 656
911 Ga0501323_088717 3300049539 Bacteria 513
912 Ga0501034_1069209 3300049571 Bacteria 689
913 Ga0501067_0389274 3300049583 Bacteria 777
914 Ga0501069_0511299 3300049585 Bacteria 717
915 Ga0501071_1254614 3300049587 Bacteria 573
916 Ga0501073_0175852 3300049589 Bacteria 1482
917 Ga0501198_161236 3300049649 Bacteria 501
918 Ga0501207_011481 3300049654 Bacteria 1320
919 Ga0501216_005790 3300049660 Bacteria 1874
920 Ga0501217_020816 3300049661 Bacteria 1544
921 Ga0501224_002274 3300049664 Bacteria 2601
922 Ga0501228_070032 3300049666 Unclassified 511
923 Ga0501230_016822 3300049667 Bacteria 1231
924 Ga0501233_002061 3300049668 Bacteria 3507
925 Ga0501233_222767 3300049668 Bacteria 557
926 Ga0501235_003188 3300049669 Bacteria 3535
927 Ga0501235_122109 3300049669 Unclassified 653
928 Ga0501242_010215 3300049674 Bacteria 1119
929 Ga0501243_027043 3300049675 Bacteria 967
930 Ga0501243_037291 3300049675 Bacteria 845
931 Ga0501247_014257 3300049677 Bacteria 984
932 Ga0501247_034840 3300049677 Bacteria 701
933 Ga0501247_051939 3300049677 Bacteria 610
934 Ga0501249_045259 3300049679 Bacteria 1004
935 Ga0501249_080489 3300049679 Bacteria 766
936 Ga0501252_000489 3300049682 Bacteria 3052
937 Ga0501252_042749 3300049682 Bacteria 663
938 Ga0501252_052816 3300049682 Bacteria 618
939 Ga0501257_119078 3300049686 Bacteria 706
940 Ga0501261_007497 3300049690 Bacteria 1401
941 Ga0501221_003414 3300049704 Bacteria 2612
942 Ga0501225_0013296 3300049705 Bacteria 2305
943 Ga0501229_080776 3300049706 Bacteria 520
944 Ga0501234_042886 3300049707 Bacteria 743
945 Ga0501245_005236 3300049708 Bacteria 1795
946 Ga0501245_052400 3300049708 Unclassified 727
947 Ga0501262_006240 3300049759 Bacteria 1422
948 Ga0501266_002003 3300049763 Bacteria 2567
949 Ga0501266_089569 3300049763 Unclassified 532
950 Ga0501268_005281 3300049765 Bacteria 1852
951 Ga0501270_008782 3300049767 Bacteria 1288
952 Ga0501271_035135 3300049768 Bacteria 634
953 Ga0501273_057980 3300049770 Bacteria 605
954 nmdc:mga09592_17631_c1 3300050508 Bacteria 5851
955 nmdc:mga09592_264993_c1 3300050508 Bacteria 1490
956 nmdc:mga09592_580235_c1 3300050508 Bacteria 962
957 nmdc:mga09592_817718_c1 3300050508 Bacteria 787
958 nmdc:mga0qj67_346845_c1 3300050509 Bacteria 1201
959 nmdc:mga0qj67_844301_c1 3300050509 Unclassified 724
960 nmdc:mga06r32_1823380_c1 3300050510 Bacteria 544
961 nmdc:mga06r32_30321_c1 3300050510 Bacteria 5075
962 nmdc:mga06r32_364956_c1 3300050510 Bacteria 1428
963 nmdc:mga08y16_168621_c1 3300050511 Bacteria 2274
964 nmdc:mga08y16_307808_c1 3300050511 Bacteria 1632
965 nmdc:mga0n895_71244_c1 3300050512 Bacteria 3446
966 nmdc:mga0rr50_394144_c1 3300050513 Bacteria 1169
967 Ga0495612_0024300 3300053078 Bacteria 2432
968 Ga0495595_0109202 3300053084 Bacteria 1340
969 Ga0495619_0380228 3300053085 Bacteria 976
970 Ga0587070_016939 3300059491 Bacteria 1174
971 Ga0587073_0187586 3300059492 Bacteria 611
972 Ga0587082_049144 3300059504 Unclassified 799
973 Ga0587091_020731 3300059511 Bacteria 1144
974 Ga0587091_165143 3300059511 Bacteria 572
975 Ga0587113_050434 3300059625 Bacteria 518
976 Ga0587067_138613 3300059640 Bacteria 601
977 Ga0587072_121028 3300059643 Bacteria 607
978 Ga0587075_048258 3300059644 Bacteria 735
979 Ga0587076_191070 3300059645 Bacteria 521
980 Ga0587078_008240 3300059646 Bacteria 1165
981 Ga0587071_004892 3300060344 Bacteria 2021
982 Ga0587111_0181018 3300060346 Viruses 586
983 Ga0501082_1268943 3300060353 Bacteria 644

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049765 Ga0501268_005281 Ga0501268_005281_1519_1842 89
2 3300046472 Ga0495580_0689714 Ga0495580_0689714_143_604 94
3 3300005341 Ga0070691_10013009 Ga0070691_100130092 95
4 3300005353 Ga0070669_100277876 Ga0070669_1002778761 95
5 3300009094 Ga0111539_10233831 Ga0111539_102338312 95
6 3300009545 Ga0105237_10197173 Ga0105237_101971731 95
7 3300009551 Ga0105238_10069130 Ga0105238_100691303 95
8 3300013307 Ga0157372_12338893 Ga0157372_123388932 95
9 3300025961 Ga0207712_10430976 Ga0207712_104309761 95
10 3300042876 Ga0451577_0836999 Ga0451577_0836999_296_712 95
11 3300045051 Ga0451576_0591386 Ga0451576_0591386_424_840 95
12 3300042876 Ga0451577_0499227 Ga0451577_0499227_450_851 96
13 3300003308 Ga0006777J48905_1058895 Ga0006777J48905_10588954 97
14 3300005437 Ga0070710_10357910 Ga0070710_103579101 97
15 3300005439 Ga0070711_100222579 Ga0070711_1002225791 97
16 3300025898 Ga0207692_10264035 Ga0207692_102640352 97
17 3300025916 Ga0207663_10038395 Ga0207663_100383952 97
18 3300045051 Ga0451576_0054679 Ga0451576_0054679_210_644 97
19 3300046475 Ga0495639_0398174 Ga0495639_0398174_198_662 97
20 3300046531 Ga0495665_0020004 Ga0495665_0020004_3106_3570 97
21 3300046535 Ga0495586_0055944 Ga0495586_0055944_671_1135 97
22 3300047319 Ga0495674_0210436 Ga0495674_0210436_1076_1540 97
23 3300048907 Ga0496104_1453739 Ga0496104_1453739_70_534 97
24 3300050511 nmdc:mga08y16_168621_c1 nmdc:mga08y16_168621_c1_1332_1766 97
25 3300005329 Ga0070683_100954592 Ga0070683_1009545921 98
26 3300035119 Ga0373956_0222514 Ga0373956_0222514_148_612 98
27 3300035172 Ga0373955_0141665 Ga0373955_0141665_687_1151 98
28 3300046511 Ga0495608_0018028 Ga0495608_0018028_1939_2403 98
29 3300046559 Ga0495667_0001590 Ga0495667_0001590_5351_5815 98
30 3300046675 Ga0495657_0062418 Ga0495657_0062418_664_1128 98
31 3300048088 Ga0495602_0035269 Ga0495602_0035269_4184_4648 98
32 3300032126 Ga0307415_100236016 Ga0307415_1002360162 99
33 3300048918 Ga0496115_0550406 Ga0496115_0550406_19_378 100
34 3300050510 nmdc:mga06r32_1823380_c1 nmdc:mga06r32_1823380_c1_157_516 100
35 3300031731 Ga0307405_10401024 Ga0307405_104010242 101
36 3300049706 Ga0501229_080776 Ga0501229_080776_21_380 101
37 3300060353 Ga0501082_1268943 Ga0501082_1268943_47_406 101
38 3300042876 Ga0451577_0000016 Ga0451577_0000016_474297_474713 102
39 3300049571 Ga0501034_1069209 Ga0501034_1069209_235_660 102
40 3300049675 Ga0501243_027043 Ga0501243_027043_77_484 102
41 3300042876 Ga0451577_0045162 Ga0451577_0045162_860_1285 103
42 3300044712 Ga0453684_0000617 Ga0453684_0000617_20797_21222 103
43 3300049682 Ga0501252_052816 Ga0501252_052816_16_426 103
44 3300013306 Ga0163162_13401403 Ga0163162_134014031 105
45 3300031824 Ga0307413_10007021 Ga0307413_100070213 105
46 3300031852 Ga0307410_10009102 Ga0307410_100091025 105
47 3300031852 Ga0307410_10318583 Ga0307410_103185831 105
48 3300031901 Ga0307406_10009401 Ga0307406_100094013 105
49 3300031903 Ga0307407_10000229 Ga0307407_100002299 105
50 3300031911 Ga0307412_10005145 Ga0307412_100051455 105
51 3300032002 Ga0307416_100005742 Ga0307416_1000057427 105
52 3300032004 Ga0307414_10305415 Ga0307414_103054152 105
53 3300032005 Ga0307411_10040214 Ga0307411_100402144 105
54 3300032126 Ga0307415_100000784 Ga0307415_10000078413 105
55 3300046543 Ga0495645_0094485 Ga0495645_0094485_232_696 105
56 3300049668 Ga0501233_222767 Ga0501233_222767_66_479 105
57 3300005339 Ga0070660_100205577 Ga0070660_1002055772 106
58 3300031911 Ga0307412_10222875 Ga0307412_102228752 106
59 3300060344 Ga0587071_004892 Ga0587071_004892_1101_1580 106
60 3300005328 Ga0070676_10404908 Ga0070676_104049082 107
61 3300013307 Ga0157372_10405406 Ga0157372_104054062 107
62 3300027360 Ga0209969_1011738 Ga0209969_10117383 107
63 3300027378 Ga0209981_1039614 Ga0209981_10396142 107
64 3300027471 Ga0209995_1009374 Ga0209995_10093743 107
65 3300027526 Ga0209968_1010342 Ga0209968_10103423 107
66 3300027543 Ga0209999_1029098 Ga0209999_10290981 107
67 3300027682 Ga0209971_1020035 Ga0209971_10200353 107
68 3300027695 Ga0209966_1000840 Ga0209966_10008404 107
69 3300027876 Ga0209974_10016968 Ga0209974_100169681 107
70 3300049708 Ga0501245_052400 Ga0501245_052400_233_643 107
71 3300005331 Ga0070670_100902962 Ga0070670_1009029621 108
72 3300005364 Ga0070673_100216471 Ga0070673_1002164712 108
73 3300005536 Ga0070697_100213740 Ga0070697_1002137402 108
74 3300006846 Ga0075430_100026576 Ga0075430_1000265765 108
75 3300006847 Ga0075431_100022910 Ga0075431_1000229105 108
76 3300006880 Ga0075429_100155646 Ga0075429_1001556462 108
77 3300009553 Ga0105249_10837042 Ga0105249_108370422 108
78 3300035086 Ga0373934_0013069 Ga0373934_0013069_1830_2294 108
79 3300035111 Ga0373923_0098131 Ga0373923_0098131_532_996 108
80 3300035120 Ga0373957_0234398 Ga0373957_0234398_283_747 108
81 3300035724 Ga0373933_0051813 Ga0373933_0051813_1071_1535 108
82 3300046463 Ga0495653_0045292 Ga0495653_0045292_71_535 108
83 3300046477 Ga0495664_0009895 Ga0495664_0009895_31_495 108
84 3300046529 Ga0495652_0003351 Ga0495652_0003351_8808_9272 108
85 3300046536 Ga0495587_0000747 Ga0495587_0000747_19822_20286 108
86 3300046543 Ga0495645_0000475 Ga0495645_0000475_19834_20298 108
87 3300046663 Ga0495635_0032403 Ga0495635_0032403_1078_1542 108
88 3300046678 Ga0495599_0003716 Ga0495599_0003716_1366_1830 108
89 3300046679 Ga0495623_0088946 Ga0495623_0088946_214_678 108
90 3300047317 Ga0495604_0459656 Ga0495604_0459656_331_795 108
91 3300047322 Ga0495680_0531580 Ga0495680_0531580_48_512 108
92 3300047444 Ga0495675_0041679 Ga0495675_0041679_1162_1626 108
93 3300047471 Ga0495684_0006808 Ga0495684_0006808_1137_1601 108
94 3300049583 Ga0501067_0389274 Ga0501067_0389274_92_508 108
95 3300049585 Ga0501069_0511299 Ga0501069_0511299_11_427 108
96 3300049763 Ga0501266_089569 Ga0501266_089569_16_426 108
97 3300050508 nmdc:mga09592_17631_c1 nmdc:mga09592_17631_c1_2749_3168 108
98 3300050509 nmdc:mga0qj67_844301_c1 nmdc:mga0qj67_844301_c1_233_652 108
99 3300050510 nmdc:mga06r32_30321_c1 nmdc:mga06r32_30321_c1_2891_3310 108
100 3300053078 Ga0495612_0024300 Ga0495612_0024300_323_787 108
101 3300001991 JGI24743J22301_10124862 JGI24743J22301_101248621 109
102 3300004803 Ga0058862_12870049 Ga0058862_128700493 109
103 3300004803 Ga0058862_12887040 Ga0058862_128870404 109
104 3300005328 Ga0070676_10046897 Ga0070676_100468973 109
105 3300005329 Ga0070683_100000565 Ga0070683_1000005653 109
106 3300005329 Ga0070683_100069251 Ga0070683_1000692513 109
107 3300005330 Ga0070690_100075352 Ga0070690_1000753521 109
108 3300005331 Ga0070670_100008774 Ga0070670_1000087746 109
109 3300005334 Ga0068869_100006227 Ga0068869_1000062273 109
110 3300005336 Ga0070680_100006760 Ga0070680_1000067603 109
111 3300005336 Ga0070680_100213568 Ga0070680_1002135683 109
112 3300005337 Ga0070682_100000275 Ga0070682_1000002753 109
113 3300005337 Ga0070682_100002639 Ga0070682_1000026393 109
114 3300005338 Ga0068868_100066722 Ga0068868_1000667224 109
115 3300005338 Ga0068868_100154703 Ga0068868_1001547032 109
116 3300005339 Ga0070660_100423221 Ga0070660_1004232212 109
117 3300005340 Ga0070689_100783143 Ga0070689_1007831432 109
118 3300005341 Ga0070691_10235550 Ga0070691_102355502 109
119 3300005343 Ga0070687_100095487 Ga0070687_1000954872 109
120 3300005344 Ga0070661_100022554 Ga0070661_1000225545 109
121 3300005344 Ga0070661_100027604 Ga0070661_1000276043 109
122 3300005345 Ga0070692_10040375 Ga0070692_100403752 109
123 3300005354 Ga0070675_100001662 Ga0070675_10000166212 109
124 3300005355 Ga0070671_100774132 Ga0070671_1007741321 109
125 3300005356 Ga0070674_100792775 Ga0070674_1007927751 109
126 3300005364 Ga0070673_100118119 Ga0070673_1001181193 109
127 3300005364 Ga0070673_100292825 Ga0070673_1002928252 109
128 3300005366 Ga0070659_100045299 Ga0070659_1000452993 109
129 3300005457 Ga0070662_100027228 Ga0070662_1000272282 109
130 3300005457 Ga0070662_100238195 Ga0070662_1002381953 109
131 3300005458 Ga0070681_10007180 Ga0070681_100071808 109
132 3300005458 Ga0070681_10026256 Ga0070681_100262564 109
133 3300005459 Ga0068867_100141930 Ga0068867_1001419302 109
134 3300005466 Ga0070685_10850856 Ga0070685_108508562 109
135 3300005471 Ga0070698_100893206 Ga0070698_1008932061 109
136 3300005530 Ga0070679_100000771 Ga0070679_1000007713 109
137 3300005530 Ga0070679_100949180 Ga0070679_1009491802 109
138 3300005535 Ga0070684_100006014 Ga0070684_1000060145 109
139 3300005535 Ga0070684_100178147 Ga0070684_1001781472 109
140 3300005544 Ga0070686_100031501 Ga0070686_1000315014 109
141 3300005545 Ga0070695_100128172 Ga0070695_1001281722 109
142 3300005545 Ga0070695_100217178 Ga0070695_1002171783 109
143 3300005547 Ga0070693_100026362 Ga0070693_1000263623 109
144 3300005563 Ga0068855_100128332 Ga0068855_1001283322 109
145 3300005564 Ga0070664_100016606 Ga0070664_1000166064 109
146 3300005564 Ga0070664_100016816 Ga0070664_1000168163 109
147 3300005577 Ga0068857_100004677 Ga0068857_1000046776 109
148 3300005577 Ga0068857_100009564 Ga0068857_1000095645 109
149 3300005578 Ga0068854_101411342 Ga0068854_1014113421 109
150 3300005614 Ga0068856_100037691 Ga0068856_1000376913 109
151 3300005614 Ga0068856_100092780 Ga0068856_1000927803 109
152 3300005615 Ga0070702_100006432 Ga0070702_1000064324 109
153 3300005616 Ga0068852_100228468 Ga0068852_1002284683 109
154 3300005617 Ga0068859_100112215 Ga0068859_1001122152 109
155 3300005618 Ga0068864_100024854 Ga0068864_1000248545 109
156 3300005718 Ga0068866_10094671 Ga0068866_100946712 109
157 3300005840 Ga0068870_10012644 Ga0068870_100126442 109
158 3300005841 Ga0068863_100029136 Ga0068863_1000291363 109
159 3300005842 Ga0068858_100192377 Ga0068858_1001923772 109
160 3300005843 Ga0068860_100021657 Ga0068860_1000216576 109
161 3300006237 Ga0097621_100010975 Ga0097621_1000109752 109
162 3300006358 Ga0068871_100284792 Ga0068871_1002847923 109
163 3300006931 Ga0097620_100112208 Ga0097620_1001122083 109
164 3300009098 Ga0105245_10340875 Ga0105245_103408752 109
165 3300009174 Ga0105241_10008171 Ga0105241_100081716 109
166 3300009176 Ga0105242_10101363 Ga0105242_101013632 109
167 3300009176 Ga0105242_11741771 Ga0105242_117417711 109
168 3300009177 Ga0105248_10325266 Ga0105248_103252663 109
169 3300009551 Ga0105238_10173727 Ga0105238_101737273 109
170 3300010375 Ga0105239_10025248 Ga0105239_100252483 109
171 3300011119 Ga0105246_10001421 Ga0105246_100014217 109
172 3300013100 Ga0157373_10338204 Ga0157373_103382042 109
173 3300013102 Ga0157371_10018782 Ga0157371_100187824 109
174 3300013296 Ga0157374_10251765 Ga0157374_102517652 109
175 3300013297 Ga0157378_10040562 Ga0157378_100405623 109
176 3300013307 Ga0157372_10057854 Ga0157372_100578542 109
177 3300013308 Ga0157375_10735713 Ga0157375_107357132 109
178 3300014325 Ga0163163_10514615 Ga0163163_105146153 109
179 3300014745 Ga0157377_10006216 Ga0157377_100062164 109
180 3300014968 Ga0157379_10214043 Ga0157379_102140431 109
181 3300014969 Ga0157376_10328044 Ga0157376_103280442 109
182 3300025315 Ga0207697_10206478 Ga0207697_102064782 109
183 3300025907 Ga0207645_10004100 Ga0207645_100041008 109
184 3300025908 Ga0207643_10024386 Ga0207643_100243863 109
185 3300025911 Ga0207654_10057461 Ga0207654_100574613 109
186 3300025912 Ga0207707_10006540 Ga0207707_100065404 109
187 3300025912 Ga0207707_10011937 Ga0207707_100119374 109
188 3300025917 Ga0207660_10009120 Ga0207660_100091203 109
189 3300025917 Ga0207660_10052123 Ga0207660_100521234 109
190 3300025919 Ga0207657_10126471 Ga0207657_101264714 109
191 3300025920 Ga0207649_10034288 Ga0207649_100342884 109
192 3300025920 Ga0207649_10112676 Ga0207649_101126762 109
193 3300025921 Ga0207652_10003240 Ga0207652_100032403 109
194 3300025921 Ga0207652_11421292 Ga0207652_114212922 109
195 3300025925 Ga0207650_10002341 Ga0207650_100023417 109
196 3300025926 Ga0207659_10005988 Ga0207659_100059887 109
197 3300025927 Ga0207687_10021571 Ga0207687_100215712 109
198 3300025932 Ga0207690_10008263 Ga0207690_100082633 109
199 3300025933 Ga0207706_10027416 Ga0207706_100274164 109
200 3300025933 Ga0207706_10103141 Ga0207706_101031413 109
201 3300025934 Ga0207686_10142532 Ga0207686_101425323 109
202 3300025936 Ga0207670_10131140 Ga0207670_101311402 109
203 3300025938 Ga0207704_10050315 Ga0207704_100503153 109
204 3300025941 Ga0207711_10140777 Ga0207711_101407772 109
205 3300025942 Ga0207689_10002618 Ga0207689_100026183 109
206 3300025944 Ga0207661_10000873 Ga0207661_100008734 109
207 3300025944 Ga0207661_10003817 Ga0207661_100038173 109
208 3300025945 Ga0207679_10001825 Ga0207679_100018257 109
209 3300025945 Ga0207679_10010401 Ga0207679_100104014 109
210 3300025949 Ga0207667_10058152 Ga0207667_100581523 109
211 3300025960 Ga0207651_10076222 Ga0207651_100762223 109
212 3300025972 Ga0207668_11065834 Ga0207668_110658342 109
213 3300026023 Ga0207677_10009848 Ga0207677_100098484 109
214 3300026023 Ga0207677_10662902 Ga0207677_106629021 109
215 3300026035 Ga0207703_10068730 Ga0207703_100687303 109
216 3300026041 Ga0207639_10180597 Ga0207639_101805972 109
217 3300026041 Ga0207639_10227883 Ga0207639_102278832 109
218 3300026075 Ga0207708_10046969 Ga0207708_100469694 109
219 3300026078 Ga0207702_10228532 Ga0207702_102285323 109
220 3300026078 Ga0207702_10265467 Ga0207702_102654671 109
221 3300026088 Ga0207641_10043525 Ga0207641_100435253 109
222 3300026089 Ga0207648_10235651 Ga0207648_102356513 109
223 3300026095 Ga0207676_10016488 Ga0207676_100164883 109
224 3300026116 Ga0207674_10002535 Ga0207674_1000253514 109
225 3300026116 Ga0207674_10012973 Ga0207674_100129736 109
226 3300026142 Ga0207698_10100267 Ga0207698_101002672 109
227 3300028381 Ga0268264_10090869 Ga0268264_100908692 109
228 3300028381 Ga0268264_11677734 Ga0268264_116777341 109
229 3300032002 Ga0307416_100317222 Ga0307416_1003172223 109
230 3300032005 Ga0307411_10697586 Ga0307411_106975861 109
231 3300059491 Ga0587070_016939 Ga0587070_016939_731_1147 109
232 3300059504 Ga0587082_049144 Ga0587082_049144_185_601 109
233 3300059511 Ga0587091_020731 Ga0587091_020731_705_1121 109
234 3300060346 Ga0587111_0181018 Ga0587111_0181018_142_558 109
235 3300005339 Ga0070660_100718842 Ga0070660_1007188422 110
236 3300005353 Ga0070669_100156457 Ga0070669_1001564573 110
237 3300005445 Ga0070708_100000052 Ga0070708_10000005243 110
238 3300005467 Ga0070706_100116838 Ga0070706_1001168383 110
239 3300005468 Ga0070707_100000643 Ga0070707_1000006435 110
240 3300005518 Ga0070699_100295801 Ga0070699_1002958011 110
241 3300005844 Ga0068862_100581222 Ga0068862_1005812222 110
242 3300006847 Ga0075431_100903771 Ga0075431_1009037712 110
243 3300009148 Ga0105243_10773134 Ga0105243_107731342 110
244 3300013306 Ga0163162_10199142 Ga0163162_101991421 110
245 3300014745 Ga0157377_10654553 Ga0157377_106545532 110
246 3300025922 Ga0207646_10004321 Ga0207646_100043215 110
247 3300025923 Ga0207681_10078694 Ga0207681_100786942 110
248 3300028380 Ga0268265_12196377 Ga0268265_121963772 110
249 3300031548 Ga0307408_100022367 Ga0307408_1000223672 110
250 3300031548 Ga0307408_101667969 Ga0307408_1016679692 110
251 3300031731 Ga0307405_10006748 Ga0307405_100067483 110
252 3300031731 Ga0307405_10059531 Ga0307405_100595312 110
253 3300031731 Ga0307405_11178038 Ga0307405_111780381 110
254 3300031824 Ga0307413_10003318 Ga0307413_100033182 110
255 3300031824 Ga0307413_10009506 Ga0307413_100095065 110
256 3300031824 Ga0307413_10191247 Ga0307413_101912472 110
257 3300031852 Ga0307410_10030194 Ga0307410_100301943 110
258 3300031852 Ga0307410_10030636 Ga0307410_100306365 110
259 3300031852 Ga0307410_10322835 Ga0307410_103228351 110
260 3300031901 Ga0307406_10020394 Ga0307406_100203942 110
261 3300031901 Ga0307406_10025247 Ga0307406_100252475 110
262 3300031903 Ga0307407_10013219 Ga0307407_100132195 110
263 3300031903 Ga0307407_10015557 Ga0307407_100155573 110
264 3300031903 Ga0307407_10049044 Ga0307407_100490442 110
265 3300031903 Ga0307407_10632672 Ga0307407_106326722 110
266 3300031911 Ga0307412_10129807 Ga0307412_101298072 110
267 3300031911 Ga0307412_10181271 Ga0307412_101812712 110
268 3300031911 Ga0307412_10323927 Ga0307412_103239273 110
269 3300031995 Ga0307409_100002735 Ga0307409_1000027358 110
270 3300031995 Ga0307409_100079525 Ga0307409_1000795253 110
271 3300032002 Ga0307416_100008465 Ga0307416_1000084656 110
272 3300032002 Ga0307416_100008817 Ga0307416_1000088172 110
273 3300032002 Ga0307416_100381702 Ga0307416_1003817021 110
274 3300032004 Ga0307414_10012566 Ga0307414_100125662 110
275 3300032004 Ga0307414_10027140 Ga0307414_100271402 110
276 3300032004 Ga0307414_10242345 Ga0307414_102423452 110
277 3300032005 Ga0307411_10015311 Ga0307411_100153113 110
278 3300032005 Ga0307411_10698073 Ga0307411_106980732 110
279 3300032005 Ga0307411_10760646 Ga0307411_107606461 110
280 3300032126 Ga0307415_100028103 Ga0307415_1000281035 110
281 3300032126 Ga0307415_100247137 Ga0307415_1002471371 110
282 3300032126 Ga0307415_100345964 Ga0307415_1003459641 110
283 3300032126 Ga0307415_100454281 Ga0307415_1004542812 110
284 3300035118 Ga0373954_0404274 Ga0373954_0404274_167_571 110
285 3300035172 Ga0373955_0088143 Ga0373955_0088143_1251_1655 110
286 3300035724 Ga0373933_0047772 Ga0373933_0047772_293_697 110
287 3300036401 Ga0373937_0089316 Ga0373937_0089316_296_700 110
288 3300046454 Ga0495592_0188349 Ga0495592_0188349_24_428 110
289 3300046462 Ga0495651_0059950 Ga0495651_0059950_407_811 110
290 3300046463 Ga0495653_0056836 Ga0495653_0056836_313_717 110
291 3300046476 Ga0495662_0006513 Ga0495662_0006513_3295_3699 110
292 3300046477 Ga0495664_0194277 Ga0495664_0194277_226_630 110
293 3300046511 Ga0495608_0022322 Ga0495608_0022322_2918_3322 110
294 3300046514 Ga0495618_0084631 Ga0495618_0084631_583_987 110
295 3300046516 Ga0495628_0038821 Ga0495628_0038821_834_1238 110
296 3300046517 Ga0495630_0011558 Ga0495630_0011558_3070_3474 110
297 3300046529 Ga0495652_0177164 Ga0495652_0177164_916_1320 110
298 3300046529 Ga0495652_0460804 Ga0495652_0460804_175_579 110
299 3300046531 Ga0495665_0072904 Ga0495665_0072904_410_814 110
300 3300046533 Ga0495640_0004624 Ga0495640_0004624_8367_8771 110
301 3300046535 Ga0495586_0036821 Ga0495586_0036821_936_1340 110
302 3300046536 Ga0495587_0116361 Ga0495587_0116361_504_908 110
303 3300046536 Ga0495587_0309706 Ga0495587_0309706_305_709 110
304 3300046543 Ga0495645_0094240 Ga0495645_0094240_901_1305 110
305 3300046559 Ga0495667_0012886 Ga0495667_0012886_227_631 110
306 3300046642 Ga0495634_0023849 Ga0495634_0023849_1234_1638 110
307 3300046663 Ga0495635_0045013 Ga0495635_0045013_480_884 110
308 3300046675 Ga0495657_0003392 Ga0495657_0003392_2542_2946 110
309 3300046679 Ga0495623_0072470 Ga0495623_0072470_1423_1827 110
310 3300046680 Ga0495646_0037731 Ga0495646_0037731_2200_2604 110
311 3300046689 Ga0495613_0029323 Ga0495613_0029323_995_1399 110
312 3300046809 Ga0495600_0505136 Ga0495600_0505136_76_480 110
313 3300047317 Ga0495604_0054807 Ga0495604_0054807_2070_2474 110
314 3300047319 Ga0495674_0172434 Ga0495674_0172434_399_803 110
315 3300047322 Ga0495680_0033583 Ga0495680_0033583_829_1233 110
316 3300047444 Ga0495675_0084915 Ga0495675_0084915_707_1111 110
317 3300047471 Ga0495684_0016565 Ga0495684_0016565_3089_3493 110
318 3300047673 Ga0495593_0121161 Ga0495593_0121161_424_828 110
319 3300048088 Ga0495602_0015244 Ga0495602_0015244_5275_5679 110
320 3300049677 Ga0501247_051939 Ga0501247_051939_171_590 110
321 3300049682 Ga0501252_042749 Ga0501252_042749_103_522 110
322 3300050508 nmdc:mga09592_580235_c1 nmdc:mga09592_580235_c1_504_923 110
323 3300050509 nmdc:mga0qj67_346845_c1 nmdc:mga0qj67_346845_c1_746_1165 110
324 3300050510 nmdc:mga06r32_364956_c1 nmdc:mga06r32_364956_c1_529_948 110
325 3300053084 Ga0495595_0109202 Ga0495595_0109202_523_927 110
326 3300053085 Ga0495619_0380228 Ga0495619_0380228_181_585 110
327 3300005330 Ga0070690_100114633 Ga0070690_1001146332 111
328 3300005335 Ga0070666_10561459 Ga0070666_105614591 111
329 3300005336 Ga0070680_100016292 Ga0070680_1000162927 111
330 3300005338 Ga0068868_100404258 Ga0068868_1004042582 111
331 3300005340 Ga0070689_100129319 Ga0070689_1001293193 111
332 3300005353 Ga0070669_100162182 Ga0070669_1001621823 111
333 3300005355 Ga0070671_100168965 Ga0070671_1001689652 111
334 3300005364 Ga0070673_100207421 Ga0070673_1002074212 111
335 3300005367 Ga0070667_100287263 Ga0070667_1002872631 111
336 3300005455 Ga0070663_100507881 Ga0070663_1005078812 111
337 3300005458 Ga0070681_10028042 Ga0070681_100280424 111
338 3300005530 Ga0070679_100484767 Ga0070679_1004847673 111
339 3300005546 Ga0070696_100021816 Ga0070696_1000218165 111
340 3300005547 Ga0070693_100001153 Ga0070693_1000011538 111
341 3300005564 Ga0070664_100379717 Ga0070664_1003797172 111
342 3300005615 Ga0070702_100258889 Ga0070702_1002588892 111
343 3300005618 Ga0068864_100715651 Ga0068864_1007156512 111
344 3300005842 Ga0068858_101271932 Ga0068858_1012719322 111
345 3300005843 Ga0068860_100321849 Ga0068860_1003218493 111
346 3300009177 Ga0105248_10408669 Ga0105248_104086692 111
347 3300009545 Ga0105237_11487973 Ga0105237_114879731 111
348 3300012485 Ga0157325_1029447 Ga0157325_10294471 111
349 3300013100 Ga0157373_10365855 Ga0157373_103658552 111
350 3300025903 Ga0207680_10538310 Ga0207680_105383102 111
351 3300025912 Ga0207707_10107250 Ga0207707_101072504 111
352 3300025917 Ga0207660_10140041 Ga0207660_101400412 111
353 3300025921 Ga0207652_10013086 Ga0207652_100130867 111
354 3300025931 Ga0207644_10838691 Ga0207644_108386911 111
355 3300025940 Ga0207691_10330784 Ga0207691_103307841 111
356 3300025945 Ga0207679_10571381 Ga0207679_105713812 111
357 3300025986 Ga0207658_10333550 Ga0207658_103335502 111
358 3300026023 Ga0207677_10327605 Ga0207677_103276051 111
359 3300028381 Ga0268264_10224201 Ga0268264_102242013 111
360 3300031911 Ga0307412_10647308 Ga0307412_106473081 111
361 3300059511 Ga0587091_165143 Ga0587091_165143_12_437 111
362 3300059640 Ga0587067_138613 Ga0587067_138613_25_450 111
363 3300059643 Ga0587072_121028 Ga0587072_121028_171_596 111
364 3300059645 Ga0587076_191070 Ga0587076_191070_76_495 111
365 3300005347 Ga0070668_100045342 Ga0070668_1000453424 112
366 3300005467 Ga0070706_100045503 Ga0070706_1000455031 112
367 3300005548 Ga0070665_100141300 Ga0070665_1001413003 112
368 3300009553 Ga0105249_10000089 Ga0105249_1000008985 112
369 3300025910 Ga0207684_10725513 Ga0207684_107255131 112
370 3300025920 Ga0207649_10880002 Ga0207649_108800021 112
371 3300025961 Ga0207712_10000181 Ga0207712_1000018158 112
372 3300025972 Ga0207668_10033958 Ga0207668_100339584 112
373 3300028379 Ga0268266_10108358 Ga0268266_101083583 112
374 3300030763 Ga0265763_1025246 Ga0265763_10252462 112
375 3300031548 Ga0307408_100776084 Ga0307408_1007760841 112
376 3300031824 Ga0307413_10372172 Ga0307413_103721721 112
377 3300031852 Ga0307410_10035924 Ga0307410_100359241 112
378 3300031852 Ga0307410_10217083 Ga0307410_102170832 112
379 3300031901 Ga0307406_11328512 Ga0307406_113285121 112
380 3300032002 Ga0307416_102850959 Ga0307416_1028509591 112
381 3300042435 Ga0439434_0055395 Ga0439434_0055395_51_467 112
382 3300005293 Ga0065715_10287769 Ga0065715_102877692 113
383 3300005293 Ga0065715_10443454 Ga0065715_104434541 113
384 3300005329 Ga0070683_100409308 Ga0070683_1004093081 113
385 3300005336 Ga0070680_100473624 Ga0070680_1004736241 113
386 3300005457 Ga0070662_100137636 Ga0070662_1001376363 113
387 3300005459 Ga0068867_100292903 Ga0068867_1002929033 113
388 3300005577 Ga0068857_102098703 Ga0068857_1020987032 113
389 3300009093 Ga0105240_10640993 Ga0105240_106409932 113
390 3300009551 Ga0105238_10589861 Ga0105238_105898613 113
391 3300013105 Ga0157369_10049701 Ga0157369_100497013 113
392 3300025917 Ga0207660_10521181 Ga0207660_105211812 113
393 3300025933 Ga0207706_10110685 Ga0207706_101106852 113
394 3300025981 Ga0207640_10450020 Ga0207640_104500202 113
395 3300026089 Ga0207648_10290183 Ga0207648_102901833 113
396 3300026116 Ga0207674_11411031 Ga0207674_114110312 113
397 3300031548 Ga0307408_100432718 Ga0307408_1004327183 113
398 3300031731 Ga0307405_10174691 Ga0307405_101746912 113
399 3300031824 Ga0307413_10715697 Ga0307413_107156972 113
400 3300031852 Ga0307410_10174202 Ga0307410_101742022 113
401 3300031901 Ga0307406_10103327 Ga0307406_101033273 113
402 3300031911 Ga0307412_10326896 Ga0307412_103268963 113
403 3300031995 Ga0307409_100083082 Ga0307409_1000830823 113
404 3300032002 Ga0307416_100023776 Ga0307416_1000237764 113
405 3300032005 Ga0307411_10227566 Ga0307411_102275663 113
406 3300032126 Ga0307415_100184652 Ga0307415_1001846521 113
407 3300032126 Ga0307415_101747941 Ga0307415_1017479411 113
408 3300036401 Ga0373937_1151606 Ga0373937_1151606_271_669 113
409 3300045976 Ga0466967_0353405 Ga0466967_0353405_619_1035 113
410 3300046476 Ga0495662_0566138 Ga0495662_0566138_55_453 113
411 3300046511 Ga0495608_0126548 Ga0495608_0126548_780_1178 113
412 3300046517 Ga0495630_0089210 Ga0495630_0089210_1846_2244 113
413 3300046529 Ga0495652_0061826 Ga0495652_0061826_132_530 113
414 3300046559 Ga0495667_0170318 Ga0495667_0170318_575_973 113
415 3300047315 Ga0495581_0208474 Ga0495581_0208474_486_884 113
416 3300047444 Ga0495675_0068082 Ga0495675_0068082_128_526 113
417 3300047471 Ga0495684_0025329 Ga0495684_0025329_386_784 113
418 3300049654 Ga0501207_011481 Ga0501207_011481_28_444 113
419 3300049660 Ga0501216_005790 Ga0501216_005790_337_753 113
420 3300049661 Ga0501217_020816 Ga0501217_020816_760_1176 113
421 3300049664 Ga0501224_002274 Ga0501224_002274_2040_2456 113
422 3300049667 Ga0501230_016822 Ga0501230_016822_83_499 113
423 3300049668 Ga0501233_002061 Ga0501233_002061_2435_2851 113
424 3300049669 Ga0501235_003188 Ga0501235_003188_107_523 113
425 3300049674 Ga0501242_010215 Ga0501242_010215_217_633 113
426 3300049677 Ga0501247_014257 Ga0501247_014257_489_905 113
427 3300049679 Ga0501249_080489 Ga0501249_080489_28_444 113
428 3300049682 Ga0501252_000489 Ga0501252_000489_115_531 113
429 3300049690 Ga0501261_007497 Ga0501261_007497_945_1361 113
430 3300049704 Ga0501221_003414 Ga0501221_003414_665_1081 113
431 3300049705 Ga0501225_0013296 Ga0501225_0013296_587_1003 113
432 3300049707 Ga0501234_042886 Ga0501234_042886_153_569 113
433 3300049708 Ga0501245_005236 Ga0501245_005236_806_1222 113
434 3300049759 Ga0501262_006240 Ga0501262_006240_425_841 113
435 3300049763 Ga0501266_002003 Ga0501266_002003_385_801 113
436 3300049767 Ga0501270_008782 Ga0501270_008782_827_1243 113
437 3300049768 Ga0501271_035135 Ga0501271_035135_136_552 113
438 3300049770 Ga0501273_057980 Ga0501273_057980_175_591 113
439 3300059492 Ga0587073_0187586 Ga0587073_0187586_163_585 113
440 3300059625 Ga0587113_050434 Ga0587113_050434_22_444 113
441 3300005336 Ga0070680_100561467 Ga0070680_1005614672 114
442 3300009553 Ga0105249_12911401 Ga0105249_129114011 114
443 3300013104 Ga0157370_10311764 Ga0157370_103117641 114
444 3300015262 Ga0182007_10196697 Ga0182007_101966972 114
445 3300032002 Ga0307416_101222220 Ga0307416_1012222201 114
446 3300044706 Ga0466964_0477592 Ga0466964_0477592_64_501 114
447 3300004799 Ga0058863_10030836 Ga0058863_100308361 115
448 3300004800 Ga0058861_11988692 Ga0058861_119886922 115
449 3300004800 Ga0058861_12072470 Ga0058861_120724701 115
450 3300005327 Ga0070658_10116648 Ga0070658_101166483 115
451 3300005354 Ga0070675_100246948 Ga0070675_1002469482 115
452 3300005364 Ga0070673_100295875 Ga0070673_1002958752 115
453 3300005471 Ga0070698_100006166 Ga0070698_10000616613 115
454 3300005518 Ga0070699_100406117 Ga0070699_1004061173 115
455 3300005535 Ga0070684_100033315 Ga0070684_1000333153 115
456 3300005564 Ga0070664_101442531 Ga0070664_1014425312 115
457 3300009545 Ga0105237_10553013 Ga0105237_105530133 115
458 3300009551 Ga0105238_10493845 Ga0105238_104938453 115
459 3300025909 Ga0207705_10090089 Ga0207705_100900892 115
460 3300025926 Ga0207659_10219174 Ga0207659_102191742 115
461 3300025944 Ga0207661_10216907 Ga0207661_102169072 115
462 3300025960 Ga0207651_10135290 Ga0207651_101352902 115
463 3300026116 Ga0207674_10494805 Ga0207674_104948053 115
464 3300046473 Ga0495582_0076878 Ga0495582_0076878_439_843 115
465 3300046477 Ga0495664_0320743 Ga0495664_0320743_435_839 115
466 3300046499 Ga0495594_0012998 Ga0495594_0012998_1108_1512 115
467 3300046531 Ga0495665_0213679 Ga0495665_0213679_481_885 115
468 3300046543 Ga0495645_0223786 Ga0495645_0223786_202_606 115
469 3300046674 Ga0495588_0110483 Ga0495588_0110483_26_430 115
470 3300046678 Ga0495599_0096910 Ga0495599_0096910_444_848 115
471 3300046678 Ga0495599_0153740 Ga0495599_0153740_400_807 115
472 3300046680 Ga0495646_0265266 Ga0495646_0265266_112_516 115
473 3300046683 Ga0495658_0424212 Ga0495658_0424212_293_697 115
474 3300047319 Ga0495674_0048052 Ga0495674_0048052_2385_2789 115
475 3300004803 Ga0058862_12775103 Ga0058862_127751033 116
476 3300005336 Ga0070680_101323455 Ga0070680_1013234551 116
477 3300005355 Ga0070671_100131468 Ga0070671_1001314682 116
478 3300005364 Ga0070673_100189519 Ga0070673_1001895193 116
479 3300005530 Ga0070679_100087543 Ga0070679_1000875433 116
480 3300005843 Ga0068860_100954314 Ga0068860_1009543142 116
481 3300006237 Ga0097621_100518440 Ga0097621_1005184402 116
482 3300011119 Ga0105246_10638675 Ga0105246_106386752 116
483 3300025917 Ga0207660_11050119 Ga0207660_110501192 116
484 3300025921 Ga0207652_10175589 Ga0207652_101755892 116
485 3300025931 Ga0207644_10238659 Ga0207644_102386592 116
486 3300025960 Ga0207651_10380178 Ga0207651_103801782 116
487 3300025981 Ga0207640_10505222 Ga0207640_105052222 116
488 3300035083 Ga0373926_0162822 Ga0373926_0162822_251_685 116
489 3300035089 Ga0373944_0209307 Ga0373944_0209307_52_486 116
490 3300035170 Ga0373943_0029448 Ga0373943_0029448_1148_1582 116
491 3300035171 Ga0373946_0332237 Ga0373946_0332237_164_598 116
492 3300037068 Ga0373925_0031465 Ga0373925_0031465_405_839 116
493 3300046473 Ga0495582_0165473 Ga0495582_0165473_306_743 116
494 3300046517 Ga0495630_0017051 Ga0495630_0017051_4486_4920 116
495 3300046526 Ga0495666_0364095 Ga0495666_0364095_79_513 116
496 3300046535 Ga0495586_0051997 Ga0495586_0051997_660_1094 116
497 3300046539 Ga0495621_0261692 Ga0495621_0261692_94_516 116
498 3300046689 Ga0495613_0696688 Ga0495613_0696688_145_579 116
499 3300047315 Ga0495581_0033867 Ga0495581_0033867_192_626 116
500 3300047673 Ga0495593_0038393 Ga0495593_0038393_82_516 116
501 3300059646 Ga0587078_008240 Ga0587078_008240_709_1146 116
502 3300005331 Ga0070670_100674750 Ga0070670_1006747502 117
503 3300005466 Ga0070685_10167664 Ga0070685_101676642 117
504 3300021384 Ga0213876_10083965 Ga0213876_100839653 117
505 3300025925 Ga0207650_10626529 Ga0207650_106265292 117
506 3300039437 Ga0436365_0013958 Ga0436365_0013958_717_1166 117
507 3300042876 Ga0451577_0029491 Ga0451577_0029491_2619_3032 117
508 3300004799 Ga0058863_10042616 Ga0058863_100426163 118
509 3300005327 Ga0070658_10027578 Ga0070658_100275783 118
510 3300005329 Ga0070683_101555253 Ga0070683_1015552532 118
511 3300005341 Ga0070691_10227759 Ga0070691_102277591 118
512 3300005434 Ga0070709_10004433 Ga0070709_100044333 118
513 3300005436 Ga0070713_101396839 Ga0070713_1013968392 118
514 3300005439 Ga0070711_100931222 Ga0070711_1009312221 118
515 3300005458 Ga0070681_10135556 Ga0070681_101355563 118
516 3300005467 Ga0070706_100488462 Ga0070706_1004884621 118
517 3300005535 Ga0070684_101458084 Ga0070684_1014580841 118
518 3300005546 Ga0070696_100239800 Ga0070696_1002398002 118
519 3300005578 Ga0068854_100747947 Ga0068854_1007479472 118
520 3300005616 Ga0068852_100215707 Ga0068852_1002157072 118
521 3300009093 Ga0105240_10062939 Ga0105240_100629396 118
522 3300009148 Ga0105243_10051387 Ga0105243_100513873 118
523 3300009174 Ga0105241_10141303 Ga0105241_101413034 118
524 3300009545 Ga0105237_11764798 Ga0105237_117647982 118
525 3300009553 Ga0105249_10130805 Ga0105249_101308053 118
526 3300013104 Ga0157370_10389222 Ga0157370_103892221 118
527 3300013105 Ga0157369_10969548 Ga0157369_109695481 118
528 3300013296 Ga0157374_10827102 Ga0157374_108271021 118
529 3300013306 Ga0163162_10041886 Ga0163162_100418863 118
530 3300013306 Ga0163162_10894075 Ga0163162_108940752 118
531 3300013307 Ga0157372_10809219 Ga0157372_108092193 118
532 3300013307 Ga0157372_10918018 Ga0157372_109180182 118
533 3300013308 Ga0157375_10090441 Ga0157375_100904413 118
534 3300020082 Ga0206353_11117605 Ga0206353_111176052 118
535 3300025906 Ga0207699_10031799 Ga0207699_100317995 118
536 3300025909 Ga0207705_10114841 Ga0207705_101148413 118
537 3300025912 Ga0207707_10847738 Ga0207707_108477382 118
538 3300025915 Ga0207693_11133062 Ga0207693_111330621 118
539 3300025916 Ga0207663_10036893 Ga0207663_100368932 118
540 3300025916 Ga0207663_10355872 Ga0207663_103558721 118
541 3300025918 Ga0207662_10146004 Ga0207662_101460042 118
542 3300025919 Ga0207657_10062737 Ga0207657_100627371 118
543 3300025920 Ga0207649_11085095 Ga0207649_110850952 118
544 3300025929 Ga0207664_10737295 Ga0207664_107372952 118
545 3300025932 Ga0207690_10071868 Ga0207690_100718682 118
546 3300025981 Ga0207640_10708745 Ga0207640_107087451 118
547 3300026041 Ga0207639_11148082 Ga0207639_111480822 118
548 3300026142 Ga0207698_10264691 Ga0207698_102646912 118
549 3300039437 Ga0436365_0569575 Ga0436365_0569575_44_475 118
550 3300041443 Ga0451789_1178062 Ga0451789_1178062_112_543 118
551 3300045976 Ga0466967_0026287 Ga0466967_0026287_1082_1507 118
552 3300047320 Ga0495672_0007750 Ga0495672_0007750_3032_3460 118
553 3300048907 Ga0496104_0165984 Ga0496104_0165984_574_1002 118
554 3300005327 Ga0070658_10067868 Ga0070658_100678683 119
555 3300005331 Ga0070670_100290046 Ga0070670_1002900462 119
556 3300005341 Ga0070691_10782145 Ga0070691_107821451 119
557 3300009176 Ga0105242_10924669 Ga0105242_109246692 119
558 3300025925 Ga0207650_11376636 Ga0207650_113766361 119
559 3300025944 Ga0207661_10101431 Ga0207661_101014312 119
560 3300035695 Ga0373927_0033533 Ga0373927_0033533_690_1121 119
561 3300035695 Ga0373927_0068207 Ga0373927_0068207_1243_1671 119
562 3300035695 Ga0373927_0565642 Ga0373927_0565642_219_647 119
563 3300036401 Ga0373937_1503722 Ga0373937_1503722_35_466 119
564 3300044693 Ga0466961_0509750 Ga0466961_0509750_193_630 119
565 3300046472 Ga0495580_0106064 Ga0495580_0106064_1032_1460 119
566 3300046499 Ga0495594_0002515 Ga0495594_0002515_1316_1744 119
567 3300046517 Ga0495630_0944108 Ga0495630_0944108_153_581 119
568 3300047319 Ga0495674_0186240 Ga0495674_0186240_149_580 119
569 3300049587 Ga0501071_1254614 Ga0501071_1254614_10_444 119
570 3300050508 nmdc:mga09592_817718_c1 nmdc:mga09592_817718_c1_104_538 119
571 3300004798 Ga0058859_11806325 Ga0058859_118063251 120
572 3300005290 Ga0065712_10105869 Ga0065712_101058691 120
573 3300005293 Ga0065715_10219187 Ga0065715_102191873 120
574 3300005327 Ga0070658_10372861 Ga0070658_103728611 120
575 3300005329 Ga0070683_100017034 Ga0070683_1000170347 120
576 3300005330 Ga0070690_100108436 Ga0070690_1001084363 120
577 3300005331 Ga0070670_100084678 Ga0070670_1000846783 120
578 3300005339 Ga0070660_100748471 Ga0070660_1007484711 120
579 3300005343 Ga0070687_100199314 Ga0070687_1001993142 120
580 3300005344 Ga0070661_100086675 Ga0070661_1000866752 120
581 3300005344 Ga0070661_100216428 Ga0070661_1002164282 120
582 3300005347 Ga0070668_100045342 Ga0070668_1000453422 120
583 3300005353 Ga0070669_100014167 Ga0070669_1000141674 120
584 3300005354 Ga0070675_100116171 Ga0070675_1001161712 120
585 3300005365 Ga0070688_100004495 Ga0070688_1000044953 120
586 3300005367 Ga0070667_100316185 Ga0070667_1003161853 120
587 3300005436 Ga0070713_100045324 Ga0070713_1000453244 120
588 3300005466 Ga0070685_10109256 Ga0070685_101092562 120
589 3300005535 Ga0070684_100004296 Ga0070684_1000042967 120
590 3300005535 Ga0070684_100693986 Ga0070684_1006939861 120
591 3300005543 Ga0070672_100083137 Ga0070672_1000831373 120
592 3300005548 Ga0070665_100141300 Ga0070665_1001413005 120
593 3300005548 Ga0070665_100354768 Ga0070665_1003547682 120
594 3300005563 Ga0068855_100114484 Ga0068855_1001144843 120
595 3300005577 Ga0068857_100094341 Ga0068857_1000943412 120
596 3300005617 Ga0068859_100088363 Ga0068859_1000883633 120
597 3300005618 Ga0068864_100137544 Ga0068864_1001375443 120
598 3300005618 Ga0068864_101006439 Ga0068864_1010064391 120
599 3300005840 Ga0068870_10020135 Ga0068870_100201353 120
600 3300006880 Ga0075429_100303956 Ga0075429_1003039563 120
601 3300006931 Ga0097620_100088359 Ga0097620_1000883593 120
602 3300009094 Ga0111539_10187731 Ga0111539_101877313 120
603 3300009101 Ga0105247_10828089 Ga0105247_108280892 120
604 3300009545 Ga0105237_10320891 Ga0105237_103208912 120
605 3300009545 Ga0105237_10445491 Ga0105237_104454912 120
606 3300009551 Ga0105238_10895881 Ga0105238_108958812 120
607 3300009553 Ga0105249_10000089 Ga0105249_1000008987 120
608 3300013105 Ga0157369_10059499 Ga0157369_100594991 120
609 3300013307 Ga0157372_10194884 Ga0157372_101948843 120
610 3300013307 Ga0157372_10214535 Ga0157372_102145353 120
611 3300013308 Ga0157375_10016467 Ga0157375_100164673 120
612 3300014969 Ga0157376_10060490 Ga0157376_100604903 120
613 3300020070 Ga0206356_10071443 Ga0206356_100714434 120
614 3300020075 Ga0206349_1665041 Ga0206349_16650412 120
615 3300020078 Ga0206352_10170617 Ga0206352_101706172 120
616 3300020082 Ga0206353_11922409 Ga0206353_119224092 120
617 3300022467 Ga0224712_10206475 Ga0224712_102064752 120
618 3300025901 Ga0207688_10087613 Ga0207688_100876133 120
619 3300025907 Ga0207645_10505950 Ga0207645_105059502 120
620 3300025913 Ga0207695_10012644 Ga0207695_100126448 120
621 3300025914 Ga0207671_10479321 Ga0207671_104793212 120
622 3300025914 Ga0207671_10871903 Ga0207671_108719032 120
623 3300025918 Ga0207662_10001709 Ga0207662_1000170911 120
624 3300025920 Ga0207649_10314641 Ga0207649_103146412 120
625 3300025923 Ga0207681_10004359 Ga0207681_100043591 120
626 3300025924 Ga0207694_11462461 Ga0207694_114624611 120
627 3300025925 Ga0207650_10049790 Ga0207650_100497903 120
628 3300025926 Ga0207659_10027390 Ga0207659_100273902 120
629 3300025928 Ga0207700_10024941 Ga0207700_100249413 120
630 3300025940 Ga0207691_10300556 Ga0207691_103005561 120
631 3300025944 Ga0207661_10063636 Ga0207661_100636363 120
632 3300025961 Ga0207712_10000181 Ga0207712_1000018160 120
633 3300025972 Ga0207668_10033958 Ga0207668_100339586 120
634 3300025986 Ga0207658_11065008 Ga0207658_110650082 120
635 3300026095 Ga0207676_10178562 Ga0207676_101785623 120
636 3300026116 Ga0207674_10026159 Ga0207674_100261597 120
637 3300027907 Ga0207428_10201907 Ga0207428_102019073 120
638 3300028379 Ga0268266_10108358 Ga0268266_101083581 120
639 3300028379 Ga0268266_11050400 Ga0268266_110504001 120
640 3300031548 Ga0307408_100011913 Ga0307408_1000119133 120
641 3300031731 Ga0307405_10002332 Ga0307405_100023325 120
642 3300031824 Ga0307413_10079566 Ga0307413_100795662 120
643 3300031852 Ga0307410_10003426 Ga0307410_100034268 120
644 3300031901 Ga0307406_10000977 Ga0307406_100009778 120
645 3300031903 Ga0307407_11554464 Ga0307407_115544641 120
646 3300031911 Ga0307412_10000533 Ga0307412_1000053320 120
647 3300031995 Ga0307409_100021235 Ga0307409_1000212353 120
648 3300032002 Ga0307416_100027093 Ga0307416_1000270932 120
649 3300032002 Ga0307416_100839885 Ga0307416_1008398852 120
650 3300032004 Ga0307414_10002477 Ga0307414_100024774 120
651 3300032005 Ga0307411_10001923 Ga0307411_100019238 120
652 3300032005 Ga0307411_10774329 Ga0307411_107743292 120
653 3300032126 Ga0307415_100003516 Ga0307415_1000035168 120
654 3300035691 Ga0373931_0023542 Ga0373931_0023542_233_664 120
655 3300048913 Ga0496110_0815835 Ga0496110_0815835_273_704 120
656 3300048916 Ga0496113_1418816 Ga0496113_1418816_31_450 120
657 3300049589 Ga0501073_0175852 Ga0501073_0175852_317_748 120
658 3300049677 Ga0501247_034840 Ga0501247_034840_111_530 120
659 3300049679 Ga0501249_045259 Ga0501249_045259_489_911 120
660 3300050508 nmdc:mga09592_264993_c1 nmdc:mga09592_264993_c1_760_1179 120
661 3300050511 nmdc:mga08y16_307808_c1 nmdc:mga08y16_307808_c1_439_858 120
662 3300050513 nmdc:mga0rr50_394144_c1 nmdc:mga0rr50_394144_c1_293_724 120
663 3300059644 Ga0587075_048258 Ga0587075_048258_294_725 120
664 3300003544 Ga0007417J51691_1054800 Ga0007417J51691_10548002 121
665 3300003574 Ga0007410J51695_1062182 Ga0007410J51695_10621822 121
666 3300004798 Ga0058859_11510136 Ga0058859_115101361 121
667 3300004799 Ga0058863_11961663 Ga0058863_119616634 121
668 3300004800 Ga0058861_10100634 Ga0058861_101006344 121
669 3300004800 Ga0058861_11820445 Ga0058861_118204452 121
670 3300004801 Ga0058860_11737710 Ga0058860_117377102 121
671 3300004803 Ga0058862_10121865 Ga0058862_101218653 121
672 3300004803 Ga0058862_10180327 Ga0058862_101803271 121
673 3300004803 Ga0058862_10264261 Ga0058862_102642614 121
674 3300005327 Ga0070658_10268770 Ga0070658_102687702 121
675 3300005328 Ga0070676_10132340 Ga0070676_101323403 121
676 3300005329 Ga0070683_100052721 Ga0070683_1000527213 121
677 3300005329 Ga0070683_100171623 Ga0070683_1001716232 121
678 3300005329 Ga0070683_100322487 Ga0070683_1003224872 121
679 3300005329 Ga0070683_100477452 Ga0070683_1004774521 121
680 3300005330 Ga0070690_100128365 Ga0070690_1001283652 121
681 3300005331 Ga0070670_100146703 Ga0070670_1001467032 121
682 3300005331 Ga0070670_100986370 Ga0070670_1009863702 121
683 3300005334 Ga0068869_100167264 Ga0068869_1001672642 121
684 3300005334 Ga0068869_100187758 Ga0068869_1001877582 121
685 3300005335 Ga0070666_10489953 Ga0070666_104899532 121
686 3300005336 Ga0070680_100046871 Ga0070680_1000468714 121
687 3300005336 Ga0070680_100251561 Ga0070680_1002515612 121
688 3300005336 Ga0070680_101019242 Ga0070680_1010192421 121
689 3300005340 Ga0070689_100057246 Ga0070689_1000572464 121
690 3300005347 Ga0070668_100021730 Ga0070668_1000217303 121
691 3300005347 Ga0070668_100106143 Ga0070668_1001061432 121
692 3300005347 Ga0070668_100582769 Ga0070668_1005827692 121
693 3300005353 Ga0070669_100308127 Ga0070669_1003081272 121
694 3300005353 Ga0070669_101660228 Ga0070669_1016602281 121
695 3300005354 Ga0070675_100142732 Ga0070675_1001427323 121
696 3300005354 Ga0070675_100266424 Ga0070675_1002664242 121
697 3300005354 Ga0070675_100297251 Ga0070675_1002972512 121
698 3300005356 Ga0070674_100231784 Ga0070674_1002317841 121
699 3300005356 Ga0070674_100960724 Ga0070674_1009607242 121
700 3300005367 Ga0070667_100054612 Ga0070667_1000546125 121
701 3300005367 Ga0070667_100637411 Ga0070667_1006374112 121
702 3300005445 Ga0070708_100017280 Ga0070708_1000172803 121
703 3300005456 Ga0070678_100137185 Ga0070678_1001371853 121
704 3300005456 Ga0070678_100300037 Ga0070678_1003000372 121
705 3300005458 Ga0070681_10054797 Ga0070681_100547973 121
706 3300005458 Ga0070681_10298269 Ga0070681_102982692 121
707 3300005466 Ga0070685_10033578 Ga0070685_100335781 121
708 3300005468 Ga0070707_100103516 Ga0070707_1001035162 121
709 3300005530 Ga0070679_100005023 Ga0070679_1000050233 121
710 3300005530 Ga0070679_100082272 Ga0070679_1000822722 121
711 3300005530 Ga0070679_100121391 Ga0070679_1001213912 121
712 3300005535 Ga0070684_100112014 Ga0070684_1001120144 121
713 3300005543 Ga0070672_100188977 Ga0070672_1001889772 121
714 3300005543 Ga0070672_100275162 Ga0070672_1002751622 121
715 3300005548 Ga0070665_100504064 Ga0070665_1005040642 121
716 3300005564 Ga0070664_100081410 Ga0070664_1000814103 121
717 3300005564 Ga0070664_100215244 Ga0070664_1002152443 121
718 3300005564 Ga0070664_100436393 Ga0070664_1004363933 121
719 3300005614 Ga0068856_100742533 Ga0068856_1007425332 121
720 3300005615 Ga0070702_100246896 Ga0070702_1002468961 121
721 3300005618 Ga0068864_100231053 Ga0068864_1002310532 121
722 3300005718 Ga0068866_10696026 Ga0068866_106960262 121
723 3300005840 Ga0068870_10119928 Ga0068870_101199281 121
724 3300005842 Ga0068858_100231828 Ga0068858_1002318283 121
725 3300005844 Ga0068862_100660953 Ga0068862_1006609532 121
726 3300006237 Ga0097621_100418306 Ga0097621_1004183062 121
727 3300006358 Ga0068871_100498274 Ga0068871_1004982741 121
728 3300006880 Ga0075429_101074913 Ga0075429_1010749132 121
729 3300009036 Ga0105244_10309066 Ga0105244_103090662 121
730 3300009098 Ga0105245_10101021 Ga0105245_101010212 121
731 3300009148 Ga0105243_10766648 Ga0105243_107666482 121
732 3300009176 Ga0105242_13249191 Ga0105242_132491911 121
733 3300009177 Ga0105248_10101948 Ga0105248_101019483 121
734 3300009553 Ga0105249_10175344 Ga0105249_101753442 121
735 3300013104 Ga0157370_10007324 Ga0157370_100073246 121
736 3300013104 Ga0157370_11949586 Ga0157370_119495861 121
737 3300013105 Ga0157369_10914683 Ga0157369_109146831 121
738 3300013297 Ga0157378_10367449 Ga0157378_103674492 121
739 3300013297 Ga0157378_10608509 Ga0157378_106085092 121
740 3300013306 Ga0163162_10025211 Ga0163162_100252115 121
741 3300013306 Ga0163162_11788542 Ga0163162_117885421 121
742 3300013308 Ga0157375_10012517 Ga0157375_100125172 121
743 3300013308 Ga0157375_10792836 Ga0157375_107928362 121
744 3300014326 Ga0157380_10177783 Ga0157380_101777833 121
745 3300014745 Ga0157377_10286177 Ga0157377_102861772 121
746 3300014969 Ga0157376_10386634 Ga0157376_103866342 121
747 3300017792 Ga0163161_10174469 Ga0163161_101744691 121
748 3300020069 Ga0197907_11487050 Ga0197907_114870502 121
749 3300022467 Ga0224712_10489652 Ga0224712_104896522 121
750 3300025893 Ga0207682_10165341 Ga0207682_101653411 121
751 3300025903 Ga0207680_10110282 Ga0207680_101102823 121
752 3300025907 Ga0207645_10111453 Ga0207645_101114531 121
753 3300025909 Ga0207705_10799216 Ga0207705_107992162 121
754 3300025910 Ga0207684_10524582 Ga0207684_105245822 121
755 3300025912 Ga0207707_10009547 Ga0207707_100095475 121
756 3300025912 Ga0207707_10119834 Ga0207707_101198343 121
757 3300025917 Ga0207660_10008227 Ga0207660_100082273 121
758 3300025917 Ga0207660_10897041 Ga0207660_108970412 121
759 3300025917 Ga0207660_10998494 Ga0207660_109984942 121
760 3300025918 Ga0207662_10015019 Ga0207662_100150193 121
761 3300025921 Ga0207652_10055753 Ga0207652_100557533 121
762 3300025921 Ga0207652_10070046 Ga0207652_100700463 121
763 3300025921 Ga0207652_10199467 Ga0207652_101994672 121
764 3300025922 Ga0207646_10370362 Ga0207646_103703622 121
765 3300025926 Ga0207659_10421588 Ga0207659_104215882 121
766 3300025934 Ga0207686_10638804 Ga0207686_106388042 121
767 3300025936 Ga0207670_10038897 Ga0207670_100388974 121
768 3300025938 Ga0207704_10136439 Ga0207704_101364392 121
769 3300025940 Ga0207691_10036983 Ga0207691_100369833 121
770 3300025940 Ga0207691_10844276 Ga0207691_108442761 121
771 3300025941 Ga0207711_10153499 Ga0207711_101534992 121
772 3300025942 Ga0207689_10077332 Ga0207689_100773323 121
773 3300025942 Ga0207689_10163820 Ga0207689_101638202 121
774 3300025942 Ga0207689_10633336 Ga0207689_106333361 121
775 3300025944 Ga0207661_10047755 Ga0207661_100477553 121
776 3300025944 Ga0207661_10111017 Ga0207661_101110173 121
777 3300025944 Ga0207661_10135219 Ga0207661_101352193 121
778 3300025944 Ga0207661_10210766 Ga0207661_102107662 121
779 3300025944 Ga0207661_10401775 Ga0207661_104017753 121
780 3300025945 Ga0207679_10095638 Ga0207679_100956383 121
781 3300025945 Ga0207679_10264993 Ga0207679_102649932 121
782 3300025945 Ga0207679_10552027 Ga0207679_105520272 121
783 3300025961 Ga0207712_10229074 Ga0207712_102290742 121
784 3300025972 Ga0207668_10529546 Ga0207668_105295462 121
785 3300025972 Ga0207668_10828199 Ga0207668_108281992 121
786 3300025986 Ga0207658_10166681 Ga0207658_101666811 121
787 3300026035 Ga0207703_10067549 Ga0207703_100675494 121
788 3300026089 Ga0207648_10101436 Ga0207648_101014364 121
789 3300026089 Ga0207648_10733541 Ga0207648_107335412 121
790 3300026095 Ga0207676_10687474 Ga0207676_106874742 121
791 3300026116 Ga0207674_11127752 Ga0207674_111277521 121
792 3300026121 Ga0207683_10136608 Ga0207683_101366082 121
793 3300026121 Ga0207683_10696966 Ga0207683_106969662 121
794 3300026142 Ga0207698_11041544 Ga0207698_110415441 121
795 3300028379 Ga0268266_10124108 Ga0268266_101241082 121
796 3300028379 Ga0268266_11032177 Ga0268266_110321772 121
797 3300031731 Ga0307405_10243046 Ga0307405_102430462 121
798 3300031995 Ga0307409_100074986 Ga0307409_1000749863 121
799 3300032004 Ga0307414_11679842 Ga0307414_116798421 121
800 3300035118 Ga0373954_0045633 Ga0373954_0045633_872_1306 121
801 3300035120 Ga0373957_0126894 Ga0373957_0126894_535_969 121
802 3300035172 Ga0373955_0016306 Ga0373955_0016306_3102_3536 121
803 3300035410 Ga0373924_0062334 Ga0373924_0062334_367_801 121
804 3300036401 Ga0373937_0015856 Ga0373937_0015856_2895_3329 121
805 3300046454 Ga0495592_0358802 Ga0495592_0358802_418_852 121
806 3300046492 Ga0495585_0605674 Ga0495585_0605674_73_495 121
807 3300046517 Ga0495630_0608841 Ga0495630_0608841_380_814 121
808 3300046529 Ga0495652_0045072 Ga0495652_0045072_1686_2120 121
809 3300046531 Ga0495665_0239780 Ga0495665_0239780_343_765 121
810 3300046531 Ga0495665_0401334 Ga0495665_0401334_44_481 121
811 3300046536 Ga0495587_0026271 Ga0495587_0026271_3087_3521 121
812 3300046543 Ga0495645_0000710 Ga0495645_0000710_18641_19075 121
813 3300046559 Ga0495667_0045361 Ga0495667_0045361_87_521 121
814 3300046678 Ga0495599_0003240 Ga0495599_0003240_5729_6163 121
815 3300046684 Ga0495669_0166659 Ga0495669_0166659_185_607 121
816 3300046809 Ga0495600_0069926 Ga0495600_0069926_71_505 121
817 3300047471 Ga0495684_0143558 Ga0495684_0143558_1319_1753 121
818 3300049675 Ga0501243_037291 Ga0501243_037291_218_640 121
819 3300003163 Ga0006759J45824_1040862 Ga0006759J45824_10408623 122
820 3300003575 Ga0007409J51694_1022942 Ga0007409J51694_10229421 122
821 3300003579 Ga0007429J51699_1023882 Ga0007429J51699_10238822 122
822 3300003693 Ga0032354_1021933 Ga0032354_10219332 122
823 3300003693 Ga0032354_1035115 Ga0032354_10351152 122
824 3300004798 Ga0058859_11821740 Ga0058859_118217401 122
825 3300004799 Ga0058863_11749764 Ga0058863_117497643 122
826 3300004801 Ga0058860_12061530 Ga0058860_120615302 122
827 3300004803 Ga0058862_12705347 Ga0058862_127053471 122
828 3300005327 Ga0070658_10133803 Ga0070658_101338033 122
829 3300005329 Ga0070683_100057123 Ga0070683_1000571233 122
830 3300005333 Ga0070677_10093995 Ga0070677_100939953 122
831 3300005333 Ga0070677_10094646 Ga0070677_100946462 122
832 3300005336 Ga0070680_100182134 Ga0070680_1001821342 122
833 3300005438 Ga0070701_10070010 Ga0070701_100700102 122
834 3300005445 Ga0070708_101134503 Ga0070708_1011345031 122
835 3300005456 Ga0070678_100779600 Ga0070678_1007796001 122
836 3300005467 Ga0070706_100031470 Ga0070706_1000314704 122
837 3300005471 Ga0070698_100104207 Ga0070698_1001042073 122
838 3300005518 Ga0070699_100142924 Ga0070699_1001429242 122
839 3300005546 Ga0070696_100000641 Ga0070696_1000006412 122
840 3300005563 Ga0068855_100233362 Ga0068855_1002333622 122
841 3300005564 Ga0070664_100056972 Ga0070664_1000569722 122
842 3300005719 Ga0068861_100985368 Ga0068861_1009853681 122
843 3300007076 Ga0075435_100307287 Ga0075435_1003072872 122
844 3300009094 Ga0111539_13044491 Ga0111539_130444911 122
845 3300009098 Ga0105245_10304012 Ga0105245_103040122 122
846 3300009101 Ga0105247_10362961 Ga0105247_103629611 122
847 3300009148 Ga0105243_10705426 Ga0105243_107054262 122
848 3300009176 Ga0105242_10489620 Ga0105242_104896201 122
849 3300013102 Ga0157371_10066051 Ga0157371_100660512 122
850 3300013102 Ga0157371_11588181 Ga0157371_115881811 122
851 3300013296 Ga0157374_11752178 Ga0157374_117521782 122
852 3300013297 Ga0157378_10135032 Ga0157378_101350323 122
853 3300013306 Ga0163162_10397847 Ga0163162_103978471 122
854 3300013307 Ga0157372_10009653 Ga0157372_100096537 122
855 3300013308 Ga0157375_10077385 Ga0157375_100773852 122
856 3300014325 Ga0163163_10754234 Ga0163163_107542342 122
857 3300014968 Ga0157379_10692149 Ga0157379_106921492 122
858 3300014969 Ga0157376_10993582 Ga0157376_109935822 122
859 3300017792 Ga0163161_10106798 Ga0163161_101067983 122
860 3300017792 Ga0163161_10526949 Ga0163161_105269492 122
861 3300020078 Ga0206352_11132655 Ga0206352_111326551 122
862 3300025321 Ga0207656_10025013 Ga0207656_100250133 122
863 3300025893 Ga0207682_10106266 Ga0207682_101062661 122
864 3300025909 Ga0207705_10224468 Ga0207705_102244682 122
865 3300025910 Ga0207684_10027668 Ga0207684_100276683 122
866 3300025917 Ga0207660_10000818 Ga0207660_100008185 122
867 3300025922 Ga0207646_10286877 Ga0207646_102868772 122
868 3300025927 Ga0207687_10166331 Ga0207687_101663313 122
869 3300025944 Ga0207661_10068651 Ga0207661_100686513 122
870 3300025944 Ga0207661_11139976 Ga0207661_111399762 122
871 3300025945 Ga0207679_10162540 Ga0207679_101625402 122
872 3300025949 Ga0207667_10117398 Ga0207667_101173983 122
873 3300025960 Ga0207651_10533315 Ga0207651_105333152 122
874 3300026075 Ga0207708_10277693 Ga0207708_102776933 122
875 3300026121 Ga0207683_10633121 Ga0207683_106331212 122
876 3300031824 Ga0307413_10012801 Ga0307413_100128014 122
877 3300031852 Ga0307410_10032064 Ga0307410_100320642 122
878 3300031852 Ga0307410_10249149 Ga0307410_102491491 122
879 3300031901 Ga0307406_10074765 Ga0307406_100747653 122
880 3300031903 Ga0307407_10170889 Ga0307407_101708892 122
881 3300031903 Ga0307407_10488845 Ga0307407_104888452 122
882 3300031911 Ga0307412_10445478 Ga0307412_104454782 122
883 3300031995 Ga0307409_101253210 Ga0307409_1012532102 122
884 3300032002 Ga0307416_100249875 Ga0307416_1002498752 122
885 3300032002 Ga0307416_101590681 Ga0307416_1015906811 122
886 3300032126 Ga0307415_100445546 Ga0307415_1004455463 122
887 3300032126 Ga0307415_101487650 Ga0307415_1014876502 122
888 3300035111 Ga0373923_0469586 Ga0373923_0469586_12_452 122
889 3300036401 Ga0373937_0166609 Ga0373937_0166609_1409_1834 122
890 3300041406 Ga0439439_0046593 Ga0439439_0046593_254_679 122
891 3300046535 Ga0495586_0312172 Ga0495586_0312172_267_707 122
892 3300046536 Ga0495587_0023334 Ga0495587_0023334_439_864 122
893 3300046543 Ga0495645_0184131 Ga0495645_0184131_331_771 122
894 3300046675 Ga0495657_0151763 Ga0495657_0151763_195_620 122
895 3300046679 Ga0495623_0032621 Ga0495623_0032621_2488_2913 122
896 3300046689 Ga0495613_0043113 Ga0495613_0043113_1133_1558 122
897 3300047315 Ga0495581_0163615 Ga0495581_0163615_155_580 122
898 3300047317 Ga0495604_0843355 Ga0495604_0843355_80_505 122
899 3300048088 Ga0495602_0186071 Ga0495602_0186071_1027_1452 122
900 3300048911 Ga0496108_0849839 Ga0496108_0849839_311_748 122
901 3300048915 Ga0496112_0024153 Ga0496112_0024153_5069_5506 122
902 3300048918 Ga0496115_0709077 Ga0496115_0709077_17_442 122
903 3300049526 Ga0501303_025790 Ga0501303_025790_184_636 122
904 3300049539 Ga0501323_088717 Ga0501323_088717_25_450 122
905 3300049649 Ga0501198_161236 Ga0501198_161236_46_471 122
906 3300049666 Ga0501228_070032 Ga0501228_070032_15_467 122
907 3300049669 Ga0501235_122109 Ga0501235_122109_73_507 122
908 3300049686 Ga0501257_119078 Ga0501257_119078_224_649 122
909 3300050512 nmdc:mga0n895_71244_c1 nmdc:mga0n895_71244_c1_594_1034 122
910 3300001990 JGI24737J22298_10024842 JGI24737J22298_100248421 123
911 3300002075 JGI24738J21930_10008993 JGI24738J21930_100089934 123
912 3300004798 Ga0058859_11715218 Ga0058859_117152181 123
913 3300004799 Ga0058863_11955260 Ga0058863_119552602 123
914 3300004800 Ga0058861_10094474 Ga0058861_100944742 123
915 3300005327 Ga0070658_10002530 Ga0070658_100025308 123
916 3300005327 Ga0070658_10089531 Ga0070658_100895313 123
917 3300005329 Ga0070683_100000662 Ga0070683_10000066221 123
918 3300005335 Ga0070666_10084739 Ga0070666_100847391 123
919 3300005347 Ga0070668_100076225 Ga0070668_1000762254 123
920 3300005366 Ga0070659_100259581 Ga0070659_1002595813 123
921 3300005367 Ga0070667_100067489 Ga0070667_1000674893 123
922 3300005436 Ga0070713_101014870 Ga0070713_1010148702 123
923 3300005457 Ga0070662_100161194 Ga0070662_1001611943 123
924 3300005458 Ga0070681_10055681 Ga0070681_100556815 123
925 3300005459 Ga0068867_100023307 Ga0068867_1000233074 123
926 3300005530 Ga0070679_100253998 Ga0070679_1002539981 123
927 3300005530 Ga0070679_100918881 Ga0070679_1009188811 123
928 3300005535 Ga0070684_100015882 Ga0070684_1000158824 123
929 3300005535 Ga0070684_100733610 Ga0070684_1007336101 123
930 3300005539 Ga0068853_100417091 Ga0068853_1004170912 123
931 3300005543 Ga0070672_100035408 Ga0070672_1000354083 123
932 3300005547 Ga0070693_100149541 Ga0070693_1001495412 123
933 3300005577 Ga0068857_100022826 Ga0068857_1000228263 123
934 3300005615 Ga0070702_100285054 Ga0070702_1002850542 123
935 3300005616 Ga0068852_100347488 Ga0068852_1003474883 123
936 3300005618 Ga0068864_100684623 Ga0068864_1006846231 123
937 3300005718 Ga0068866_10104228 Ga0068866_101042282 123
938 3300005841 Ga0068863_100069225 Ga0068863_1000692253 123
939 3300005842 Ga0068858_100147199 Ga0068858_1001471994 123
940 3300005843 Ga0068860_100117268 Ga0068860_1001172682 123
941 3300005844 Ga0068862_100423028 Ga0068862_1004230281 123
942 3300006175 Ga0070712_100743287 Ga0070712_1007432872 123
943 3300006881 Ga0068865_100005638 Ga0068865_1000056387 123
944 3300009098 Ga0105245_10231568 Ga0105245_102315683 123
945 3300010375 Ga0105239_10427565 Ga0105239_104275653 123
946 3300013100 Ga0157373_10135434 Ga0157373_101354342 123
947 3300013104 Ga0157370_10310553 Ga0157370_103105532 123
948 3300013296 Ga0157374_10422228 Ga0157374_104222283 123
949 3300013297 Ga0157378_10171220 Ga0157378_101712202 123
950 3300013307 Ga0157372_11309762 Ga0157372_113097622 123
951 3300013308 Ga0157375_10700923 Ga0157375_107009231 123
952 3300014325 Ga0163163_10458713 Ga0163163_104587131 123
953 3300014968 Ga0157379_10208245 Ga0157379_102082452 123
954 3300025899 Ga0207642_10037832 Ga0207642_100378321 123
955 3300025907 Ga0207645_10003859 Ga0207645_100038595 123
956 3300025909 Ga0207705_10054893 Ga0207705_100548933 123
957 3300025919 Ga0207657_10041175 Ga0207657_100411753 123
958 3300025921 Ga0207652_10380513 Ga0207652_103805131 123
959 3300025921 Ga0207652_10585521 Ga0207652_105855212 123
960 3300025932 Ga0207690_10036856 Ga0207690_100368565 123
961 3300025933 Ga0207706_10453325 Ga0207706_104533252 123
962 3300025934 Ga0207686_10021294 Ga0207686_100212945 123
963 3300025938 Ga0207704_10007324 Ga0207704_100073247 123
964 3300025940 Ga0207691_10054622 Ga0207691_100546223 123
965 3300025940 Ga0207691_11654504 Ga0207691_116545041 123
966 3300025941 Ga0207711_10250156 Ga0207711_102501562 123
967 3300025972 Ga0207668_10015561 Ga0207668_100155615 123
968 3300025986 Ga0207658_10350463 Ga0207658_103504632 123
969 3300026067 Ga0207678_10151545 Ga0207678_101515453 123
970 3300026089 Ga0207648_10007649 Ga0207648_100076492 123
971 3300026116 Ga0207674_10026110 Ga0207674_100261103 123
972 3300026118 Ga0207675_100132057 Ga0207675_1001320573 123
973 3300028381 Ga0268264_10091803 Ga0268264_100918034 123
974 3300031852 Ga0307410_10173984 Ga0307410_101739843 123
975 3300031995 Ga0307409_100028499 Ga0307409_1000284992 123
976 3300032002 Ga0307416_101079108 Ga0307416_1010791082 123
977 3300032126 Ga0307415_101056364 Ga0307415_1010563641 123
978 3300037418 Ga0395900_0323581 Ga0395900_0323581_556_984 123
979 3300037471 Ga0395905_0139084 Ga0395905_0139084_481_909 123
980 3300038443 Ga0395901_0434478 Ga0395901_0434478_55_483 123
981 3300048903 Ga0496100_0139361 Ga0496100_0139361_282_710 123
982 3300048904 Ga0496101_0253254 Ga0496101_0253254_61_489 123
983 3300048908 Ga0496105_0393646 Ga0496105_0393646_481_909 123
984 3300048909 Ga0496106_0189528 Ga0496106_0189528_291_719 123
985 3300048911 Ga0496108_0085778 Ga0496108_0085778_1156_1584 123
986 3300048913 Ga0496110_0167276 Ga0496110_0167276_969_1397 123
987 3300048915 Ga0496112_0014015 Ga0496112_0014015_2689_3117 123
988 3300048917 Ga0496114_0491060 Ga0496114_0491060_500_928 123
989 3300048918 Ga0496115_0485705 Ga0496115_0485705_16_444 123

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02472

ExbD

Biopolymer transport protein ExbD/TolR

10

137

0.92

Feature Viewer

pLDDT pTM Quality
68.16 0.48 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map