F487542

General Info

Members Datasets Scaffolds Average Seq Length
987 355 1974 153

Family's Representative Sequence

Representative Sequence 3300005336|Ga0070680_100187029|Ga0070680_1001870292
Length 155
Sequence MLRLSKKADYALMAMKHLALRGDRGSSSAREIAEQYDIPIELMAKVLQRLVRRGLLASHQGTRGGYHLARGASQISVADVIGAIDGPVTVTACSTDEGGTCDQFAKCNVRDPLRRVRERIAAALGECTIAELASDVAAPMAAHAMVVSRSNSAGL

Samples

Sample ID Description Type Environment
1 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
2 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
3 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
4 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
74 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
75 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
76 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
77 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
78 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
79 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
80 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
81 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
82 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
83 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
84 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
85 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
86 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
87 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
88 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
89 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
90 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
91 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
92 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
93 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
94 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
95 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
96 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
97 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
98 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
99 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
101 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
102 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
103 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
104 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
105 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
106 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
107 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
108 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
109 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
110 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
111 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
112 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
113 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
114 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
115 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
116 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
117 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
118 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
119 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
120 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
121 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
122 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
123 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
124 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
125 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
126 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
127 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
128 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
129 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
194 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
196 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
200 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
201 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
202 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
203 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
204 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
205 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
206 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
207 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
208 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
209 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
210 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
211 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
212 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
213 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
214 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
215 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
216 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
217 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
218 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
219 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
220 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
221 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
222 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
223 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
224 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
225 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
226 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
227 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
228 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
229 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
230 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
231 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
232 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
233 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
234 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
235 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
236 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
237 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
238 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
239 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
240 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
241 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
242 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
243 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
244 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
245 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
246 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
247 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
248 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
249 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
250 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
251 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
252 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
253 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
254 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
255 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
256 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
257 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
258 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
259 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
260 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
261 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
262 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
263 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
264 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
265 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
266 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
267 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
268 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
269 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
270 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
271 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
272 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
273 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
274 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
275 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
276 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
277 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
278 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
279 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
280 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
281 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
282 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
283 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
284 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
285 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
286 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
287 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
288 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
289 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
290 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
291 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
292 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
293 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
294 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
296 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
297 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
298 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
299 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
300 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
301 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
302 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
303 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
304 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
305 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
306 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
307 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
308 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
309 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
310 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
311 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
312 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
313 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
314 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
315 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
316 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
317 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
318 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
319 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
320 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
321 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
322 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
323 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
324 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
325 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
326 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
327 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
328 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
329 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
330 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
331 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
332 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
333 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
334 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
335 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
336 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
337 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
338 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
339 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
340 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
341 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
342 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
343 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
344 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
345 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
346 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
347 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
348 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
349 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
350 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
351 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
352 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
353 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
354 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
355 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.57
Metatranscriptomes 2.43
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.28
Nodule 0
Rhizoplane 4.76
Rhizosphere 88.04
Stem 0
Stem Tuber 0
Unclassified 9.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070680_100187029 3300005336 Bacteria 1745
2 Ga0058859_11731982 3300004798 Bacteria 1000
3 Ga0058860_11966351 3300004801 Bacteria 636
4 Ga0058860_11994763 3300004801 Unclassified 645
5 Ga0058862_11735751 3300004803 Bacteria 1055
6 Ga0065714_10118181 3300005288 Unclassified 1382
7 Ga0065714_10458780 3300005288 Unclassified 548
8 Ga0065704_10013904 3300005289 Bacteria 1838
9 Ga0065712_10007127 3300005290 Bacteria 2614
10 Ga0065712_10129193 3300005290 Bacteria 1570
11 Ga0065712_10209444 3300005290 Bacteria 1078
12 Ga0065712_10222346 3300005290 Bacteria 1037
13 Ga0065715_10004746 3300005293 Bacteria 5208
14 Ga0065715_10089936 3300005293 Bacteria 8088
15 Ga0065715_10095575 3300005293 Bacteria 4050
16 Ga0065715_10103317 3300005293 Bacteria 3043
17 Ga0065715_10366276 3300005293 Bacteria 928
18 Ga0065707_10040179 3300005295 Unclassified 924
19 Ga0065707_10123128 3300005295 Bacteria 2072
20 Ga0065707_10198936 3300005295 Bacteria 1320
21 Ga0065707_10486292 3300005295 Bacteria 769
22 Ga0065707_10583818 3300005295 Bacteria 700
23 Ga0070676_10080445 3300005328 Bacteria 1975
24 Ga0070676_10253456 3300005328 Bacteria 1175
25 Ga0070683_100003796 3300005329 Bacteria 12336
26 Ga0070683_100013028 3300005329 Bacteria 7240
27 Ga0070683_100157673 3300005329 Bacteria 2153
28 Ga0070690_100253535 3300005330 Bacteria 1245
29 Ga0070690_100801100 3300005330 Bacteria 731
30 Ga0070670_100001073 3300005331 Bacteria 21719
31 Ga0070670_100046452 3300005331 Bacteria 3734
32 Ga0070670_100051657 3300005331 Bacteria 3530
33 Ga0070670_100142970 3300005331 Bacteria 2069
34 Ga0070670_100155642 3300005331 Bacteria 1979
35 Ga0070670_100315239 3300005331 Bacteria 1369
36 Ga0070677_10061624 3300005333 Bacteria 1549
37 Ga0070677_10065574 3300005333 Bacteria 1511
38 Ga0070677_10793872 3300005333 Unclassified 540
39 Ga0068869_100085766 3300005334 Bacteria 2359
40 Ga0068869_100192208 3300005334 Bacteria 1605
41 Ga0068869_100469877 3300005334 Bacteria 1046
42 Ga0070666_10030942 3300005335 Bacteria 3530
43 Ga0070666_10193516 3300005335 Bacteria 1429
44 Ga0070666_11040754 3300005335 Unclassified 608
45 Ga0070682_100132809 3300005337 Bacteria 1687
46 Ga0070682_100154148 3300005337 Bacteria 1580
47 Ga0068868_100021547 3300005338 Bacteria 4853
48 Ga0068868_101414188 3300005338 Bacteria 649
49 Ga0070660_100022338 3300005339 Bacteria 4677
50 Ga0070660_100080678 3300005339 Bacteria 2553
51 Ga0070689_100039349 3300005340 Bacteria 3620
52 Ga0070689_100095876 3300005340 Bacteria 2344
53 Ga0070689_100239577 3300005340 Bacteria 1494
54 Ga0070689_101079155 3300005340 Unclassified 717
55 Ga0070689_101377756 3300005340 Unclassified 637
56 Ga0070687_100088175 3300005343 Bacteria 1710
57 Ga0070687_100754855 3300005343 Unclassified 685
58 Ga0070687_100784144 3300005343 Bacteria 674
59 Ga0070661_100059710 3300005344 Bacteria 2797
60 Ga0070661_100379782 3300005344 Bacteria 1114
61 Ga0070661_100468643 3300005344 Bacteria 1004
62 Ga0070668_100451868 3300005347 Bacteria 1105
63 Ga0070668_100732433 3300005347 Bacteria 874
64 Ga0070669_100003506 3300005353 Bacteria 11310
65 Ga0070669_100034288 3300005353 Bacteria 3674
66 Ga0070669_100075451 3300005353 Bacteria 2501
67 Ga0070669_100116057 3300005353 Bacteria 2037
68 Ga0070675_100296158 3300005354 Bacteria 1424
69 Ga0070675_100722677 3300005354 Bacteria 908
70 Ga0070675_101359115 3300005354 Bacteria 655
71 Ga0070671_100008709 3300005355 Bacteria 8140
72 Ga0070671_100017222 3300005355 Bacteria 5850
73 Ga0070671_100029357 3300005355 Bacteria 4534
74 Ga0070671_100235848 3300005355 Bacteria 1553
75 Ga0070674_100002314 3300005356 Bacteria 10519
76 Ga0070674_100058006 3300005356 Bacteria 2690
77 Ga0070674_100373898 3300005356 Unclassified 1157
78 Ga0070674_100416276 3300005356 Bacteria 1101
79 Ga0070674_100702457 3300005356 Bacteria 865
80 Ga0070674_100738473 3300005356 Bacteria 845
81 Ga0070674_100960402 3300005356 Bacteria 748
82 Ga0070673_100019968 3300005364 Bacteria 4823
83 Ga0070673_100077835 3300005364 Bacteria 2681
84 Ga0070673_100099192 3300005364 Bacteria 2395
85 Ga0070673_100123549 3300005364 Bacteria 2163
86 Ga0070673_100433577 3300005364 Bacteria 1180
87 Ga0070673_101285358 3300005364 Bacteria 687
88 Ga0070688_100021140 3300005365 Bacteria 3797
89 Ga0070688_100142728 3300005365 Bacteria 1629
90 Ga0070688_100363235 3300005365 Bacteria 1063
91 Ga0070688_101520846 3300005365 Unclassified 545
92 Ga0070659_100045405 3300005366 Bacteria 3442
93 Ga0070659_100187389 3300005366 Bacteria 1700
94 Ga0070659_100200424 3300005366 Bacteria 1643
95 Ga0070659_100210187 3300005366 Bacteria 1604
96 Ga0070667_100047697 3300005367 Bacteria 3604
97 Ga0070667_100165797 3300005367 Bacteria 1948
98 Ga0070709_10430728 3300005434 Bacteria 990
99 Ga0070701_10037508 3300005438 Bacteria 2447
100 Ga0070701_10074979 3300005438 Bacteria 1818
101 Ga0070701_10358499 3300005438 Bacteria 913
102 Ga0070705_100040941 3300005440 Bacteria 2638
103 Ga0070700_100054295 3300005441 Bacteria 2503
104 Ga0070700_100106643 3300005441 Bacteria 1855
105 Ga0070700_100247661 3300005441 Bacteria 1277
106 Ga0070700_100289091 3300005441 Bacteria 1192
107 Ga0070700_100777137 3300005441 Bacteria 769
108 Ga0070694_100075096 3300005444 Bacteria 2337
109 Ga0070694_100280300 3300005444 Bacteria 1271
110 Ga0070708_100635759 3300005445 Bacteria 1006
111 Ga0070663_100026811 3300005455 Bacteria 3906
112 Ga0070663_100045532 3300005455 Bacteria 3100
113 Ga0070663_100296982 3300005455 Bacteria 1292
114 Ga0070663_101636789 3300005455 Unclassified 575
115 Ga0070678_100092324 3300005456 Bacteria 2325
116 Ga0070678_100155832 3300005456 Bacteria 1845
117 Ga0070678_100582460 3300005456 Bacteria 997
118 Ga0070678_100601123 3300005456 Bacteria 982
119 Ga0070678_100723203 3300005456 Bacteria 898
120 Ga0070662_100309743 3300005457 Bacteria 1285
121 Ga0070662_100403931 3300005457 Bacteria 1128
122 Ga0070662_100843520 3300005457 Bacteria 780
123 Ga0070681_10014055 3300005458 Bacteria 7967
124 Ga0070681_10657281 3300005458 Unclassified 963
125 Ga0068867_100010339 3300005459 Bacteria 6584
126 Ga0068867_101225500 3300005459 Unclassified 690
127 Ga0070685_10112692 3300005466 Bacteria 1678
128 Ga0070685_10358060 3300005466 Unclassified 999
129 Ga0070706_100028003 3300005467 Bacteria 5184
130 Ga0070706_100469996 3300005467 Bacteria 1170
131 Ga0070707_100160179 3300005468 Bacteria 2193
132 Ga0070707_100860611 3300005468 Bacteria 871
133 Ga0070707_101337124 3300005468 Bacteria 683
134 Ga0070698_100052927 3300005471 Bacteria 4127
135 Ga0070698_100231953 3300005471 Bacteria 1779
136 Ga0070698_100821627 3300005471 Bacteria 874
137 Ga0070699_100444365 3300005518 Bacteria 1175
138 Ga0070699_100533225 3300005518 Bacteria 1068
139 Ga0070699_100557962 3300005518 Bacteria 1043
140 Ga0070679_100051177 3300005530 Bacteria 4114
141 Ga0070679_100952528 3300005530 Bacteria 802
142 Ga0070684_100002103 3300005535 Bacteria 14661
143 Ga0070684_100074004 3300005535 Bacteria 3003
144 Ga0070684_100649378 3300005535 Bacteria 982
145 Ga0070684_101930620 3300005535 Unclassified 557
146 Ga0070697_100622591 3300005536 Bacteria 949
147 Ga0070697_100889432 3300005536 Bacteria 790
148 Ga0068853_100334990 3300005539 Bacteria 1405
149 Ga0070672_100009755 3300005543 Bacteria 6630
150 Ga0070672_100061006 3300005543 Bacteria 2971
151 Ga0070672_100067203 3300005543 Bacteria 2840
152 Ga0070672_100072821 3300005543 Bacteria 2737
153 Ga0070672_100084896 3300005543 Bacteria 2543
154 Ga0070672_100241485 3300005543 Bacteria 1519
155 Ga0070672_100653963 3300005543 Bacteria 918
156 Ga0070686_100028825 3300005544 Bacteria 3370
157 Ga0070686_100086557 3300005544 Bacteria 2087
158 Ga0070686_100110453 3300005544 Bacteria 1872
159 Ga0070686_100190785 3300005544 Bacteria 1462
160 Ga0070686_100216760 3300005544 Bacteria 1381
161 Ga0070686_100265100 3300005544 Bacteria 1261
162 Ga0070695_100013286 3300005545 Bacteria 4947
163 Ga0070695_100380192 3300005545 Unclassified 1065
164 Ga0070695_100941398 3300005545 Bacteria 700
165 Ga0070696_100481087 3300005546 Bacteria 985
166 Ga0070696_100595911 3300005546 Bacteria 890
167 Ga0070696_100787065 3300005546 Bacteria 782
168 Ga0070693_100058780 3300005547 Bacteria 2227
169 Ga0070665_100042019 3300005548 Bacteria 4595
170 Ga0070665_100061590 3300005548 Bacteria 3762
171 Ga0070665_100086619 3300005548 Bacteria 3137
172 Ga0070665_100129577 3300005548 Bacteria 2524
173 Ga0070665_100173970 3300005548 Bacteria 2154
174 Ga0070665_100449733 3300005548 Bacteria 1298
175 Ga0070665_101907187 3300005548 Unclassified 600
176 Ga0070704_100034673 3300005549 Bacteria 3425
177 Ga0070704_101048515 3300005549 Bacteria 739
178 Ga0068855_100017318 3300005563 Bacteria 8669
179 Ga0068855_101041513 3300005563 Unclassified 858
180 Ga0068855_101054566 3300005563 Bacteria 852
181 Ga0070664_100007179 3300005564 Bacteria 8982
182 Ga0070664_100184476 3300005564 Bacteria 1856
183 Ga0070664_100279788 3300005564 Bacteria 1504
184 Ga0070664_100479969 3300005564 Bacteria 1144
185 Ga0070664_100491639 3300005564 Bacteria 1130
186 Ga0070664_100516836 3300005564 Bacteria 1102
187 Ga0070664_100914188 3300005564 Bacteria 823
188 Ga0068857_100002325 3300005577 Bacteria 15456
189 Ga0068857_100010417 3300005577 Bacteria 8080
190 Ga0068857_100666176 3300005577 Bacteria 987
191 Ga0068857_101139585 3300005577 Bacteria 754
192 Ga0068854_100474532 3300005578 Bacteria 1049
193 Ga0068854_100478136 3300005578 Bacteria 1045
194 Ga0068854_100783535 3300005578 Bacteria 830
195 Ga0070702_100764233 3300005615 Bacteria 743
196 Ga0068852_100727101 3300005616 Bacteria 1004
197 Ga0068852_102506153 3300005616 Bacteria 536
198 Ga0068859_100002294 3300005617 Bacteria 19421
199 Ga0068859_100149440 3300005617 Bacteria 2412
200 Ga0068859_100242506 3300005617 Bacteria 1892
201 Ga0068859_100272286 3300005617 Bacteria 1785
202 Ga0068859_100350678 3300005617 Bacteria 1571
203 Ga0068859_100457196 3300005617 Bacteria 1373
204 Ga0068859_101107078 3300005617 Bacteria 871
205 Ga0068859_101418715 3300005617 Unclassified 766
206 Ga0068864_100013376 3300005618 Bacteria 6801
207 Ga0068864_100459932 3300005618 Bacteria 1218
208 Ga0068864_100652894 3300005618 Bacteria 1024
209 Ga0068864_100727329 3300005618 Bacteria 971
210 Ga0068864_101652216 3300005618 Unclassified 645
211 Ga0068864_101915098 3300005618 Bacteria 599
212 Ga0068866_10392327 3300005718 Bacteria 893
213 Ga0068861_101182588 3300005719 Bacteria 739
214 Ga0068861_101441216 3300005719 Bacteria 674
215 Ga0068863_100001594 3300005841 Bacteria 22409
216 Ga0068863_100632847 3300005841 Bacteria 1060
217 Ga0068858_100003439 3300005842 Bacteria 15721
218 Ga0068858_100070668 3300005842 Bacteria 3236
219 Ga0068858_100133834 3300005842 Bacteria 2325
220 Ga0068858_100162422 3300005842 Bacteria 2103
221 Ga0068858_100366752 3300005842 Bacteria 1381
222 Ga0068858_100589317 3300005842 Bacteria 1078
223 Ga0068858_101045867 3300005842 Bacteria 801
224 Ga0068860_100013508 3300005843 Bacteria 8006
225 Ga0068860_100220965 3300005843 Bacteria 1840
226 Ga0068860_100231197 3300005843 Bacteria 1797
227 Ga0068860_100606046 3300005843 Bacteria 1101
228 Ga0068860_101145284 3300005843 Bacteria 798
229 Ga0068860_101504994 3300005843 Bacteria 695
230 Ga0068862_100066631 3300005844 Bacteria 3103
231 Ga0068862_100076347 3300005844 Bacteria 2900
232 Ga0068862_100093423 3300005844 Bacteria 2623
233 Ga0068862_100340433 3300005844 Bacteria 1389
234 Ga0068862_100377788 3300005844 Bacteria 1321
235 Ga0068862_100446551 3300005844 Bacteria 1218
236 Ga0081455_10028442 3300005937 Bacteria 5108
237 Ga0081539_10153786 3300005985 Bacteria 1104
238 Ga0070717_10062924 3300006028 Bacteria 3078
239 Ga0075365_10035910 3300006038 Bacteria 3209
240 Ga0075365_10072101 3300006038 Bacteria 2326
241 Ga0075365_10073418 3300006038 Bacteria 2306
242 Ga0075365_10241464 3300006038 Bacteria 1269
243 Ga0075365_10621642 3300006038 Unclassified 764
244 Ga0075368_10016677 3300006042 Bacteria 2739
245 Ga0075368_10026385 3300006042 Bacteria 2234
246 Ga0075368_10044702 3300006042 Bacteria 1748
247 Ga0075363_100020142 3300006048 Bacteria 3344
248 Ga0075363_100126230 3300006048 Bacteria 1433
249 Ga0075364_10002444 3300006051 Bacteria 10408
250 Ga0075364_10029834 3300006051 Bacteria 3498
251 Ga0075364_10039690 3300006051 Bacteria 3052
252 Ga0075364_10244313 3300006051 Bacteria 1219
253 Ga0075364_10351083 3300006051 Bacteria 1005
254 Ga0070715_10494078 3300006163 Bacteria 699
255 Ga0070715_10740380 3300006163 Bacteria 591
256 Ga0070716_100050992 3300006173 Bacteria 2351
257 Ga0070716_101170592 3300006173 Unclassified 616
258 Ga0075362_10001840 3300006177 Bacteria 6933
259 Ga0075362_10274291 3300006177 Bacteria 833
260 Ga0075367_10003718 3300006178 Bacteria 7337
261 Ga0075367_10020613 3300006178 Bacteria 3674
262 Ga0075367_10132236 3300006178 Bacteria 1543
263 Ga0075367_10236979 3300006178 Bacteria 1143
264 Ga0075369_10476537 3300006186 Bacteria 592
265 Ga0075366_10021130 3300006195 Bacteria 3783
266 Ga0075366_10139289 3300006195 Bacteria 1466
267 Ga0075366_10154588 3300006195 Bacteria 1389
268 Ga0075370_10002749 3300006353 Bacteria 8238
269 Ga0075370_10019572 3300006353 Bacteria 3688
270 Ga0075370_10049477 3300006353 Bacteria 2383
271 Ga0075370_10258246 3300006353 Bacteria 1033
272 Ga0068871_100078946 3300006358 Bacteria 2722
273 Ga0068871_100204400 3300006358 Bacteria 1706
274 Ga0068871_101488200 3300006358 Bacteria 639
275 Ga0075428_100000086 3300006844 Bacteria 77110
276 Ga0075428_100147332 3300006844 Bacteria 2558
277 Ga0075428_100467020 3300006844 Bacteria 1351
278 Ga0075428_101305724 3300006844 Bacteria 763
279 Ga0075430_100000028 3300006846 Bacteria 74712
280 Ga0075430_100050759 3300006846 Bacteria 3496
281 Ga0075431_100002556 3300006847 Bacteria 17557
282 Ga0075431_100159547 3300006847 Bacteria 2319
283 Ga0075431_100185223 3300006847 Bacteria 2135
284 Ga0075431_100887089 3300006847 Bacteria 862
285 Ga0075433_10018891 3300006852 Bacteria 5737
286 Ga0075433_10104953 3300006852 Bacteria 2504
287 Ga0075433_10145020 3300006852 Bacteria 2111
288 Ga0075433_10267373 3300006852 Bacteria 1516
289 Ga0075434_100007002 3300006871 Bacteria 10399
290 Ga0075434_100033292 3300006871 Bacteria 5085
291 Ga0075434_100099686 3300006871 Bacteria 2910
292 Ga0075434_100188995 3300006871 Bacteria 2080
293 Ga0075434_100216817 3300006871 Bacteria 1934
294 Ga0075434_100693888 3300006871 Bacteria 1036
295 Ga0075434_101767451 3300006871 Bacteria 625
296 Ga0075429_100015445 3300006880 Bacteria 6616
297 Ga0075429_100020933 3300006880 Bacteria 5674
298 Ga0068865_100021449 3300006881 Bacteria 4200
299 Ga0068865_101205844 3300006881 Bacteria 670
300 Ga0068865_101319780 3300006881 Bacteria 642
301 Ga0075436_100052691 3300006914 Bacteria 2809
302 Ga0075436_100267281 3300006914 Bacteria 1221
303 Ga0075436_100425595 3300006914 Bacteria 964
304 Ga0097620_100002294 3300006931 Bacteria 19421
305 Ga0097620_100149436 3300006931 Bacteria 2412
306 Ga0097620_100242513 3300006931 Bacteria 1892
307 Ga0097620_100272286 3300006931 Bacteria 1785
308 Ga0097620_100350656 3300006931 Bacteria 1571
309 Ga0097620_100457216 3300006931 Bacteria 1373
310 Ga0097620_101107334 3300006931 Bacteria 871
311 Ga0097620_101418749 3300006931 Unclassified 766
312 Ga0075435_100002170 3300007076 Bacteria 12940
313 Ga0075435_100003388 3300007076 Bacteria 10812
314 Ga0075435_100153273 3300007076 Bacteria 1938
315 Ga0075435_100574978 3300007076 Unclassified 977
316 Ga0105240_10120545 3300009093 Bacteria 3159
317 Ga0105240_10189656 3300009093 Bacteria 2418
318 Ga0105240_11957434 3300009093 Bacteria 609
319 Ga0111539_10000166 3300009094 Bacteria 76156
320 Ga0111539_10002576 3300009094 Bacteria 24001
321 Ga0111539_10004018 3300009094 Bacteria 19307
322 Ga0111539_10185798 3300009094 Bacteria 2427
323 Ga0111539_10880010 3300009094 Bacteria 1042
324 Ga0111539_11608085 3300009094 Bacteria 754
325 Ga0111539_12512761 3300009094 Unclassified 597
326 Ga0105245_10028234 3300009098 Bacteria 4947
327 Ga0105245_10200392 3300009098 Bacteria 1917
328 Ga0105245_11033658 3300009098 Bacteria 867
329 Ga0105247_10055811 3300009101 Bacteria 2438
330 Ga0105247_10064187 3300009101 Bacteria 2281
331 Ga0105247_10246730 3300009101 Bacteria 1219
332 Ga0114129_10000148 3300009147 Bacteria 74039
333 Ga0114129_10000358 3300009147 Bacteria 52801
334 Ga0114129_10002946 3300009147 Bacteria 23809
335 Ga0114129_10006068 3300009147 Bacteria 17125
336 Ga0114129_10014154 3300009147 Bacteria 11366
337 Ga0114129_10040079 3300009147 Bacteria 6604
338 Ga0114129_10419120 3300009147 Bacteria 1761
339 Ga0105243_10262519 3300009148 Bacteria 1547
340 Ga0105243_10528805 3300009148 Bacteria 1123
341 Ga0105243_10727697 3300009148 Bacteria 970
342 Ga0105243_10833904 3300009148 Bacteria 912
343 Ga0105241_10163490 3300009174 Bacteria 1832
344 Ga0105242_10018526 3300009176 Bacteria 5445
345 Ga0105242_10115531 3300009176 Bacteria 2294
346 Ga0105242_10736244 3300009176 Bacteria 969
347 Ga0105242_11239220 3300009176 Bacteria 767
348 Ga0105248_10013671 3300009177 Bacteria 8936
349 Ga0105248_10076090 3300009177 Bacteria 3773
350 Ga0105248_10088878 3300009177 Bacteria 3477
351 Ga0105248_10150544 3300009177 Bacteria 2625
352 Ga0105248_10228041 3300009177 Bacteria 2097
353 Ga0105248_10270859 3300009177 Bacteria 1912
354 Ga0105248_10311259 3300009177 Bacteria 1773
355 Ga0105248_11101684 3300009177 Unclassified 898
356 Ga0105248_11294259 3300009177 Bacteria 825
357 Ga0105248_12060140 3300009177 Unclassified 649
358 Ga0105248_12781123 3300009177 Unclassified 558
359 Ga0105237_10179627 3300009545 Bacteria 2117
360 Ga0105238_10135684 3300009551 Bacteria 2438
361 Ga0105238_11561879 3300009551 Unclassified 689
362 Ga0105238_12139891 3300009551 Bacteria 594
363 Ga0105249_10001013 3300009553 Bacteria 24888
364 Ga0105249_10315647 3300009553 Bacteria 1573
365 Ga0105249_10562392 3300009553 Bacteria 1192
366 Ga0105249_10629230 3300009553 Bacteria 1130
367 Ga0099796_10250611 3300010159 Bacteria 735
368 Ga0105239_10466037 3300010375 Bacteria 1434
369 Ga0105239_10738436 3300010375 Bacteria 1126
370 Ga0105239_10914970 3300010375 Bacteria 1007
371 Ga0105239_12371652 3300010375 Bacteria 618
372 Ga0105246_11343526 3300011119 Unclassified 664
373 Ga0105246_11622907 3300011119 Bacteria 612
374 Ga0157370_10892946 3300013104 Unclassified 807
375 Ga0157374_10328637 3300013296 Bacteria 1516
376 Ga0157378_10099251 3300013297 Bacteria 2656
377 Ga0157378_10467008 3300013297 Bacteria 1255
378 Ga0157378_12287638 3300013297 Unclassified 592
379 Ga0163162_10307341 3300013306 Bacteria 1718
380 Ga0163162_10453101 3300013306 Bacteria 1415
381 Ga0157375_10314059 3300013308 Bacteria 1731
382 Ga0157375_10420869 3300013308 Bacteria 1502
383 Ga0157375_10856823 3300013308 Bacteria 1055
384 Ga0157375_11323891 3300013308 Bacteria 847
385 Ga0157375_12018442 3300013308 Unclassified 686
386 Ga0157375_13305678 3300013308 Unclassified 537
387 Ga0163163_10051912 3300014325 Bacteria 4043
388 Ga0163163_10082704 3300014325 Bacteria 3215
389 Ga0163163_10105470 3300014325 Bacteria 2844
390 Ga0163163_10708118 3300014325 Bacteria 1070
391 Ga0163163_11502758 3300014325 Unclassified 735
392 Ga0163163_12222216 3300014325 Unclassified 608
393 Ga0157380_10498945 3300014326 Bacteria 1182
394 Ga0157380_10610457 3300014326 Bacteria 1081
395 Ga0157380_10647777 3300014326 Bacteria 1053
396 Ga0157380_11115811 3300014326 Bacteria 828
397 Ga0157377_10074656 3300014745 Bacteria 1967
398 Ga0157377_10191353 3300014745 Bacteria 1293
399 Ga0157379_10084743 3300014968 Bacteria 2840
400 Ga0157379_10111874 3300014968 Bacteria 2453
401 Ga0157379_10590108 3300014968 Bacteria 1036
402 Ga0157379_10907493 3300014968 Unclassified 836
403 Ga0157376_10155190 3300014969 Bacteria 2069
404 Ga0157376_10333140 3300014969 Bacteria 1447
405 Ga0157376_10347629 3300014969 Bacteria 1418
406 Ga0163161_10093031 3300017792 Bacteria 2233
407 Ga0163161_10342708 3300017792 Bacteria 1186
408 Ga0163161_10394749 3300017792 Bacteria 1108
409 Ga0206356_10200085 3300020070 Bacteria 2125
410 Ga0206356_11468788 3300020070 Bacteria 2220
411 Ga0206349_1777349 3300020075 Bacteria 608
412 Ga0206351_10123141 3300020077 Bacteria 580
413 Ga0206350_10791712 3300020080 Bacteria 1263
414 Ga0224712_10059528 3300022467 Bacteria 1517
415 Ga0224712_10378210 3300022467 Bacteria 672
416 Ga0207697_10001509 3300025315 Bacteria 12653
417 Ga0207653_10121842 3300025885 Bacteria 939
418 Ga0207682_10024623 3300025893 Bacteria 2384
419 Ga0207682_10044122 3300025893 Bacteria 1827
420 Ga0207642_10153937 3300025899 Bacteria 1227
421 Ga0207642_10504247 3300025899 Unclassified 741
422 Ga0207710_10075879 3300025900 Bacteria 1550
423 Ga0207710_10264812 3300025900 Unclassified 862
424 Ga0207688_10001938 3300025901 Bacteria 11081
425 Ga0207688_10098974 3300025901 Bacteria 1682
426 Ga0207688_10265740 3300025901 Bacteria 1042
427 Ga0207680_10245020 3300025903 Bacteria 1236
428 Ga0207647_10060282 3300025904 Bacteria 2320
429 Ga0207647_10300592 3300025904 Bacteria 914
430 Ga0207685_10113187 3300025905 Bacteria 1179
431 Ga0207685_10412726 3300025905 Bacteria 694
432 Ga0207699_10396871 3300025906 Unclassified 982
433 Ga0207645_10024800 3300025907 Bacteria 3885
434 Ga0207645_10122806 3300025907 Bacteria 1686
435 Ga0207645_10333460 3300025907 Bacteria 1013
436 Ga0207645_10394113 3300025907 Bacteria 931
437 Ga0207643_10188289 3300025908 Bacteria 1252
438 Ga0207705_10522495 3300025909 Bacteria 922
439 Ga0207684_10223191 3300025910 Bacteria 1626
440 Ga0207684_10445042 3300025910 Bacteria 1112
441 Ga0207684_10727132 3300025910 Unclassified 842
442 Ga0207654_10256687 3300025911 Bacteria 1174
443 Ga0207707_10114508 3300025912 Bacteria 2357
444 Ga0207695_10378456 3300025913 Bacteria 1301
445 Ga0207671_10436319 3300025914 Bacteria 1042
446 Ga0207662_10164115 3300025918 Bacteria 1421
447 Ga0207662_10245974 3300025918 Bacteria 1172
448 Ga0207662_10693352 3300025918 Unclassified 713
449 Ga0207662_10766589 3300025918 Bacteria 679
450 Ga0207657_10000779 3300025919 Bacteria 33835
451 Ga0207657_10047849 3300025919 Bacteria 3736
452 Ga0207657_10272876 3300025919 Bacteria 1344
453 Ga0207649_10536203 3300025920 Bacteria 894
454 Ga0207649_10822803 3300025920 Bacteria 726
455 Ga0207652_10016687 3300025921 Bacteria 6001
456 Ga0207652_10070002 3300025921 Bacteria 3046
457 Ga0207681_10047381 3300025923 Bacteria 2895
458 Ga0207681_10064030 3300025923 Bacteria 2537
459 Ga0207681_10658024 3300025923 Bacteria 869
460 Ga0207681_10796352 3300025923 Unclassified 789
461 Ga0207681_11588536 3300025923 Bacteria 548
462 Ga0207694_10921168 3300025924 Bacteria 739
463 Ga0207650_10045723 3300025925 Bacteria 3221
464 Ga0207650_10199670 3300025925 Bacteria 1601
465 Ga0207650_10219756 3300025925 Bacteria 1529
466 Ga0207650_10665692 3300025925 Bacteria 878
467 Ga0207659_10523973 3300025926 Bacteria 1005
468 Ga0207659_10703524 3300025926 Bacteria 865
469 Ga0207687_10017556 3300025927 Bacteria 4713
470 Ga0207687_10639620 3300025927 Bacteria 899
471 Ga0207700_11041714 3300025928 Bacteria 732
472 Ga0207700_11379010 3300025928 Bacteria 627
473 Ga0207644_10004449 3300025931 Bacteria 9100
474 Ga0207644_10047694 3300025931 Bacteria 3058
475 Ga0207644_10047715 3300025931 Bacteria 3058
476 Ga0207690_10018485 3300025932 Bacteria 4275
477 Ga0207690_10024913 3300025932 Bacteria 3751
478 Ga0207690_10145797 3300025932 Bacteria 1750
479 Ga0207690_10360628 3300025932 Bacteria 1151
480 Ga0207706_10098916 3300025933 Bacteria 2566
481 Ga0207706_10307324 3300025933 Bacteria 1381
482 Ga0207706_10513390 3300025933 Bacteria 1034
483 Ga0207706_10611557 3300025933 Bacteria 935
484 Ga0207706_10632371 3300025933 Bacteria 918
485 Ga0207706_10637364 3300025933 Bacteria 913
486 Ga0207706_10982698 3300025933 Bacteria 710
487 Ga0207686_10198675 3300025934 Bacteria 1435
488 Ga0207686_10424551 3300025934 Bacteria 1018
489 Ga0207686_10470811 3300025934 Bacteria 970
490 Ga0207686_10708078 3300025934 Bacteria 801
491 Ga0207686_11009893 3300025934 Bacteria 675
492 Ga0207709_10095066 3300025935 Bacteria 1957
493 Ga0207670_10061323 3300025936 Bacteria 2566
494 Ga0207670_10110194 3300025936 Bacteria 1982
495 Ga0207670_10436249 3300025936 Unclassified 1054
496 Ga0207670_10579362 3300025936 Bacteria 920
497 Ga0207670_11118863 3300025936 Unclassified 665
498 Ga0207670_11323412 3300025936 Unclassified 611
499 Ga0207670_11334813 3300025936 Unclassified 608
500 Ga0207669_10028290 3300025937 Bacteria 3082
501 Ga0207669_10038284 3300025937 Bacteria 2760
502 Ga0207669_10075226 3300025937 Bacteria 2139
503 Ga0207669_10307828 3300025937 Bacteria 1207
504 Ga0207669_10308450 3300025937 Bacteria 1206
505 Ga0207669_11302742 3300025937 Bacteria 617
506 Ga0207704_10414430 3300025938 Bacteria 1066
507 Ga0207704_11167375 3300025938 Bacteria 656
508 Ga0207665_10039643 3300025939 Bacteria 3140
509 Ga0207691_10027047 3300025940 Bacteria 5383
510 Ga0207691_10080494 3300025940 Bacteria 2930
511 Ga0207691_10086446 3300025940 Bacteria 2813
512 Ga0207691_10128082 3300025940 Bacteria 2244
513 Ga0207691_10129306 3300025940 Bacteria 2232
514 Ga0207691_10166207 3300025940 Bacteria 1933
515 Ga0207711_10011982 3300025941 Bacteria 7207
516 Ga0207711_10043705 3300025941 Bacteria 3823
517 Ga0207711_10075501 3300025941 Bacteria 2933
518 Ga0207711_10186427 3300025941 Bacteria 1889
519 Ga0207711_10242890 3300025941 Bacteria 1651
520 Ga0207711_10291705 3300025941 Bacteria 1503
521 Ga0207711_10293338 3300025941 Bacteria 1499
522 Ga0207711_10467798 3300025941 Bacteria 1174
523 Ga0207711_10533050 3300025941 Unclassified 1095
524 Ga0207711_10675963 3300025941 Bacteria 963
525 Ga0207689_10063367 3300025942 Bacteria 3041
526 Ga0207689_10104437 3300025942 Bacteria 2328
527 Ga0207689_10186212 3300025942 Bacteria 1712
528 Ga0207689_10278715 3300025942 Bacteria 1384
529 Ga0207689_10372973 3300025942 Bacteria 1188
530 Ga0207661_10001442 3300025944 Bacteria 16036
531 Ga0207661_10008087 3300025944 Bacteria 7501
532 Ga0207661_10188648 3300025944 Bacteria 1806
533 Ga0207679_10008487 3300025945 Bacteria 6545
534 Ga0207679_10062150 3300025945 Bacteria 2782
535 Ga0207679_10124370 3300025945 Bacteria 2059
536 Ga0207679_10133488 3300025945 Bacteria 1995
537 Ga0207679_10221747 3300025945 Bacteria 1591
538 Ga0207679_10719607 3300025945 Bacteria 907
539 Ga0207679_10845798 3300025945 Bacteria 836
540 Ga0207679_10845840 3300025945 Bacteria 835
541 Ga0207667_10060522 3300025949 Bacteria 3963
542 Ga0207667_10416712 3300025949 Bacteria 1367
543 Ga0207667_10617797 3300025949 Bacteria 1092
544 Ga0207651_10012231 3300025960 Bacteria 4846
545 Ga0207651_10092071 3300025960 Bacteria 2222
546 Ga0207651_10156458 3300025960 Bacteria 1781
547 Ga0207651_10331072 3300025960 Unclassified 1276
548 Ga0207651_11029916 3300025960 Bacteria 736
549 Ga0207651_11288093 3300025960 Unclassified 657
550 Ga0207712_10891215 3300025961 Bacteria 786
551 Ga0207668_10105691 3300025972 Bacteria 2102
552 Ga0207668_10224766 3300025972 Bacteria 1510
553 Ga0207668_10416605 3300025972 Bacteria 1139
554 Ga0207668_10613944 3300025972 Bacteria 948
555 Ga0207640_10200975 3300025981 Bacteria 1510
556 Ga0207640_10555555 3300025981 Bacteria 965
557 Ga0207658_10013997 3300025986 Bacteria 5491
558 Ga0207658_10145628 3300025986 Bacteria 1923
559 Ga0207658_10179324 3300025986 Bacteria 1752
560 Ga0207658_10552344 3300025986 Bacteria 1031
561 Ga0207677_10014100 3300026023 Bacteria 4655
562 Ga0207677_10145964 3300026023 Bacteria 1818
563 Ga0207677_10493078 3300026023 Bacteria 1058
564 Ga0207677_11073613 3300026023 Bacteria 733
565 Ga0207677_11237068 3300026023 Bacteria 684
566 Ga0207703_10010325 3300026035 Bacteria 7311
567 Ga0207703_10092573 3300026035 Bacteria 2545
568 Ga0207703_10135760 3300026035 Bacteria 2129
569 Ga0207703_10164149 3300026035 Bacteria 1947
570 Ga0207703_10170306 3300026035 Bacteria 1915
571 Ga0207703_10237222 3300026035 Bacteria 1638
572 Ga0207703_10269672 3300026035 Bacteria 1541
573 Ga0207703_10457663 3300026035 Bacteria 1193
574 Ga0207703_10463954 3300026035 Bacteria 1185
575 Ga0207703_10469888 3300026035 Bacteria 1177
576 Ga0207703_10927935 3300026035 Bacteria 834
577 Ga0207639_10330158 3300026041 Bacteria 1357
578 Ga0207639_11362260 3300026041 Bacteria 666
579 Ga0207678_10074931 3300026067 Bacteria 2899
580 Ga0207678_10210500 3300026067 Bacteria 1663
581 Ga0207708_10004224 3300026075 Bacteria 10574
582 Ga0207708_10159975 3300026075 Bacteria 1778
583 Ga0207708_10181924 3300026075 Bacteria 1669
584 Ga0207708_10241723 3300026075 Bacteria 1452
585 Ga0207708_10787626 3300026075 Bacteria 818
586 Ga0207708_10873839 3300026075 Unclassified 777
587 Ga0207641_10000431 3300026088 Bacteria 48383
588 Ga0207641_10123666 3300026088 Bacteria 2313
589 Ga0207641_10398451 3300026088 Bacteria 1321
590 Ga0207641_10680232 3300026088 Bacteria 1012
591 Ga0207648_10005720 3300026089 Bacteria 12456
592 Ga0207648_10153745 3300026089 Bacteria 2030
593 Ga0207648_10775222 3300026089 Bacteria 892
594 Ga0207676_10117832 3300026095 Bacteria 2234
595 Ga0207676_10459462 3300026095 Bacteria 1202
596 Ga0207676_10678522 3300026095 Bacteria 996
597 Ga0207674_10005663 3300026116 Bacteria 14810
598 Ga0207674_10028619 3300026116 Bacteria 5877
599 Ga0207674_10410771 3300026116 Bacteria 1308
600 Ga0207675_100227927 3300026118 Bacteria 1797
601 Ga0207675_100270439 3300026118 Bacteria 1649
602 Ga0207675_101952073 3300026118 Unclassified 605
603 Ga0207683_10075353 3300026121 Bacteria 2986
604 Ga0207683_10106248 3300026121 Bacteria 2510
605 Ga0207683_10123090 3300026121 Bacteria 2330
606 Ga0207683_10240028 3300026121 Bacteria 1653
607 Ga0207683_10466242 3300026121 Bacteria 1165
608 Ga0207683_10569956 3300026121 Bacteria 1047
609 Ga0207683_11386669 3300026121 Bacteria 650
610 Ga0207698_10551285 3300026142 Bacteria 1130
611 Ga0207698_11115467 3300026142 Bacteria 802
612 Ga0209982_1036566 3300027552 Unclassified 779
613 Ga0210002_1028495 3300027617 Bacteria 922
614 Ga0209971_1037117 3300027682 Bacteria 1172
615 Ga0209971_1073564 3300027682 Bacteria 830
616 Ga0209998_10095223 3300027717 Unclassified 733
617 Ga0209813_10083190 3300027866 Bacteria 1062
618 Ga0209813_10104050 3300027866 Unclassified 970
619 Ga0209974_10165150 3300027876 Unclassified 805
620 Ga0207428_10000251 3300027907 Bacteria 73186
621 Ga0207428_10075710 3300027907 Bacteria 2637
622 Ga0207428_10092857 3300027907 Bacteria 2342
623 Ga0207428_10155431 3300027907 Unclassified 1740
624 Ga0207428_10162113 3300027907 Bacteria 1697
625 Ga0207428_10357578 3300027907 Bacteria 1074
626 Ga0268266_10026474 3300028379 Bacteria 4935
627 Ga0268266_10026899 3300028379 Bacteria 4894
628 Ga0268266_10163585 3300028379 Bacteria 2015
629 Ga0268265_10008553 3300028380 Bacteria 6918
630 Ga0268265_10126163 3300028380 Bacteria 2118
631 Ga0268265_10335244 3300028380 Bacteria 1375
632 Ga0268265_10628512 3300028380 Unclassified 1030
633 Ga0268265_11086257 3300028380 Bacteria 794
634 Ga0268264_10038634 3300028381 Bacteria 3940
635 Ga0268264_10190244 3300028381 Bacteria 1870
636 Ga0268264_10195551 3300028381 Bacteria 1846
637 Ga0268264_10257928 3300028381 Bacteria 1623
638 Ga0268264_10344674 3300028381 Bacteria 1416
639 Ga0268264_11030756 3300028381 Unclassified 830
640 Ga0268264_11685999 3300028381 Unclassified 644
641 Ga0268264_11899662 3300028381 Bacteria 605
642 Ga0268264_12102990 3300028381 Bacteria 573
643 Ga0307513_10938030 3300031456 Bacteria 574
644 Ga0307408_100014989 3300031548 Bacteria 5158
645 Ga0307408_100054214 3300031548 Bacteria 2898
646 Ga0307408_100328287 3300031548 Bacteria 1291
647 Ga0307408_100599296 3300031548 Bacteria 979
648 Ga0307408_100820095 3300031548 Unclassified 846
649 Ga0307405_10103281 3300031731 Bacteria 1916
650 Ga0307405_10161242 3300031731 Bacteria 1589
651 Ga0307405_10203906 3300031731 Bacteria 1438
652 Ga0307405_10878168 3300031731 Bacteria 757
653 Ga0307413_10026826 3300031824 Bacteria 3181
654 Ga0307413_10231542 3300031824 Bacteria 1357
655 Ga0307413_10418495 3300031824 Bacteria 1055
656 Ga0307410_10015632 3300031852 Bacteria 4507
657 Ga0307410_10021278 3300031852 Bacteria 3986
658 Ga0307406_10051064 3300031901 Bacteria 2624
659 Ga0307406_10434249 3300031901 Bacteria 1049
660 Ga0307406_10436210 3300031901 Bacteria 1047
661 Ga0307407_10216542 3300031903 Bacteria 1292
662 Ga0307407_10218532 3300031903 Bacteria 1287
663 Ga0307412_10052749 3300031911 Bacteria 2694
664 Ga0307412_10634748 3300031911 Bacteria 909
665 Ga0307412_10681398 3300031911 Bacteria 880
666 Ga0307412_10879193 3300031911 Bacteria 784
667 Ga0307412_11256097 3300031911 Bacteria 665
668 Ga0307409_100191125 3300031995 Bacteria 1822
669 Ga0307409_102211362 3300031995 Unclassified 579
670 Ga0307409_102757670 3300031995 Bacteria 519
671 Ga0307416_100010427 3300032002 Bacteria 6135
672 Ga0307416_100084366 3300032002 Bacteria 2699
673 Ga0307414_10042484 3300032004 Bacteria 3089
674 Ga0307414_10843542 3300032004 Bacteria 838
675 Ga0307414_11487475 3300032004 Bacteria 630
676 Ga0307411_10109785 3300032005 Bacteria 1971
677 Ga0307411_10303431 3300032005 Bacteria 1281
678 Ga0307411_10540863 3300032005 Bacteria 992
679 Ga0307411_11776844 3300032005 Bacteria 572
680 Ga0307415_100014486 3300032126 Bacteria 4638
681 Ga0307415_100404630 3300032126 Bacteria 1166
682 Ga0373959_0042992 3300034820 Bacteria 954
683 Ga0373951_0219771 3300035091 Unclassified 560
684 Ga0373923_0249973 3300035111 Bacteria 830
685 Ga0373932_0088487 3300035112 Bacteria 990
686 Ga0373932_0239273 3300035112 Bacteria 659
687 Ga0373945_0044341 3300035116 Bacteria 1617
688 Ga0373945_0053564 3300035116 Bacteria 1490
689 Ga0373945_0441240 3300035116 Bacteria 575
690 Ga0373943_0286882 3300035170 Bacteria 932
691 Ga0373943_0486687 3300035170 Bacteria 720
692 Ga0373962_0177365 3300035242 Unclassified 711
693 Ga0373962_0207369 3300035242 Unclassified 666
694 Ga0373935_0168620 3300035692 Bacteria 1496
695 Ga0373935_0334542 3300035692 Bacteria 1077
696 Ga0373935_0482393 3300035692 Bacteria 898
697 Ga0373933_0070506 3300035724 Bacteria 2126
698 Ga0373933_0244894 3300035724 Unclassified 1154
699 Ga0373933_0465146 3300035724 Bacteria 828
700 Ga0373947_0045626 3300035725 Bacteria 2623
701 Ga0373947_0486045 3300035725 Bacteria 838
702 Ga0373937_0000242 3300036401 Bacteria 53400
703 Ga0373937_1320060 3300036401 Bacteria 669
704 Ga0373937_1444980 3300036401 Unclassified 635
705 Ga0373937_1473357 3300036401 Unclassified 628
706 Ga0373925_0599361 3300037068 Bacteria 907
707 Ga0373925_1332456 3300037068 Unclassified 589
708 Ga0395905_0409249 3300037471 Bacteria 1252
709 Ga0436365_0384702 3300039437 Bacteria 3211
710 Ga0451800_1601123 3300041459 Bacteria 657
711 Ga0451807_1313738 3300041486 Bacteria 866
712 Ga0451853_0422307 3300041512 Bacteria 546
713 Ga0451853_1194632 3300041512 Bacteria 688
714 Ga0451853_2373166 3300041512 Bacteria 594
715 Ga0451853_2555440 3300041512 Unclassified 701
716 Ga0439437_032572 3300042000 Bacteria 659
717 Ga0439445_0197436 3300042004 Bacteria 594
718 Ga0439449_0198954 3300042007 Bacteria 750
719 Ga0439450_032151 3300042008 Bacteria 1184
720 Ga0439462_0077183 3300042015 Bacteria 908
721 Ga0450920_006545 3300042122 Bacteria 2099
722 Ga0450892_026003 3300042130 Bacteria 596
723 Ga0450896_039783 3300042133 Bacteria 730
724 Ga0450905_034493 3300042142 Unclassified 790
725 Ga0439446_0023581 3300042156 Bacteria 1752
726 Ga0439446_0058411 3300042156 Bacteria 1163
727 Ga0439446_0216736 3300042156 Bacteria 651
728 Ga0450908_002755 3300042184 Bacteria 3432
729 Ga0439434_0036037 3300042435 Bacteria 1513
730 Ga0439435_0000595 3300042436 Bacteria 5861
731 Ga0439435_0032865 3300042436 Bacteria 1417
732 Ga0439435_0086290 3300042436 Bacteria 948
733 Ga0439464_0003160 3300042439 Bacteria 4132
734 Ga0439460_0012706 3300042461 Bacteria 2190
735 Ga0450918_014085 3300042531 Bacteria 1390
736 Ga0451577_0577228 3300042876 Bacteria 1021
737 Ga0439440_0258845 3300042993 Bacteria 532
738 Ga0466963_0139246 3300044694 Bacteria 1680
739 Ga0466957_0865598 3300044842 Bacteria 645
740 Ga0466958_0228069 3300045836 Bacteria 1189
741 Ga0495629_0593879 3300046459 Unclassified 741
742 Ga0495638_0005770 3300046460 Bacteria 9117
743 Ga0495638_0009220 3300046460 Bacteria 6938
744 Ga0495641_0490426 3300046461 Bacteria 560
745 Ga0495582_0229090 3300046473 Bacteria 1064
746 Ga0495639_0072573 3300046475 Bacteria 1592
747 Ga0495628_0277678 3300046516 Bacteria 1245
748 Ga0495652_0334921 3300046529 Bacteria 1089
749 Ga0495640_0505483 3300046533 Unclassified 735
750 Ga0495586_0606870 3300046535 Unclassified 632
751 Ga0495621_0301450 3300046539 Bacteria 664
752 Ga0495621_0383964 3300046539 Bacteria 594
753 Ga0495667_0504293 3300046559 Bacteria 758
754 Ga0495634_0357513 3300046642 Bacteria 873
755 Ga0495647_0278805 3300046681 Bacteria 749
756 Ga0495658_0008309 3300046683 Bacteria 5144
757 Ga0495658_0046824 3300046683 Bacteria 2433
758 Ga0495674_0148572 3300047319 Bacteria 1966
759 Ga0495674_0374516 3300047319 Bacteria 1153
760 Ga0495593_0249785 3300047673 Bacteria 888
761 Ga0495602_0395221 3300048088 Bacteria 987
762 Ga0496100_0140924 3300048903 Bacteria 1709
763 Ga0496100_0283485 3300048903 Bacteria 1236
764 Ga0496100_0316852 3300048903 Bacteria 1171
765 Ga0496100_0615766 3300048903 Bacteria 844
766 Ga0496101_1478021 3300048904 Unclassified 529
767 Ga0496102_0009219 3300048905 Bacteria 8470
768 Ga0496102_0346524 3300048905 Bacteria 1399
769 Ga0496102_0548370 3300048905 Unclassified 1079
770 Ga0496102_0724179 3300048905 Unclassified 918
771 Ga0496103_0022284 3300048906 Bacteria 3814
772 Ga0496104_0013022 3300048907 Bacteria 7490
773 Ga0496105_0021098 3300048908 Bacteria 5268
774 Ga0496105_0109874 3300048908 Bacteria 2276
775 Ga0496105_0422358 3300048908 Bacteria 1055
776 Ga0496105_0583129 3300048908 Bacteria 870
777 Ga0496105_0601774 3300048908 Bacteria 853
778 Ga0496106_0052526 3300048909 Bacteria 3075
779 Ga0496106_0336121 3300048909 Bacteria 1213
780 Ga0496106_0405283 3300048909 Bacteria 1096
781 Ga0496106_0595162 3300048909 Bacteria 886
782 Ga0496106_1302292 3300048909 Bacteria 564
783 Ga0496107_0102575 3300048910 Bacteria 2098
784 Ga0496107_0725285 3300048910 Bacteria 730
785 Ga0496108_0090161 3300048911 Bacteria 2606
786 Ga0496108_0211857 3300048911 Bacteria 1682
787 Ga0496109_0000421 3300048912 Bacteria 37279
788 Ga0496109_0154792 3300048912 Bacteria 2147
789 Ga0496109_0393830 3300048912 Bacteria 1309
790 Ga0496109_0397940 3300048912 Bacteria 1301
791 Ga0496109_0564880 3300048912 Bacteria 1073
792 Ga0496109_0576682 3300048912 Bacteria 1060
793 Ga0496109_1615821 3300048912 Unclassified 582
794 Ga0496110_0019957 3300048913 Bacteria 5650
795 Ga0496110_0491016 3300048913 Bacteria 1118
796 Ga0496111_0666033 3300048914 Bacteria 759
797 Ga0496112_0001306 3300048915 Bacteria 18933
798 Ga0496112_0118214 3300048915 Bacteria 2621
799 Ga0496112_0220737 3300048915 Bacteria 1852
800 Ga0496112_0388603 3300048915 Bacteria 1336
801 Ga0496112_1595163 3300048915 Bacteria 566
802 Ga0496113_0065401 3300048916 Bacteria 2752
803 Ga0496113_0121910 3300048916 Bacteria 2039
804 Ga0496113_0513633 3300048916 Bacteria 962
805 Ga0496114_0783305 3300048917 Unclassified 832
806 Ga0496114_1014470 3300048917 Unclassified 713
807 Ga0501309_019626 3300049129 Bacteria 942
808 Ga0501305_069728 3300049161 Bacteria 617
809 Ga0501291_050615 3300049514 Bacteria 756
810 Ga0501311_075250 3300049527 Bacteria 566
811 Ga0501312_087815 3300049528 Bacteria 570
812 Ga0501316_040337 3300049532 Bacteria 649
813 Ga0501318_048795 3300049534 Bacteria 624
814 Ga0501323_037442 3300049539 Bacteria 701
815 Ga0501031_0512847 3300049568 Bacteria 773
816 Ga0501033_0631359 3300049570 Bacteria 733
817 Ga0501034_0001239 3300049571 Bacteria 34664
818 Ga0501036_0137736 3300049572 Bacteria 2060
819 Ga0501036_0142366 3300049572 Bacteria 2023
820 Ga0501036_0175013 3300049572 Bacteria 1807
821 Ga0501036_0249091 3300049572 Bacteria 1489
822 Ga0501037_0236037 3300049573 Bacteria 1283
823 Ga0501037_0794999 3300049573 Bacteria 625
824 Ga0501039_0091865 3300049575 Bacteria 2366
825 Ga0501039_0135965 3300049575 Unclassified 1930
826 Ga0501039_0211948 3300049575 Bacteria 1523
827 Ga0501039_0386872 3300049575 Bacteria 1099
828 Ga0501040_0064864 3300049576 Bacteria 2515
829 Ga0501040_0147581 3300049576 Bacteria 1658
830 Ga0501040_0184567 3300049576 Unclassified 1479
831 Ga0501040_0648281 3300049576 Unclassified 763
832 Ga0501041_0025274 3300049577 Bacteria 3570
833 Ga0501041_0119725 3300049577 Bacteria 1636
834 Ga0501041_0152958 3300049577 Bacteria 1441
835 Ga0501041_0627849 3300049577 Bacteria 686
836 Ga0501043_0458214 3300049579 Bacteria 957
837 Ga0501046_0149282 3300049580 Bacteria 1764
838 Ga0501068_0133232 3300049584 Bacteria 1555
839 Ga0501068_0795841 3300049584 Bacteria 620
840 Ga0501069_0714796 3300049585 Unclassified 605
841 Ga0501070_0531177 3300049586 Bacteria 943
842 Ga0501071_0004760 3300049587 Bacteria 8641
843 Ga0501071_0068065 3300049587 Bacteria 2591
844 Ga0501071_0146789 3300049587 Bacteria 1758
845 Ga0501072_0009092 3300049588 Bacteria 7544
846 Ga0501072_0018518 3300049588 Bacteria 5365
847 Ga0501072_0045430 3300049588 Bacteria 3454
848 Ga0501072_0048329 3300049588 Bacteria 3350
849 Ga0501072_0049602 3300049588 Bacteria 3305
850 Ga0501072_0685474 3300049588 Bacteria 806
851 Ga0501074_0041057 3300049590 Bacteria 3350
852 Ga0501074_0063724 3300049590 Bacteria 2655
853 Ga0501075_0036134 3300049591 Bacteria 3687
854 Ga0501075_0165807 3300049591 Bacteria 1685
855 Ga0501075_0192490 3300049591 Bacteria 1555
856 Ga0501075_0345804 3300049591 Unclassified 1133
857 Ga0501075_1035513 3300049591 Unclassified 623
858 Ga0501076_0045215 3300049592 Bacteria 3476
859 Ga0501076_0128638 3300049592 Bacteria 2053
860 Ga0501207_094765 3300049654 Bacteria 592
861 Ga0501228_028514 3300049666 Unclassified 672
862 Ga0501239_019518 3300049672 Bacteria 822
863 Ga0501243_058462 3300049675 Unclassified 710
864 Ga0501079_0036201 3300049741 Bacteria 3802
865 Ga0501079_0526259 3300049741 Bacteria 930
866 Ga0501079_0565976 3300049741 Bacteria 894
867 Ga0501079_1025667 3300049741 Unclassified 650
868 Ga0501080_0546278 3300049742 Bacteria 1032
869 Ga0501080_0668751 3300049742 Bacteria 918
870 Ga0501081_0031159 3300049743 Bacteria 3614
871 Ga0501081_0093891 3300049743 Bacteria 2113
872 Ga0501083_0370169 3300049744 Bacteria 932
873 Ga0501268_078186 3300049765 Bacteria 679
874 Ga0501283_037896 3300049779 Bacteria 827
875 Ga0501045_0003131 3300049824 Bacteria 11313
876 Ga0501045_0008690 3300049824 Bacteria 7083
877 Ga0501045_0075027 3300049824 Bacteria 2490
878 Ga0501045_0163397 3300049824 Bacteria 1658
879 Ga0501045_0207118 3300049824 Bacteria 1461
880 Ga0501045_0306781 3300049824 Bacteria 1181
881 Ga0501212_053852 3300049851 Bacteria 686
882 nmdc:mga03683_4092_c1 3300050489 Bacteria 4792
883 nmdc:mga03n38_452938_c1 3300050490 Bacteria 714
884 nmdc:mga00v17_211815_c1 3300050491 Bacteria 1254
885 nmdc:mga00v17_3860_c1 3300050491 Bacteria 7732
886 nmdc:mga00v17_3971_c1 3300050491 Bacteria 7631
887 nmdc:mga00v17_621389_c1 3300050491 Unclassified 696
888 nmdc:mga00v17_96841_c1 3300050491 Bacteria 1859
889 nmdc:mga0yw44_199854_c1 3300050492 Bacteria 1320
890 nmdc:mga0yw44_66404_c1 3300050492 Bacteria 2226
891 nmdc:mga0yw44_75158_c1 3300050492 Bacteria 2106
892 nmdc:mga0k408_106177_c1 3300050493 Bacteria 1659
893 nmdc:mga0k408_115504_c1 3300050493 Bacteria 1588
894 nmdc:mga0k408_213329_c1 3300050493 Bacteria 1153
895 nmdc:mga0k408_6227_c1 3300050493 Bacteria 6364
896 nmdc:mga0k408_85968_c1 3300050493 Bacteria 1846
897 nmdc:mga0k408_90605_c1 3300050493 Bacteria 1796
898 nmdc:mga06z11_12139_c1 3300050494 Bacteria 3738
899 nmdc:mga06z11_45548_c1 3300050494 Bacteria 2218
900 nmdc:mga06z11_49110_c1 3300050494 Bacteria 2151
901 nmdc:mga06z11_4966_c1 3300050494 Bacteria 5282
902 nmdc:mga06z11_74792_c1 3300050494 Bacteria 1802
903 nmdc:mga06z11_8610_c1 3300050494 Bacteria 4265
904 nmdc:mga04h51_62165_c1 3300050495 Bacteria 1283
905 nmdc:mga04h51_66163_c1 3300050495 Bacteria 1251
906 nmdc:mga07m45_104346_c1 3300050496 Bacteria 1630
907 nmdc:mga07m45_318839_c1 3300050496 Bacteria 903
908 nmdc:mga05p37_11992_c1 3300050507 Bacteria 10342
909 nmdc:mga05p37_158_c1 3300050507 Bacteria 65027
910 nmdc:mga05p37_221_c1 3300050507 Bacteria 57542
911 nmdc:mga05p37_24608_c1 3300050507 Bacteria 7319
912 nmdc:mga05p37_25173_c1 3300050507 Bacteria 7237
913 nmdc:mga05p37_72094_c1 3300050507 Bacteria 4250
914 nmdc:mga05p37_72672_c1 3300050507 Bacteria 4233
915 nmdc:mga05p37_95854_c1 3300050507 Bacteria 3655
916 nmdc:mga09592_4212_c1 3300050508 Bacteria 11618
917 nmdc:mga09592_7728_c1 3300050508 Bacteria 8741
918 nmdc:mga0qj67_1071755_c1 3300050509 Unclassified 630
919 nmdc:mga0qj67_56920_c1 3300050509 Bacteria 3100
920 nmdc:mga0qj67_6228_c1 3300050509 Bacteria 8759
921 nmdc:mga06r32_129964_c1 3300050510 Bacteria 2490
922 nmdc:mga06r32_154724_c1 3300050510 Bacteria 2273
923 nmdc:mga06r32_654_c1 3300050510 Bacteria 30275
924 nmdc:mga06r32_772187_c1 3300050510 Bacteria 923
925 nmdc:mga06r32_9845_c1 3300050510 Bacteria 8625
926 nmdc:mga08y16_12331_c1 3300050511 Bacteria 8988
927 nmdc:mga08y16_14583_c1 3300050511 Bacteria 8266
928 nmdc:mga08y16_14770_c1 3300050511 Bacteria 8211
929 nmdc:mga08y16_390548_c1 3300050511 Bacteria 1426
930 nmdc:mga08y16_464_c1 3300050511 Bacteria 37766
931 nmdc:mga08y16_591751_c1 3300050511 Bacteria 1119
932 nmdc:mga08y16_677894_c1 3300050511 Bacteria 1033
933 nmdc:mga0n895_128280_c1 3300050512 Bacteria 2561
934 nmdc:mga0n895_196707_c1 3300050512 Bacteria 2047
935 nmdc:mga0n895_2179231_c1 3300050512 Bacteria 510
936 nmdc:mga0n895_376782_c1 3300050512 Bacteria 1436
937 nmdc:mga0n895_415635_c1 3300050512 Bacteria 1360
938 nmdc:mga0n895_43927_c1 3300050512 Bacteria 4358
939 nmdc:mga0n895_690918_c1 3300050512 Bacteria 1017
940 nmdc:mga0n895_785823_c1 3300050512 Bacteria 943
941 nmdc:mga0rr50_11146_c1 3300050513 Bacteria 5737
942 nmdc:mga0rr50_278431_c1 3300050513 Bacteria 1396
943 nmdc:mga0rr50_315716_c1 3300050513 Bacteria 1309
944 nmdc:mga0rr50_557528_c1 3300050513 Unclassified 976
945 nmdc:mga0rr50_91586_c1 3300050513 Bacteria 2369
946 nmdc:mga08x19_14326_c1 3300050514 Bacteria 4810
947 nmdc:mga08x19_526437_c1 3300050514 Bacteria 836
948 nmdc:mga08x19_825278_c1 3300050514 Bacteria 659
949 nmdc:mga08x19_9509_c1 3300050514 Bacteria 5821
950 nmdc:mga0a205_325342_c1 3300050515 Bacteria 1408
951 nmdc:mga0a205_44429_c1 3300050515 Bacteria 4283
952 nmdc:mga0a205_44975_c1 3300050515 Bacteria 4258
953 nmdc:mga0a205_54083_c1 3300050515 Bacteria 3876
954 nmdc:mga0a205_96252_c1 3300050515 Bacteria 2859
955 Ga0495601_0611592 3300053077 Bacteria 699
956 Ga0495601_1047018 3300053077 Unclassified 512
957 Ga0495619_0022983 3300053085 Bacteria 3993
958 Ga0495619_0111505 3300053085 Bacteria 1870
959 Ga0495619_0259293 3300053085 Bacteria 1205
960 Ga0500555_000812 3300053103 Bacteria 11232
961 Ga0500628_019232 3300053129 Bacteria 1357
962 Ga0500628_087120 3300053129 Bacteria 808
963 Ga0500616_0000066 3300053153 Bacteria 237304
964 Ga0500645_001676 3300053730 Bacteria 10853
965 Ga0501084_0013516 3300054114 Bacteria 6756
966 Ga0501084_0068796 3300054114 Bacteria 2964
967 Ga0501084_0237735 3300054114 Bacteria 1538
968 Ga0501084_0505137 3300054114 Bacteria 1022
969 Ga0501084_1310143 3300054114 Bacteria 607
970 Ga0590071_002020 3300059421 Bacteria 5188
971 Ga0590074_000424 3300059423 Bacteria 6101
972 Ga0590075_006390 3300059424 Bacteria 2795
973 Ga0590077_000281 3300059426 Bacteria 14428
974 Ga0587091_146096 3300059511 Bacteria 596
975 Ga0587098_033744 3300059604 Unclassified 716
976 Ga0587099_019353 3300059622 Unclassified 758
977 Ga0587079_015057 3300059647 Bacteria 1308
978 Ga0587114_002608 3300059655 Bacteria 1700
979 Ga0587071_050070 3300060344 Bacteria 862
980 Ga0501082_0141138 3300060353 Bacteria 2091
981 Ga0501082_0316177 3300060353 Bacteria 1360
982 Ga0501082_0486584 3300060353 Unclassified 1078
983 Ga0501082_0680516 3300060353 Bacteria 900
984 Ga0501082_0841459 3300060353 Bacteria 803
985 Ga0501082_1783771 3300060353 Unclassified 537
986 Ga0530510_0023331 3300061734 Bacteria 4408
987 Ga0530510_0386216 3300061734 Bacteria 1054
988 Ga0070680_100187029
989 Ga0058859_11731982
990 Ga0058860_11966351
991 Ga0058860_11994763
992 Ga0058862_11735751
993 Ga0065714_10118181
994 Ga0065714_10458780
995 Ga0065704_10013904
996 Ga0065712_10007127
997 Ga0065712_10129193
998 Ga0065712_10209444
999 Ga0065712_10222346
1000 Ga0065715_10004746
1001 Ga0065715_10089936
1002 Ga0065715_10095575
1003 Ga0065715_10103317
1004 Ga0065715_10366276
1005 Ga0065707_10040179
1006 Ga0065707_10123128
1007 Ga0065707_10198936
1008 Ga0065707_10486292
1009 Ga0065707_10583818
1010 Ga0070676_10080445
1011 Ga0070676_10253456
1012 Ga0070683_100003796
1013 Ga0070683_100013028
1014 Ga0070683_100157673
1015 Ga0070690_100253535
1016 Ga0070690_100801100
1017 Ga0070670_100001073
1018 Ga0070670_100046452
1019 Ga0070670_100051657
1020 Ga0070670_100142970
1021 Ga0070670_100155642
1022 Ga0070670_100315239
1023 Ga0070677_10061624
1024 Ga0070677_10065574
1025 Ga0070677_10793872
1026 Ga0068869_100085766
1027 Ga0068869_100192208
1028 Ga0068869_100469877
1029 Ga0070666_10030942
1030 Ga0070666_10193516
1031 Ga0070666_11040754
1032 Ga0070682_100132809
1033 Ga0070682_100154148
1034 Ga0068868_100021547
1035 Ga0068868_101414188
1036 Ga0070660_100022338
1037 Ga0070660_100080678
1038 Ga0070689_100039349
1039 Ga0070689_100095876
1040 Ga0070689_100239577
1041 Ga0070689_101079155
1042 Ga0070689_101377756
1043 Ga0070687_100088175
1044 Ga0070687_100754855
1045 Ga0070687_100784144
1046 Ga0070661_100059710
1047 Ga0070661_100379782
1048 Ga0070661_100468643
1049 Ga0070668_100451868
1050 Ga0070668_100732433
1051 Ga0070669_100003506
1052 Ga0070669_100034288
1053 Ga0070669_100075451
1054 Ga0070669_100116057
1055 Ga0070675_100296158
1056 Ga0070675_100722677
1057 Ga0070675_101359115
1058 Ga0070671_100008709
1059 Ga0070671_100017222
1060 Ga0070671_100029357
1061 Ga0070671_100235848
1062 Ga0070674_100002314
1063 Ga0070674_100058006
1064 Ga0070674_100373898
1065 Ga0070674_100416276
1066 Ga0070674_100702457
1067 Ga0070674_100738473
1068 Ga0070674_100960402
1069 Ga0070673_100019968
1070 Ga0070673_100077835
1071 Ga0070673_100099192
1072 Ga0070673_100123549
1073 Ga0070673_100433577
1074 Ga0070673_101285358
1075 Ga0070688_100021140
1076 Ga0070688_100142728
1077 Ga0070688_100363235
1078 Ga0070688_101520846
1079 Ga0070659_100045405
1080 Ga0070659_100187389
1081 Ga0070659_100200424
1082 Ga0070659_100210187
1083 Ga0070667_100047697
1084 Ga0070667_100165797
1085 Ga0070709_10430728
1086 Ga0070701_10037508
1087 Ga0070701_10074979
1088 Ga0070701_10358499
1089 Ga0070705_100040941
1090 Ga0070700_100054295
1091 Ga0070700_100106643
1092 Ga0070700_100247661
1093 Ga0070700_100289091
1094 Ga0070700_100777137
1095 Ga0070694_100075096
1096 Ga0070694_100280300
1097 Ga0070708_100635759
1098 Ga0070663_100026811
1099 Ga0070663_100045532
1100 Ga0070663_100296982
1101 Ga0070663_101636789
1102 Ga0070678_100092324
1103 Ga0070678_100155832
1104 Ga0070678_100582460
1105 Ga0070678_100601123
1106 Ga0070678_100723203
1107 Ga0070662_100309743
1108 Ga0070662_100403931
1109 Ga0070662_100843520
1110 Ga0070681_10014055
1111 Ga0070681_10657281
1112 Ga0068867_100010339
1113 Ga0068867_101225500
1114 Ga0070685_10112692
1115 Ga0070685_10358060
1116 Ga0070706_100028003
1117 Ga0070706_100469996
1118 Ga0070707_100160179
1119 Ga0070707_100860611
1120 Ga0070707_101337124
1121 Ga0070698_100052927
1122 Ga0070698_100231953
1123 Ga0070698_100821627
1124 Ga0070699_100444365
1125 Ga0070699_100533225
1126 Ga0070699_100557962
1127 Ga0070679_100051177
1128 Ga0070679_100952528
1129 Ga0070684_100002103
1130 Ga0070684_100074004
1131 Ga0070684_100649378
1132 Ga0070684_101930620
1133 Ga0070697_100622591
1134 Ga0070697_100889432
1135 Ga0068853_100334990
1136 Ga0070672_100009755
1137 Ga0070672_100061006
1138 Ga0070672_100067203
1139 Ga0070672_100072821
1140 Ga0070672_100084896
1141 Ga0070672_100241485
1142 Ga0070672_100653963
1143 Ga0070686_100028825
1144 Ga0070686_100086557
1145 Ga0070686_100110453
1146 Ga0070686_100190785
1147 Ga0070686_100216760
1148 Ga0070686_100265100
1149 Ga0070695_100013286
1150 Ga0070695_100380192
1151 Ga0070695_100941398
1152 Ga0070696_100481087
1153 Ga0070696_100595911
1154 Ga0070696_100787065
1155 Ga0070693_100058780
1156 Ga0070665_100042019
1157 Ga0070665_100061590
1158 Ga0070665_100086619
1159 Ga0070665_100129577
1160 Ga0070665_100173970
1161 Ga0070665_100449733
1162 Ga0070665_101907187
1163 Ga0070704_100034673
1164 Ga0070704_101048515
1165 Ga0068855_100017318
1166 Ga0068855_101041513
1167 Ga0068855_101054566
1168 Ga0070664_100007179
1169 Ga0070664_100184476
1170 Ga0070664_100279788
1171 Ga0070664_100479969
1172 Ga0070664_100491639
1173 Ga0070664_100516836
1174 Ga0070664_100914188
1175 Ga0068857_100002325
1176 Ga0068857_100010417
1177 Ga0068857_100666176
1178 Ga0068857_101139585
1179 Ga0068854_100474532
1180 Ga0068854_100478136
1181 Ga0068854_100783535
1182 Ga0070702_100764233
1183 Ga0068852_100727101
1184 Ga0068852_102506153
1185 Ga0068859_100002294
1186 Ga0068859_100149440
1187 Ga0068859_100242506
1188 Ga0068859_100272286
1189 Ga0068859_100350678
1190 Ga0068859_100457196
1191 Ga0068859_101107078
1192 Ga0068859_101418715
1193 Ga0068864_100013376
1194 Ga0068864_100459932
1195 Ga0068864_100652894
1196 Ga0068864_100727329
1197 Ga0068864_101652216
1198 Ga0068864_101915098
1199 Ga0068866_10392327
1200 Ga0068861_101182588
1201 Ga0068861_101441216
1202 Ga0068863_100001594
1203 Ga0068863_100632847
1204 Ga0068858_100003439
1205 Ga0068858_100070668
1206 Ga0068858_100133834
1207 Ga0068858_100162422
1208 Ga0068858_100366752
1209 Ga0068858_100589317
1210 Ga0068858_101045867
1211 Ga0068860_100013508
1212 Ga0068860_100220965
1213 Ga0068860_100231197
1214 Ga0068860_100606046
1215 Ga0068860_101145284
1216 Ga0068860_101504994
1217 Ga0068862_100066631
1218 Ga0068862_100076347
1219 Ga0068862_100093423
1220 Ga0068862_100340433
1221 Ga0068862_100377788
1222 Ga0068862_100446551
1223 Ga0081455_10028442
1224 Ga0081539_10153786
1225 Ga0070717_10062924
1226 Ga0075365_10035910
1227 Ga0075365_10072101
1228 Ga0075365_10073418
1229 Ga0075365_10241464
1230 Ga0075365_10621642
1231 Ga0075368_10016677
1232 Ga0075368_10026385
1233 Ga0075368_10044702
1234 Ga0075363_100020142
1235 Ga0075363_100126230
1236 Ga0075364_10002444
1237 Ga0075364_10029834
1238 Ga0075364_10039690
1239 Ga0075364_10244313
1240 Ga0075364_10351083
1241 Ga0070715_10494078
1242 Ga0070715_10740380
1243 Ga0070716_100050992
1244 Ga0070716_101170592
1245 Ga0075362_10001840
1246 Ga0075362_10274291
1247 Ga0075367_10003718
1248 Ga0075367_10020613
1249 Ga0075367_10132236
1250 Ga0075367_10236979
1251 Ga0075369_10476537
1252 Ga0075366_10021130
1253 Ga0075366_10139289
1254 Ga0075366_10154588
1255 Ga0075370_10002749
1256 Ga0075370_10019572
1257 Ga0075370_10049477
1258 Ga0075370_10258246
1259 Ga0068871_100078946
1260 Ga0068871_100204400
1261 Ga0068871_101488200
1262 Ga0075428_100000086
1263 Ga0075428_100147332
1264 Ga0075428_100467020
1265 Ga0075428_101305724
1266 Ga0075430_100000028
1267 Ga0075430_100050759
1268 Ga0075431_100002556
1269 Ga0075431_100159547
1270 Ga0075431_100185223
1271 Ga0075431_100887089
1272 Ga0075433_10018891
1273 Ga0075433_10104953
1274 Ga0075433_10145020
1275 Ga0075433_10267373
1276 Ga0075434_100007002
1277 Ga0075434_100033292
1278 Ga0075434_100099686
1279 Ga0075434_100188995
1280 Ga0075434_100216817
1281 Ga0075434_100693888
1282 Ga0075434_101767451
1283 Ga0075429_100015445
1284 Ga0075429_100020933
1285 Ga0068865_100021449
1286 Ga0068865_101205844
1287 Ga0068865_101319780
1288 Ga0075436_100052691
1289 Ga0075436_100267281
1290 Ga0075436_100425595
1291 Ga0097620_100002294
1292 Ga0097620_100149436
1293 Ga0097620_100242513
1294 Ga0097620_100272286
1295 Ga0097620_100350656
1296 Ga0097620_100457216
1297 Ga0097620_101107334
1298 Ga0097620_101418749
1299 Ga0075435_100002170
1300 Ga0075435_100003388
1301 Ga0075435_100153273
1302 Ga0075435_100574978
1303 Ga0105240_10120545
1304 Ga0105240_10189656
1305 Ga0105240_11957434
1306 Ga0111539_10000166
1307 Ga0111539_10002576
1308 Ga0111539_10004018
1309 Ga0111539_10185798
1310 Ga0111539_10880010
1311 Ga0111539_11608085
1312 Ga0111539_12512761
1313 Ga0105245_10028234
1314 Ga0105245_10200392
1315 Ga0105245_11033658
1316 Ga0105247_10055811
1317 Ga0105247_10064187
1318 Ga0105247_10246730
1319 Ga0114129_10000148
1320 Ga0114129_10000358
1321 Ga0114129_10002946
1322 Ga0114129_10006068
1323 Ga0114129_10014154
1324 Ga0114129_10040079
1325 Ga0114129_10419120
1326 Ga0105243_10262519
1327 Ga0105243_10528805
1328 Ga0105243_10727697
1329 Ga0105243_10833904
1330 Ga0105241_10163490
1331 Ga0105242_10018526
1332 Ga0105242_10115531
1333 Ga0105242_10736244
1334 Ga0105242_11239220
1335 Ga0105248_10013671
1336 Ga0105248_10076090
1337 Ga0105248_10088878
1338 Ga0105248_10150544
1339 Ga0105248_10228041
1340 Ga0105248_10270859
1341 Ga0105248_10311259
1342 Ga0105248_11101684
1343 Ga0105248_11294259
1344 Ga0105248_12060140
1345 Ga0105248_12781123
1346 Ga0105237_10179627
1347 Ga0105238_10135684
1348 Ga0105238_11561879
1349 Ga0105238_12139891
1350 Ga0105249_10001013
1351 Ga0105249_10315647
1352 Ga0105249_10562392
1353 Ga0105249_10629230
1354 Ga0099796_10250611
1355 Ga0105239_10466037
1356 Ga0105239_10738436
1357 Ga0105239_10914970
1358 Ga0105239_12371652
1359 Ga0105246_11343526
1360 Ga0105246_11622907
1361 Ga0157370_10892946
1362 Ga0157374_10328637
1363 Ga0157378_10099251
1364 Ga0157378_10467008
1365 Ga0157378_12287638
1366 Ga0163162_10307341
1367 Ga0163162_10453101
1368 Ga0157375_10314059
1369 Ga0157375_10420869
1370 Ga0157375_10856823
1371 Ga0157375_11323891
1372 Ga0157375_12018442
1373 Ga0157375_13305678
1374 Ga0163163_10051912
1375 Ga0163163_10082704
1376 Ga0163163_10105470
1377 Ga0163163_10708118
1378 Ga0163163_11502758
1379 Ga0163163_12222216
1380 Ga0157380_10498945
1381 Ga0157380_10610457
1382 Ga0157380_10647777
1383 Ga0157380_11115811
1384 Ga0157377_10074656
1385 Ga0157377_10191353
1386 Ga0157379_10084743
1387 Ga0157379_10111874
1388 Ga0157379_10590108
1389 Ga0157379_10907493
1390 Ga0157376_10155190
1391 Ga0157376_10333140
1392 Ga0157376_10347629
1393 Ga0163161_10093031
1394 Ga0163161_10342708
1395 Ga0163161_10394749
1396 Ga0206356_10200085
1397 Ga0206356_11468788
1398 Ga0206349_1777349
1399 Ga0206351_10123141
1400 Ga0206350_10791712
1401 Ga0224712_10059528
1402 Ga0224712_10378210
1403 Ga0207697_10001509
1404 Ga0207653_10121842
1405 Ga0207682_10024623
1406 Ga0207682_10044122
1407 Ga0207642_10153937
1408 Ga0207642_10504247
1409 Ga0207710_10075879
1410 Ga0207710_10264812
1411 Ga0207688_10001938
1412 Ga0207688_10098974
1413 Ga0207688_10265740
1414 Ga0207680_10245020
1415 Ga0207647_10060282
1416 Ga0207647_10300592
1417 Ga0207685_10113187
1418 Ga0207685_10412726
1419 Ga0207699_10396871
1420 Ga0207645_10024800
1421 Ga0207645_10122806
1422 Ga0207645_10333460
1423 Ga0207645_10394113
1424 Ga0207643_10188289
1425 Ga0207705_10522495
1426 Ga0207684_10223191
1427 Ga0207684_10445042
1428 Ga0207684_10727132
1429 Ga0207654_10256687
1430 Ga0207707_10114508
1431 Ga0207695_10378456
1432 Ga0207671_10436319
1433 Ga0207662_10164115
1434 Ga0207662_10245974
1435 Ga0207662_10693352
1436 Ga0207662_10766589
1437 Ga0207657_10000779
1438 Ga0207657_10047849
1439 Ga0207657_10272876
1440 Ga0207649_10536203
1441 Ga0207649_10822803
1442 Ga0207652_10016687
1443 Ga0207652_10070002
1444 Ga0207681_10047381
1445 Ga0207681_10064030
1446 Ga0207681_10658024
1447 Ga0207681_10796352
1448 Ga0207681_11588536
1449 Ga0207694_10921168
1450 Ga0207650_10045723
1451 Ga0207650_10199670
1452 Ga0207650_10219756
1453 Ga0207650_10665692
1454 Ga0207659_10523973
1455 Ga0207659_10703524
1456 Ga0207687_10017556
1457 Ga0207687_10639620
1458 Ga0207700_11041714
1459 Ga0207700_11379010
1460 Ga0207644_10004449
1461 Ga0207644_10047694
1462 Ga0207644_10047715
1463 Ga0207690_10018485
1464 Ga0207690_10024913
1465 Ga0207690_10145797
1466 Ga0207690_10360628
1467 Ga0207706_10098916
1468 Ga0207706_10307324
1469 Ga0207706_10513390
1470 Ga0207706_10611557
1471 Ga0207706_10632371
1472 Ga0207706_10637364
1473 Ga0207706_10982698
1474 Ga0207686_10198675
1475 Ga0207686_10424551
1476 Ga0207686_10470811
1477 Ga0207686_10708078
1478 Ga0207686_11009893
1479 Ga0207709_10095066
1480 Ga0207670_10061323
1481 Ga0207670_10110194
1482 Ga0207670_10436249
1483 Ga0207670_10579362
1484 Ga0207670_11118863
1485 Ga0207670_11323412
1486 Ga0207670_11334813
1487 Ga0207669_10028290
1488 Ga0207669_10038284
1489 Ga0207669_10075226
1490 Ga0207669_10307828
1491 Ga0207669_10308450
1492 Ga0207669_11302742
1493 Ga0207704_10414430
1494 Ga0207704_11167375
1495 Ga0207665_10039643
1496 Ga0207691_10027047
1497 Ga0207691_10080494
1498 Ga0207691_10086446
1499 Ga0207691_10128082
1500 Ga0207691_10129306
1501 Ga0207691_10166207
1502 Ga0207711_10011982
1503 Ga0207711_10043705
1504 Ga0207711_10075501
1505 Ga0207711_10186427
1506 Ga0207711_10242890
1507 Ga0207711_10291705
1508 Ga0207711_10293338
1509 Ga0207711_10467798
1510 Ga0207711_10533050
1511 Ga0207711_10675963
1512 Ga0207689_10063367
1513 Ga0207689_10104437
1514 Ga0207689_10186212
1515 Ga0207689_10278715
1516 Ga0207689_10372973
1517 Ga0207661_10001442
1518 Ga0207661_10008087
1519 Ga0207661_10188648
1520 Ga0207679_10008487
1521 Ga0207679_10062150
1522 Ga0207679_10124370
1523 Ga0207679_10133488
1524 Ga0207679_10221747
1525 Ga0207679_10719607
1526 Ga0207679_10845798
1527 Ga0207679_10845840
1528 Ga0207667_10060522
1529 Ga0207667_10416712
1530 Ga0207667_10617797
1531 Ga0207651_10012231
1532 Ga0207651_10092071
1533 Ga0207651_10156458
1534 Ga0207651_10331072
1535 Ga0207651_11029916
1536 Ga0207651_11288093
1537 Ga0207712_10891215
1538 Ga0207668_10105691
1539 Ga0207668_10224766
1540 Ga0207668_10416605
1541 Ga0207668_10613944
1542 Ga0207640_10200975
1543 Ga0207640_10555555
1544 Ga0207658_10013997
1545 Ga0207658_10145628
1546 Ga0207658_10179324
1547 Ga0207658_10552344
1548 Ga0207677_10014100
1549 Ga0207677_10145964
1550 Ga0207677_10493078
1551 Ga0207677_11073613
1552 Ga0207677_11237068
1553 Ga0207703_10010325
1554 Ga0207703_10092573
1555 Ga0207703_10135760
1556 Ga0207703_10164149
1557 Ga0207703_10170306
1558 Ga0207703_10237222
1559 Ga0207703_10269672
1560 Ga0207703_10457663
1561 Ga0207703_10463954
1562 Ga0207703_10469888
1563 Ga0207703_10927935
1564 Ga0207639_10330158
1565 Ga0207639_11362260
1566 Ga0207678_10074931
1567 Ga0207678_10210500
1568 Ga0207708_10004224
1569 Ga0207708_10159975
1570 Ga0207708_10181924
1571 Ga0207708_10241723
1572 Ga0207708_10787626
1573 Ga0207708_10873839
1574 Ga0207641_10000431
1575 Ga0207641_10123666
1576 Ga0207641_10398451
1577 Ga0207641_10680232
1578 Ga0207648_10005720
1579 Ga0207648_10153745
1580 Ga0207648_10775222
1581 Ga0207676_10117832
1582 Ga0207676_10459462
1583 Ga0207676_10678522
1584 Ga0207674_10005663
1585 Ga0207674_10028619
1586 Ga0207674_10410771
1587 Ga0207675_100227927
1588 Ga0207675_100270439
1589 Ga0207675_101952073
1590 Ga0207683_10075353
1591 Ga0207683_10106248
1592 Ga0207683_10123090
1593 Ga0207683_10240028
1594 Ga0207683_10466242
1595 Ga0207683_10569956
1596 Ga0207683_11386669
1597 Ga0207698_10551285
1598 Ga0207698_11115467
1599 Ga0209982_1036566
1600 Ga0210002_1028495
1601 Ga0209971_1037117
1602 Ga0209971_1073564
1603 Ga0209998_10095223
1604 Ga0209813_10083190
1605 Ga0209813_10104050
1606 Ga0209974_10165150
1607 Ga0207428_10000251
1608 Ga0207428_10075710
1609 Ga0207428_10092857
1610 Ga0207428_10155431
1611 Ga0207428_10162113
1612 Ga0207428_10357578
1613 Ga0268266_10026474
1614 Ga0268266_10026899
1615 Ga0268266_10163585
1616 Ga0268265_10008553
1617 Ga0268265_10126163
1618 Ga0268265_10335244
1619 Ga0268265_10628512
1620 Ga0268265_11086257
1621 Ga0268264_10038634
1622 Ga0268264_10190244
1623 Ga0268264_10195551
1624 Ga0268264_10257928
1625 Ga0268264_10344674
1626 Ga0268264_11030756
1627 Ga0268264_11685999
1628 Ga0268264_11899662
1629 Ga0268264_12102990
1630 Ga0307513_10938030
1631 Ga0307408_100014989
1632 Ga0307408_100054214
1633 Ga0307408_100328287
1634 Ga0307408_100599296
1635 Ga0307408_100820095
1636 Ga0307405_10103281
1637 Ga0307405_10161242
1638 Ga0307405_10203906
1639 Ga0307405_10878168
1640 Ga0307413_10026826
1641 Ga0307413_10231542
1642 Ga0307413_10418495
1643 Ga0307410_10015632
1644 Ga0307410_10021278
1645 Ga0307406_10051064
1646 Ga0307406_10434249
1647 Ga0307406_10436210
1648 Ga0307407_10216542
1649 Ga0307407_10218532
1650 Ga0307412_10052749
1651 Ga0307412_10634748
1652 Ga0307412_10681398
1653 Ga0307412_10879193
1654 Ga0307412_11256097
1655 Ga0307409_100191125
1656 Ga0307409_102211362
1657 Ga0307409_102757670
1658 Ga0307416_100010427
1659 Ga0307416_100084366
1660 Ga0307414_10042484
1661 Ga0307414_10843542
1662 Ga0307414_11487475
1663 Ga0307411_10109785
1664 Ga0307411_10303431
1665 Ga0307411_10540863
1666 Ga0307411_11776844
1667 Ga0307415_100014486
1668 Ga0307415_100404630
1669 Ga0373959_0042992
1670 Ga0373951_0219771
1671 Ga0373923_0249973
1672 Ga0373932_0088487
1673 Ga0373932_0239273
1674 Ga0373945_0044341
1675 Ga0373945_0053564
1676 Ga0373945_0441240
1677 Ga0373943_0286882
1678 Ga0373943_0486687
1679 Ga0373962_0177365
1680 Ga0373962_0207369
1681 Ga0373935_0168620
1682 Ga0373935_0334542
1683 Ga0373935_0482393
1684 Ga0373933_0070506
1685 Ga0373933_0244894
1686 Ga0373933_0465146
1687 Ga0373947_0045626
1688 Ga0373947_0486045
1689 Ga0373937_0000242
1690 Ga0373937_1320060
1691 Ga0373937_1444980
1692 Ga0373937_1473357
1693 Ga0373925_0599361
1694 Ga0373925_1332456
1695 Ga0395905_0409249
1696 Ga0436365_0384702
1697 Ga0451800_1601123
1698 Ga0451807_1313738
1699 Ga0451853_0422307
1700 Ga0451853_1194632
1701 Ga0451853_2373166
1702 Ga0451853_2555440
1703 Ga0439437_032572
1704 Ga0439445_0197436
1705 Ga0439449_0198954
1706 Ga0439450_032151
1707 Ga0439462_0077183
1708 Ga0450920_006545
1709 Ga0450892_026003
1710 Ga0450896_039783
1711 Ga0450905_034493
1712 Ga0439446_0023581
1713 Ga0439446_0058411
1714 Ga0439446_0216736
1715 Ga0450908_002755
1716 Ga0439434_0036037
1717 Ga0439435_0000595
1718 Ga0439435_0032865
1719 Ga0439435_0086290
1720 Ga0439464_0003160
1721 Ga0439460_0012706
1722 Ga0450918_014085
1723 Ga0451577_0577228
1724 Ga0439440_0258845
1725 Ga0466963_0139246
1726 Ga0466957_0865598
1727 Ga0466958_0228069
1728 Ga0495629_0593879
1729 Ga0495638_0005770
1730 Ga0495638_0009220
1731 Ga0495641_0490426
1732 Ga0495582_0229090
1733 Ga0495639_0072573
1734 Ga0495628_0277678
1735 Ga0495652_0334921
1736 Ga0495640_0505483
1737 Ga0495586_0606870
1738 Ga0495621_0301450
1739 Ga0495621_0383964
1740 Ga0495667_0504293
1741 Ga0495634_0357513
1742 Ga0495647_0278805
1743 Ga0495658_0008309
1744 Ga0495658_0046824
1745 Ga0495674_0148572
1746 Ga0495674_0374516
1747 Ga0495593_0249785
1748 Ga0495602_0395221
1749 Ga0496100_0140924
1750 Ga0496100_0283485
1751 Ga0496100_0316852
1752 Ga0496100_0615766
1753 Ga0496101_1478021
1754 Ga0496102_0009219
1755 Ga0496102_0346524
1756 Ga0496102_0548370
1757 Ga0496102_0724179
1758 Ga0496103_0022284
1759 Ga0496104_0013022
1760 Ga0496105_0021098
1761 Ga0496105_0109874
1762 Ga0496105_0422358
1763 Ga0496105_0583129
1764 Ga0496105_0601774
1765 Ga0496106_0052526
1766 Ga0496106_0336121
1767 Ga0496106_0405283
1768 Ga0496106_0595162
1769 Ga0496106_1302292
1770 Ga0496107_0102575
1771 Ga0496107_0725285
1772 Ga0496108_0090161
1773 Ga0496108_0211857
1774 Ga0496109_0000421
1775 Ga0496109_0154792
1776 Ga0496109_0393830
1777 Ga0496109_0397940
1778 Ga0496109_0564880
1779 Ga0496109_0576682
1780 Ga0496109_1615821
1781 Ga0496110_0019957
1782 Ga0496110_0491016
1783 Ga0496111_0666033
1784 Ga0496112_0001306
1785 Ga0496112_0118214
1786 Ga0496112_0220737
1787 Ga0496112_0388603
1788 Ga0496112_1595163
1789 Ga0496113_0065401
1790 Ga0496113_0121910
1791 Ga0496113_0513633
1792 Ga0496114_0783305
1793 Ga0496114_1014470
1794 Ga0501309_019626
1795 Ga0501305_069728
1796 Ga0501291_050615
1797 Ga0501311_075250
1798 Ga0501312_087815
1799 Ga0501316_040337
1800 Ga0501318_048795
1801 Ga0501323_037442
1802 Ga0501031_0512847
1803 Ga0501033_0631359
1804 Ga0501034_0001239
1805 Ga0501036_0137736
1806 Ga0501036_0142366
1807 Ga0501036_0175013
1808 Ga0501036_0249091
1809 Ga0501037_0236037
1810 Ga0501037_0794999
1811 Ga0501039_0091865
1812 Ga0501039_0135965
1813 Ga0501039_0211948
1814 Ga0501039_0386872
1815 Ga0501040_0064864
1816 Ga0501040_0147581
1817 Ga0501040_0184567
1818 Ga0501040_0648281
1819 Ga0501041_0025274
1820 Ga0501041_0119725
1821 Ga0501041_0152958
1822 Ga0501041_0627849
1823 Ga0501043_0458214
1824 Ga0501046_0149282
1825 Ga0501068_0133232
1826 Ga0501068_0795841
1827 Ga0501069_0714796
1828 Ga0501070_0531177
1829 Ga0501071_0004760
1830 Ga0501071_0068065
1831 Ga0501071_0146789
1832 Ga0501072_0009092
1833 Ga0501072_0018518
1834 Ga0501072_0045430
1835 Ga0501072_0048329
1836 Ga0501072_0049602
1837 Ga0501072_0685474
1838 Ga0501074_0041057
1839 Ga0501074_0063724
1840 Ga0501075_0036134
1841 Ga0501075_0165807
1842 Ga0501075_0192490
1843 Ga0501075_0345804
1844 Ga0501075_1035513
1845 Ga0501076_0045215
1846 Ga0501076_0128638
1847 Ga0501207_094765
1848 Ga0501228_028514
1849 Ga0501239_019518
1850 Ga0501243_058462
1851 Ga0501079_0036201
1852 Ga0501079_0526259
1853 Ga0501079_0565976
1854 Ga0501079_1025667
1855 Ga0501080_0546278
1856 Ga0501080_0668751
1857 Ga0501081_0031159
1858 Ga0501081_0093891
1859 Ga0501083_0370169
1860 Ga0501268_078186
1861 Ga0501283_037896
1862 Ga0501045_0003131
1863 Ga0501045_0008690
1864 Ga0501045_0075027
1865 Ga0501045_0163397
1866 Ga0501045_0207118
1867 Ga0501045_0306781
1868 Ga0501212_053852
1869 nmdc:mga03683_4092_c1
1870 nmdc:mga03n38_452938_c1
1871 nmdc:mga00v17_211815_c1
1872 nmdc:mga00v17_3860_c1
1873 nmdc:mga00v17_3971_c1
1874 nmdc:mga00v17_621389_c1
1875 nmdc:mga00v17_96841_c1
1876 nmdc:mga0yw44_199854_c1
1877 nmdc:mga0yw44_66404_c1
1878 nmdc:mga0yw44_75158_c1
1879 nmdc:mga0k408_106177_c1
1880 nmdc:mga0k408_115504_c1
1881 nmdc:mga0k408_213329_c1
1882 nmdc:mga0k408_6227_c1
1883 nmdc:mga0k408_85968_c1
1884 nmdc:mga0k408_90605_c1
1885 nmdc:mga06z11_12139_c1
1886 nmdc:mga06z11_45548_c1
1887 nmdc:mga06z11_49110_c1
1888 nmdc:mga06z11_4966_c1
1889 nmdc:mga06z11_74792_c1
1890 nmdc:mga06z11_8610_c1
1891 nmdc:mga04h51_62165_c1
1892 nmdc:mga04h51_66163_c1
1893 nmdc:mga07m45_104346_c1
1894 nmdc:mga07m45_318839_c1
1895 nmdc:mga05p37_11992_c1
1896 nmdc:mga05p37_158_c1
1897 nmdc:mga05p37_221_c1
1898 nmdc:mga05p37_24608_c1
1899 nmdc:mga05p37_25173_c1
1900 nmdc:mga05p37_72094_c1
1901 nmdc:mga05p37_72672_c1
1902 nmdc:mga05p37_95854_c1
1903 nmdc:mga09592_4212_c1
1904 nmdc:mga09592_7728_c1
1905 nmdc:mga0qj67_1071755_c1
1906 nmdc:mga0qj67_56920_c1
1907 nmdc:mga0qj67_6228_c1
1908 nmdc:mga06r32_129964_c1
1909 nmdc:mga06r32_154724_c1
1910 nmdc:mga06r32_654_c1
1911 nmdc:mga06r32_772187_c1
1912 nmdc:mga06r32_9845_c1
1913 nmdc:mga08y16_12331_c1
1914 nmdc:mga08y16_14583_c1
1915 nmdc:mga08y16_14770_c1
1916 nmdc:mga08y16_390548_c1
1917 nmdc:mga08y16_464_c1
1918 nmdc:mga08y16_591751_c1
1919 nmdc:mga08y16_677894_c1
1920 nmdc:mga0n895_128280_c1
1921 nmdc:mga0n895_196707_c1
1922 nmdc:mga0n895_2179231_c1
1923 nmdc:mga0n895_376782_c1
1924 nmdc:mga0n895_415635_c1
1925 nmdc:mga0n895_43927_c1
1926 nmdc:mga0n895_690918_c1
1927 nmdc:mga0n895_785823_c1
1928 nmdc:mga0rr50_11146_c1
1929 nmdc:mga0rr50_278431_c1
1930 nmdc:mga0rr50_315716_c1
1931 nmdc:mga0rr50_557528_c1
1932 nmdc:mga0rr50_91586_c1
1933 nmdc:mga08x19_14326_c1
1934 nmdc:mga08x19_526437_c1
1935 nmdc:mga08x19_825278_c1
1936 nmdc:mga08x19_9509_c1
1937 nmdc:mga0a205_325342_c1
1938 nmdc:mga0a205_44429_c1
1939 nmdc:mga0a205_44975_c1
1940 nmdc:mga0a205_54083_c1
1941 nmdc:mga0a205_96252_c1
1942 Ga0495601_0611592
1943 Ga0495601_1047018
1944 Ga0495619_0022983
1945 Ga0495619_0111505
1946 Ga0495619_0259293
1947 Ga0500555_000812
1948 Ga0500628_019232
1949 Ga0500628_087120
1950 Ga0500616_0000066
1951 Ga0500645_001676
1952 Ga0501084_0013516
1953 Ga0501084_0068796
1954 Ga0501084_0237735
1955 Ga0501084_0505137
1956 Ga0501084_1310143
1957 Ga0590071_002020
1958 Ga0590074_000424
1959 Ga0590075_006390
1960 Ga0590077_000281
1961 Ga0587091_146096
1962 Ga0587098_033744
1963 Ga0587099_019353
1964 Ga0587079_015057
1965 Ga0587114_002608
1966 Ga0587071_050070
1967 Ga0501082_0141138
1968 Ga0501082_0316177
1969 Ga0501082_0486584
1970 Ga0501082_0680516
1971 Ga0501082_0841459
1972 Ga0501082_1783771
1973 Ga0530510_0023331
1974 Ga0530510_0386216

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02082

Rrf2

Iron-dependent Transcriptional regulator

4

135

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3f23-assembly1.cif.gz_A crystal structure of zalpha in complex with d(cggccg) 0.9273 5 68
2acj-assembly1.cif.gz_D crystal structure of the b/z junction containing dna bound to z-dna binding proteins 0.9265 9 68
3f22-assembly1.cif.gz_B crystal structure of zalpha in complex with d(cgtacg) 0.9261 9 68
3nrv-assembly2.cif.gz_B crystal structure of marr/emrr family transcriptional regulator from acinetobacter sp. adp1 0.9242 11 68
3nrv-assembly1.cif.gz_A crystal structure of marr/emrr family transcriptional regulator from acinetobacter sp. adp1 0.9236 11 68
ID Description Score Start End Superfamily
3nrvB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9246 10 68 1.10.10.10
3f22A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9244 5 68 1.10.10.10
af_P55265_129_209_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9192 7 68 1.10.10.10
2gxbB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9171 11 68 1.10.10.10
af_P39360_5_75_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.91 6 69 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A496ZQE4-F1-model_v4 Rrf2 family transcriptional regulator 0.8472 2 132 GO:0003700
GO:0005829
AF-A0A1Q7U519-F1-model_v4 Transcriptional regulator 0.8449 1 133 GO:0003700
GO:0005829
AF-A0A2D5ZQ74-F1-model_v4 Rrf2 family transcriptional regulator 0.8404 1 132 GO:0003700
GO:0005829
AF-T0ZSP7-F1-model_v4 Transcriptional regulator, Rrf2 0.8399 2 132 GO:0003700
GO:0005829
AF-A0A330HCM1-F1-model_v4 deleted 0.8396 2 135

Map