F487402
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 981 | 393 | 981 | 181 |
Family's Representative Sequence
| Representative Sequence | 3300046524|Ga0495648_0090864|Ga0495648_0090864_828_1376 |
| Length | 182 |
| Sequence | MSLHLVSPGAKAPEEFNVIIEIPMNADPIKYEVDKESGALFVDRFMTTAMHYPCNYGYVPRTLADDGDPVDVLVITPFPLTPGVVVTCRAIGVLMMDDEAGDAKLLAVPTTKILPIYDHWQKPEDINQMRLKAIQHFFEHYKDLEPNKWVKVKGWEGPEAAKAEITSGMKAYDADQAKKAGK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 2 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 3 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 4 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 5 | 3300003503 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM | Metagenome | Rhizosphere |
| 6 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 7 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 8 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 9 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 10 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 11 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 12 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 13 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 14 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 15 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 16 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 17 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 18 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 19 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 20 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 27 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 31 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 40 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 53 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 58 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 59 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 66 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 68 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 69 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 70 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 72 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 73 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 74 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 75 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 76 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 77 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 78 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 79 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 80 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 81 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 82 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 83 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 84 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 85 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 86 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 87 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 88 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 89 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 91 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 92 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 93 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 94 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 95 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 96 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 98 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 111 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 123 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 127 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 129 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 135 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 137 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 138 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 140 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 208 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 213 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 214 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 215 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 216 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 217 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 218 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 219 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 220 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 221 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 222 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 223 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 224 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 225 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 226 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 227 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 228 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 229 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 230 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 231 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 232 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 233 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 234 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 235 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 236 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 237 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 238 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 239 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 240 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 241 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 242 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 243 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 244 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 245 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 246 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 247 | 3300033527 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 248 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 249 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 250 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 251 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 252 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 253 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 254 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 255 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 256 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 257 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 258 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 259 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 260 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 261 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 262 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 263 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 264 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 265 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 266 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 267 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 268 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 269 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 270 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 271 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 272 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 273 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 274 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 275 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 276 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 277 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 278 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 279 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 280 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 281 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 282 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 283 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 284 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 285 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 286 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 287 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 288 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 289 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 290 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 291 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 292 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 293 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 294 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 295 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 296 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 297 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 298 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 299 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 300 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 301 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 302 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 303 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 304 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 305 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 306 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 307 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 335 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 336 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 337 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 338 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 339 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 340 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 341 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 342 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 343 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 344 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 345 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 346 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 347 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 348 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 349 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 350 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 351 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 352 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 353 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 354 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 355 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 356 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 357 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 359 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 361 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 362 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 363 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 364 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 365 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 366 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 367 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 368 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 369 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 370 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 371 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 372 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 373 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 374 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 375 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 376 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 377 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 378 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 379 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 380 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 381 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 382 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 383 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 384 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 385 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 386 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 387 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 389 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 390 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 391 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 392 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 393 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.55 |
| Metatranscriptomes | 2.45 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 13.25 |
| Nodule | 0.1 |
| Rhizoplane | 2.24 |
| Rhizosphere | 82.36 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.04 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25150J39212_1003483 | 3300002774 | Bacteria | 3674 |
| 2 | JGI25150J39212_1024682 | 3300002774 | Bacteria | 883 |
| 3 | JGI25159J45721_1009081 | 3300002987 | Bacteria | 2660 |
| 4 | JGI25160J50197_1001459 | 3300003354 | Bacteria | 11787 |
| 5 | JGI25161J50226_1000015 | 3300003374 | Bacteria | 183773 |
| 6 | JGI25161J50226_1008780 | 3300003374 | Bacteria | 1515 |
| 7 | JGI26141J51220_1007754 | 3300003503 | Bacteria | 688 |
| 8 | Ga0055539_1005175 | 3300003752 | Bacteria | 1703 |
| 9 | Ga0055533_1000006 | 3300003756 | Bacteria | 635559 |
| 10 | Ga0055525_1001050 | 3300003759 | Bacteria | 7136 |
| 11 | Ga0055535_1000702 | 3300003761 | Bacteria | 25845 |
| 12 | Ga0055529_1000340 | 3300003763 | Bacteria | 52215 |
| 13 | Ga0055526_1003568 | 3300003771 | Bacteria | 9797 |
| 14 | Ga0055524_1000016 | 3300003775 | Bacteria | 244926 |
| 15 | Ga0055524_1002380 | 3300003775 | Bacteria | 9743 |
| 16 | Ga0055534_1000697 | 3300003784 | Bacteria | 16609 |
| 17 | Ga0055530_10000243 | 3300003791 | Bacteria | 49150 |
| 18 | Ga0055530_10031028 | 3300003791 | Bacteria | 1407 |
| 19 | Ga0055540_1000031 | 3300003792 | Bacteria | 177859 |
| 20 | Ga0055540_1005908 | 3300003792 | Bacteria | 5000 |
| 21 | Ga0055540_1040189 | 3300003792 | Bacteria | 1015 |
| 22 | Ga0055531_10000358 | 3300003794 | Bacteria | 44456 |
| 23 | Ga0055531_10001823 | 3300003794 | Bacteria | 15098 |
| 24 | Ga0055531_10009351 | 3300003794 | Bacteria | 5018 |
| 25 | Ga0055531_10018799 | 3300003794 | Bacteria | 2833 |
| 26 | Ga0055543_1000749 | 3300004625 | Bacteria | 16336 |
| 27 | Ga0065165_1000184 | 3300005262 | Bacteria | 109539 |
| 28 | Ga0065165_1001656 | 3300005262 | Bacteria | 22573 |
| 29 | Ga0065712_10414260 | 3300005290 | Bacteria | 718 |
| 30 | Ga0070658_10100190 | 3300005327 | Bacteria | 2394 |
| 31 | Ga0070658_10133246 | 3300005327 | Bacteria | 2072 |
| 32 | Ga0070658_10202913 | 3300005327 | Bacteria | 1673 |
| 33 | Ga0070658_10355992 | 3300005327 | Bacteria | 1253 |
| 34 | Ga0070658_10381235 | 3300005327 | Bacteria | 1210 |
| 35 | Ga0070658_11084150 | 3300005327 | Bacteria | 697 |
| 36 | Ga0070676_10003114 | 3300005328 | Bacteria | 8566 |
| 37 | Ga0070683_100046468 | 3300005329 | Bacteria | 4011 |
| 38 | Ga0070690_100096829 | 3300005330 | Bacteria | 1951 |
| 39 | Ga0070690_100108266 | 3300005330 | Bacteria | 1851 |
| 40 | Ga0070670_100103661 | 3300005331 | Bacteria | 2450 |
| 41 | Ga0070670_100109374 | 3300005331 | Bacteria | 2381 |
| 42 | Ga0070670_100112783 | 3300005331 | Bacteria | 2344 |
| 43 | Ga0070677_10060395 | 3300005333 | Bacteria | 1562 |
| 44 | Ga0068869_100008595 | 3300005334 | Bacteria | 6594 |
| 45 | Ga0068869_100094463 | 3300005334 | Bacteria | 2254 |
| 46 | Ga0068869_100478998 | 3300005334 | Bacteria | 1036 |
| 47 | Ga0068869_100540583 | 3300005334 | Bacteria | 977 |
| 48 | Ga0070666_10026213 | 3300005335 | Bacteria | 3805 |
| 49 | Ga0070666_10047978 | 3300005335 | Bacteria | 2868 |
| 50 | Ga0070680_100003443 | 3300005336 | Bacteria | 11816 |
| 51 | Ga0070680_100236703 | 3300005336 | Bacteria | 1543 |
| 52 | Ga0070680_100301955 | 3300005336 | Bacteria | 1358 |
| 53 | Ga0070680_100707356 | 3300005336 | Bacteria | 867 |
| 54 | Ga0070682_100561892 | 3300005337 | Bacteria | 895 |
| 55 | Ga0068868_100005289 | 3300005338 | Bacteria | 9069 |
| 56 | Ga0068868_100052727 | 3300005338 | Bacteria | 3202 |
| 57 | Ga0068868_100061443 | 3300005338 | Bacteria | 2976 |
| 58 | Ga0068868_100593224 | 3300005338 | Bacteria | 981 |
| 59 | Ga0070660_100116604 | 3300005339 | Bacteria | 2129 |
| 60 | Ga0070660_100626551 | 3300005339 | Bacteria | 900 |
| 61 | Ga0070660_101281453 | 3300005339 | Bacteria | 622 |
| 62 | Ga0070661_100001017 | 3300005344 | Bacteria | 19866 |
| 63 | Ga0070661_100003350 | 3300005344 | Bacteria | 11047 |
| 64 | Ga0070661_100003668 | 3300005344 | Bacteria | 10577 |
| 65 | Ga0070661_100009848 | 3300005344 | Bacteria | 6630 |
| 66 | Ga0070661_100244661 | 3300005344 | Bacteria | 1382 |
| 67 | Ga0070661_100292187 | 3300005344 | Bacteria | 1267 |
| 68 | Ga0070668_100052979 | 3300005347 | Bacteria | 3129 |
| 69 | Ga0070668_100128808 | 3300005347 | Bacteria | 2029 |
| 70 | Ga0070668_100295979 | 3300005347 | Bacteria | 1356 |
| 71 | Ga0070668_100470585 | 3300005347 | Bacteria | 1084 |
| 72 | Ga0070668_100819777 | 3300005347 | Bacteria | 828 |
| 73 | Ga0070669_100064909 | 3300005353 | Bacteria | 2689 |
| 74 | Ga0070669_100120123 | 3300005353 | Bacteria | 2004 |
| 75 | Ga0070669_100144552 | 3300005353 | Bacteria | 1837 |
| 76 | Ga0070669_100290021 | 3300005353 | Bacteria | 1313 |
| 77 | Ga0070669_100316324 | 3300005353 | Bacteria | 1259 |
| 78 | Ga0070675_100004442 | 3300005354 | Bacteria | 10691 |
| 79 | Ga0070675_100040042 | 3300005354 | Bacteria | 3825 |
| 80 | Ga0070675_100051871 | 3300005354 | Bacteria | 3372 |
| 81 | Ga0070675_100127239 | 3300005354 | Bacteria | 2168 |
| 82 | Ga0070671_100001374 | 3300005355 | Bacteria | 18233 |
| 83 | Ga0070671_100002406 | 3300005355 | Bacteria | 14465 |
| 84 | Ga0070671_100083652 | 3300005355 | Bacteria | 2668 |
| 85 | Ga0070671_100267940 | 3300005355 | Bacteria | 1452 |
| 86 | Ga0070671_100431894 | 3300005355 | Bacteria | 1129 |
| 87 | Ga0070674_100107477 | 3300005356 | Bacteria | 2043 |
| 88 | Ga0070674_100275481 | 3300005356 | Bacteria | 1331 |
| 89 | Ga0070674_100285037 | 3300005356 | Bacteria | 1311 |
| 90 | Ga0070673_100011989 | 3300005364 | Bacteria | 5935 |
| 91 | Ga0070673_100028745 | 3300005364 | Bacteria | 4139 |
| 92 | Ga0070673_100060774 | 3300005364 | Bacteria | 2995 |
| 93 | Ga0070673_100134464 | 3300005364 | Bacteria | 2079 |
| 94 | Ga0070673_100169243 | 3300005364 | Bacteria | 1864 |
| 95 | Ga0070673_100355852 | 3300005364 | Bacteria | 1300 |
| 96 | Ga0070673_100538360 | 3300005364 | Bacteria | 1060 |
| 97 | Ga0070688_100092870 | 3300005365 | Bacteria | 1975 |
| 98 | Ga0070688_100847574 | 3300005365 | Bacteria | 718 |
| 99 | Ga0070659_100008648 | 3300005366 | Bacteria | 7447 |
| 100 | Ga0070659_100009656 | 3300005366 | Bacteria | 7093 |
| 101 | Ga0070659_100010955 | 3300005366 | Bacteria | 6694 |
| 102 | Ga0070659_100034650 | 3300005366 | Bacteria | 3927 |
| 103 | Ga0070659_100141291 | 3300005366 | Bacteria | 1960 |
| 104 | Ga0070659_100411493 | 3300005366 | Bacteria | 1143 |
| 105 | Ga0070667_100011503 | 3300005367 | Bacteria | 7319 |
| 106 | Ga0070667_100117594 | 3300005367 | Bacteria | 2309 |
| 107 | Ga0070667_100241234 | 3300005367 | Bacteria | 1614 |
| 108 | Ga0070709_10030621 | 3300005434 | Bacteria | 3231 |
| 109 | Ga0070714_100173379 | 3300005435 | Bacteria | 1959 |
| 110 | Ga0070713_100000130 | 3300005436 | Bacteria | 49533 |
| 111 | Ga0070705_100017028 | 3300005440 | Bacteria | 3786 |
| 112 | Ga0070700_100256201 | 3300005441 | Bacteria | 1258 |
| 113 | Ga0070708_101176366 | 3300005445 | Bacteria | 717 |
| 114 | Ga0070663_100003894 | 3300005455 | Bacteria | 8699 |
| 115 | Ga0070663_100109842 | 3300005455 | Bacteria | 2071 |
| 116 | Ga0070663_100199084 | 3300005455 | Bacteria | 1562 |
| 117 | Ga0070678_100196536 | 3300005456 | Bacteria | 1662 |
| 118 | Ga0070678_100281519 | 3300005456 | Bacteria | 1406 |
| 119 | Ga0070662_100008653 | 3300005457 | Bacteria | 6642 |
| 120 | Ga0070662_100035270 | 3300005457 | Bacteria | 3532 |
| 121 | Ga0070662_100055900 | 3300005457 | Bacteria | 2864 |
| 122 | Ga0070662_100251718 | 3300005457 | Bacteria | 1420 |
| 123 | Ga0070662_100382564 | 3300005457 | Bacteria | 1159 |
| 124 | Ga0070681_10244657 | 3300005458 | Bacteria | 1707 |
| 125 | Ga0070681_10271022 | 3300005458 | Bacteria | 1609 |
| 126 | Ga0068867_100003867 | 3300005459 | Bacteria | 10534 |
| 127 | Ga0068867_100022367 | 3300005459 | Bacteria | 4520 |
| 128 | Ga0068867_100041971 | 3300005459 | Bacteria | 3343 |
| 129 | Ga0068867_100048475 | 3300005459 | Bacteria | 3125 |
| 130 | Ga0068867_100058206 | 3300005459 | Bacteria | 2863 |
| 131 | Ga0068867_100087816 | 3300005459 | Bacteria | 2355 |
| 132 | Ga0068867_100178516 | 3300005459 | Bacteria | 1687 |
| 133 | Ga0068867_100357333 | 3300005459 | Bacteria | 1221 |
| 134 | Ga0070706_100118675 | 3300005467 | Bacteria | 2465 |
| 135 | Ga0070707_100203639 | 3300005468 | Bacteria | 1929 |
| 136 | Ga0070698_100264266 | 3300005471 | Bacteria | 1653 |
| 137 | Ga0070699_101629698 | 3300005518 | Bacteria | 591 |
| 138 | Ga0070679_100025230 | 3300005530 | Bacteria | 5830 |
| 139 | Ga0070679_100028347 | 3300005530 | Bacteria | 5520 |
| 140 | Ga0068853_100016064 | 3300005539 | Bacteria | 6156 |
| 141 | Ga0068853_100016533 | 3300005539 | Bacteria | 6075 |
| 142 | Ga0068853_100116503 | 3300005539 | Bacteria | 2379 |
| 143 | Ga0068853_100169118 | 3300005539 | Bacteria | 1977 |
| 144 | Ga0068853_100624162 | 3300005539 | Bacteria | 1025 |
| 145 | Ga0068853_100873844 | 3300005539 | Bacteria | 863 |
| 146 | Ga0070672_100002447 | 3300005543 | Bacteria | 11784 |
| 147 | Ga0070672_100023360 | 3300005543 | Bacteria | 4556 |
| 148 | Ga0070672_100096280 | 3300005543 | Bacteria | 2395 |
| 149 | Ga0070672_100400394 | 3300005543 | Bacteria | 1176 |
| 150 | Ga0070672_100719987 | 3300005543 | Bacteria | 874 |
| 151 | Ga0070686_100240166 | 3300005544 | Bacteria | 1319 |
| 152 | Ga0070686_100374691 | 3300005544 | Bacteria | 1076 |
| 153 | Ga0070695_100162631 | 3300005545 | Bacteria | 1568 |
| 154 | Ga0070693_100116592 | 3300005547 | Bacteria | 1651 |
| 155 | Ga0070665_100232077 | 3300005548 | Bacteria | 1845 |
| 156 | Ga0070704_100058372 | 3300005549 | Bacteria | 2748 |
| 157 | Ga0068855_100020005 | 3300005563 | Bacteria | 8038 |
| 158 | Ga0068855_100089265 | 3300005563 | Bacteria | 3559 |
| 159 | Ga0068855_100107592 | 3300005563 | Bacteria | 3203 |
| 160 | Ga0068855_100192672 | 3300005563 | Bacteria | 2298 |
| 161 | Ga0068855_100262901 | 3300005563 | Bacteria | 1922 |
| 162 | Ga0070664_100007230 | 3300005564 | Bacteria | 8956 |
| 163 | Ga0070664_100015534 | 3300005564 | Bacteria | 6230 |
| 164 | Ga0070664_100172576 | 3300005564 | Bacteria | 1919 |
| 165 | Ga0070664_100377837 | 3300005564 | Bacteria | 1293 |
| 166 | Ga0070664_100501624 | 3300005564 | Bacteria | 1119 |
| 167 | Ga0068857_100133458 | 3300005577 | Bacteria | 2241 |
| 168 | Ga0068857_100162416 | 3300005577 | Bacteria | 2027 |
| 169 | Ga0068854_100010927 | 3300005578 | Bacteria | 5890 |
| 170 | Ga0068854_100014879 | 3300005578 | Bacteria | 5137 |
| 171 | Ga0068854_100307993 | 3300005578 | Bacteria | 1284 |
| 172 | Ga0068854_100361197 | 3300005578 | Bacteria | 1191 |
| 173 | Ga0068854_100852354 | 3300005578 | Bacteria | 798 |
| 174 | Ga0068856_100000937 | 3300005614 | Bacteria | 31230 |
| 175 | Ga0068856_100031144 | 3300005614 | Bacteria | 5218 |
| 176 | Ga0068856_100147214 | 3300005614 | Bacteria | 2363 |
| 177 | Ga0068856_100444718 | 3300005614 | Bacteria | 1317 |
| 178 | Ga0068856_100712745 | 3300005614 | Bacteria | 1024 |
| 179 | Ga0070702_100168051 | 3300005615 | Bacteria | 1424 |
| 180 | Ga0068852_100099190 | 3300005616 | Bacteria | 2625 |
| 181 | Ga0068852_100117707 | 3300005616 | Bacteria | 2427 |
| 182 | Ga0068852_100141142 | 3300005616 | Bacteria | 2229 |
| 183 | Ga0068852_100208568 | 3300005616 | Bacteria | 1852 |
| 184 | Ga0068852_100482686 | 3300005616 | Bacteria | 1232 |
| 185 | Ga0068852_100711964 | 3300005616 | Bacteria | 1014 |
| 186 | Ga0068852_101005196 | 3300005616 | Bacteria | 853 |
| 187 | Ga0068859_100123948 | 3300005617 | Bacteria | 2652 |
| 188 | Ga0068859_100441896 | 3300005617 | Bacteria | 1397 |
| 189 | Ga0068859_101763367 | 3300005617 | Bacteria | 684 |
| 190 | Ga0068864_100011853 | 3300005618 | Bacteria | 7199 |
| 191 | Ga0068864_100046809 | 3300005618 | Bacteria | 3712 |
| 192 | Ga0068864_100055254 | 3300005618 | Bacteria | 3427 |
| 193 | Ga0068866_10014255 | 3300005718 | Bacteria | 3506 |
| 194 | Ga0068861_100031456 | 3300005719 | Bacteria | 3899 |
| 195 | Ga0068861_100036313 | 3300005719 | Bacteria | 3656 |
| 196 | Ga0068863_100148557 | 3300005841 | Bacteria | 2242 |
| 197 | Ga0068863_100202444 | 3300005841 | Bacteria | 1910 |
| 198 | Ga0068863_100780030 | 3300005841 | Bacteria | 953 |
| 199 | Ga0068863_100868468 | 3300005841 | Bacteria | 901 |
| 200 | Ga0068863_100952990 | 3300005841 | Bacteria | 860 |
| 201 | Ga0068858_100054024 | 3300005842 | Bacteria | 3715 |
| 202 | Ga0068858_100146464 | 3300005842 | Bacteria | 2218 |
| 203 | Ga0068858_100532627 | 3300005842 | Bacteria | 1136 |
| 204 | Ga0068860_100000678 | 3300005843 | Bacteria | 39403 |
| 205 | Ga0068860_100024635 | 3300005843 | Bacteria | 5810 |
| 206 | Ga0068860_100248454 | 3300005843 | Bacteria | 1732 |
| 207 | Ga0068862_100003264 | 3300005844 | Bacteria | 14033 |
| 208 | Ga0068862_100017965 | 3300005844 | Bacteria | 5891 |
| 209 | Ga0068862_100080001 | 3300005844 | Bacteria | 2833 |
| 210 | Ga0068862_100150910 | 3300005844 | Bacteria | 2068 |
| 211 | Ga0068862_100163746 | 3300005844 | Bacteria | 1987 |
| 212 | Ga0068862_100838872 | 3300005844 | Bacteria | 900 |
| 213 | Ga0068862_101634610 | 3300005844 | Bacteria | 652 |
| 214 | Ga0081539_10041122 | 3300005985 | Bacteria | 2706 |
| 215 | Ga0075365_10008403 | 3300006038 | Bacteria | 5857 |
| 216 | Ga0075365_10008748 | 3300006038 | Bacteria | 5772 |
| 217 | Ga0075365_10028653 | 3300006038 | Bacteria | 3552 |
| 218 | Ga0075365_10147299 | 3300006038 | Bacteria | 1637 |
| 219 | Ga0075368_10014094 | 3300006042 | Bacteria | 2947 |
| 220 | Ga0075363_100025312 | 3300006048 | Bacteria | 3025 |
| 221 | Ga0075363_100033613 | 3300006048 | Bacteria | 2672 |
| 222 | Ga0075363_100202375 | 3300006048 | Bacteria | 1135 |
| 223 | Ga0075363_100334914 | 3300006048 | Bacteria | 882 |
| 224 | Ga0075363_100693279 | 3300006048 | Bacteria | 615 |
| 225 | Ga0075364_10101510 | 3300006051 | Bacteria | 1915 |
| 226 | Ga0075364_10139438 | 3300006051 | Bacteria | 1630 |
| 227 | Ga0075364_10154474 | 3300006051 | Bacteria | 1547 |
| 228 | Ga0075364_10183979 | 3300006051 | Bacteria | 1414 |
| 229 | Ga0070712_100315479 | 3300006175 | Bacteria | 1270 |
| 230 | Ga0075362_10004144 | 3300006177 | Bacteria | 5171 |
| 231 | Ga0075362_10012281 | 3300006177 | Bacteria | 3399 |
| 232 | Ga0075362_10016593 | 3300006177 | Bacteria | 3018 |
| 233 | Ga0075362_10152765 | 3300006177 | Bacteria | 1108 |
| 234 | Ga0075367_10020025 | 3300006178 | Bacteria | 3720 |
| 235 | Ga0075367_10055393 | 3300006178 | Bacteria | 2353 |
| 236 | Ga0075367_10084616 | 3300006178 | Bacteria | 1923 |
| 237 | Ga0075367_10116234 | 3300006178 | Bacteria | 1645 |
| 238 | Ga0075367_10177445 | 3300006178 | Bacteria | 1328 |
| 239 | Ga0075367_10213445 | 3300006178 | Bacteria | 1207 |
| 240 | Ga0075366_10013879 | 3300006195 | Bacteria | 4592 |
| 241 | Ga0075366_10020363 | 3300006195 | Bacteria | 3849 |
| 242 | Ga0075366_10022395 | 3300006195 | Bacteria | 3675 |
| 243 | Ga0075366_10026318 | 3300006195 | Bacteria | 3406 |
| 244 | Ga0075366_10044832 | 3300006195 | Bacteria | 2622 |
| 245 | Ga0075366_10052485 | 3300006195 | Bacteria | 2422 |
| 246 | Ga0075366_10064797 | 3300006195 | Bacteria | 2173 |
| 247 | Ga0075366_10088105 | 3300006195 | Bacteria | 1858 |
| 248 | Ga0075366_10114371 | 3300006195 | Bacteria | 1625 |
| 249 | Ga0075366_10130349 | 3300006195 | Bacteria | 1517 |
| 250 | Ga0075366_10143213 | 3300006195 | Bacteria | 1446 |
| 251 | Ga0097621_100068313 | 3300006237 | Bacteria | 2931 |
| 252 | Ga0097621_100096690 | 3300006237 | Bacteria | 2478 |
| 253 | Ga0097621_100542168 | 3300006237 | Bacteria | 1058 |
| 254 | Ga0075370_10000607 | 3300006353 | Bacteria | 13847 |
| 255 | Ga0075370_10003963 | 3300006353 | Bacteria | 7113 |
| 256 | Ga0075370_10009619 | 3300006353 | Bacteria | 5029 |
| 257 | Ga0075370_10017562 | 3300006353 | Bacteria | 3868 |
| 258 | Ga0075370_10018992 | 3300006353 | Bacteria | 3734 |
| 259 | Ga0075370_10056841 | 3300006353 | Bacteria | 2224 |
| 260 | Ga0075370_10144595 | 3300006353 | Bacteria | 1391 |
| 261 | Ga0075370_10187168 | 3300006353 | Bacteria | 1219 |
| 262 | Ga0075370_10191401 | 3300006353 | Bacteria | 1205 |
| 263 | Ga0068871_100129517 | 3300006358 | Bacteria | 2138 |
| 264 | Ga0068871_100218700 | 3300006358 | Bacteria | 1649 |
| 265 | Ga0068871_100522893 | 3300006358 | Bacteria | 1072 |
| 266 | Ga0068871_100606574 | 3300006358 | Bacteria | 996 |
| 267 | Ga0075428_100121466 | 3300006844 | Bacteria | 2844 |
| 268 | Ga0075428_100271198 | 3300006844 | Bacteria | 1826 |
| 269 | Ga0075431_100009882 | 3300006847 | Bacteria | 9579 |
| 270 | Ga0075429_100000463 | 3300006880 | Bacteria | 30330 |
| 271 | Ga0068865_100002721 | 3300006881 | Bacteria | 10495 |
| 272 | Ga0068865_100059260 | 3300006881 | Bacteria | 2677 |
| 273 | Ga0097620_100123944 | 3300006931 | Bacteria | 2652 |
| 274 | Ga0097620_100441896 | 3300006931 | Bacteria | 1397 |
| 275 | Ga0097620_101763187 | 3300006931 | Bacteria | 684 |
| 276 | Ga0099823_1000039 | 3300006944 | Bacteria | 61476 |
| 277 | Ga0105240_10026368 | 3300009093 | Bacteria | 7624 |
| 278 | Ga0105240_10026912 | 3300009093 | Bacteria | 7540 |
| 279 | Ga0105240_10064807 | 3300009093 | Bacteria | 4538 |
| 280 | Ga0105240_10835949 | 3300009093 | Bacteria | 995 |
| 281 | Ga0111539_10842640 | 3300009094 | Bacteria | 1067 |
| 282 | Ga0111539_11825265 | 3300009094 | Bacteria | 705 |
| 283 | Ga0105245_10086581 | 3300009098 | Bacteria | 2874 |
| 284 | Ga0105245_11373214 | 3300009098 | Bacteria | 756 |
| 285 | Ga0114129_10018075 | 3300009147 | Bacteria | 10043 |
| 286 | Ga0114129_10077730 | 3300009147 | Bacteria | 4616 |
| 287 | Ga0105243_10044991 | 3300009148 | Bacteria | 3466 |
| 288 | Ga0105243_10093501 | 3300009148 | Bacteria | 2481 |
| 289 | Ga0105243_10144779 | 3300009148 | Bacteria | 2032 |
| 290 | Ga0105243_10191615 | 3300009148 | Bacteria | 1786 |
| 291 | Ga0105242_10262339 | 3300009176 | Bacteria | 1561 |
| 292 | Ga0105242_10638813 | 3300009176 | Bacteria | 1033 |
| 293 | Ga0105242_11007014 | 3300009176 | Bacteria | 841 |
| 294 | Ga0105248_10006076 | 3300009177 | Bacteria | 13254 |
| 295 | Ga0105248_10116226 | 3300009177 | Bacteria | 3017 |
| 296 | Ga0105248_10158577 | 3300009177 | Bacteria | 2553 |
| 297 | Ga0105248_10447586 | 3300009177 | Bacteria | 1455 |
| 298 | Ga0105248_10853246 | 3300009177 | Bacteria | 1028 |
| 299 | Ga0105248_11258934 | 3300009177 | Bacteria | 837 |
| 300 | Ga0105237_10000784 | 3300009545 | Bacteria | 43457 |
| 301 | Ga0105237_10154894 | 3300009545 | Bacteria | 2288 |
| 302 | Ga0105237_10639506 | 3300009545 | Bacteria | 1071 |
| 303 | Ga0105238_10033583 | 3300009551 | Bacteria | 5221 |
| 304 | Ga0105238_10326403 | 3300009551 | Bacteria | 1521 |
| 305 | Ga0105238_10926360 | 3300009551 | Bacteria | 890 |
| 306 | Ga0105238_11708558 | 3300009551 | Bacteria | 660 |
| 307 | Ga0105249_10055139 | 3300009553 | Bacteria | 3635 |
| 308 | Ga0105249_10109205 | 3300009553 | Bacteria | 2612 |
| 309 | Ga0105249_11874964 | 3300009553 | Bacteria | 672 |
| 310 | Ga0105239_10017475 | 3300010375 | Bacteria | 7931 |
| 311 | Ga0105239_10035331 | 3300010375 | Bacteria | 5489 |
| 312 | Ga0105239_10439208 | 3300010375 | Bacteria | 1480 |
| 313 | Ga0105246_10124310 | 3300011119 | Bacteria | 1917 |
| 314 | Ga0105246_10266759 | 3300011119 | Bacteria | 1367 |
| 315 | Ga0105246_10819111 | 3300011119 | Bacteria | 828 |
| 316 | Ga0105246_11511185 | 3300011119 | Bacteria | 631 |
| 317 | Ga0157319_1000009 | 3300012497 | Bacteria | 227971 |
| 318 | Ga0157373_10009401 | 3300013100 | Bacteria | 7218 |
| 319 | Ga0157373_10014120 | 3300013100 | Bacteria | 5855 |
| 320 | Ga0157373_10201252 | 3300013100 | Bacteria | 1404 |
| 321 | Ga0157371_10003553 | 3300013102 | Bacteria | 14068 |
| 322 | Ga0157371_10186726 | 3300013102 | Bacteria | 1483 |
| 323 | Ga0157371_10527989 | 3300013102 | Bacteria | 873 |
| 324 | Ga0157370_10011086 | 3300013104 | Bacteria | 9449 |
| 325 | Ga0157370_10016304 | 3300013104 | Bacteria | 7528 |
| 326 | Ga0157370_10021276 | 3300013104 | Bacteria | 6466 |
| 327 | Ga0157370_10069410 | 3300013104 | Bacteria | 3328 |
| 328 | Ga0157369_10007076 | 3300013105 | Bacteria | 12938 |
| 329 | Ga0157369_10009390 | 3300013105 | Bacteria | 11184 |
| 330 | Ga0157369_10065405 | 3300013105 | Bacteria | 3913 |
| 331 | Ga0157369_10139689 | 3300013105 | Bacteria | 2564 |
| 332 | Ga0157369_10205427 | 3300013105 | Bacteria | 2066 |
| 333 | Ga0157374_10117423 | 3300013296 | Bacteria | 2564 |
| 334 | Ga0157374_10435906 | 3300013296 | Bacteria | 1310 |
| 335 | Ga0157374_10498262 | 3300013296 | Bacteria | 1222 |
| 336 | Ga0157378_10003415 | 3300013297 | Bacteria | 14098 |
| 337 | Ga0157378_10004517 | 3300013297 | Bacteria | 12208 |
| 338 | Ga0157378_10041933 | 3300013297 | Bacteria | 4061 |
| 339 | Ga0157378_10051563 | 3300013297 | Bacteria | 3661 |
| 340 | Ga0157378_10276787 | 3300013297 | Bacteria | 1616 |
| 341 | Ga0157378_10517891 | 3300013297 | Bacteria | 1194 |
| 342 | Ga0157378_10524014 | 3300013297 | Bacteria | 1187 |
| 343 | Ga0163162_10013003 | 3300013306 | Bacteria | 8123 |
| 344 | Ga0163162_10066107 | 3300013306 | Bacteria | 3664 |
| 345 | Ga0163162_10461464 | 3300013306 | Bacteria | 1402 |
| 346 | Ga0163162_10921910 | 3300013306 | Bacteria | 986 |
| 347 | Ga0157372_10002684 | 3300013307 | Bacteria | 19245 |
| 348 | Ga0157372_10140032 | 3300013307 | Bacteria | 2787 |
| 349 | Ga0157372_10205402 | 3300013307 | Bacteria | 2283 |
| 350 | Ga0157372_10235394 | 3300013307 | Bacteria | 2124 |
| 351 | Ga0157372_10349207 | 3300013307 | Bacteria | 1723 |
| 352 | Ga0157372_10402936 | 3300013307 | Bacteria | 1594 |
| 353 | Ga0157372_10562488 | 3300013307 | Bacteria | 1329 |
| 354 | Ga0157372_11043954 | 3300013307 | Bacteria | 946 |
| 355 | Ga0157375_10100019 | 3300013308 | Bacteria | 2979 |
| 356 | Ga0157375_10249533 | 3300013308 | Bacteria | 1935 |
| 357 | Ga0157375_10350313 | 3300013308 | Bacteria | 1642 |
| 358 | Ga0163163_10106185 | 3300014325 | Bacteria | 2834 |
| 359 | Ga0157380_10030768 | 3300014326 | Bacteria | 4114 |
| 360 | Ga0157380_10155746 | 3300014326 | Bacteria | 1980 |
| 361 | Ga0157380_10559661 | 3300014326 | Bacteria | 1123 |
| 362 | Ga0182008_10351666 | 3300014497 | Bacteria | 782 |
| 363 | Ga0157377_10218330 | 3300014745 | Bacteria | 1219 |
| 364 | Ga0157377_10538668 | 3300014745 | Bacteria | 823 |
| 365 | Ga0157377_10614920 | 3300014745 | Bacteria | 777 |
| 366 | Ga0157379_10059549 | 3300014968 | Bacteria | 3414 |
| 367 | Ga0157379_10093284 | 3300014968 | Bacteria | 2701 |
| 368 | Ga0157379_10791041 | 3300014968 | Bacteria | 895 |
| 369 | Ga0157376_10014203 | 3300014969 | Bacteria | 5968 |
| 370 | Ga0157376_10165688 | 3300014969 | Bacteria | 2008 |
| 371 | Ga0157376_10319603 | 3300014969 | Bacteria | 1475 |
| 372 | Ga0157376_10339627 | 3300014969 | Bacteria | 1434 |
| 373 | Ga0157376_10927008 | 3300014969 | Bacteria | 890 |
| 374 | Ga0182007_10027607 | 3300015262 | Bacteria | 1955 |
| 375 | Ga0163161_10062740 | 3300017792 | Bacteria | 2708 |
| 376 | Ga0163161_10385129 | 3300017792 | Bacteria | 1121 |
| 377 | Ga0213872_10000003 | 3300021361 | Bacteria | 366948 |
| 378 | Ga0213872_10000004 | 3300021361 | Bacteria | 306230 |
| 379 | Ga0213872_10049430 | 3300021361 | Bacteria | 1910 |
| 380 | Ga0209674_100003 | 3300025226 | Bacteria | 2196646 |
| 381 | Ga0209563_100010 | 3300025230 | Bacteria | 1337457 |
| 382 | Ga0209258_100060 | 3300025242 | Bacteria | 319881 |
| 383 | Ga0209677_100026 | 3300025253 | Bacteria | 382520 |
| 384 | Ga0209677_106728 | 3300025253 | Bacteria | 2640 |
| 385 | Ga0209148_1008101 | 3300025254 | Bacteria | 2132 |
| 386 | Ga0209759_1000663 | 3300025256 | Bacteria | 31934 |
| 387 | Ga0209455_1000093 | 3300025272 | Bacteria | 220487 |
| 388 | Ga0209673_1010377 | 3300025273 | Bacteria | 3930 |
| 389 | Ga0209673_1011036 | 3300025273 | Bacteria | 3756 |
| 390 | Ga0209673_1067835 | 3300025273 | Bacteria | 861 |
| 391 | Ga0209564_1000003 | 3300025295 | Bacteria | 1585848 |
| 392 | Ga0209050_1019110 | 3300025298 | Bacteria | 2623 |
| 393 | Ga0209256_1001390 | 3300025299 | Bacteria | 25244 |
| 394 | Ga0209256_1021613 | 3300025299 | Bacteria | 1969 |
| 395 | Ga0209051_1000140 | 3300025303 | Bacteria | 135919 |
| 396 | Ga0209051_1001698 | 3300025303 | Bacteria | 17649 |
| 397 | Ga0209257_1000012 | 3300025304 | Bacteria | 1111138 |
| 398 | Ga0209257_1000045 | 3300025304 | Bacteria | 484429 |
| 399 | Ga0209257_1001619 | 3300025304 | Bacteria | 25820 |
| 400 | Ga0209257_1002501 | 3300025304 | Bacteria | 18143 |
| 401 | Ga0207697_10081189 | 3300025315 | Bacteria | 1366 |
| 402 | Ga0207656_10003677 | 3300025321 | Bacteria | 5306 |
| 403 | Ga0207682_10020313 | 3300025893 | Bacteria | 2607 |
| 404 | Ga0207682_10045037 | 3300025893 | Bacteria | 1810 |
| 405 | Ga0207642_10058363 | 3300025899 | Bacteria | 1780 |
| 406 | Ga0207642_10122933 | 3300025899 | Bacteria | 1342 |
| 407 | Ga0207688_10082222 | 3300025901 | Bacteria | 1840 |
| 408 | Ga0207688_10226644 | 3300025901 | Bacteria | 1127 |
| 409 | Ga0207680_10234937 | 3300025903 | Bacteria | 1261 |
| 410 | Ga0207680_10545585 | 3300025903 | Bacteria | 827 |
| 411 | Ga0207647_10180276 | 3300025904 | Bacteria | 1227 |
| 412 | Ga0207699_10173423 | 3300025906 | Bacteria | 1445 |
| 413 | Ga0207645_10001190 | 3300025907 | Bacteria | 21497 |
| 414 | Ga0207645_10035276 | 3300025907 | Bacteria | 3212 |
| 415 | Ga0207645_10061879 | 3300025907 | Bacteria | 2391 |
| 416 | Ga0207645_10116159 | 3300025907 | Bacteria | 1735 |
| 417 | Ga0207643_10019116 | 3300025908 | Bacteria | 3754 |
| 418 | Ga0207643_10138836 | 3300025908 | Bacteria | 1451 |
| 419 | Ga0207643_10435912 | 3300025908 | Bacteria | 832 |
| 420 | Ga0207705_10036481 | 3300025909 | Bacteria | 3518 |
| 421 | Ga0207705_10859350 | 3300025909 | Bacteria | 703 |
| 422 | Ga0207684_10045154 | 3300025910 | Bacteria | 3738 |
| 423 | Ga0207654_10456993 | 3300025911 | Bacteria | 896 |
| 424 | Ga0207695_10018064 | 3300025913 | Bacteria | 8165 |
| 425 | Ga0207695_10030121 | 3300025913 | Bacteria | 5979 |
| 426 | Ga0207695_10099170 | 3300025913 | Bacteria | 2911 |
| 427 | Ga0207695_10499108 | 3300025913 | Bacteria | 1099 |
| 428 | Ga0207695_10709983 | 3300025913 | Bacteria | 886 |
| 429 | Ga0207695_10801652 | 3300025913 | Bacteria | 822 |
| 430 | Ga0207671_10220348 | 3300025914 | Bacteria | 1486 |
| 431 | Ga0207660_10051575 | 3300025917 | Bacteria | 2925 |
| 432 | Ga0207660_10072521 | 3300025917 | Bacteria | 2508 |
| 433 | Ga0207662_10156985 | 3300025918 | Bacteria | 1451 |
| 434 | Ga0207657_10018458 | 3300025919 | Bacteria | 6657 |
| 435 | Ga0207657_10035340 | 3300025919 | Bacteria | 4482 |
| 436 | Ga0207657_10113026 | 3300025919 | Bacteria | 2241 |
| 437 | Ga0207657_10116858 | 3300025919 | Bacteria | 2197 |
| 438 | Ga0207657_10611274 | 3300025919 | Bacteria | 850 |
| 439 | Ga0207649_10014385 | 3300025920 | Bacteria | 4429 |
| 440 | Ga0207649_10027192 | 3300025920 | Bacteria | 3354 |
| 441 | Ga0207649_10175747 | 3300025920 | Bacteria | 1495 |
| 442 | Ga0207649_10984124 | 3300025920 | Bacteria | 663 |
| 443 | Ga0207652_10021537 | 3300025921 | Bacteria | 5320 |
| 444 | Ga0207652_10046811 | 3300025921 | Bacteria | 3692 |
| 445 | Ga0207652_10442167 | 3300025921 | Bacteria | 1172 |
| 446 | Ga0207652_11212238 | 3300025921 | Bacteria | 656 |
| 447 | Ga0207681_10068098 | 3300025923 | Bacteria | 2471 |
| 448 | Ga0207694_10006337 | 3300025924 | Bacteria | 9030 |
| 449 | Ga0207694_10006652 | 3300025924 | Bacteria | 8782 |
| 450 | Ga0207694_10650963 | 3300025924 | Bacteria | 888 |
| 451 | Ga0207650_10000900 | 3300025925 | Bacteria | 22446 |
| 452 | Ga0207650_10132089 | 3300025925 | Bacteria | 1955 |
| 453 | Ga0207650_10799132 | 3300025925 | Bacteria | 799 |
| 454 | Ga0207659_10004818 | 3300025926 | Bacteria | 8182 |
| 455 | Ga0207659_10021623 | 3300025926 | Bacteria | 4274 |
| 456 | Ga0207659_10030715 | 3300025926 | Bacteria | 3673 |
| 457 | Ga0207659_10052521 | 3300025926 | Bacteria | 2904 |
| 458 | Ga0207659_10072244 | 3300025926 | Bacteria | 2522 |
| 459 | Ga0207659_10235315 | 3300025926 | Bacteria | 1479 |
| 460 | Ga0207659_10279495 | 3300025926 | Bacteria | 1364 |
| 461 | Ga0207687_10048767 | 3300025927 | Bacteria | 2942 |
| 462 | Ga0207687_10196620 | 3300025927 | Bacteria | 1573 |
| 463 | Ga0207687_10249590 | 3300025927 | Bacteria | 1410 |
| 464 | Ga0207687_10902448 | 3300025927 | Bacteria | 756 |
| 465 | Ga0207700_10000262 | 3300025928 | Bacteria | 31393 |
| 466 | Ga0207664_10322557 | 3300025929 | Bacteria | 1363 |
| 467 | Ga0207644_10012179 | 3300025931 | Bacteria | 5708 |
| 468 | Ga0207644_10081730 | 3300025931 | Bacteria | 2388 |
| 469 | Ga0207644_10097386 | 3300025931 | Bacteria | 2203 |
| 470 | Ga0207644_10120098 | 3300025931 | Bacteria | 2000 |
| 471 | Ga0207644_10232733 | 3300025931 | Bacteria | 1464 |
| 472 | Ga0207644_10375554 | 3300025931 | Bacteria | 1159 |
| 473 | Ga0207644_10397442 | 3300025931 | Bacteria | 1126 |
| 474 | Ga0207690_10032871 | 3300025932 | Bacteria | 3332 |
| 475 | Ga0207690_10066926 | 3300025932 | Bacteria | 2462 |
| 476 | Ga0207690_10074322 | 3300025932 | Bacteria | 2354 |
| 477 | Ga0207690_10124324 | 3300025932 | Bacteria | 1879 |
| 478 | Ga0207706_10000045 | 3300025933 | Bacteria | 120758 |
| 479 | Ga0207706_10003498 | 3300025933 | Bacteria | 15001 |
| 480 | Ga0207706_10097737 | 3300025933 | Bacteria | 2582 |
| 481 | Ga0207686_10059943 | 3300025934 | Bacteria | 2407 |
| 482 | Ga0207709_10100467 | 3300025935 | Bacteria | 1911 |
| 483 | Ga0207709_10104151 | 3300025935 | Bacteria | 1882 |
| 484 | Ga0207709_10104840 | 3300025935 | Bacteria | 1877 |
| 485 | Ga0207670_10017790 | 3300025936 | Bacteria | 4304 |
| 486 | Ga0207670_10235473 | 3300025936 | Bacteria | 1408 |
| 487 | Ga0207670_10316726 | 3300025936 | Bacteria | 1226 |
| 488 | Ga0207669_10094383 | 3300025937 | Bacteria | 1957 |
| 489 | Ga0207669_10107269 | 3300025937 | Bacteria | 1862 |
| 490 | Ga0207669_10216156 | 3300025937 | Bacteria | 1403 |
| 491 | Ga0207704_10103926 | 3300025938 | Bacteria | 1901 |
| 492 | Ga0207691_10013008 | 3300025940 | Bacteria | 7968 |
| 493 | Ga0207691_10014607 | 3300025940 | Bacteria | 7484 |
| 494 | Ga0207691_10044537 | 3300025940 | Bacteria | 4083 |
| 495 | Ga0207691_10119141 | 3300025940 | Bacteria | 2341 |
| 496 | Ga0207711_10012329 | 3300025941 | Bacteria | 7105 |
| 497 | Ga0207711_10119369 | 3300025941 | Bacteria | 2353 |
| 498 | Ga0207711_10200226 | 3300025941 | Bacteria | 1822 |
| 499 | Ga0207711_10597961 | 3300025941 | Bacteria | 1029 |
| 500 | Ga0207689_10020361 | 3300025942 | Bacteria | 5585 |
| 501 | Ga0207689_10035080 | 3300025942 | Bacteria | 4167 |
| 502 | Ga0207689_10081629 | 3300025942 | Bacteria | 2658 |
| 503 | Ga0207689_10113327 | 3300025942 | Bacteria | 2229 |
| 504 | Ga0207689_10200002 | 3300025942 | Bacteria | 1649 |
| 505 | Ga0207689_10396096 | 3300025942 | Bacteria | 1151 |
| 506 | Ga0207679_10000279 | 3300025945 | Bacteria | 38594 |
| 507 | Ga0207679_10009086 | 3300025945 | Bacteria | 6350 |
| 508 | Ga0207679_10111289 | 3300025945 | Bacteria | 2162 |
| 509 | Ga0207679_10195290 | 3300025945 | Bacteria | 1686 |
| 510 | Ga0207679_10318076 | 3300025945 | Bacteria | 1347 |
| 511 | Ga0207679_10385851 | 3300025945 | Bacteria | 1229 |
| 512 | Ga0207679_11467526 | 3300025945 | Bacteria | 626 |
| 513 | Ga0207667_10012656 | 3300025949 | Bacteria | 9696 |
| 514 | Ga0207667_10043079 | 3300025949 | Bacteria | 4791 |
| 515 | Ga0207667_10083607 | 3300025949 | Bacteria | 3305 |
| 516 | Ga0207667_10161785 | 3300025949 | Bacteria | 2302 |
| 517 | Ga0207667_10179516 | 3300025949 | Bacteria | 2174 |
| 518 | Ga0207667_10493162 | 3300025949 | Bacteria | 1243 |
| 519 | Ga0207651_10006141 | 3300025960 | Bacteria | 6247 |
| 520 | Ga0207651_10015175 | 3300025960 | Bacteria | 4470 |
| 521 | Ga0207651_10030873 | 3300025960 | Bacteria | 3418 |
| 522 | Ga0207651_10112746 | 3300025960 | Bacteria | 2045 |
| 523 | Ga0207651_10173688 | 3300025960 | Bacteria | 1702 |
| 524 | Ga0207651_10269997 | 3300025960 | Bacteria | 1400 |
| 525 | Ga0207712_10069351 | 3300025961 | Bacteria | 2529 |
| 526 | Ga0207668_10282294 | 3300025972 | Bacteria | 1362 |
| 527 | Ga0207640_10276066 | 3300025981 | Bacteria | 1317 |
| 528 | Ga0207658_10322841 | 3300025986 | Bacteria | 1337 |
| 529 | Ga0207658_10475361 | 3300025986 | Bacteria | 1110 |
| 530 | Ga0207677_10014503 | 3300026023 | Bacteria | 4603 |
| 531 | Ga0207677_10058377 | 3300026023 | Bacteria | 2656 |
| 532 | Ga0207677_10105045 | 3300026023 | Bacteria | 2089 |
| 533 | Ga0207677_10324713 | 3300026023 | Bacteria | 1280 |
| 534 | Ga0207677_10355356 | 3300026023 | Bacteria | 1229 |
| 535 | Ga0207677_10419687 | 3300026023 | Bacteria | 1139 |
| 536 | Ga0207703_10038338 | 3300026035 | Bacteria | 3823 |
| 537 | Ga0207703_10103802 | 3300026035 | Bacteria | 2414 |
| 538 | Ga0207703_10117595 | 3300026035 | Bacteria | 2278 |
| 539 | Ga0207703_10172623 | 3300026035 | Bacteria | 1903 |
| 540 | Ga0207639_10003482 | 3300026041 | Bacteria | 10594 |
| 541 | Ga0207639_10043795 | 3300026041 | Bacteria | 3362 |
| 542 | Ga0207639_10047438 | 3300026041 | Bacteria | 3247 |
| 543 | Ga0207639_10154489 | 3300026041 | Bacteria | 1926 |
| 544 | Ga0207639_10246566 | 3300026041 | Bacteria | 1556 |
| 545 | Ga0207639_10570673 | 3300026041 | Bacteria | 1041 |
| 546 | Ga0207678_10099991 | 3300026067 | Bacteria | 2477 |
| 547 | Ga0207708_10163986 | 3300026075 | Bacteria | 1756 |
| 548 | Ga0207702_10009898 | 3300026078 | Bacteria | 7992 |
| 549 | Ga0207702_10503655 | 3300026078 | Bacteria | 1181 |
| 550 | Ga0207702_10947705 | 3300026078 | Bacteria | 853 |
| 551 | Ga0207641_10033004 | 3300026088 | Bacteria | 4301 |
| 552 | Ga0207641_10033151 | 3300026088 | Bacteria | 4292 |
| 553 | Ga0207641_10037100 | 3300026088 | Bacteria | 4070 |
| 554 | Ga0207641_10155795 | 3300026088 | Bacteria | 2072 |
| 555 | Ga0207648_10000839 | 3300026089 | Bacteria | 34622 |
| 556 | Ga0207648_10012441 | 3300026089 | Bacteria | 7967 |
| 557 | Ga0207648_10021693 | 3300026089 | Bacteria | 5771 |
| 558 | Ga0207648_10059325 | 3300026089 | Bacteria | 3337 |
| 559 | Ga0207648_10125892 | 3300026089 | Bacteria | 2254 |
| 560 | Ga0207648_10186196 | 3300026089 | Bacteria | 1839 |
| 561 | Ga0207648_10254825 | 3300026089 | Bacteria | 1565 |
| 562 | Ga0207648_10292811 | 3300026089 | Bacteria | 1458 |
| 563 | Ga0207676_10041647 | 3300026095 | Bacteria | 3527 |
| 564 | Ga0207676_10713779 | 3300026095 | Bacteria | 972 |
| 565 | Ga0207674_10024176 | 3300026116 | Bacteria | 6496 |
| 566 | Ga0207674_10060362 | 3300026116 | Bacteria | 3835 |
| 567 | Ga0207674_10089913 | 3300026116 | Bacteria | 3062 |
| 568 | Ga0207674_10277867 | 3300026116 | Bacteria | 1622 |
| 569 | Ga0207675_100014777 | 3300026118 | Bacteria | 7283 |
| 570 | Ga0207675_100020138 | 3300026118 | Bacteria | 6222 |
| 571 | Ga0207675_100035648 | 3300026118 | Bacteria | 4640 |
| 572 | Ga0207675_100267249 | 3300026118 | Bacteria | 1659 |
| 573 | Ga0207683_10040196 | 3300026121 | Bacteria | 4079 |
| 574 | Ga0207683_10051101 | 3300026121 | Bacteria | 3621 |
| 575 | Ga0207683_10126900 | 3300026121 | Bacteria | 2293 |
| 576 | Ga0207683_10373255 | 3300026121 | Bacteria | 1310 |
| 577 | Ga0207683_10458389 | 3300026121 | Bacteria | 1176 |
| 578 | Ga0207698_10636810 | 3300026142 | Bacteria | 1055 |
| 579 | Ga0209996_1017210 | 3300027395 | Bacteria | 998 |
| 580 | Ga0209968_1001019 | 3300027526 | Bacteria | 4307 |
| 581 | Ga0209970_1001463 | 3300027614 | Bacteria | 4125 |
| 582 | Ga0209983_1000576 | 3300027665 | Bacteria | 7944 |
| 583 | Ga0209983_1003615 | 3300027665 | Bacteria | 3280 |
| 584 | Ga0209971_1001545 | 3300027682 | Bacteria | 5694 |
| 585 | Ga0209971_1005862 | 3300027682 | Bacteria | 2910 |
| 586 | Ga0209966_1000029 | 3300027695 | Bacteria | 65037 |
| 587 | Ga0209998_10000768 | 3300027717 | Bacteria | 8347 |
| 588 | Ga0209813_10106099 | 3300027866 | Bacteria | 962 |
| 589 | Ga0209974_10002778 | 3300027876 | Bacteria | 6345 |
| 590 | Ga0268266_10437405 | 3300028379 | Bacteria | 1242 |
| 591 | Ga0268265_10030474 | 3300028380 | Bacteria | 3885 |
| 592 | Ga0268265_10047991 | 3300028380 | Bacteria | 3203 |
| 593 | Ga0268265_10063432 | 3300028380 | Bacteria | 2842 |
| 594 | Ga0268265_10112322 | 3300028380 | Bacteria | 2227 |
| 595 | Ga0268265_10133804 | 3300028380 | Bacteria | 2065 |
| 596 | Ga0268265_10138928 | 3300028380 | Bacteria | 2031 |
| 597 | Ga0268264_10005634 | 3300028381 | Bacteria | 10610 |
| 598 | Ga0268264_10037292 | 3300028381 | Bacteria | 4007 |
| 599 | Ga0268264_10088901 | 3300028381 | Bacteria | 2659 |
| 600 | Ga0307517_10194429 | 3300028786 | Bacteria | 1281 |
| 601 | Ga0307517_10283162 | 3300028786 | Bacteria | 943 |
| 602 | Ga0307517_10349679 | 3300028786 | Bacteria | 803 |
| 603 | Ga0307515_10000178 | 3300028794 | Bacteria | 157107 |
| 604 | Ga0307515_10007082 | 3300028794 | Bacteria | 22278 |
| 605 | Ga0307515_10013694 | 3300028794 | Bacteria | 15113 |
| 606 | Ga0307515_10186577 | 3300028794 | Bacteria | 2001 |
| 607 | Ga0307515_10221093 | 3300028794 | Bacteria | 1712 |
| 608 | Ga0265338_10184741 | 3300028800 | Bacteria | 1586 |
| 609 | Ga0265332_10000033 | 3300031238 | Bacteria | 153334 |
| 610 | Ga0265332_10005892 | 3300031238 | Bacteria | 5607 |
| 611 | Ga0265325_10129797 | 3300031241 | Bacteria | 1208 |
| 612 | Ga0265329_10035652 | 3300031242 | Bacteria | 1605 |
| 613 | Ga0265339_10107418 | 3300031249 | Bacteria | 1447 |
| 614 | Ga0265331_10005725 | 3300031250 | Bacteria | 7451 |
| 615 | Ga0265331_10055884 | 3300031250 | Bacteria | 1876 |
| 616 | Ga0265327_10000043 | 3300031251 | Bacteria | 285108 |
| 617 | Ga0265316_10039638 | 3300031344 | Bacteria | 3782 |
| 618 | Ga0307513_10000010 | 3300031456 | Bacteria | 360812 |
| 619 | Ga0307513_10000121 | 3300031456 | Bacteria | 109551 |
| 620 | Ga0307513_10018754 | 3300031456 | Bacteria | 8259 |
| 621 | Ga0307509_10457407 | 3300031507 | Bacteria | 969 |
| 622 | Ga0307408_100000008 | 3300031548 | Bacteria | 456355 |
| 623 | Ga0307408_100165763 | 3300031548 | Bacteria | 1759 |
| 624 | Ga0307408_101194529 | 3300031548 | Bacteria | 709 |
| 625 | Ga0316575_10044571 | 3300031665 | Bacteria | 1760 |
| 626 | Ga0316575_10048459 | 3300031665 | Bacteria | 1689 |
| 627 | Ga0316579_10049839 | 3300031691 | Bacteria | 1957 |
| 628 | Ga0316579_10288578 | 3300031691 | Bacteria | 793 |
| 629 | Ga0265314_10006842 | 3300031711 | Bacteria | 9991 |
| 630 | Ga0265314_10008368 | 3300031711 | Bacteria | 8865 |
| 631 | Ga0265314_10336950 | 3300031711 | Bacteria | 834 |
| 632 | Ga0265342_10024495 | 3300031712 | Bacteria | 3809 |
| 633 | Ga0265342_10030598 | 3300031712 | Bacteria | 3335 |
| 634 | Ga0316576_10001775 | 3300031727 | Bacteria | 11922 |
| 635 | Ga0316576_10002619 | 3300031727 | Bacteria | 10287 |
| 636 | Ga0316576_10023686 | 3300031727 | Bacteria | 4280 |
| 637 | Ga0316576_10032757 | 3300031727 | Bacteria | 3695 |
| 638 | Ga0316576_10033884 | 3300031727 | Bacteria | 3637 |
| 639 | Ga0316576_10036603 | 3300031727 | Bacteria | 3508 |
| 640 | Ga0316576_10067573 | 3300031727 | Bacteria | 2631 |
| 641 | Ga0316576_10158509 | 3300031727 | Bacteria | 1706 |
| 642 | Ga0316576_10391654 | 3300031727 | Bacteria | 1030 |
| 643 | Ga0316578_10000798 | 3300031728 | Bacteria | 11661 |
| 644 | Ga0316578_10013746 | 3300031728 | Bacteria | 4302 |
| 645 | Ga0316578_10030496 | 3300031728 | Bacteria | 3066 |
| 646 | Ga0316578_10047399 | 3300031728 | Bacteria | 2507 |
| 647 | Ga0316578_10059235 | 3300031728 | Bacteria | 2252 |
| 648 | Ga0316578_10090417 | 3300031728 | Bacteria | 1827 |
| 649 | Ga0316578_10182017 | 3300031728 | Bacteria | 1266 |
| 650 | Ga0307516_10002378 | 3300031730 | Bacteria | 25205 |
| 651 | Ga0307516_10005887 | 3300031730 | Bacteria | 14509 |
| 652 | Ga0307516_10570200 | 3300031730 | Bacteria | 786 |
| 653 | Ga0316577_10009861 | 3300031733 | Bacteria | 5147 |
| 654 | Ga0316577_10152920 | 3300031733 | Bacteria | 1300 |
| 655 | Ga0316577_10175676 | 3300031733 | Bacteria | 1209 |
| 656 | Ga0307413_10198960 | 3300031824 | Bacteria | 1445 |
| 657 | Ga0307410_10005441 | 3300031852 | Bacteria | 6741 |
| 658 | Ga0307410_10018840 | 3300031852 | Bacteria | 4181 |
| 659 | Ga0307406_10010235 | 3300031901 | Bacteria | 5286 |
| 660 | Ga0307406_10053466 | 3300031901 | Bacteria | 2572 |
| 661 | Ga0307412_10058043 | 3300031911 | Bacteria | 2587 |
| 662 | Ga0307412_10134042 | 3300031911 | Bacteria | 1804 |
| 663 | Ga0307412_10249010 | 3300031911 | Bacteria | 1379 |
| 664 | Ga0307412_10370111 | 3300031911 | Bacteria | 1157 |
| 665 | Ga0307412_10910244 | 3300031911 | Bacteria | 771 |
| 666 | Ga0307412_11157869 | 3300031911 | Bacteria | 691 |
| 667 | Ga0307409_100812105 | 3300031995 | Bacteria | 943 |
| 668 | Ga0307416_100014325 | 3300032002 | Bacteria | 5429 |
| 669 | Ga0307416_101732301 | 3300032002 | Bacteria | 729 |
| 670 | Ga0307414_10007104 | 3300032004 | Bacteria | 6283 |
| 671 | Ga0307414_10044693 | 3300032004 | Bacteria | 3028 |
| 672 | Ga0307411_10001688 | 3300032005 | Bacteria | 9254 |
| 673 | Ga0307411_10020197 | 3300032005 | Bacteria | 3868 |
| 674 | Ga0307415_100069326 | 3300032126 | Bacteria | 2472 |
| 675 | Ga0307415_100069811 | 3300032126 | Bacteria | 2465 |
| 676 | Ga0307415_101278943 | 3300032126 | Bacteria | 694 |
| 677 | Ga0316583_10010416 | 3300032133 | Bacteria | 3352 |
| 678 | Ga0316583_10054187 | 3300032133 | Bacteria | 1410 |
| 679 | Ga0316585_10050155 | 3300032137 | Bacteria | 1339 |
| 680 | Ga0316585_10064366 | 3300032137 | Bacteria | 1187 |
| 681 | Ga0316580_10002360 | 3300032139 | Bacteria | 5177 |
| 682 | Ga0316580_10007122 | 3300032139 | Bacteria | 3321 |
| 683 | Ga0316580_10029510 | 3300032139 | Bacteria | 1697 |
| 684 | Ga0316580_10067803 | 3300032139 | Bacteria | 1093 |
| 685 | Ga0316580_10160385 | 3300032139 | Bacteria | 690 |
| 686 | Ga0316593_10005398 | 3300032168 | Bacteria | 3367 |
| 687 | Ga0316593_10035709 | 3300032168 | Bacteria | 1636 |
| 688 | Ga0316593_10063194 | 3300032168 | Bacteria | 1269 |
| 689 | Ga0316593_10092979 | 3300032168 | Bacteria | 1063 |
| 690 | Ga0316592_1003645 | 3300033524 | Bacteria | 2796 |
| 691 | Ga0316592_1006282 | 3300033524 | Bacteria | 2285 |
| 692 | Ga0316592_1019878 | 3300033524 | Bacteria | 1423 |
| 693 | Ga0316586_1005635 | 3300033527 | Bacteria | 1770 |
| 694 | Ga0316586_1017679 | 3300033527 | Bacteria | 1152 |
| 695 | Ga0316588_1004499 | 3300033528 | Bacteria | 2646 |
| 696 | Ga0316588_1008935 | 3300033528 | Bacteria | 2077 |
| 697 | Ga0316588_1026379 | 3300033528 | Bacteria | 1345 |
| 698 | Ga0316588_1031547 | 3300033528 | Bacteria | 1244 |
| 699 | Ga0316588_1032277 | 3300033528 | Bacteria | 1231 |
| 700 | Ga0316588_1141172 | 3300033528 | Bacteria | 615 |
| 701 | Ga0316587_1000383 | 3300033529 | Bacteria | 4304 |
| 702 | Ga0316587_1002976 | 3300033529 | Bacteria | 2324 |
| 703 | Ga0316587_1039632 | 3300033529 | Bacteria | 849 |
| 704 | Ga0316596_1000394 | 3300033541 | Bacteria | 7244 |
| 705 | Ga0316596_1002261 | 3300033541 | Bacteria | 4085 |
| 706 | Ga0316596_1010352 | 3300033541 | Bacteria | 2254 |
| 707 | Ga0316596_1027499 | 3300033541 | Bacteria | 1468 |
| 708 | Ga0316596_1050225 | 3300033541 | Bacteria | 1103 |
| 709 | Ga0373948_0007970 | 3300034817 | Bacteria | 1794 |
| 710 | Ga0373959_0026928 | 3300034820 | Bacteria | 1139 |
| 711 | Ga0373934_0033151 | 3300035086 | Bacteria | 2027 |
| 712 | Ga0373949_0033932 | 3300035090 | Bacteria | 1228 |
| 713 | Ga0373952_0000782 | 3300035092 | Bacteria | 5725 |
| 714 | Ga0373939_0003522 | 3300035114 | Bacteria | 3677 |
| 715 | Ga0373939_0089969 | 3300035114 | Bacteria | 1036 |
| 716 | Ga0373945_0122326 | 3300035116 | Bacteria | 1036 |
| 717 | Ga0373943_0175733 | 3300035170 | Bacteria | 1174 |
| 718 | Ga0373946_0114156 | 3300035171 | Bacteria | 1226 |
| 719 | Ga0373962_0049958 | 3300035242 | Bacteria | 1203 |
| 720 | Ga0316574_0005456 | 3300035398 | Bacteria | 6780 |
| 721 | Ga0316574_0085608 | 3300035398 | Bacteria | 2005 |
| 722 | Ga0316574_0244048 | 3300035398 | Bacteria | 1148 |
| 723 | Ga0316574_0285703 | 3300035398 | Bacteria | 1050 |
| 724 | Ga0316574_0339714 | 3300035398 | Bacteria | 951 |
| 725 | Ga0373931_0001103 | 3300035691 | Bacteria | 11455 |
| 726 | Ga0373931_0155375 | 3300035691 | Bacteria | 1337 |
| 727 | Ga0373927_0097286 | 3300035695 | Bacteria | 1913 |
| 728 | Ga0373947_0280795 | 3300035725 | Bacteria | 1107 |
| 729 | Ga0373947_0310403 | 3300035725 | Bacteria | 1053 |
| 730 | Ga0373937_0134367 | 3300036401 | Bacteria | 2312 |
| 731 | Ga0373937_0268384 | 3300036401 | Bacteria | 1610 |
| 732 | Ga0316582_0008735 | 3300036647 | Bacteria | 5456 |
| 733 | Ga0316582_0251500 | 3300036647 | Bacteria | 1211 |
| 734 | Ga0316582_0322223 | 3300036647 | Bacteria | 1062 |
| 735 | Ga0316582_0688999 | 3300036647 | Bacteria | 702 |
| 736 | Ga0316584_0002169 | 3300036712 | Bacteria | 12292 |
| 737 | Ga0316584_0002768 | 3300036712 | Bacteria | 11217 |
| 738 | Ga0316584_0079540 | 3300036712 | Bacteria | 2456 |
| 739 | Ga0316584_0211980 | 3300036712 | Bacteria | 1425 |
| 740 | Ga0316584_0314817 | 3300036712 | Bacteria | 1130 |
| 741 | Ga0316584_0420334 | 3300036712 | Bacteria | 949 |
| 742 | Ga0316584_0541647 | 3300036712 | Bacteria | 813 |
| 743 | Ga0373925_0011540 | 3300037068 | Bacteria | 6393 |
| 744 | Ga0373925_0332102 | 3300037068 | Bacteria | 1232 |
| 745 | Ga0395899_0001756 | 3300037312 | Bacteria | 17997 |
| 746 | Ga0395899_0108877 | 3300037312 | Bacteria | 1994 |
| 747 | Ga0395900_0004771 | 3300037418 | Bacteria | 14288 |
| 748 | Ga0395900_0030415 | 3300037418 | Bacteria | 5546 |
| 749 | Ga0395900_0060539 | 3300037418 | Bacteria | 3896 |
| 750 | Ga0395900_0188924 | 3300037418 | Bacteria | 2090 |
| 751 | Ga0395900_0227543 | 3300037418 | Bacteria | 1877 |
| 752 | Ga0395900_0365348 | 3300037418 | Bacteria | 1414 |
| 753 | Ga0395898_0009054 | 3300037466 | Bacteria | 10483 |
| 754 | Ga0395898_0053216 | 3300037466 | Bacteria | 3954 |
| 755 | Ga0395898_0098846 | 3300037466 | Bacteria | 2802 |
| 756 | Ga0395898_0609028 | 3300037466 | Bacteria | 1035 |
| 757 | Ga0395898_0771871 | 3300037466 | Bacteria | 902 |
| 758 | Ga0395905_0000766 | 3300037471 | Bacteria | 42342 |
| 759 | Ga0395905_0001291 | 3300037471 | Bacteria | 30780 |
| 760 | Ga0395905_0012118 | 3300037471 | Bacteria | 8305 |
| 761 | Ga0395905_0014796 | 3300037471 | Bacteria | 7440 |
| 762 | Ga0395905_0016964 | 3300037471 | Bacteria | 6914 |
| 763 | Ga0395905_0020727 | 3300037471 | Bacteria | 6223 |
| 764 | Ga0395905_0026748 | 3300037471 | Bacteria | 5440 |
| 765 | Ga0395905_0068703 | 3300037471 | Bacteria | 3318 |
| 766 | Ga0395905_0092246 | 3300037471 | Bacteria | 2840 |
| 767 | Ga0395905_0099460 | 3300037471 | Bacteria | 2731 |
| 768 | Ga0395905_0124829 | 3300037471 | Bacteria | 2420 |
| 769 | Ga0395905_0206586 | 3300037471 | Bacteria | 1840 |
| 770 | Ga0395905_0284423 | 3300037471 | Bacteria | 1540 |
| 771 | Ga0395905_0942309 | 3300037471 | Bacteria | 766 |
| 772 | Ga0436364_0110021 | 3300037853 | Bacteria | 921 |
| 773 | Ga0395901_0008851 | 3300038443 | Bacteria | 10191 |
| 774 | Ga0395901_0019770 | 3300038443 | Bacteria | 6886 |
| 775 | Ga0395901_0058625 | 3300038443 | Bacteria | 4004 |
| 776 | Ga0395901_0086077 | 3300038443 | Bacteria | 3286 |
| 777 | Ga0395901_0366081 | 3300038443 | Bacteria | 1486 |
| 778 | Ga0436361_0287447 | 3300039447 | Bacteria | 113524 |
| 779 | Ga0436361_0678114 | 3300039447 | Bacteria | 29523 |
| 780 | Ga0436361_1178843 | 3300039447 | Bacteria | 1056 |
| 781 | Ga0439453_0022910 | 3300041408 | Bacteria | 1136 |
| 782 | Ga0451798_0103100 | 3300041458 | Bacteria | 612 |
| 783 | Ga0451798_0705620 | 3300041458 | Bacteria | 629 |
| 784 | Ga0451849_0427330 | 3300041505 | Bacteria | 929 |
| 785 | Ga0439431_0005395 | 3300041997 | Bacteria | 2824 |
| 786 | Ga0439437_015198 | 3300042000 | Bacteria | 903 |
| 787 | Ga0439449_0013312 | 3300042007 | Bacteria | 3095 |
| 788 | Ga0439457_011808 | 3300042014 | Bacteria | 1977 |
| 789 | Ga0439462_0000705 | 3300042015 | Bacteria | 6854 |
| 790 | Ga0450888_013593 | 3300042126 | Bacteria | 977 |
| 791 | Ga0450891_001234 | 3300042129 | Bacteria | 2659 |
| 792 | Ga0450892_002535 | 3300042130 | Bacteria | 1552 |
| 793 | Ga0450902_039386 | 3300042137 | Bacteria | 803 |
| 794 | Ga0450889_004023 | 3300042144 | Bacteria | 1451 |
| 795 | Ga0439435_0077011 | 3300042436 | Bacteria | 996 |
| 796 | Ga0450893_0005510 | 3300042532 | Bacteria | 2033 |
| 797 | Ga0451577_0053739 | 3300042876 | Bacteria | 3595 |
| 798 | Ga0451577_0069012 | 3300042876 | Bacteria | 3152 |
| 799 | Ga0451577_0101947 | 3300042876 | Bacteria | 2564 |
| 800 | Ga0451577_0354764 | 3300042876 | Bacteria | 1330 |
| 801 | Ga0451577_0355963 | 3300042876 | Bacteria | 1328 |
| 802 | Ga0451577_0413853 | 3300042876 | Bacteria | 1224 |
| 803 | Ga0466969_0016587 | 3300044656 | Bacteria | 3852 |
| 804 | Ga0466969_0023883 | 3300044656 | Bacteria | 3146 |
| 805 | Ga0466972_0037986 | 3300044658 | Bacteria | 2352 |
| 806 | Ga0453683_0002126 | 3300044673 | Bacteria | 15797 |
| 807 | Ga0466965_0077858 | 3300044683 | Bacteria | 1674 |
| 808 | Ga0466966_0003258 | 3300044684 | Bacteria | 10703 |
| 809 | Ga0466966_0108259 | 3300044684 | Bacteria | 1714 |
| 810 | Ga0466966_0276151 | 3300044684 | Bacteria | 1011 |
| 811 | Ga0466961_0099700 | 3300044693 | Bacteria | 1830 |
| 812 | Ga0466961_0101036 | 3300044693 | Bacteria | 1817 |
| 813 | Ga0466963_0295644 | 3300044694 | Bacteria | 1139 |
| 814 | Ga0466963_0312675 | 3300044694 | Bacteria | 1105 |
| 815 | Ga0466963_0334919 | 3300044694 | Bacteria | 1065 |
| 816 | Ga0466964_0051982 | 3300044706 | Bacteria | 1683 |
| 817 | Ga0453684_0010561 | 3300044712 | Bacteria | 15762 |
| 818 | Ga0453684_0039888 | 3300044712 | Bacteria | 6387 |
| 819 | Ga0453684_0040403 | 3300044712 | Bacteria | 6334 |
| 820 | Ga0453684_0196771 | 3300044712 | Bacteria | 2353 |
| 821 | Ga0453684_0295646 | 3300044712 | Bacteria | 1842 |
| 822 | Ga0453684_0398824 | 3300044712 | Bacteria | 1541 |
| 823 | Ga0453684_0441204 | 3300044712 | Bacteria | 1451 |
| 824 | Ga0453684_0668228 | 3300044712 | Bacteria | 1132 |
| 825 | Ga0466971_0033519 | 3300044719 | Bacteria | 2301 |
| 826 | Ga0466970_0011494 | 3300044765 | Bacteria | 4513 |
| 827 | Ga0466957_0010823 | 3300044842 | Bacteria | 5245 |
| 828 | Ga0466957_0062916 | 3300044842 | Bacteria | 2280 |
| 829 | Ga0466957_0602662 | 3300044842 | Bacteria | 769 |
| 830 | Ga0466959_0024293 | 3300045049 | Bacteria | 4488 |
| 831 | Ga0466959_0029610 | 3300045049 | Bacteria | 4056 |
| 832 | Ga0451576_0005135 | 3300045051 | Bacteria | 16590 |
| 833 | Ga0451576_0027293 | 3300045051 | Bacteria | 6134 |
| 834 | Ga0451576_0040243 | 3300045051 | Bacteria | 4949 |
| 835 | Ga0451576_0135333 | 3300045051 | Bacteria | 2569 |
| 836 | Ga0451576_0326585 | 3300045051 | Bacteria | 1606 |
| 837 | Ga0451576_0357068 | 3300045051 | Bacteria | 1530 |
| 838 | Ga0466958_0026784 | 3300045836 | Bacteria | 3407 |
| 839 | Ga0466958_0879166 | 3300045836 | Bacteria | 585 |
| 840 | Ga0495650_0009489 | 3300046471 | Bacteria | 5526 |
| 841 | Ga0495605_0352638 | 3300046474 | Bacteria | 617 |
| 842 | Ga0495583_0001275 | 3300046506 | Bacteria | 26345 |
| 843 | Ga0495606_0021187 | 3300046507 | Bacteria | 4764 |
| 844 | Ga0495606_0024795 | 3300046507 | Bacteria | 4312 |
| 845 | Ga0495632_0010763 | 3300046519 | Bacteria | 5390 |
| 846 | Ga0495648_0090864 | 3300046524 | Bacteria | 1710 |
| 847 | Ga0495642_0065383 | 3300046528 | Bacteria | 1514 |
| 848 | Ga0495652_0607795 | 3300046529 | Bacteria | 745 |
| 849 | Ga0495654_0166021 | 3300046530 | Bacteria | 966 |
| 850 | Ga0495598_0060682 | 3300046537 | Bacteria | 1166 |
| 851 | Ga0495621_0008072 | 3300046539 | Bacteria | 3140 |
| 852 | Ga0495621_0087741 | 3300046539 | Bacteria | 1169 |
| 853 | Ga0495597_0016988 | 3300046542 | Bacteria | 3430 |
| 854 | Ga0495633_0261256 | 3300046558 | Bacteria | 789 |
| 855 | Ga0495656_0026669 | 3300046615 | Bacteria | 2302 |
| 856 | Ga0495668_0090235 | 3300046616 | Bacteria | 1679 |
| 857 | Ga0495625_0039914 | 3300046660 | Bacteria | 3426 |
| 858 | Ga0495625_0114983 | 3300046660 | Bacteria | 1836 |
| 859 | Ga0495588_0335815 | 3300046674 | Bacteria | 795 |
| 860 | Ga0495647_0146392 | 3300046681 | Bacteria | 1010 |
| 861 | Ga0495669_0019999 | 3300046684 | Bacteria | 2893 |
| 862 | Ga0495671_0173846 | 3300046692 | Bacteria | 1046 |
| 863 | Ga0495649_0002640 | 3300046694 | Bacteria | 12495 |
| 864 | Ga0495649_0012323 | 3300046694 | Bacteria | 4982 |
| 865 | Ga0495589_0033363 | 3300046794 | Bacteria | 2586 |
| 866 | Ga0495600_0046717 | 3300046809 | Bacteria | 2824 |
| 867 | Ga0495660_0138009 | 3300046810 | Bacteria | 1216 |
| 868 | Ga0495687_000790 | 3300047443 | Bacteria | 34028 |
| 869 | Ga0495687_014895 | 3300047443 | Bacteria | 3974 |
| 870 | Ga0495685_089313 | 3300047447 | Bacteria | 1022 |
| 871 | Ga0495686_0006292 | 3300047472 | Bacteria | 9129 |
| 872 | Ga0496100_0252142 | 3300048903 | Bacteria | 1306 |
| 873 | Ga0496101_0026022 | 3300048904 | Bacteria | 4065 |
| 874 | Ga0496102_0041398 | 3300048905 | Bacteria | 4171 |
| 875 | Ga0496103_0082579 | 3300048906 | Bacteria | 2022 |
| 876 | Ga0496105_0138860 | 3300048908 | Bacteria | 2001 |
| 877 | Ga0496105_0285447 | 3300048908 | Bacteria | 1330 |
| 878 | Ga0496106_0007016 | 3300048909 | Bacteria | 8320 |
| 879 | Ga0496106_0228967 | 3300048909 | Bacteria | 1484 |
| 880 | Ga0496106_0622549 | 3300048909 | Bacteria | 864 |
| 881 | Ga0496107_0003667 | 3300048910 | Bacteria | 10323 |
| 882 | Ga0496108_0100651 | 3300048911 | Bacteria | 2465 |
| 883 | Ga0496108_0811767 | 3300048911 | Bacteria | 807 |
| 884 | Ga0496109_0688124 | 3300048912 | Bacteria | 960 |
| 885 | Ga0496110_0082466 | 3300048913 | Bacteria | 2868 |
| 886 | Ga0496110_0392366 | 3300048913 | Bacteria | 1265 |
| 887 | Ga0496110_0485215 | 3300048913 | Bacteria | 1126 |
| 888 | Ga0496114_0040304 | 3300048917 | Bacteria | 3866 |
| 889 | Ga0496114_0321718 | 3300048917 | Bacteria | 1367 |
| 890 | Ga0496114_0892279 | 3300048917 | Bacteria | 770 |
| 891 | Ga0496115_0110638 | 3300048918 | Bacteria | 2257 |
| 892 | Ga0496126_0073906 | 3300048929 | Bacteria | 3029 |
| 893 | Ga0496126_0098894 | 3300048929 | Bacteria | 2556 |
| 894 | Ga0501321_033060 | 3300049537 | Bacteria | 699 |
| 895 | Ga0501031_0344540 | 3300049568 | Bacteria | 965 |
| 896 | Ga0501032_0042298 | 3300049569 | Bacteria | 3091 |
| 897 | Ga0501033_0003126 | 3300049570 | Bacteria | 13757 |
| 898 | Ga0501034_0144355 | 3300049571 | Bacteria | 2358 |
| 899 | Ga0501036_0048691 | 3300049572 | Bacteria | 3588 |
| 900 | Ga0501036_0373238 | 3300049572 | Bacteria | 1191 |
| 901 | Ga0501038_0001778 | 3300049574 | Bacteria | 20024 |
| 902 | Ga0501038_0002840 | 3300049574 | Bacteria | 16115 |
| 903 | Ga0501038_0016852 | 3300049574 | Bacteria | 6613 |
| 904 | Ga0501039_0185429 | 3300049575 | Bacteria | 1636 |
| 905 | Ga0501043_0117673 | 3300049579 | Bacteria | 2085 |
| 906 | Ga0501043_0208325 | 3300049579 | Bacteria | 1515 |
| 907 | Ga0501046_0212720 | 3300049580 | Bacteria | 1434 |
| 908 | Ga0501047_0051037 | 3300049581 | Bacteria | 3995 |
| 909 | Ga0501047_0129991 | 3300049581 | Bacteria | 2399 |
| 910 | Ga0501047_0201281 | 3300049581 | Bacteria | 1852 |
| 911 | Ga0501067_0044231 | 3300049583 | Bacteria | 2474 |
| 912 | Ga0501067_0126021 | 3300049583 | Bacteria | 1425 |
| 913 | Ga0501068_0087775 | 3300049584 | Bacteria | 1916 |
| 914 | Ga0501070_0020843 | 3300049586 | Bacteria | 5499 |
| 915 | Ga0501072_0151564 | 3300049588 | Bacteria | 1848 |
| 916 | Ga0501074_0049464 | 3300049590 | Bacteria | 3035 |
| 917 | Ga0501206_044493 | 3300049653 | Bacteria | 693 |
| 918 | Ga0501249_123915 | 3300049679 | Bacteria | 633 |
| 919 | Ga0501080_0012284 | 3300049742 | Bacteria | 7845 |
| 920 | Ga0501080_0223535 | 3300049742 | Bacteria | 1722 |
| 921 | Ga0501083_0020376 | 3300049744 | Bacteria | 4613 |
| 922 | Ga0501268_009130 | 3300049765 | Bacteria | 1518 |
| 923 | Ga0501035_0040039 | 3300049822 | Bacteria | 4237 |
| 924 | Ga0501035_0335483 | 3300049822 | Bacteria | 1268 |
| 925 | Ga0501044_0000190 | 3300049823 | Bacteria | 77415 |
| 926 | Ga0501044_0007285 | 3300049823 | Bacteria | 12155 |
| 927 | Ga0501044_0199944 | 3300049823 | Bacteria | 1957 |
| 928 | Ga0501044_0411221 | 3300049823 | Bacteria | 1264 |
| 929 | nmdc:mga03683_404348_c1 | 3300050489 | Bacteria | 652 |
| 930 | nmdc:mga03683_9197_c1 | 3300050489 | Bacteria | 3504 |
| 931 | nmdc:mga03n38_22608_c1 | 3300050490 | Bacteria | 2548 |
| 932 | nmdc:mga00v17_479592_c1 | 3300050491 | Bacteria | 807 |
| 933 | nmdc:mga0yw44_81222_c1 | 3300050492 | Bacteria | 2032 |
| 934 | nmdc:mga0yw44_84203_c1 | 3300050492 | Bacteria | 1999 |
| 935 | nmdc:mga0yw44_89251_c1 | 3300050492 | Bacteria | 1945 |
| 936 | nmdc:mga0k408_103702_c1 | 3300050493 | Bacteria | 1678 |
| 937 | nmdc:mga0k408_11575_c1 | 3300050493 | Bacteria | 4808 |
| 938 | nmdc:mga0k408_1329_c1 | 3300050493 | Bacteria | 13372 |
| 939 | nmdc:mga0k408_148_c1 | 3300050493 | Bacteria | 35989 |
| 940 | nmdc:mga0k408_166294_c1 | 3300050493 | Bacteria | 1314 |
| 941 | nmdc:mga0k408_19570_c1 | 3300050493 | Bacteria | 3785 |
| 942 | nmdc:mga0k408_20110_c1 | 3300050493 | Bacteria | 3736 |
| 943 | nmdc:mga0k408_209017_c1 | 3300050493 | Bacteria | 1165 |
| 944 | nmdc:mga0k408_229191_c1 | 3300050493 | Bacteria | 1109 |
| 945 | nmdc:mga0k408_24729_c1 | 3300050493 | Bacteria | 3397 |
| 946 | nmdc:mga0k408_460634_c1 | 3300050493 | Bacteria | 755 |
| 947 | nmdc:mga0k408_485201_c1 | 3300050493 | Bacteria | 733 |
| 948 | nmdc:mga0k408_50348_c1 | 3300050493 | Bacteria | 2412 |
| 949 | nmdc:mga0k408_55388_c1 | 3300050493 | Bacteria | 2300 |
| 950 | nmdc:mga06z11_15349_c1 | 3300050494 | Bacteria | 3417 |
| 951 | nmdc:mga06z11_161280_c1 | 3300050494 | Bacteria | 1282 |
| 952 | nmdc:mga06z11_194338_c1 | 3300050494 | Bacteria | 1176 |
| 953 | nmdc:mga06z11_203047_c1 | 3300050494 | Bacteria | 1152 |
| 954 | nmdc:mga06z11_330043_c1 | 3300050494 | Bacteria | 911 |
| 955 | nmdc:mga06z11_49023_c1 | 3300050494 | Bacteria | 2152 |
| 956 | nmdc:mga04h51_7088_c1 | 3300050495 | Bacteria | 2941 |
| 957 | nmdc:mga07m45_138780_c1 | 3300050496 | Bacteria | 1408 |
| 958 | nmdc:mga07m45_1748_c1 | 3300050496 | Bacteria | 10008 |
| 959 | nmdc:mga07m45_295207_c1 | 3300050496 | Bacteria | 943 |
| 960 | nmdc:mga07m45_39199_c1 | 3300050496 | Bacteria | 2647 |
| 961 | nmdc:mga07m45_7066_c1 | 3300050496 | Bacteria | 5714 |
| 962 | nmdc:mga05p37_21359_c1 | 3300050507 | Bacteria | 7840 |
| 963 | nmdc:mga05p37_329145_c2 | 3300050507 | Bacteria | 855 |
| 964 | nmdc:mga09592_1507_c1 | 3300050508 | Bacteria | 18749 |
| 965 | nmdc:mga0qj67_625084_c1 | 3300050509 | Bacteria | 860 |
| 966 | nmdc:mga06r32_372966_c1 | 3300050510 | Bacteria | 1410 |
| 967 | nmdc:mga08y16_275352_c1 | 3300050511 | Bacteria | 1737 |
| 968 | nmdc:mga0n895_862014_c1 | 3300050512 | Bacteria | 893 |
| 969 | nmdc:mga0rr50_723454_c1 | 3300050513 | Bacteria | 849 |
| 970 | nmdc:mga0a205_704416_c1 | 3300050515 | Bacteria | 859 |
| 971 | nmdc:mga0sz30_66687_c1 | 3300050516 | Bacteria | 1545 |
| 972 | nmdc:mga0sz30_72880_c1 | 3300050516 | Bacteria | 1480 |
| 973 | Ga0495619_0329632 | 3300053085 | Bacteria | 1057 |
| 974 | Ga0500569_002749 | 3300053109 | Bacteria | 3504 |
| 975 | Ga0500568_0040985 | 3300053139 | Bacteria | 1862 |
| 976 | Ga0500622_0000875 | 3300053156 | Bacteria | 25652 |
| 977 | Ga0590071_086766 | 3300059421 | Bacteria | 781 |
| 978 | Ga0590075_039292 | 3300059424 | Bacteria | 1207 |
| 979 | Ga0590075_162080 | 3300059424 | Bacteria | 590 |
| 980 | Ga0466962_0033010 | 3300061719 | Bacteria | 2476 |
| 981 | Ga0466962_0140193 | 3300061719 | Bacteria | 1171 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300014745 | Ga0157377_10614920 | Ga0157377_106149201 | 175 |
| 2 | 3300046524 | Ga0495648_0090864 | Ga0495648_0090864_828_1376 | 175 |
| 3 | 3300003752 | Ga0055539_1005175 | Ga0055539_10051752 | 176 |
| 4 | 3300003756 | Ga0055533_1000006 | Ga0055533_1000006141 | 176 |
| 5 | 3300003759 | Ga0055525_1001050 | Ga0055525_10010502 | 176 |
| 6 | 3300003761 | Ga0055535_1000702 | Ga0055535_10007022 | 176 |
| 7 | 3300003763 | Ga0055529_1000340 | Ga0055529_100034026 | 176 |
| 8 | 3300005290 | Ga0065712_10414260 | Ga0065712_104142601 | 176 |
| 9 | 3300005327 | Ga0070658_10355992 | Ga0070658_103559922 | 176 |
| 10 | 3300005327 | Ga0070658_10381235 | Ga0070658_103812352 | 176 |
| 11 | 3300005328 | Ga0070676_10003114 | Ga0070676_100031143 | 176 |
| 12 | 3300005338 | Ga0068868_100005289 | Ga0068868_1000052894 | 176 |
| 13 | 3300005344 | Ga0070661_100003350 | Ga0070661_1000033508 | 176 |
| 14 | 3300005347 | Ga0070668_100470585 | Ga0070668_1004705852 | 176 |
| 15 | 3300005353 | Ga0070669_100120123 | Ga0070669_1001201232 | 176 |
| 16 | 3300005354 | Ga0070675_100004442 | Ga0070675_10000444210 | 176 |
| 17 | 3300005354 | Ga0070675_100127239 | Ga0070675_1001272392 | 176 |
| 18 | 3300005355 | Ga0070671_100083652 | Ga0070671_1000836523 | 176 |
| 19 | 3300005355 | Ga0070671_100267940 | Ga0070671_1002679402 | 176 |
| 20 | 3300005356 | Ga0070674_100285037 | Ga0070674_1002850372 | 176 |
| 21 | 3300005364 | Ga0070673_100011989 | Ga0070673_1000119892 | 176 |
| 22 | 3300005364 | Ga0070673_100060774 | Ga0070673_1000607742 | 176 |
| 23 | 3300005364 | Ga0070673_100169243 | Ga0070673_1001692432 | 176 |
| 24 | 3300005365 | Ga0070688_100847574 | Ga0070688_1008475741 | 176 |
| 25 | 3300005366 | Ga0070659_100141291 | Ga0070659_1001412912 | 176 |
| 26 | 3300005445 | Ga0070708_101176366 | Ga0070708_1011763661 | 176 |
| 27 | 3300005455 | Ga0070663_100109842 | Ga0070663_1001098422 | 176 |
| 28 | 3300005457 | Ga0070662_100008653 | Ga0070662_1000086537 | 176 |
| 29 | 3300005457 | Ga0070662_100382564 | Ga0070662_1003825641 | 176 |
| 30 | 3300005459 | Ga0068867_100003867 | Ga0068867_1000038674 | 176 |
| 31 | 3300005459 | Ga0068867_100178516 | Ga0068867_1001785162 | 176 |
| 32 | 3300005467 | Ga0070706_100118675 | Ga0070706_1001186752 | 176 |
| 33 | 3300005468 | Ga0070707_100203639 | Ga0070707_1002036392 | 176 |
| 34 | 3300005471 | Ga0070698_100264266 | Ga0070698_1002642662 | 176 |
| 35 | 3300005539 | Ga0068853_100016533 | Ga0068853_1000165335 | 176 |
| 36 | 3300005539 | Ga0068853_100169118 | Ga0068853_1001691182 | 176 |
| 37 | 3300005539 | Ga0068853_100624162 | Ga0068853_1006241621 | 176 |
| 38 | 3300005543 | Ga0070672_100002447 | Ga0070672_10000244711 | 176 |
| 39 | 3300005547 | Ga0070693_100116592 | Ga0070693_1001165923 | 176 |
| 40 | 3300005563 | Ga0068855_100262901 | Ga0068855_1002629012 | 176 |
| 41 | 3300005577 | Ga0068857_100162416 | Ga0068857_1001624162 | 176 |
| 42 | 3300005578 | Ga0068854_100852354 | Ga0068854_1008523541 | 176 |
| 43 | 3300005616 | Ga0068852_100117707 | Ga0068852_1001177072 | 176 |
| 44 | 3300005616 | Ga0068852_100141142 | Ga0068852_1001411423 | 176 |
| 45 | 3300005719 | Ga0068861_100036313 | Ga0068861_1000363133 | 176 |
| 46 | 3300005841 | Ga0068863_100952990 | Ga0068863_1009529901 | 176 |
| 47 | 3300005844 | Ga0068862_101634610 | Ga0068862_1016346101 | 176 |
| 48 | 3300006038 | Ga0075365_10028653 | Ga0075365_100286533 | 176 |
| 49 | 3300006048 | Ga0075363_100033613 | Ga0075363_1000336132 | 176 |
| 50 | 3300006048 | Ga0075363_100334914 | Ga0075363_1003349142 | 176 |
| 51 | 3300006051 | Ga0075364_10101510 | Ga0075364_101015102 | 176 |
| 52 | 3300006177 | Ga0075362_10004144 | Ga0075362_100041442 | 176 |
| 53 | 3300006177 | Ga0075362_10016593 | Ga0075362_100165933 | 176 |
| 54 | 3300006178 | Ga0075367_10055393 | Ga0075367_100553932 | 176 |
| 55 | 3300006178 | Ga0075367_10084616 | Ga0075367_100846162 | 176 |
| 56 | 3300006178 | Ga0075367_10116234 | Ga0075367_101162342 | 176 |
| 57 | 3300006178 | Ga0075367_10177445 | Ga0075367_101774452 | 176 |
| 58 | 3300006195 | Ga0075366_10020363 | Ga0075366_100203633 | 176 |
| 59 | 3300006195 | Ga0075366_10022395 | Ga0075366_100223953 | 176 |
| 60 | 3300006195 | Ga0075366_10026318 | Ga0075366_100263182 | 176 |
| 61 | 3300006195 | Ga0075366_10044832 | Ga0075366_100448323 | 176 |
| 62 | 3300006195 | Ga0075366_10052485 | Ga0075366_100524852 | 176 |
| 63 | 3300006353 | Ga0075370_10000607 | Ga0075370_1000060714 | 176 |
| 64 | 3300006353 | Ga0075370_10003963 | Ga0075370_100039634 | 176 |
| 65 | 3300006353 | Ga0075370_10009619 | Ga0075370_100096192 | 176 |
| 66 | 3300006353 | Ga0075370_10018992 | Ga0075370_100189923 | 176 |
| 67 | 3300006353 | Ga0075370_10187168 | Ga0075370_101871682 | 176 |
| 68 | 3300006881 | Ga0068865_100059260 | Ga0068865_1000592603 | 176 |
| 69 | 3300009093 | Ga0105240_10026912 | Ga0105240_100269122 | 176 |
| 70 | 3300009147 | Ga0114129_10077730 | Ga0114129_100777303 | 176 |
| 71 | 3300009545 | Ga0105237_10639506 | Ga0105237_106395061 | 176 |
| 72 | 3300010375 | Ga0105239_10035331 | Ga0105239_100353314 | 176 |
| 73 | 3300010375 | Ga0105239_10439208 | Ga0105239_104392081 | 176 |
| 74 | 3300011119 | Ga0105246_10124310 | Ga0105246_101243102 | 176 |
| 75 | 3300013100 | Ga0157373_10014120 | Ga0157373_100141203 | 176 |
| 76 | 3300013104 | Ga0157370_10011086 | Ga0157370_1001108610 | 176 |
| 77 | 3300013105 | Ga0157369_10139689 | Ga0157369_101396891 | 176 |
| 78 | 3300013296 | Ga0157374_10435906 | Ga0157374_104359061 | 176 |
| 79 | 3300013297 | Ga0157378_10051563 | Ga0157378_100515633 | 176 |
| 80 | 3300013307 | Ga0157372_10562488 | Ga0157372_105624882 | 176 |
| 81 | 3300013308 | Ga0157375_10249533 | Ga0157375_102495333 | 176 |
| 82 | 3300014497 | Ga0182008_10351666 | Ga0182008_103516661 | 176 |
| 83 | 3300014745 | Ga0157377_10218330 | Ga0157377_102183302 | 176 |
| 84 | 3300021361 | Ga0213872_10000003 | Ga0213872_100000039 | 176 |
| 85 | 3300025226 | Ga0209674_100003 | Ga0209674_1000031195 | 176 |
| 86 | 3300025230 | Ga0209563_100010 | Ga0209563_100010923 | 176 |
| 87 | 3300025242 | Ga0209258_100060 | Ga0209258_100060116 | 176 |
| 88 | 3300025253 | Ga0209677_100026 | Ga0209677_10002612 | 176 |
| 89 | 3300025253 | Ga0209677_106728 | Ga0209677_1067282 | 176 |
| 90 | 3300025254 | Ga0209148_1008101 | Ga0209148_10081012 | 176 |
| 91 | 3300025256 | Ga0209759_1000663 | Ga0209759_10006637 | 176 |
| 92 | 3300025272 | Ga0209455_1000093 | Ga0209455_1000093122 | 176 |
| 93 | 3300025899 | Ga0207642_10122933 | Ga0207642_101229331 | 176 |
| 94 | 3300025901 | Ga0207688_10226644 | Ga0207688_102266441 | 176 |
| 95 | 3300025903 | Ga0207680_10234937 | Ga0207680_102349371 | 176 |
| 96 | 3300025907 | Ga0207645_10001190 | Ga0207645_100011902 | 176 |
| 97 | 3300025908 | Ga0207643_10019116 | Ga0207643_100191163 | 176 |
| 98 | 3300025908 | Ga0207643_10435912 | Ga0207643_104359121 | 176 |
| 99 | 3300025910 | Ga0207684_10045154 | Ga0207684_100451542 | 176 |
| 100 | 3300025913 | Ga0207695_10018064 | Ga0207695_100180647 | 176 |
| 101 | 3300025913 | Ga0207695_10499108 | Ga0207695_104991081 | 176 |
| 102 | 3300025918 | Ga0207662_10156985 | Ga0207662_101569852 | 176 |
| 103 | 3300025919 | Ga0207657_10035340 | Ga0207657_100353404 | 176 |
| 104 | 3300025921 | Ga0207652_11212238 | Ga0207652_112122381 | 176 |
| 105 | 3300025923 | Ga0207681_10068098 | Ga0207681_100680982 | 176 |
| 106 | 3300025925 | Ga0207650_10799132 | Ga0207650_107991321 | 176 |
| 107 | 3300025926 | Ga0207659_10021623 | Ga0207659_100216232 | 176 |
| 108 | 3300025926 | Ga0207659_10030715 | Ga0207659_100307152 | 176 |
| 109 | 3300025927 | Ga0207687_10048767 | Ga0207687_100487673 | 176 |
| 110 | 3300025927 | Ga0207687_10249590 | Ga0207687_102495901 | 176 |
| 111 | 3300025931 | Ga0207644_10097386 | Ga0207644_100973862 | 176 |
| 112 | 3300025931 | Ga0207644_10120098 | Ga0207644_101200981 | 176 |
| 113 | 3300025932 | Ga0207690_10124324 | Ga0207690_101243242 | 176 |
| 114 | 3300025933 | Ga0207706_10003498 | Ga0207706_1000349811 | 176 |
| 115 | 3300025938 | Ga0207704_10103926 | Ga0207704_101039262 | 176 |
| 116 | 3300025940 | Ga0207691_10044537 | Ga0207691_100445372 | 176 |
| 117 | 3300025942 | Ga0207689_10020361 | Ga0207689_100203613 | 176 |
| 118 | 3300025942 | Ga0207689_10200002 | Ga0207689_102000022 | 176 |
| 119 | 3300025945 | Ga0207679_10111289 | Ga0207679_101112892 | 176 |
| 120 | 3300025945 | Ga0207679_11467526 | Ga0207679_114675261 | 176 |
| 121 | 3300025949 | Ga0207667_10493162 | Ga0207667_104931622 | 176 |
| 122 | 3300025960 | Ga0207651_10006141 | Ga0207651_100061416 | 176 |
| 123 | 3300025960 | Ga0207651_10112746 | Ga0207651_101127462 | 176 |
| 124 | 3300026023 | Ga0207677_10014503 | Ga0207677_100145032 | 176 |
| 125 | 3300026023 | Ga0207677_10419687 | Ga0207677_104196872 | 176 |
| 126 | 3300026067 | Ga0207678_10099991 | Ga0207678_100999912 | 176 |
| 127 | 3300026089 | Ga0207648_10012441 | Ga0207648_100124413 | 176 |
| 128 | 3300026116 | Ga0207674_10060362 | Ga0207674_100603622 | 176 |
| 129 | 3300026118 | Ga0207675_100020138 | Ga0207675_1000201384 | 176 |
| 130 | 3300026118 | Ga0207675_100267249 | Ga0207675_1002672492 | 176 |
| 131 | 3300027526 | Ga0209968_1001019 | Ga0209968_10010192 | 176 |
| 132 | 3300027695 | Ga0209966_1000029 | Ga0209966_10000292 | 176 |
| 133 | 3300028786 | Ga0307517_10194429 | Ga0307517_101944292 | 176 |
| 134 | 3300028786 | Ga0307517_10283162 | Ga0307517_102831621 | 176 |
| 135 | 3300028786 | Ga0307517_10349679 | Ga0307517_103496792 | 176 |
| 136 | 3300031250 | Ga0265331_10055884 | Ga0265331_100558842 | 176 |
| 137 | 3300031251 | Ga0265327_10000043 | Ga0265327_100000439 | 176 |
| 138 | 3300031507 | Ga0307509_10457407 | Ga0307509_104574072 | 176 |
| 139 | 3300031548 | Ga0307408_101194529 | Ga0307408_1011945291 | 176 |
| 140 | 3300031730 | Ga0307516_10002378 | Ga0307516_1000237814 | 176 |
| 141 | 3300031911 | Ga0307412_10370111 | Ga0307412_103701111 | 176 |
| 142 | 3300032168 | Ga0316593_10005398 | Ga0316593_100053981 | 176 |
| 143 | 3300033541 | Ga0316596_1027499 | Ga0316596_10274992 | 176 |
| 144 | 3300035086 | Ga0373934_0033151 | Ga0373934_0033151_621_1172 | 176 |
| 145 | 3300036401 | Ga0373937_0268384 | Ga0373937_0268384_983_1525 | 176 |
| 146 | 3300036647 | Ga0316582_0251500 | Ga0316582_0251500_315_860 | 176 |
| 147 | 3300037312 | Ga0395899_0108877 | Ga0395899_0108877_973_1524 | 176 |
| 148 | 3300038443 | Ga0395901_0008851 | Ga0395901_0008851_5966_6517 | 176 |
| 149 | 3300039447 | Ga0436361_0678114 | Ga0436361_0678114_2161_2700 | 176 |
| 150 | 3300039447 | Ga0436361_1178843 | Ga0436361_1178843_224_766 | 176 |
| 151 | 3300044656 | Ga0466969_0016587 | Ga0466969_0016587_2420_2962 | 176 |
| 152 | 3300044683 | Ga0466965_0077858 | Ga0466965_0077858_104_646 | 176 |
| 153 | 3300044684 | Ga0466966_0108259 | Ga0466966_0108259_904_1446 | 176 |
| 154 | 3300044693 | Ga0466961_0099700 | Ga0466961_0099700_766_1308 | 176 |
| 155 | 3300044706 | Ga0466964_0051982 | Ga0466964_0051982_644_1186 | 176 |
| 156 | 3300044719 | Ga0466971_0033519 | Ga0466971_0033519_483_1025 | 176 |
| 157 | 3300044765 | Ga0466970_0011494 | Ga0466970_0011494_2166_2708 | 176 |
| 158 | 3300044842 | Ga0466957_0010823 | Ga0466957_0010823_1527_2069 | 176 |
| 159 | 3300045049 | Ga0466959_0029610 | Ga0466959_0029610_3134_3676 | 176 |
| 160 | 3300045836 | Ga0466958_0026784 | Ga0466958_0026784_2639_3181 | 176 |
| 161 | 3300046471 | Ga0495650_0009489 | Ga0495650_0009489_787_1326 | 176 |
| 162 | 3300046474 | Ga0495605_0352638 | Ga0495605_0352638_20_556 | 176 |
| 163 | 3300046506 | Ga0495583_0001275 | Ga0495583_0001275_25457_26008 | 176 |
| 164 | 3300046507 | Ga0495606_0024795 | Ga0495606_0024795_2554_3105 | 176 |
| 165 | 3300046519 | Ga0495632_0010763 | Ga0495632_0010763_4406_4942 | 176 |
| 166 | 3300046529 | Ga0495652_0607795 | Ga0495652_0607795_177_728 | 176 |
| 167 | 3300046530 | Ga0495654_0166021 | Ga0495654_0166021_252_788 | 176 |
| 168 | 3300046537 | Ga0495598_0060682 | Ga0495598_0060682_591_1130 | 176 |
| 169 | 3300046539 | Ga0495621_0008072 | Ga0495621_0008072_838_1377 | 176 |
| 170 | 3300046542 | Ga0495597_0016988 | Ga0495597_0016988_2116_2652 | 176 |
| 171 | 3300046616 | Ga0495668_0090235 | Ga0495668_0090235_418_969 | 176 |
| 172 | 3300046660 | Ga0495625_0039914 | Ga0495625_0039914_2815_3351 | 176 |
| 173 | 3300046660 | Ga0495625_0114983 | Ga0495625_0114983_299_850 | 176 |
| 174 | 3300046684 | Ga0495669_0019999 | Ga0495669_0019999_784_1335 | 176 |
| 175 | 3300046692 | Ga0495671_0173846 | Ga0495671_0173846_257_808 | 176 |
| 176 | 3300046694 | Ga0495649_0002640 | Ga0495649_0002640_2258_2794 | 176 |
| 177 | 3300046694 | Ga0495649_0012323 | Ga0495649_0012323_3645_4196 | 176 |
| 178 | 3300046794 | Ga0495589_0033363 | Ga0495589_0033363_805_1356 | 176 |
| 179 | 3300046810 | Ga0495660_0138009 | Ga0495660_0138009_572_1108 | 176 |
| 180 | 3300047443 | Ga0495687_000790 | Ga0495687_000790_9986_10522 | 176 |
| 181 | 3300047443 | Ga0495687_014895 | Ga0495687_014895_1813_2349 | 176 |
| 182 | 3300047472 | Ga0495686_0006292 | Ga0495686_0006292_6634_7176 | 176 |
| 183 | 3300048908 | Ga0496105_0285447 | Ga0496105_0285447_387_929 | 176 |
| 184 | 3300048909 | Ga0496106_0228967 | Ga0496106_0228967_407_949 | 176 |
| 185 | 3300050489 | nmdc:mga03683_9197_c1 | nmdc:mga03683_9197_c1_342_878 | 176 |
| 186 | 3300050490 | nmdc:mga03n38_22608_c1 | nmdc:mga03n38_22608_c1_508_1044 | 176 |
| 187 | 3300050492 | nmdc:mga0yw44_81222_c1 | nmdc:mga0yw44_81222_c1_560_1096 | 176 |
| 188 | 3300050493 | nmdc:mga0k408_1329_c1 | nmdc:mga0k408_1329_c1_10883_11419 | 176 |
| 189 | 3300050493 | nmdc:mga0k408_148_c1 | nmdc:mga0k408_148_c1_27301_27837 | 176 |
| 190 | 3300050493 | nmdc:mga0k408_19570_c1 | nmdc:mga0k408_19570_c1_960_1511 | 176 |
| 191 | 3300050493 | nmdc:mga0k408_50348_c1 | nmdc:mga0k408_50348_c1_1124_1660 | 176 |
| 192 | 3300050494 | nmdc:mga06z11_15349_c1 | nmdc:mga06z11_15349_c1_1247_1783 | 176 |
| 193 | 3300050494 | nmdc:mga06z11_161280_c1 | nmdc:mga06z11_161280_c1_289_825 | 176 |
| 194 | 3300050494 | nmdc:mga06z11_194338_c1 | nmdc:mga06z11_194338_c1_267_803 | 176 |
| 195 | 3300050495 | nmdc:mga04h51_7088_c1 | nmdc:mga04h51_7088_c1_1408_1944 | 176 |
| 196 | 3300050496 | nmdc:mga07m45_1748_c1 | nmdc:mga07m45_1748_c1_7061_7597 | 176 |
| 197 | 3300050496 | nmdc:mga07m45_7066_c1 | nmdc:mga07m45_7066_c1_1738_2274 | 176 |
| 198 | 3300050507 | nmdc:mga05p37_329145_c2 | nmdc:mga05p37_329145_c2_300_836 | 176 |
| 199 | 3300050513 | nmdc:mga0rr50_723454_c1 | nmdc:mga0rr50_723454_c1_123_662 | 176 |
| 200 | 3300050516 | nmdc:mga0sz30_66687_c1 | nmdc:mga0sz30_66687_c1_206_742 | 176 |
| 201 | 3300050516 | nmdc:mga0sz30_72880_c1 | nmdc:mga0sz30_72880_c1_355_891 | 176 |
| 202 | 3300053085 | Ga0495619_0329632 | Ga0495619_0329632_186_737 | 176 |
| 203 | 3300053109 | Ga0500569_002749 | Ga0500569_002749_2412_2957 | 176 |
| 204 | 3300053139 | Ga0500568_0040985 | Ga0500568_0040985_627_1163 | 176 |
| 205 | 3300061719 | Ga0466962_0033010 | Ga0466962_0033010_901_1443 | 176 |
| 206 | 3300002774 | JGI25150J39212_1003483 | JGI25150J39212_10034831 | 177 |
| 207 | 3300002774 | JGI25150J39212_1024682 | JGI25150J39212_10246821 | 177 |
| 208 | 3300002987 | JGI25159J45721_1009081 | JGI25159J45721_10090812 | 177 |
| 209 | 3300003354 | JGI25160J50197_1001459 | JGI25160J50197_100145914 | 177 |
| 210 | 3300003374 | JGI25161J50226_1000015 | JGI25161J50226_100001586 | 177 |
| 211 | 3300003374 | JGI25161J50226_1008780 | JGI25161J50226_10087802 | 177 |
| 212 | 3300003503 | JGI26141J51220_1007754 | JGI26141J51220_10077542 | 177 |
| 213 | 3300003771 | Ga0055526_1003568 | Ga0055526_10035682 | 177 |
| 214 | 3300003775 | Ga0055524_1000016 | Ga0055524_1000016159 | 177 |
| 215 | 3300003775 | Ga0055524_1002380 | Ga0055524_10023802 | 177 |
| 216 | 3300003784 | Ga0055534_1000697 | Ga0055534_10006972 | 177 |
| 217 | 3300003791 | Ga0055530_10000243 | Ga0055530_1000024349 | 177 |
| 218 | 3300003791 | Ga0055530_10031028 | Ga0055530_100310282 | 177 |
| 219 | 3300003792 | Ga0055540_1000031 | Ga0055540_1000031168 | 177 |
| 220 | 3300003792 | Ga0055540_1005908 | Ga0055540_10059082 | 177 |
| 221 | 3300003792 | Ga0055540_1040189 | Ga0055540_10401891 | 177 |
| 222 | 3300003794 | Ga0055531_10000358 | Ga0055531_1000035840 | 177 |
| 223 | 3300003794 | Ga0055531_10001823 | Ga0055531_100018233 | 177 |
| 224 | 3300003794 | Ga0055531_10009351 | Ga0055531_100093514 | 177 |
| 225 | 3300003794 | Ga0055531_10018799 | Ga0055531_100187992 | 177 |
| 226 | 3300004625 | Ga0055543_1000749 | Ga0055543_100074917 | 177 |
| 227 | 3300005262 | Ga0065165_1000184 | Ga0065165_100018460 | 177 |
| 228 | 3300005262 | Ga0065165_1001656 | Ga0065165_100165610 | 177 |
| 229 | 3300005327 | Ga0070658_10100190 | Ga0070658_101001902 | 177 |
| 230 | 3300005327 | Ga0070658_10133246 | Ga0070658_101332463 | 177 |
| 231 | 3300005327 | Ga0070658_10202913 | Ga0070658_102029132 | 177 |
| 232 | 3300005327 | Ga0070658_11084150 | Ga0070658_110841501 | 177 |
| 233 | 3300005329 | Ga0070683_100046468 | Ga0070683_1000464682 | 177 |
| 234 | 3300005330 | Ga0070690_100096829 | Ga0070690_1000968292 | 177 |
| 235 | 3300005330 | Ga0070690_100108266 | Ga0070690_1001082662 | 177 |
| 236 | 3300005331 | Ga0070670_100103661 | Ga0070670_1001036612 | 177 |
| 237 | 3300005331 | Ga0070670_100109374 | Ga0070670_1001093742 | 177 |
| 238 | 3300005331 | Ga0070670_100112783 | Ga0070670_1001127832 | 177 |
| 239 | 3300005333 | Ga0070677_10060395 | Ga0070677_100603952 | 177 |
| 240 | 3300005334 | Ga0068869_100008595 | Ga0068869_1000085957 | 177 |
| 241 | 3300005334 | Ga0068869_100094463 | Ga0068869_1000944633 | 177 |
| 242 | 3300005334 | Ga0068869_100478998 | Ga0068869_1004789982 | 177 |
| 243 | 3300005334 | Ga0068869_100540583 | Ga0068869_1005405832 | 177 |
| 244 | 3300005335 | Ga0070666_10026213 | Ga0070666_100262134 | 177 |
| 245 | 3300005335 | Ga0070666_10047978 | Ga0070666_100479782 | 177 |
| 246 | 3300005336 | Ga0070680_100003443 | Ga0070680_1000034432 | 177 |
| 247 | 3300005336 | Ga0070680_100236703 | Ga0070680_1002367032 | 177 |
| 248 | 3300005336 | Ga0070680_100301955 | Ga0070680_1003019551 | 177 |
| 249 | 3300005336 | Ga0070680_100707356 | Ga0070680_1007073561 | 177 |
| 250 | 3300005337 | Ga0070682_100561892 | Ga0070682_1005618921 | 177 |
| 251 | 3300005338 | Ga0068868_100052727 | Ga0068868_1000527272 | 177 |
| 252 | 3300005338 | Ga0068868_100061443 | Ga0068868_1000614432 | 177 |
| 253 | 3300005338 | Ga0068868_100593224 | Ga0068868_1005932242 | 177 |
| 254 | 3300005339 | Ga0070660_100116604 | Ga0070660_1001166043 | 177 |
| 255 | 3300005339 | Ga0070660_100626551 | Ga0070660_1006265511 | 177 |
| 256 | 3300005339 | Ga0070660_101281453 | Ga0070660_1012814531 | 177 |
| 257 | 3300005344 | Ga0070661_100001017 | Ga0070661_1000010172 | 177 |
| 258 | 3300005344 | Ga0070661_100003668 | Ga0070661_1000036687 | 177 |
| 259 | 3300005344 | Ga0070661_100009848 | Ga0070661_1000098483 | 177 |
| 260 | 3300005344 | Ga0070661_100244661 | Ga0070661_1002446612 | 177 |
| 261 | 3300005344 | Ga0070661_100292187 | Ga0070661_1002921871 | 177 |
| 262 | 3300005347 | Ga0070668_100052979 | Ga0070668_1000529792 | 177 |
| 263 | 3300005347 | Ga0070668_100128808 | Ga0070668_1001288082 | 177 |
| 264 | 3300005347 | Ga0070668_100295979 | Ga0070668_1002959792 | 177 |
| 265 | 3300005347 | Ga0070668_100819777 | Ga0070668_1008197771 | 177 |
| 266 | 3300005353 | Ga0070669_100064909 | Ga0070669_1000649094 | 177 |
| 267 | 3300005353 | Ga0070669_100144552 | Ga0070669_1001445522 | 177 |
| 268 | 3300005353 | Ga0070669_100290021 | Ga0070669_1002900212 | 177 |
| 269 | 3300005353 | Ga0070669_100316324 | Ga0070669_1003163242 | 177 |
| 270 | 3300005354 | Ga0070675_100040042 | Ga0070675_1000400422 | 177 |
| 271 | 3300005354 | Ga0070675_100051871 | Ga0070675_1000518714 | 177 |
| 272 | 3300005355 | Ga0070671_100001374 | Ga0070671_10000137417 | 177 |
| 273 | 3300005355 | Ga0070671_100002406 | Ga0070671_1000024063 | 177 |
| 274 | 3300005355 | Ga0070671_100431894 | Ga0070671_1004318942 | 177 |
| 275 | 3300005356 | Ga0070674_100107477 | Ga0070674_1001074773 | 177 |
| 276 | 3300005356 | Ga0070674_100275481 | Ga0070674_1002754812 | 177 |
| 277 | 3300005364 | Ga0070673_100028745 | Ga0070673_1000287451 | 177 |
| 278 | 3300005364 | Ga0070673_100134464 | Ga0070673_1001344642 | 177 |
| 279 | 3300005364 | Ga0070673_100355852 | Ga0070673_1003558522 | 177 |
| 280 | 3300005364 | Ga0070673_100538360 | Ga0070673_1005383602 | 177 |
| 281 | 3300005365 | Ga0070688_100092870 | Ga0070688_1000928702 | 177 |
| 282 | 3300005366 | Ga0070659_100008648 | Ga0070659_1000086482 | 177 |
| 283 | 3300005366 | Ga0070659_100009656 | Ga0070659_1000096564 | 177 |
| 284 | 3300005366 | Ga0070659_100010955 | Ga0070659_1000109557 | 177 |
| 285 | 3300005366 | Ga0070659_100034650 | Ga0070659_1000346502 | 177 |
| 286 | 3300005366 | Ga0070659_100411493 | Ga0070659_1004114933 | 177 |
| 287 | 3300005367 | Ga0070667_100011503 | Ga0070667_1000115039 | 177 |
| 288 | 3300005367 | Ga0070667_100117594 | Ga0070667_1001175942 | 177 |
| 289 | 3300005367 | Ga0070667_100241234 | Ga0070667_1002412342 | 177 |
| 290 | 3300005434 | Ga0070709_10030621 | Ga0070709_100306213 | 177 |
| 291 | 3300005435 | Ga0070714_100173379 | Ga0070714_1001733791 | 177 |
| 292 | 3300005436 | Ga0070713_100000130 | Ga0070713_10000013033 | 177 |
| 293 | 3300005440 | Ga0070705_100017028 | Ga0070705_1000170282 | 177 |
| 294 | 3300005441 | Ga0070700_100256201 | Ga0070700_1002562012 | 177 |
| 295 | 3300005455 | Ga0070663_100003894 | Ga0070663_1000038947 | 177 |
| 296 | 3300005455 | Ga0070663_100199084 | Ga0070663_1001990842 | 177 |
| 297 | 3300005456 | Ga0070678_100196536 | Ga0070678_1001965362 | 177 |
| 298 | 3300005456 | Ga0070678_100281519 | Ga0070678_1002815192 | 177 |
| 299 | 3300005457 | Ga0070662_100035270 | Ga0070662_1000352702 | 177 |
| 300 | 3300005457 | Ga0070662_100055900 | Ga0070662_1000559003 | 177 |
| 301 | 3300005457 | Ga0070662_100251718 | Ga0070662_1002517182 | 177 |
| 302 | 3300005458 | Ga0070681_10244657 | Ga0070681_102446571 | 177 |
| 303 | 3300005458 | Ga0070681_10271022 | Ga0070681_102710222 | 177 |
| 304 | 3300005459 | Ga0068867_100022367 | Ga0068867_1000223672 | 177 |
| 305 | 3300005459 | Ga0068867_100041971 | Ga0068867_1000419712 | 177 |
| 306 | 3300005459 | Ga0068867_100048475 | Ga0068867_1000484752 | 177 |
| 307 | 3300005459 | Ga0068867_100058206 | Ga0068867_1000582062 | 177 |
| 308 | 3300005459 | Ga0068867_100087816 | Ga0068867_1000878162 | 177 |
| 309 | 3300005459 | Ga0068867_100357333 | Ga0068867_1003573331 | 177 |
| 310 | 3300005518 | Ga0070699_101629698 | Ga0070699_1016296981 | 177 |
| 311 | 3300005530 | Ga0070679_100025230 | Ga0070679_1000252303 | 177 |
| 312 | 3300005530 | Ga0070679_100028347 | Ga0070679_1000283475 | 177 |
| 313 | 3300005539 | Ga0068853_100016064 | Ga0068853_1000160646 | 177 |
| 314 | 3300005539 | Ga0068853_100116503 | Ga0068853_1001165032 | 177 |
| 315 | 3300005539 | Ga0068853_100873844 | Ga0068853_1008738441 | 177 |
| 316 | 3300005543 | Ga0070672_100023360 | Ga0070672_1000233604 | 177 |
| 317 | 3300005543 | Ga0070672_100096280 | Ga0070672_1000962803 | 177 |
| 318 | 3300005543 | Ga0070672_100400394 | Ga0070672_1004003942 | 177 |
| 319 | 3300005543 | Ga0070672_100719987 | Ga0070672_1007199871 | 177 |
| 320 | 3300005544 | Ga0070686_100240166 | Ga0070686_1002401662 | 177 |
| 321 | 3300005544 | Ga0070686_100374691 | Ga0070686_1003746912 | 177 |
| 322 | 3300005545 | Ga0070695_100162631 | Ga0070695_1001626312 | 177 |
| 323 | 3300005548 | Ga0070665_100232077 | Ga0070665_1002320772 | 177 |
| 324 | 3300005549 | Ga0070704_100058372 | Ga0070704_1000583722 | 177 |
| 325 | 3300005563 | Ga0068855_100020005 | Ga0068855_1000200057 | 177 |
| 326 | 3300005563 | Ga0068855_100089265 | Ga0068855_1000892654 | 177 |
| 327 | 3300005563 | Ga0068855_100107592 | Ga0068855_1001075923 | 177 |
| 328 | 3300005563 | Ga0068855_100192672 | Ga0068855_1001926722 | 177 |
| 329 | 3300005564 | Ga0070664_100007230 | Ga0070664_1000072307 | 177 |
| 330 | 3300005564 | Ga0070664_100015534 | Ga0070664_1000155344 | 177 |
| 331 | 3300005564 | Ga0070664_100172576 | Ga0070664_1001725762 | 177 |
| 332 | 3300005564 | Ga0070664_100377837 | Ga0070664_1003778372 | 177 |
| 333 | 3300005564 | Ga0070664_100501624 | Ga0070664_1005016241 | 177 |
| 334 | 3300005577 | Ga0068857_100133458 | Ga0068857_1001334583 | 177 |
| 335 | 3300005578 | Ga0068854_100010927 | Ga0068854_1000109272 | 177 |
| 336 | 3300005578 | Ga0068854_100014879 | Ga0068854_1000148797 | 177 |
| 337 | 3300005578 | Ga0068854_100307993 | Ga0068854_1003079932 | 177 |
| 338 | 3300005578 | Ga0068854_100361197 | Ga0068854_1003611972 | 177 |
| 339 | 3300005614 | Ga0068856_100000937 | Ga0068856_1000009378 | 177 |
| 340 | 3300005614 | Ga0068856_100031144 | Ga0068856_1000311447 | 177 |
| 341 | 3300005614 | Ga0068856_100147214 | Ga0068856_1001472143 | 177 |
| 342 | 3300005614 | Ga0068856_100444718 | Ga0068856_1004447183 | 177 |
| 343 | 3300005614 | Ga0068856_100712745 | Ga0068856_1007127451 | 177 |
| 344 | 3300005615 | Ga0070702_100168051 | Ga0070702_1001680512 | 177 |
| 345 | 3300005616 | Ga0068852_100099190 | Ga0068852_1000991903 | 177 |
| 346 | 3300005616 | Ga0068852_100208568 | Ga0068852_1002085682 | 177 |
| 347 | 3300005616 | Ga0068852_100482686 | Ga0068852_1004826861 | 177 |
| 348 | 3300005616 | Ga0068852_100711964 | Ga0068852_1007119641 | 177 |
| 349 | 3300005616 | Ga0068852_101005196 | Ga0068852_1010051962 | 177 |
| 350 | 3300005617 | Ga0068859_100123948 | Ga0068859_1001239481 | 177 |
| 351 | 3300005617 | Ga0068859_100441896 | Ga0068859_1004418962 | 177 |
| 352 | 3300005617 | Ga0068859_101763367 | Ga0068859_1017633672 | 177 |
| 353 | 3300005618 | Ga0068864_100011853 | Ga0068864_1000118533 | 177 |
| 354 | 3300005618 | Ga0068864_100046809 | Ga0068864_1000468095 | 177 |
| 355 | 3300005618 | Ga0068864_100055254 | Ga0068864_1000552542 | 177 |
| 356 | 3300005718 | Ga0068866_10014255 | Ga0068866_100142552 | 177 |
| 357 | 3300005719 | Ga0068861_100031456 | Ga0068861_1000314562 | 177 |
| 358 | 3300005841 | Ga0068863_100148557 | Ga0068863_1001485573 | 177 |
| 359 | 3300005841 | Ga0068863_100202444 | Ga0068863_1002024442 | 177 |
| 360 | 3300005841 | Ga0068863_100780030 | Ga0068863_1007800303 | 177 |
| 361 | 3300005841 | Ga0068863_100868468 | Ga0068863_1008684682 | 177 |
| 362 | 3300005842 | Ga0068858_100054024 | Ga0068858_1000540244 | 177 |
| 363 | 3300005842 | Ga0068858_100146464 | Ga0068858_1001464641 | 177 |
| 364 | 3300005842 | Ga0068858_100532627 | Ga0068858_1005326272 | 177 |
| 365 | 3300005843 | Ga0068860_100000678 | Ga0068860_1000006785 | 177 |
| 366 | 3300005843 | Ga0068860_100024635 | Ga0068860_1000246351 | 177 |
| 367 | 3300005843 | Ga0068860_100248454 | Ga0068860_1002484542 | 177 |
| 368 | 3300005844 | Ga0068862_100003264 | Ga0068862_1000032649 | 177 |
| 369 | 3300005844 | Ga0068862_100017965 | Ga0068862_1000179652 | 177 |
| 370 | 3300005844 | Ga0068862_100080001 | Ga0068862_1000800011 | 177 |
| 371 | 3300005844 | Ga0068862_100150910 | Ga0068862_1001509102 | 177 |
| 372 | 3300005844 | Ga0068862_100163746 | Ga0068862_1001637462 | 177 |
| 373 | 3300005844 | Ga0068862_100838872 | Ga0068862_1008388722 | 177 |
| 374 | 3300005985 | Ga0081539_10041122 | Ga0081539_100411222 | 177 |
| 375 | 3300006038 | Ga0075365_10008403 | Ga0075365_100084035 | 177 |
| 376 | 3300006038 | Ga0075365_10008748 | Ga0075365_100087486 | 177 |
| 377 | 3300006038 | Ga0075365_10147299 | Ga0075365_101472992 | 177 |
| 378 | 3300006042 | Ga0075368_10014094 | Ga0075368_100140942 | 177 |
| 379 | 3300006048 | Ga0075363_100025312 | Ga0075363_1000253122 | 177 |
| 380 | 3300006048 | Ga0075363_100202375 | Ga0075363_1002023752 | 177 |
| 381 | 3300006048 | Ga0075363_100693279 | Ga0075363_1006932791 | 177 |
| 382 | 3300006051 | Ga0075364_10139438 | Ga0075364_101394382 | 177 |
| 383 | 3300006051 | Ga0075364_10154474 | Ga0075364_101544742 | 177 |
| 384 | 3300006051 | Ga0075364_10183979 | Ga0075364_101839792 | 177 |
| 385 | 3300006175 | Ga0070712_100315479 | Ga0070712_1003154792 | 177 |
| 386 | 3300006177 | Ga0075362_10012281 | Ga0075362_100122812 | 177 |
| 387 | 3300006177 | Ga0075362_10152765 | Ga0075362_101527652 | 177 |
| 388 | 3300006178 | Ga0075367_10020025 | Ga0075367_100200252 | 177 |
| 389 | 3300006178 | Ga0075367_10213445 | Ga0075367_102134452 | 177 |
| 390 | 3300006195 | Ga0075366_10013879 | Ga0075366_100138792 | 177 |
| 391 | 3300006195 | Ga0075366_10064797 | Ga0075366_100647972 | 177 |
| 392 | 3300006195 | Ga0075366_10088105 | Ga0075366_100881052 | 177 |
| 393 | 3300006195 | Ga0075366_10114371 | Ga0075366_101143712 | 177 |
| 394 | 3300006195 | Ga0075366_10130349 | Ga0075366_101303492 | 177 |
| 395 | 3300006195 | Ga0075366_10143213 | Ga0075366_101432132 | 177 |
| 396 | 3300006237 | Ga0097621_100068313 | Ga0097621_1000683132 | 177 |
| 397 | 3300006237 | Ga0097621_100096690 | Ga0097621_1000966902 | 177 |
| 398 | 3300006237 | Ga0097621_100542168 | Ga0097621_1005421682 | 177 |
| 399 | 3300006353 | Ga0075370_10017562 | Ga0075370_100175622 | 177 |
| 400 | 3300006353 | Ga0075370_10056841 | Ga0075370_100568413 | 177 |
| 401 | 3300006353 | Ga0075370_10144595 | Ga0075370_101445952 | 177 |
| 402 | 3300006353 | Ga0075370_10191401 | Ga0075370_101914012 | 177 |
| 403 | 3300006358 | Ga0068871_100129517 | Ga0068871_1001295172 | 177 |
| 404 | 3300006358 | Ga0068871_100218700 | Ga0068871_1002187002 | 177 |
| 405 | 3300006358 | Ga0068871_100522893 | Ga0068871_1005228931 | 177 |
| 406 | 3300006358 | Ga0068871_100606574 | Ga0068871_1006065742 | 177 |
| 407 | 3300006844 | Ga0075428_100121466 | Ga0075428_1001214665 | 177 |
| 408 | 3300006844 | Ga0075428_100271198 | Ga0075428_1002711982 | 177 |
| 409 | 3300006847 | Ga0075431_100009882 | Ga0075431_1000098822 | 177 |
| 410 | 3300006880 | Ga0075429_100000463 | Ga0075429_10000046324 | 177 |
| 411 | 3300006881 | Ga0068865_100002721 | Ga0068865_1000027213 | 177 |
| 412 | 3300006931 | Ga0097620_100123944 | Ga0097620_1001239442 | 177 |
| 413 | 3300006931 | Ga0097620_100441896 | Ga0097620_1004418962 | 177 |
| 414 | 3300006931 | Ga0097620_101763187 | Ga0097620_1017631871 | 177 |
| 415 | 3300006944 | Ga0099823_1000039 | Ga0099823_100003925 | 177 |
| 416 | 3300009093 | Ga0105240_10026368 | Ga0105240_100263684 | 177 |
| 417 | 3300009093 | Ga0105240_10064807 | Ga0105240_100648074 | 177 |
| 418 | 3300009093 | Ga0105240_10835949 | Ga0105240_108359492 | 177 |
| 419 | 3300009094 | Ga0111539_10842640 | Ga0111539_108426401 | 177 |
| 420 | 3300009094 | Ga0111539_11825265 | Ga0111539_118252651 | 177 |
| 421 | 3300009098 | Ga0105245_10086581 | Ga0105245_100865812 | 177 |
| 422 | 3300009098 | Ga0105245_11373214 | Ga0105245_113732141 | 177 |
| 423 | 3300009147 | Ga0114129_10018075 | Ga0114129_100180752 | 177 |
| 424 | 3300009148 | Ga0105243_10044991 | Ga0105243_100449912 | 177 |
| 425 | 3300009148 | Ga0105243_10093501 | Ga0105243_100935012 | 177 |
| 426 | 3300009148 | Ga0105243_10144779 | Ga0105243_101447792 | 177 |
| 427 | 3300009148 | Ga0105243_10191615 | Ga0105243_101916152 | 177 |
| 428 | 3300009176 | Ga0105242_10262339 | Ga0105242_102623392 | 177 |
| 429 | 3300009176 | Ga0105242_10638813 | Ga0105242_106388132 | 177 |
| 430 | 3300009176 | Ga0105242_11007014 | Ga0105242_110070141 | 177 |
| 431 | 3300009177 | Ga0105248_10006076 | Ga0105248_100060767 | 177 |
| 432 | 3300009177 | Ga0105248_10116226 | Ga0105248_101162263 | 177 |
| 433 | 3300009177 | Ga0105248_10158577 | Ga0105248_101585772 | 177 |
| 434 | 3300009177 | Ga0105248_10447586 | Ga0105248_104475862 | 177 |
| 435 | 3300009177 | Ga0105248_10853246 | Ga0105248_108532461 | 177 |
| 436 | 3300009177 | Ga0105248_11258934 | Ga0105248_112589342 | 177 |
| 437 | 3300009545 | Ga0105237_10000784 | Ga0105237_100007842 | 177 |
| 438 | 3300009545 | Ga0105237_10154894 | Ga0105237_101548943 | 177 |
| 439 | 3300009551 | Ga0105238_10033583 | Ga0105238_100335832 | 177 |
| 440 | 3300009551 | Ga0105238_10326403 | Ga0105238_103264032 | 177 |
| 441 | 3300009551 | Ga0105238_10926360 | Ga0105238_109263601 | 177 |
| 442 | 3300009551 | Ga0105238_11708558 | Ga0105238_117085581 | 177 |
| 443 | 3300009553 | Ga0105249_10055139 | Ga0105249_100551392 | 177 |
| 444 | 3300009553 | Ga0105249_10109205 | Ga0105249_101092052 | 177 |
| 445 | 3300009553 | Ga0105249_11874964 | Ga0105249_118749641 | 177 |
| 446 | 3300010375 | Ga0105239_10017475 | Ga0105239_100174754 | 177 |
| 447 | 3300011119 | Ga0105246_10266759 | Ga0105246_102667592 | 177 |
| 448 | 3300011119 | Ga0105246_10819111 | Ga0105246_108191111 | 177 |
| 449 | 3300011119 | Ga0105246_11511185 | Ga0105246_115111851 | 177 |
| 450 | 3300012497 | Ga0157319_1000009 | Ga0157319_100000971 | 177 |
| 451 | 3300013100 | Ga0157373_10009401 | Ga0157373_100094019 | 177 |
| 452 | 3300013100 | Ga0157373_10201252 | Ga0157373_102012522 | 177 |
| 453 | 3300013102 | Ga0157371_10003553 | Ga0157371_100035535 | 177 |
| 454 | 3300013102 | Ga0157371_10186726 | Ga0157371_101867262 | 177 |
| 455 | 3300013102 | Ga0157371_10527989 | Ga0157371_105279891 | 177 |
| 456 | 3300013104 | Ga0157370_10016304 | Ga0157370_100163042 | 177 |
| 457 | 3300013104 | Ga0157370_10021276 | Ga0157370_100212768 | 177 |
| 458 | 3300013104 | Ga0157370_10069410 | Ga0157370_100694104 | 177 |
| 459 | 3300013105 | Ga0157369_10007076 | Ga0157369_100070763 | 177 |
| 460 | 3300013105 | Ga0157369_10009390 | Ga0157369_1000939010 | 177 |
| 461 | 3300013105 | Ga0157369_10065405 | Ga0157369_100654053 | 177 |
| 462 | 3300013105 | Ga0157369_10205427 | Ga0157369_102054272 | 177 |
| 463 | 3300013296 | Ga0157374_10117423 | Ga0157374_101174232 | 177 |
| 464 | 3300013296 | Ga0157374_10498262 | Ga0157374_104982621 | 177 |
| 465 | 3300013297 | Ga0157378_10003415 | Ga0157378_100034152 | 177 |
| 466 | 3300013297 | Ga0157378_10004517 | Ga0157378_100045177 | 177 |
| 467 | 3300013297 | Ga0157378_10041933 | Ga0157378_100419334 | 177 |
| 468 | 3300013297 | Ga0157378_10276787 | Ga0157378_102767872 | 177 |
| 469 | 3300013297 | Ga0157378_10517891 | Ga0157378_105178911 | 177 |
| 470 | 3300013297 | Ga0157378_10524014 | Ga0157378_105240142 | 177 |
| 471 | 3300013306 | Ga0163162_10013003 | Ga0163162_100130032 | 177 |
| 472 | 3300013306 | Ga0163162_10066107 | Ga0163162_100661073 | 177 |
| 473 | 3300013306 | Ga0163162_10461464 | Ga0163162_104614642 | 177 |
| 474 | 3300013306 | Ga0163162_10921910 | Ga0163162_109219102 | 177 |
| 475 | 3300013307 | Ga0157372_10002684 | Ga0157372_1000268411 | 177 |
| 476 | 3300013307 | Ga0157372_10140032 | Ga0157372_101400323 | 177 |
| 477 | 3300013307 | Ga0157372_10205402 | Ga0157372_102054023 | 177 |
| 478 | 3300013307 | Ga0157372_10235394 | Ga0157372_102353942 | 177 |
| 479 | 3300013307 | Ga0157372_10349207 | Ga0157372_103492073 | 177 |
| 480 | 3300013307 | Ga0157372_10402936 | Ga0157372_104029362 | 177 |
| 481 | 3300013307 | Ga0157372_11043954 | Ga0157372_110439541 | 177 |
| 482 | 3300013308 | Ga0157375_10100019 | Ga0157375_101000191 | 177 |
| 483 | 3300013308 | Ga0157375_10350313 | Ga0157375_103503132 | 177 |
| 484 | 3300014325 | Ga0163163_10106185 | Ga0163163_101061854 | 177 |
| 485 | 3300014326 | Ga0157380_10030768 | Ga0157380_100307682 | 177 |
| 486 | 3300014326 | Ga0157380_10155746 | Ga0157380_101557461 | 177 |
| 487 | 3300014326 | Ga0157380_10559661 | Ga0157380_105596612 | 177 |
| 488 | 3300014745 | Ga0157377_10538668 | Ga0157377_105386682 | 177 |
| 489 | 3300014968 | Ga0157379_10059549 | Ga0157379_100595492 | 177 |
| 490 | 3300014968 | Ga0157379_10093284 | Ga0157379_100932844 | 177 |
| 491 | 3300014968 | Ga0157379_10791041 | Ga0157379_107910412 | 177 |
| 492 | 3300014969 | Ga0157376_10014203 | Ga0157376_100142035 | 177 |
| 493 | 3300014969 | Ga0157376_10165688 | Ga0157376_101656883 | 177 |
| 494 | 3300014969 | Ga0157376_10319603 | Ga0157376_103196032 | 177 |
| 495 | 3300014969 | Ga0157376_10339627 | Ga0157376_103396272 | 177 |
| 496 | 3300014969 | Ga0157376_10927008 | Ga0157376_109270081 | 177 |
| 497 | 3300015262 | Ga0182007_10027607 | Ga0182007_100276072 | 177 |
| 498 | 3300017792 | Ga0163161_10062740 | Ga0163161_100627402 | 177 |
| 499 | 3300017792 | Ga0163161_10385129 | Ga0163161_103851292 | 177 |
| 500 | 3300021361 | Ga0213872_10000004 | Ga0213872_10000004146 | 177 |
| 501 | 3300021361 | Ga0213872_10049430 | Ga0213872_100494302 | 177 |
| 502 | 3300025273 | Ga0209673_1010377 | Ga0209673_10103772 | 177 |
| 503 | 3300025273 | Ga0209673_1011036 | Ga0209673_10110362 | 177 |
| 504 | 3300025273 | Ga0209673_1067835 | Ga0209673_10678351 | 177 |
| 505 | 3300025295 | Ga0209564_1000003 | Ga0209564_1000003444 | 177 |
| 506 | 3300025298 | Ga0209050_1019110 | Ga0209050_10191103 | 177 |
| 507 | 3300025299 | Ga0209256_1001390 | Ga0209256_100139010 | 177 |
| 508 | 3300025299 | Ga0209256_1021613 | Ga0209256_10216131 | 177 |
| 509 | 3300025303 | Ga0209051_1000140 | Ga0209051_100014053 | 177 |
| 510 | 3300025303 | Ga0209051_1001698 | Ga0209051_10016985 | 177 |
| 511 | 3300025304 | Ga0209257_1000012 | Ga0209257_1000012787 | 177 |
| 512 | 3300025304 | Ga0209257_1000045 | Ga0209257_1000045193 | 177 |
| 513 | 3300025304 | Ga0209257_1001619 | Ga0209257_100161912 | 177 |
| 514 | 3300025304 | Ga0209257_1002501 | Ga0209257_100250110 | 177 |
| 515 | 3300025315 | Ga0207697_10081189 | Ga0207697_100811891 | 177 |
| 516 | 3300025321 | Ga0207656_10003677 | Ga0207656_100036773 | 177 |
| 517 | 3300025893 | Ga0207682_10020313 | Ga0207682_100203132 | 177 |
| 518 | 3300025893 | Ga0207682_10045037 | Ga0207682_100450372 | 177 |
| 519 | 3300025899 | Ga0207642_10058363 | Ga0207642_100583632 | 177 |
| 520 | 3300025901 | Ga0207688_10082222 | Ga0207688_100822222 | 177 |
| 521 | 3300025903 | Ga0207680_10545585 | Ga0207680_105455852 | 177 |
| 522 | 3300025904 | Ga0207647_10180276 | Ga0207647_101802762 | 177 |
| 523 | 3300025906 | Ga0207699_10173423 | Ga0207699_101734232 | 177 |
| 524 | 3300025907 | Ga0207645_10035276 | Ga0207645_100352764 | 177 |
| 525 | 3300025907 | Ga0207645_10061879 | Ga0207645_100618792 | 177 |
| 526 | 3300025907 | Ga0207645_10116159 | Ga0207645_101161592 | 177 |
| 527 | 3300025908 | Ga0207643_10138836 | Ga0207643_101388362 | 177 |
| 528 | 3300025909 | Ga0207705_10036481 | Ga0207705_100364814 | 177 |
| 529 | 3300025909 | Ga0207705_10859350 | Ga0207705_108593501 | 177 |
| 530 | 3300025911 | Ga0207654_10456993 | Ga0207654_104569931 | 177 |
| 531 | 3300025913 | Ga0207695_10030121 | Ga0207695_100301213 | 177 |
| 532 | 3300025913 | Ga0207695_10099170 | Ga0207695_100991702 | 177 |
| 533 | 3300025913 | Ga0207695_10709983 | Ga0207695_107099831 | 177 |
| 534 | 3300025913 | Ga0207695_10801652 | Ga0207695_108016521 | 177 |
| 535 | 3300025914 | Ga0207671_10220348 | Ga0207671_102203482 | 177 |
| 536 | 3300025917 | Ga0207660_10051575 | Ga0207660_100515752 | 177 |
| 537 | 3300025917 | Ga0207660_10072521 | Ga0207660_100725212 | 177 |
| 538 | 3300025919 | Ga0207657_10018458 | Ga0207657_100184583 | 177 |
| 539 | 3300025919 | Ga0207657_10113026 | Ga0207657_101130262 | 177 |
| 540 | 3300025919 | Ga0207657_10116858 | Ga0207657_101168583 | 177 |
| 541 | 3300025919 | Ga0207657_10611274 | Ga0207657_106112741 | 177 |
| 542 | 3300025920 | Ga0207649_10014385 | Ga0207649_100143853 | 177 |
| 543 | 3300025920 | Ga0207649_10027192 | Ga0207649_100271922 | 177 |
| 544 | 3300025920 | Ga0207649_10175747 | Ga0207649_101757472 | 177 |
| 545 | 3300025920 | Ga0207649_10984124 | Ga0207649_109841241 | 177 |
| 546 | 3300025921 | Ga0207652_10021537 | Ga0207652_100215372 | 177 |
| 547 | 3300025921 | Ga0207652_10046811 | Ga0207652_100468111 | 177 |
| 548 | 3300025921 | Ga0207652_10442167 | Ga0207652_104421671 | 177 |
| 549 | 3300025924 | Ga0207694_10006337 | Ga0207694_100063375 | 177 |
| 550 | 3300025924 | Ga0207694_10006652 | Ga0207694_1000665210 | 177 |
| 551 | 3300025924 | Ga0207694_10650963 | Ga0207694_106509631 | 177 |
| 552 | 3300025925 | Ga0207650_10000900 | Ga0207650_1000090019 | 177 |
| 553 | 3300025925 | Ga0207650_10132089 | Ga0207650_101320892 | 177 |
| 554 | 3300025926 | Ga0207659_10004818 | Ga0207659_100048187 | 177 |
| 555 | 3300025926 | Ga0207659_10052521 | Ga0207659_100525212 | 177 |
| 556 | 3300025926 | Ga0207659_10072244 | Ga0207659_100722441 | 177 |
| 557 | 3300025926 | Ga0207659_10235315 | Ga0207659_102353152 | 177 |
| 558 | 3300025926 | Ga0207659_10279495 | Ga0207659_102794952 | 177 |
| 559 | 3300025927 | Ga0207687_10196620 | Ga0207687_101966202 | 177 |
| 560 | 3300025927 | Ga0207687_10902448 | Ga0207687_109024481 | 177 |
| 561 | 3300025928 | Ga0207700_10000262 | Ga0207700_1000026225 | 177 |
| 562 | 3300025929 | Ga0207664_10322557 | Ga0207664_103225572 | 177 |
| 563 | 3300025931 | Ga0207644_10012179 | Ga0207644_100121795 | 177 |
| 564 | 3300025931 | Ga0207644_10081730 | Ga0207644_100817301 | 177 |
| 565 | 3300025931 | Ga0207644_10232733 | Ga0207644_102327332 | 177 |
| 566 | 3300025931 | Ga0207644_10375554 | Ga0207644_103755541 | 177 |
| 567 | 3300025931 | Ga0207644_10397442 | Ga0207644_103974422 | 177 |
| 568 | 3300025932 | Ga0207690_10032871 | Ga0207690_100328714 | 177 |
| 569 | 3300025932 | Ga0207690_10066926 | Ga0207690_100669261 | 177 |
| 570 | 3300025932 | Ga0207690_10074322 | Ga0207690_100743222 | 177 |
| 571 | 3300025933 | Ga0207706_10000045 | Ga0207706_1000004538 | 177 |
| 572 | 3300025933 | Ga0207706_10097737 | Ga0207706_100977372 | 177 |
| 573 | 3300025934 | Ga0207686_10059943 | Ga0207686_100599432 | 177 |
| 574 | 3300025935 | Ga0207709_10100467 | Ga0207709_101004672 | 177 |
| 575 | 3300025935 | Ga0207709_10104151 | Ga0207709_101041512 | 177 |
| 576 | 3300025935 | Ga0207709_10104840 | Ga0207709_101048401 | 177 |
| 577 | 3300025936 | Ga0207670_10017790 | Ga0207670_100177906 | 177 |
| 578 | 3300025936 | Ga0207670_10235473 | Ga0207670_102354731 | 177 |
| 579 | 3300025936 | Ga0207670_10316726 | Ga0207670_103167262 | 177 |
| 580 | 3300025937 | Ga0207669_10094383 | Ga0207669_100943831 | 177 |
| 581 | 3300025937 | Ga0207669_10107269 | Ga0207669_101072692 | 177 |
| 582 | 3300025937 | Ga0207669_10216156 | Ga0207669_102161561 | 177 |
| 583 | 3300025940 | Ga0207691_10013008 | Ga0207691_100130082 | 177 |
| 584 | 3300025940 | Ga0207691_10014607 | Ga0207691_100146072 | 177 |
| 585 | 3300025940 | Ga0207691_10119141 | Ga0207691_101191413 | 177 |
| 586 | 3300025941 | Ga0207711_10012329 | Ga0207711_100123294 | 177 |
| 587 | 3300025941 | Ga0207711_10119369 | Ga0207711_101193692 | 177 |
| 588 | 3300025941 | Ga0207711_10200226 | Ga0207711_102002262 | 177 |
| 589 | 3300025941 | Ga0207711_10597961 | Ga0207711_105979611 | 177 |
| 590 | 3300025942 | Ga0207689_10035080 | Ga0207689_100350801 | 177 |
| 591 | 3300025942 | Ga0207689_10081629 | Ga0207689_100816292 | 177 |
| 592 | 3300025942 | Ga0207689_10113327 | Ga0207689_101133272 | 177 |
| 593 | 3300025942 | Ga0207689_10396096 | Ga0207689_103960962 | 177 |
| 594 | 3300025945 | Ga0207679_10000279 | Ga0207679_1000027914 | 177 |
| 595 | 3300025945 | Ga0207679_10009086 | Ga0207679_100090863 | 177 |
| 596 | 3300025945 | Ga0207679_10195290 | Ga0207679_101952902 | 177 |
| 597 | 3300025945 | Ga0207679_10318076 | Ga0207679_103180762 | 177 |
| 598 | 3300025945 | Ga0207679_10385851 | Ga0207679_103858512 | 177 |
| 599 | 3300025949 | Ga0207667_10012656 | Ga0207667_100126562 | 177 |
| 600 | 3300025949 | Ga0207667_10043079 | Ga0207667_100430796 | 177 |
| 601 | 3300025949 | Ga0207667_10083607 | Ga0207667_100836072 | 177 |
| 602 | 3300025949 | Ga0207667_10161785 | Ga0207667_101617854 | 177 |
| 603 | 3300025949 | Ga0207667_10179516 | Ga0207667_101795162 | 177 |
| 604 | 3300025960 | Ga0207651_10015175 | Ga0207651_100151754 | 177 |
| 605 | 3300025960 | Ga0207651_10030873 | Ga0207651_100308733 | 177 |
| 606 | 3300025960 | Ga0207651_10173688 | Ga0207651_101736882 | 177 |
| 607 | 3300025960 | Ga0207651_10269997 | Ga0207651_102699972 | 177 |
| 608 | 3300025961 | Ga0207712_10069351 | Ga0207712_100693512 | 177 |
| 609 | 3300025972 | Ga0207668_10282294 | Ga0207668_102822942 | 177 |
| 610 | 3300025981 | Ga0207640_10276066 | Ga0207640_102760662 | 177 |
| 611 | 3300025986 | Ga0207658_10322841 | Ga0207658_103228412 | 177 |
| 612 | 3300025986 | Ga0207658_10475361 | Ga0207658_104753611 | 177 |
| 613 | 3300026023 | Ga0207677_10058377 | Ga0207677_100583772 | 177 |
| 614 | 3300026023 | Ga0207677_10105045 | Ga0207677_101050452 | 177 |
| 615 | 3300026023 | Ga0207677_10324713 | Ga0207677_103247131 | 177 |
| 616 | 3300026023 | Ga0207677_10355356 | Ga0207677_103553561 | 177 |
| 617 | 3300026035 | Ga0207703_10038338 | Ga0207703_100383384 | 177 |
| 618 | 3300026035 | Ga0207703_10103802 | Ga0207703_101038023 | 177 |
| 619 | 3300026035 | Ga0207703_10117595 | Ga0207703_101175951 | 177 |
| 620 | 3300026035 | Ga0207703_10172623 | Ga0207703_101726232 | 177 |
| 621 | 3300026041 | Ga0207639_10003482 | Ga0207639_1000348210 | 177 |
| 622 | 3300026041 | Ga0207639_10043795 | Ga0207639_100437952 | 177 |
| 623 | 3300026041 | Ga0207639_10047438 | Ga0207639_100474382 | 177 |
| 624 | 3300026041 | Ga0207639_10154489 | Ga0207639_101544893 | 177 |
| 625 | 3300026041 | Ga0207639_10246566 | Ga0207639_102465662 | 177 |
| 626 | 3300026041 | Ga0207639_10570673 | Ga0207639_105706731 | 177 |
| 627 | 3300026075 | Ga0207708_10163986 | Ga0207708_101639862 | 177 |
| 628 | 3300026078 | Ga0207702_10009898 | Ga0207702_100098984 | 177 |
| 629 | 3300026078 | Ga0207702_10503655 | Ga0207702_105036552 | 177 |
| 630 | 3300026078 | Ga0207702_10947705 | Ga0207702_109477051 | 177 |
| 631 | 3300026088 | Ga0207641_10033004 | Ga0207641_100330042 | 177 |
| 632 | 3300026088 | Ga0207641_10033151 | Ga0207641_100331515 | 177 |
| 633 | 3300026088 | Ga0207641_10037100 | Ga0207641_100371004 | 177 |
| 634 | 3300026088 | Ga0207641_10155795 | Ga0207641_101557952 | 177 |
| 635 | 3300026089 | Ga0207648_10000839 | Ga0207648_1000083929 | 177 |
| 636 | 3300026089 | Ga0207648_10021693 | Ga0207648_100216933 | 177 |
| 637 | 3300026089 | Ga0207648_10059325 | Ga0207648_100593252 | 177 |
| 638 | 3300026089 | Ga0207648_10125892 | Ga0207648_101258922 | 177 |
| 639 | 3300026089 | Ga0207648_10186196 | Ga0207648_101861962 | 177 |
| 640 | 3300026089 | Ga0207648_10254825 | Ga0207648_102548252 | 177 |
| 641 | 3300026089 | Ga0207648_10292811 | Ga0207648_102928112 | 177 |
| 642 | 3300026095 | Ga0207676_10041647 | Ga0207676_100416472 | 177 |
| 643 | 3300026095 | Ga0207676_10713779 | Ga0207676_107137792 | 177 |
| 644 | 3300026116 | Ga0207674_10024176 | Ga0207674_100241765 | 177 |
| 645 | 3300026116 | Ga0207674_10089913 | Ga0207674_100899134 | 177 |
| 646 | 3300026116 | Ga0207674_10277867 | Ga0207674_102778673 | 177 |
| 647 | 3300026118 | Ga0207675_100014777 | Ga0207675_1000147772 | 177 |
| 648 | 3300026118 | Ga0207675_100035648 | Ga0207675_1000356486 | 177 |
| 649 | 3300026121 | Ga0207683_10040196 | Ga0207683_100401964 | 177 |
| 650 | 3300026121 | Ga0207683_10051101 | Ga0207683_100511015 | 177 |
| 651 | 3300026121 | Ga0207683_10126900 | Ga0207683_101269002 | 177 |
| 652 | 3300026121 | Ga0207683_10373255 | Ga0207683_103732552 | 177 |
| 653 | 3300026121 | Ga0207683_10458389 | Ga0207683_104583891 | 177 |
| 654 | 3300026142 | Ga0207698_10636810 | Ga0207698_106368102 | 177 |
| 655 | 3300027395 | Ga0209996_1017210 | Ga0209996_10172102 | 177 |
| 656 | 3300027614 | Ga0209970_1001463 | Ga0209970_10014633 | 177 |
| 657 | 3300027665 | Ga0209983_1000576 | Ga0209983_10005769 | 177 |
| 658 | 3300027665 | Ga0209983_1003615 | Ga0209983_10036151 | 177 |
| 659 | 3300027682 | Ga0209971_1001545 | Ga0209971_10015455 | 177 |
| 660 | 3300027682 | Ga0209971_1005862 | Ga0209971_10058623 | 177 |
| 661 | 3300027717 | Ga0209998_10000768 | Ga0209998_100007684 | 177 |
| 662 | 3300027866 | Ga0209813_10106099 | Ga0209813_101060991 | 177 |
| 663 | 3300027876 | Ga0209974_10002778 | Ga0209974_100027787 | 177 |
| 664 | 3300028379 | Ga0268266_10437405 | Ga0268266_104374052 | 177 |
| 665 | 3300028380 | Ga0268265_10030474 | Ga0268265_100304741 | 177 |
| 666 | 3300028380 | Ga0268265_10047991 | Ga0268265_100479913 | 177 |
| 667 | 3300028380 | Ga0268265_10063432 | Ga0268265_100634322 | 177 |
| 668 | 3300028380 | Ga0268265_10112322 | Ga0268265_101123221 | 177 |
| 669 | 3300028380 | Ga0268265_10133804 | Ga0268265_101338042 | 177 |
| 670 | 3300028380 | Ga0268265_10138928 | Ga0268265_101389282 | 177 |
| 671 | 3300028381 | Ga0268264_10005634 | Ga0268264_100056343 | 177 |
| 672 | 3300028381 | Ga0268264_10037292 | Ga0268264_100372926 | 177 |
| 673 | 3300028381 | Ga0268264_10088901 | Ga0268264_100889012 | 177 |
| 674 | 3300028794 | Ga0307515_10000178 | Ga0307515_1000017831 | 177 |
| 675 | 3300028794 | Ga0307515_10007082 | Ga0307515_1000708211 | 177 |
| 676 | 3300028794 | Ga0307515_10013694 | Ga0307515_1001369411 | 177 |
| 677 | 3300028794 | Ga0307515_10186577 | Ga0307515_101865772 | 177 |
| 678 | 3300028794 | Ga0307515_10221093 | Ga0307515_102210932 | 177 |
| 679 | 3300028800 | Ga0265338_10184741 | Ga0265338_101847413 | 177 |
| 680 | 3300031238 | Ga0265332_10000033 | Ga0265332_1000003399 | 177 |
| 681 | 3300031238 | Ga0265332_10005892 | Ga0265332_100058924 | 177 |
| 682 | 3300031241 | Ga0265325_10129797 | Ga0265325_101297972 | 177 |
| 683 | 3300031242 | Ga0265329_10035652 | Ga0265329_100356522 | 177 |
| 684 | 3300031249 | Ga0265339_10107418 | Ga0265339_101074182 | 177 |
| 685 | 3300031250 | Ga0265331_10005725 | Ga0265331_100057257 | 177 |
| 686 | 3300031344 | Ga0265316_10039638 | Ga0265316_100396382 | 177 |
| 687 | 3300031456 | Ga0307513_10000010 | Ga0307513_10000010297 | 177 |
| 688 | 3300031456 | Ga0307513_10000121 | Ga0307513_1000012136 | 177 |
| 689 | 3300031456 | Ga0307513_10018754 | Ga0307513_100187545 | 177 |
| 690 | 3300031548 | Ga0307408_100000008 | Ga0307408_100000008154 | 177 |
| 691 | 3300031548 | Ga0307408_100165763 | Ga0307408_1001657632 | 177 |
| 692 | 3300031665 | Ga0316575_10044571 | Ga0316575_100445713 | 177 |
| 693 | 3300031665 | Ga0316575_10048459 | Ga0316575_100484591 | 177 |
| 694 | 3300031691 | Ga0316579_10049839 | Ga0316579_100498392 | 177 |
| 695 | 3300031691 | Ga0316579_10288578 | Ga0316579_102885782 | 177 |
| 696 | 3300031711 | Ga0265314_10006842 | Ga0265314_100068423 | 177 |
| 697 | 3300031711 | Ga0265314_10008368 | Ga0265314_100083682 | 177 |
| 698 | 3300031711 | Ga0265314_10336950 | Ga0265314_103369501 | 177 |
| 699 | 3300031712 | Ga0265342_10024495 | Ga0265342_100244954 | 177 |
| 700 | 3300031712 | Ga0265342_10030598 | Ga0265342_100305983 | 177 |
| 701 | 3300031727 | Ga0316576_10001775 | Ga0316576_100017752 | 177 |
| 702 | 3300031727 | Ga0316576_10002619 | Ga0316576_1000261912 | 177 |
| 703 | 3300031727 | Ga0316576_10023686 | Ga0316576_100236863 | 177 |
| 704 | 3300031727 | Ga0316576_10032757 | Ga0316576_100327574 | 177 |
| 705 | 3300031727 | Ga0316576_10033884 | Ga0316576_100338841 | 177 |
| 706 | 3300031727 | Ga0316576_10036603 | Ga0316576_100366034 | 177 |
| 707 | 3300031727 | Ga0316576_10067573 | Ga0316576_100675733 | 177 |
| 708 | 3300031727 | Ga0316576_10158509 | Ga0316576_101585091 | 177 |
| 709 | 3300031727 | Ga0316576_10391654 | Ga0316576_103916541 | 177 |
| 710 | 3300031728 | Ga0316578_10000798 | Ga0316578_1000079810 | 177 |
| 711 | 3300031728 | Ga0316578_10013746 | Ga0316578_100137463 | 177 |
| 712 | 3300031728 | Ga0316578_10030496 | Ga0316578_100304962 | 177 |
| 713 | 3300031728 | Ga0316578_10047399 | Ga0316578_100473993 | 177 |
| 714 | 3300031728 | Ga0316578_10059235 | Ga0316578_100592351 | 177 |
| 715 | 3300031728 | Ga0316578_10090417 | Ga0316578_100904172 | 177 |
| 716 | 3300031728 | Ga0316578_10182017 | Ga0316578_101820171 | 177 |
| 717 | 3300031730 | Ga0307516_10005887 | Ga0307516_100058879 | 177 |
| 718 | 3300031730 | Ga0307516_10570200 | Ga0307516_105702002 | 177 |
| 719 | 3300031733 | Ga0316577_10009861 | Ga0316577_100098616 | 177 |
| 720 | 3300031733 | Ga0316577_10152920 | Ga0316577_101529202 | 177 |
| 721 | 3300031733 | Ga0316577_10175676 | Ga0316577_101756761 | 177 |
| 722 | 3300031824 | Ga0307413_10198960 | Ga0307413_101989602 | 177 |
| 723 | 3300031852 | Ga0307410_10005441 | Ga0307410_100054418 | 177 |
| 724 | 3300031852 | Ga0307410_10018840 | Ga0307410_100188402 | 177 |
| 725 | 3300031901 | Ga0307406_10010235 | Ga0307406_100102352 | 177 |
| 726 | 3300031901 | Ga0307406_10053466 | Ga0307406_100534662 | 177 |
| 727 | 3300031911 | Ga0307412_10058043 | Ga0307412_100580433 | 177 |
| 728 | 3300031911 | Ga0307412_10134042 | Ga0307412_101340422 | 177 |
| 729 | 3300031911 | Ga0307412_10249010 | Ga0307412_102490101 | 177 |
| 730 | 3300031911 | Ga0307412_10910244 | Ga0307412_109102442 | 177 |
| 731 | 3300031911 | Ga0307412_11157869 | Ga0307412_111578691 | 177 |
| 732 | 3300031995 | Ga0307409_100812105 | Ga0307409_1008121052 | 177 |
| 733 | 3300032002 | Ga0307416_100014325 | Ga0307416_1000143253 | 177 |
| 734 | 3300032002 | Ga0307416_101732301 | Ga0307416_1017323011 | 177 |
| 735 | 3300032004 | Ga0307414_10007104 | Ga0307414_100071048 | 177 |
| 736 | 3300032004 | Ga0307414_10044693 | Ga0307414_100446932 | 177 |
| 737 | 3300032005 | Ga0307411_10001688 | Ga0307411_100016882 | 177 |
| 738 | 3300032005 | Ga0307411_10020197 | Ga0307411_100201972 | 177 |
| 739 | 3300032126 | Ga0307415_100069326 | Ga0307415_1000693262 | 177 |
| 740 | 3300032126 | Ga0307415_100069811 | Ga0307415_1000698112 | 177 |
| 741 | 3300032126 | Ga0307415_101278943 | Ga0307415_1012789431 | 177 |
| 742 | 3300032133 | Ga0316583_10010416 | Ga0316583_100104164 | 177 |
| 743 | 3300032133 | Ga0316583_10054187 | Ga0316583_100541871 | 177 |
| 744 | 3300032137 | Ga0316585_10050155 | Ga0316585_100501552 | 177 |
| 745 | 3300032137 | Ga0316585_10064366 | Ga0316585_100643662 | 177 |
| 746 | 3300032139 | Ga0316580_10002360 | Ga0316580_100023606 | 177 |
| 747 | 3300032139 | Ga0316580_10007122 | Ga0316580_100071222 | 177 |
| 748 | 3300032139 | Ga0316580_10029510 | Ga0316580_100295101 | 177 |
| 749 | 3300032139 | Ga0316580_10067803 | Ga0316580_100678032 | 177 |
| 750 | 3300032139 | Ga0316580_10160385 | Ga0316580_101603851 | 177 |
| 751 | 3300032168 | Ga0316593_10035709 | Ga0316593_100357091 | 177 |
| 752 | 3300032168 | Ga0316593_10063194 | Ga0316593_100631941 | 177 |
| 753 | 3300032168 | Ga0316593_10092979 | Ga0316593_100929791 | 177 |
| 754 | 3300033524 | Ga0316592_1003645 | Ga0316592_10036455 | 177 |
| 755 | 3300033524 | Ga0316592_1006282 | Ga0316592_10062822 | 177 |
| 756 | 3300033524 | Ga0316592_1019878 | Ga0316592_10198782 | 177 |
| 757 | 3300033527 | Ga0316586_1005635 | Ga0316586_10056353 | 177 |
| 758 | 3300033527 | Ga0316586_1017679 | Ga0316586_10176792 | 177 |
| 759 | 3300033528 | Ga0316588_1004499 | Ga0316588_10044994 | 177 |
| 760 | 3300033528 | Ga0316588_1008935 | Ga0316588_10089351 | 177 |
| 761 | 3300033528 | Ga0316588_1026379 | Ga0316588_10263792 | 177 |
| 762 | 3300033528 | Ga0316588_1031547 | Ga0316588_10315472 | 177 |
| 763 | 3300033528 | Ga0316588_1032277 | Ga0316588_10322772 | 177 |
| 764 | 3300033528 | Ga0316588_1141172 | Ga0316588_11411721 | 177 |
| 765 | 3300033529 | Ga0316587_1000383 | Ga0316587_10003834 | 177 |
| 766 | 3300033529 | Ga0316587_1002976 | Ga0316587_10029763 | 177 |
| 767 | 3300033529 | Ga0316587_1039632 | Ga0316587_10396322 | 177 |
| 768 | 3300033541 | Ga0316596_1000394 | Ga0316596_10003945 | 177 |
| 769 | 3300033541 | Ga0316596_1002261 | Ga0316596_10022613 | 177 |
| 770 | 3300033541 | Ga0316596_1010352 | Ga0316596_10103522 | 177 |
| 771 | 3300033541 | Ga0316596_1050225 | Ga0316596_10502251 | 177 |
| 772 | 3300034817 | Ga0373948_0007970 | Ga0373948_0007970_963_1502 | 177 |
| 773 | 3300034820 | Ga0373959_0026928 | Ga0373959_0026928_58_597 | 177 |
| 774 | 3300035090 | Ga0373949_0033932 | Ga0373949_0033932_657_1193 | 177 |
| 775 | 3300035092 | Ga0373952_0000782 | Ga0373952_0000782_3139_3687 | 177 |
| 776 | 3300035114 | Ga0373939_0003522 | Ga0373939_0003522_441_980 | 177 |
| 777 | 3300035114 | Ga0373939_0089969 | Ga0373939_0089969_53_595 | 177 |
| 778 | 3300035116 | Ga0373945_0122326 | Ga0373945_0122326_325_867 | 177 |
| 779 | 3300035170 | Ga0373943_0175733 | Ga0373943_0175733_281_823 | 177 |
| 780 | 3300035171 | Ga0373946_0114156 | Ga0373946_0114156_41_595 | 177 |
| 781 | 3300035242 | Ga0373962_0049958 | Ga0373962_0049958_599_1138 | 177 |
| 782 | 3300035398 | Ga0316574_0005456 | Ga0316574_0005456_5389_5937 | 177 |
| 783 | 3300035398 | Ga0316574_0085608 | Ga0316574_0085608_40_588 | 177 |
| 784 | 3300035398 | Ga0316574_0244048 | Ga0316574_0244048_198_746 | 177 |
| 785 | 3300035398 | Ga0316574_0285703 | Ga0316574_0285703_149_697 | 177 |
| 786 | 3300035398 | Ga0316574_0339714 | Ga0316574_0339714_154_702 | 177 |
| 787 | 3300035691 | Ga0373931_0001103 | Ga0373931_0001103_7384_7923 | 177 |
| 788 | 3300035691 | Ga0373931_0155375 | Ga0373931_0155375_176_715 | 177 |
| 789 | 3300035695 | Ga0373927_0097286 | Ga0373927_0097286_1027_1566 | 177 |
| 790 | 3300035725 | Ga0373947_0280795 | Ga0373947_0280795_87_629 | 177 |
| 791 | 3300035725 | Ga0373947_0310403 | Ga0373947_0310403_440_979 | 177 |
| 792 | 3300036401 | Ga0373937_0134367 | Ga0373937_0134367_1502_2044 | 177 |
| 793 | 3300036647 | Ga0316582_0008735 | Ga0316582_0008735_104_652 | 177 |
| 794 | 3300036647 | Ga0316582_0322223 | Ga0316582_0322223_318_866 | 177 |
| 795 | 3300036647 | Ga0316582_0688999 | Ga0316582_0688999_97_645 | 177 |
| 796 | 3300036712 | Ga0316584_0002169 | Ga0316584_0002169_5271_5819 | 177 |
| 797 | 3300036712 | Ga0316584_0002768 | Ga0316584_0002768_2820_3368 | 177 |
| 798 | 3300036712 | Ga0316584_0079540 | Ga0316584_0079540_1598_2146 | 177 |
| 799 | 3300036712 | Ga0316584_0211980 | Ga0316584_0211980_849_1397 | 177 |
| 800 | 3300036712 | Ga0316584_0314817 | Ga0316584_0314817_398_946 | 177 |
| 801 | 3300036712 | Ga0316584_0420334 | Ga0316584_0420334_337_885 | 177 |
| 802 | 3300036712 | Ga0316584_0541647 | Ga0316584_0541647_174_722 | 177 |
| 803 | 3300037068 | Ga0373925_0011540 | Ga0373925_0011540_1219_1758 | 177 |
| 804 | 3300037068 | Ga0373925_0332102 | Ga0373925_0332102_417_971 | 177 |
| 805 | 3300037312 | Ga0395899_0001756 | Ga0395899_0001756_5481_6017 | 177 |
| 806 | 3300037418 | Ga0395900_0004771 | Ga0395900_0004771_9510_10046 | 177 |
| 807 | 3300037418 | Ga0395900_0030415 | Ga0395900_0030415_4408_4950 | 177 |
| 808 | 3300037418 | Ga0395900_0060539 | Ga0395900_0060539_1761_2297 | 177 |
| 809 | 3300037418 | Ga0395900_0188924 | Ga0395900_0188924_210_746 | 177 |
| 810 | 3300037418 | Ga0395900_0227543 | Ga0395900_0227543_328_885 | 177 |
| 811 | 3300037418 | Ga0395900_0365348 | Ga0395900_0365348_525_1073 | 177 |
| 812 | 3300037466 | Ga0395898_0009054 | Ga0395898_0009054_6680_7216 | 177 |
| 813 | 3300037466 | Ga0395898_0053216 | Ga0395898_0053216_385_942 | 177 |
| 814 | 3300037466 | Ga0395898_0098846 | Ga0395898_0098846_1198_1734 | 177 |
| 815 | 3300037466 | Ga0395898_0609028 | Ga0395898_0609028_239_781 | 177 |
| 816 | 3300037466 | Ga0395898_0771871 | Ga0395898_0771871_260_805 | 177 |
| 817 | 3300037471 | Ga0395905_0000766 | Ga0395905_0000766_34722_35258 | 177 |
| 818 | 3300037471 | Ga0395905_0001291 | Ga0395905_0001291_9250_9786 | 177 |
| 819 | 3300037471 | Ga0395905_0012118 | Ga0395905_0012118_7702_8238 | 177 |
| 820 | 3300037471 | Ga0395905_0014796 | Ga0395905_0014796_4138_4674 | 177 |
| 821 | 3300037471 | Ga0395905_0016964 | Ga0395905_0016964_1970_2506 | 177 |
| 822 | 3300037471 | Ga0395905_0020727 | Ga0395905_0020727_5617_6153 | 177 |
| 823 | 3300037471 | Ga0395905_0026748 | Ga0395905_0026748_2290_2835 | 177 |
| 824 | 3300037471 | Ga0395905_0068703 | Ga0395905_0068703_724_1260 | 177 |
| 825 | 3300037471 | Ga0395905_0092246 | Ga0395905_0092246_1884_2444 | 177 |
| 826 | 3300037471 | Ga0395905_0099460 | Ga0395905_0099460_1854_2396 | 177 |
| 827 | 3300037471 | Ga0395905_0124829 | Ga0395905_0124829_1123_1659 | 177 |
| 828 | 3300037471 | Ga0395905_0206586 | Ga0395905_0206586_663_1199 | 177 |
| 829 | 3300037471 | Ga0395905_0284423 | Ga0395905_0284423_873_1412 | 177 |
| 830 | 3300037471 | Ga0395905_0942309 | Ga0395905_0942309_192_749 | 177 |
| 831 | 3300037853 | Ga0436364_0110021 | Ga0436364_0110021_74_634 | 177 |
| 832 | 3300038443 | Ga0395901_0019770 | Ga0395901_0019770_17_553 | 177 |
| 833 | 3300038443 | Ga0395901_0058625 | Ga0395901_0058625_3083_3619 | 177 |
| 834 | 3300038443 | Ga0395901_0086077 | Ga0395901_0086077_1012_1569 | 177 |
| 835 | 3300038443 | Ga0395901_0366081 | Ga0395901_0366081_142_678 | 177 |
| 836 | 3300039447 | Ga0436361_0287447 | Ga0436361_0287447_93628_94197 | 177 |
| 837 | 3300041408 | Ga0439453_0022910 | Ga0439453_0022910_425_997 | 177 |
| 838 | 3300041458 | Ga0451798_0103100 | Ga0451798_0103100_27_566 | 177 |
| 839 | 3300041458 | Ga0451798_0705620 | Ga0451798_0705620_53_598 | 177 |
| 840 | 3300041505 | Ga0451849_0427330 | Ga0451849_0427330_287_829 | 177 |
| 841 | 3300041997 | Ga0439431_0005395 | Ga0439431_0005395_1371_1913 | 177 |
| 842 | 3300042000 | Ga0439437_015198 | Ga0439437_015198_95_634 | 177 |
| 843 | 3300042007 | Ga0439449_0013312 | Ga0439449_0013312_1699_2235 | 177 |
| 844 | 3300042014 | Ga0439457_011808 | Ga0439457_011808_527_1063 | 177 |
| 845 | 3300042015 | Ga0439462_0000705 | Ga0439462_0000705_5411_5947 | 177 |
| 846 | 3300042126 | Ga0450888_013593 | Ga0450888_013593_364_903 | 177 |
| 847 | 3300042129 | Ga0450891_001234 | Ga0450891_001234_2033_2572 | 177 |
| 848 | 3300042130 | Ga0450892_002535 | Ga0450892_002535_760_1299 | 177 |
| 849 | 3300042137 | Ga0450902_039386 | Ga0450902_039386_24_563 | 177 |
| 850 | 3300042144 | Ga0450889_004023 | Ga0450889_004023_587_1126 | 177 |
| 851 | 3300042436 | Ga0439435_0077011 | Ga0439435_0077011_84_626 | 177 |
| 852 | 3300042532 | Ga0450893_0005510 | Ga0450893_0005510_927_1466 | 177 |
| 853 | 3300042876 | Ga0451577_0053739 | Ga0451577_0053739_1562_2098 | 177 |
| 854 | 3300042876 | Ga0451577_0069012 | Ga0451577_0069012_1630_2178 | 177 |
| 855 | 3300042876 | Ga0451577_0101947 | Ga0451577_0101947_1714_2250 | 177 |
| 856 | 3300042876 | Ga0451577_0354764 | Ga0451577_0354764_403_939 | 177 |
| 857 | 3300042876 | Ga0451577_0355963 | Ga0451577_0355963_129_671 | 177 |
| 858 | 3300042876 | Ga0451577_0413853 | Ga0451577_0413853_655_1191 | 177 |
| 859 | 3300044656 | Ga0466969_0023883 | Ga0466969_0023883_485_1021 | 177 |
| 860 | 3300044658 | Ga0466972_0037986 | Ga0466972_0037986_1078_1614 | 177 |
| 861 | 3300044673 | Ga0453683_0002126 | Ga0453683_0002126_9864_10403 | 177 |
| 862 | 3300044684 | Ga0466966_0003258 | Ga0466966_0003258_877_1413 | 177 |
| 863 | 3300044684 | Ga0466966_0276151 | Ga0466966_0276151_116_652 | 177 |
| 864 | 3300044693 | Ga0466961_0101036 | Ga0466961_0101036_133_669 | 177 |
| 865 | 3300044694 | Ga0466963_0295644 | Ga0466963_0295644_212_748 | 177 |
| 866 | 3300044694 | Ga0466963_0312675 | Ga0466963_0312675_301_840 | 177 |
| 867 | 3300044694 | Ga0466963_0334919 | Ga0466963_0334919_406_1053 | 177 |
| 868 | 3300044712 | Ga0453684_0010561 | Ga0453684_0010561_2627_3169 | 177 |
| 869 | 3300044712 | Ga0453684_0039888 | Ga0453684_0039888_1750_2292 | 177 |
| 870 | 3300044712 | Ga0453684_0040403 | Ga0453684_0040403_284_820 | 177 |
| 871 | 3300044712 | Ga0453684_0196771 | Ga0453684_0196771_1408_1944 | 177 |
| 872 | 3300044712 | Ga0453684_0295646 | Ga0453684_0295646_742_1278 | 177 |
| 873 | 3300044712 | Ga0453684_0398824 | Ga0453684_0398824_984_1523 | 177 |
| 874 | 3300044712 | Ga0453684_0441204 | Ga0453684_0441204_787_1323 | 177 |
| 875 | 3300044712 | Ga0453684_0668228 | Ga0453684_0668228_276_812 | 177 |
| 876 | 3300044842 | Ga0466957_0062916 | Ga0466957_0062916_1717_2253 | 177 |
| 877 | 3300044842 | Ga0466957_0602662 | Ga0466957_0602662_188_724 | 177 |
| 878 | 3300045049 | Ga0466959_0024293 | Ga0466959_0024293_3493_4029 | 177 |
| 879 | 3300045051 | Ga0451576_0005135 | Ga0451576_0005135_10538_11074 | 177 |
| 880 | 3300045051 | Ga0451576_0027293 | Ga0451576_0027293_4632_5177 | 177 |
| 881 | 3300045051 | Ga0451576_0040243 | Ga0451576_0040243_967_1503 | 177 |
| 882 | 3300045051 | Ga0451576_0135333 | Ga0451576_0135333_1902_2438 | 177 |
| 883 | 3300045051 | Ga0451576_0326585 | Ga0451576_0326585_817_1356 | 177 |
| 884 | 3300045051 | Ga0451576_0357068 | Ga0451576_0357068_295_963 | 177 |
| 885 | 3300045836 | Ga0466958_0879166 | Ga0466958_0879166_22_567 | 177 |
| 886 | 3300046507 | Ga0495606_0021187 | Ga0495606_0021187_665_1204 | 177 |
| 887 | 3300046528 | Ga0495642_0065383 | Ga0495642_0065383_48_590 | 177 |
| 888 | 3300046539 | Ga0495621_0087741 | Ga0495621_0087741_463_1017 | 177 |
| 889 | 3300046558 | Ga0495633_0261256 | Ga0495633_0261256_91_645 | 177 |
| 890 | 3300046615 | Ga0495656_0026669 | Ga0495656_0026669_1729_2271 | 177 |
| 891 | 3300046674 | Ga0495588_0335815 | Ga0495588_0335815_234_776 | 177 |
| 892 | 3300046681 | Ga0495647_0146392 | Ga0495647_0146392_437_991 | 177 |
| 893 | 3300046809 | Ga0495600_0046717 | Ga0495600_0046717_540_1079 | 177 |
| 894 | 3300047447 | Ga0495685_089313 | Ga0495685_089313_58_600 | 177 |
| 895 | 3300048903 | Ga0496100_0252142 | Ga0496100_0252142_369_923 | 177 |
| 896 | 3300048904 | Ga0496101_0026022 | Ga0496101_0026022_1903_2442 | 177 |
| 897 | 3300048905 | Ga0496102_0041398 | Ga0496102_0041398_722_1261 | 177 |
| 898 | 3300048906 | Ga0496103_0082579 | Ga0496103_0082579_721_1260 | 177 |
| 899 | 3300048908 | Ga0496105_0138860 | Ga0496105_0138860_351_905 | 177 |
| 900 | 3300048909 | Ga0496106_0007016 | Ga0496106_0007016_2008_2547 | 177 |
| 901 | 3300048909 | Ga0496106_0622549 | Ga0496106_0622549_255_803 | 177 |
| 902 | 3300048910 | Ga0496107_0003667 | Ga0496107_0003667_3181_3720 | 177 |
| 903 | 3300048911 | Ga0496108_0100651 | Ga0496108_0100651_1809_2363 | 177 |
| 904 | 3300048911 | Ga0496108_0811767 | Ga0496108_0811767_65_613 | 177 |
| 905 | 3300048912 | Ga0496109_0688124 | Ga0496109_0688124_230_784 | 177 |
| 906 | 3300048913 | Ga0496110_0082466 | Ga0496110_0082466_24_563 | 177 |
| 907 | 3300048913 | Ga0496110_0392366 | Ga0496110_0392366_173_721 | 177 |
| 908 | 3300048913 | Ga0496110_0485215 | Ga0496110_0485215_267_806 | 177 |
| 909 | 3300048917 | Ga0496114_0040304 | Ga0496114_0040304_32_580 | 177 |
| 910 | 3300048917 | Ga0496114_0321718 | Ga0496114_0321718_557_1096 | 177 |
| 911 | 3300048917 | Ga0496114_0892279 | Ga0496114_0892279_210_749 | 177 |
| 912 | 3300048918 | Ga0496115_0110638 | Ga0496115_0110638_792_1340 | 177 |
| 913 | 3300048929 | Ga0496126_0073906 | Ga0496126_0073906_92_631 | 177 |
| 914 | 3300048929 | Ga0496126_0098894 | Ga0496126_0098894_20_610 | 177 |
| 915 | 3300049537 | Ga0501321_033060 | Ga0501321_033060_20_556 | 177 |
| 916 | 3300049568 | Ga0501031_0344540 | Ga0501031_0344540_208_744 | 177 |
| 917 | 3300049569 | Ga0501032_0042298 | Ga0501032_0042298_2353_2901 | 177 |
| 918 | 3300049570 | Ga0501033_0003126 | Ga0501033_0003126_9237_9785 | 177 |
| 919 | 3300049571 | Ga0501034_0144355 | Ga0501034_0144355_382_930 | 177 |
| 920 | 3300049572 | Ga0501036_0048691 | Ga0501036_0048691_2015_2563 | 177 |
| 921 | 3300049572 | Ga0501036_0373238 | Ga0501036_0373238_249_785 | 177 |
| 922 | 3300049574 | Ga0501038_0001778 | Ga0501038_0001778_1680_2228 | 177 |
| 923 | 3300049574 | Ga0501038_0002840 | Ga0501038_0002840_702_1250 | 177 |
| 924 | 3300049574 | Ga0501038_0016852 | Ga0501038_0016852_763_1311 | 177 |
| 925 | 3300049575 | Ga0501039_0185429 | Ga0501039_0185429_751_1299 | 177 |
| 926 | 3300049579 | Ga0501043_0117673 | Ga0501043_0117673_1348_1896 | 177 |
| 927 | 3300049579 | Ga0501043_0208325 | Ga0501043_0208325_213_761 | 177 |
| 928 | 3300049580 | Ga0501046_0212720 | Ga0501046_0212720_464_1000 | 177 |
| 929 | 3300049581 | Ga0501047_0051037 | Ga0501047_0051037_1458_2006 | 177 |
| 930 | 3300049581 | Ga0501047_0129991 | Ga0501047_0129991_206_754 | 177 |
| 931 | 3300049581 | Ga0501047_0201281 | Ga0501047_0201281_393_929 | 177 |
| 932 | 3300049583 | Ga0501067_0044231 | Ga0501067_0044231_29_577 | 177 |
| 933 | 3300049583 | Ga0501067_0126021 | Ga0501067_0126021_491_1030 | 177 |
| 934 | 3300049584 | Ga0501068_0087775 | Ga0501068_0087775_928_1476 | 177 |
| 935 | 3300049586 | Ga0501070_0020843 | Ga0501070_0020843_1228_1776 | 177 |
| 936 | 3300049588 | Ga0501072_0151564 | Ga0501072_0151564_913_1461 | 177 |
| 937 | 3300049590 | Ga0501074_0049464 | Ga0501074_0049464_2078_2632 | 177 |
| 938 | 3300049653 | Ga0501206_044493 | Ga0501206_044493_122_661 | 177 |
| 939 | 3300049679 | Ga0501249_123915 | Ga0501249_123915_68_604 | 177 |
| 940 | 3300049742 | Ga0501080_0012284 | Ga0501080_0012284_5965_6513 | 177 |
| 941 | 3300049742 | Ga0501080_0223535 | Ga0501080_0223535_263_799 | 177 |
| 942 | 3300049744 | Ga0501083_0020376 | Ga0501083_0020376_3064_3618 | 177 |
| 943 | 3300049765 | Ga0501268_009130 | Ga0501268_009130_230_766 | 177 |
| 944 | 3300049822 | Ga0501035_0040039 | Ga0501035_0040039_436_972 | 177 |
| 945 | 3300049822 | Ga0501035_0335483 | Ga0501035_0335483_662_1198 | 177 |
| 946 | 3300049823 | Ga0501044_0000190 | Ga0501044_0000190_28758_29306 | 177 |
| 947 | 3300049823 | Ga0501044_0007285 | Ga0501044_0007285_3897_4445 | 177 |
| 948 | 3300049823 | Ga0501044_0199944 | Ga0501044_0199944_905_1441 | 177 |
| 949 | 3300049823 | Ga0501044_0411221 | Ga0501044_0411221_127_675 | 177 |
| 950 | 3300050489 | nmdc:mga03683_404348_c1 | nmdc:mga03683_404348_c1_68_607 | 177 |
| 951 | 3300050491 | nmdc:mga00v17_479592_c1 | nmdc:mga00v17_479592_c1_23_571 | 177 |
| 952 | 3300050492 | nmdc:mga0yw44_84203_c1 | nmdc:mga0yw44_84203_c1_607_1143 | 177 |
| 953 | 3300050492 | nmdc:mga0yw44_89251_c1 | nmdc:mga0yw44_89251_c1_754_1290 | 177 |
| 954 | 3300050493 | nmdc:mga0k408_103702_c1 | nmdc:mga0k408_103702_c1_971_1519 | 177 |
| 955 | 3300050493 | nmdc:mga0k408_11575_c1 | nmdc:mga0k408_11575_c1_4122_4661 | 177 |
| 956 | 3300050493 | nmdc:mga0k408_166294_c1 | nmdc:mga0k408_166294_c1_134_673 | 177 |
| 957 | 3300050493 | nmdc:mga0k408_20110_c1 | nmdc:mga0k408_20110_c1_2538_3077 | 177 |
| 958 | 3300050493 | nmdc:mga0k408_209017_c1 | nmdc:mga0k408_209017_c1_340_879 | 177 |
| 959 | 3300050493 | nmdc:mga0k408_229191_c1 | nmdc:mga0k408_229191_c1_529_1077 | 177 |
| 960 | 3300050493 | nmdc:mga0k408_24729_c1 | nmdc:mga0k408_24729_c1_942_1490 | 177 |
| 961 | 3300050493 | nmdc:mga0k408_460634_c1 | nmdc:mga0k408_460634_c1_114_650 | 177 |
| 962 | 3300050493 | nmdc:mga0k408_485201_c1 | nmdc:mga0k408_485201_c1_172_708 | 177 |
| 963 | 3300050493 | nmdc:mga0k408_55388_c1 | nmdc:mga0k408_55388_c1_1296_1835 | 177 |
| 964 | 3300050494 | nmdc:mga06z11_203047_c1 | nmdc:mga06z11_203047_c1_198_737 | 177 |
| 965 | 3300050494 | nmdc:mga06z11_330043_c1 | nmdc:mga06z11_330043_c1_364_900 | 177 |
| 966 | 3300050494 | nmdc:mga06z11_49023_c1 | nmdc:mga06z11_49023_c1_1293_1832 | 177 |
| 967 | 3300050496 | nmdc:mga07m45_138780_c1 | nmdc:mga07m45_138780_c1_822_1361 | 177 |
| 968 | 3300050496 | nmdc:mga07m45_295207_c1 | nmdc:mga07m45_295207_c1_357_896 | 177 |
| 969 | 3300050496 | nmdc:mga07m45_39199_c1 | nmdc:mga07m45_39199_c1_845_1384 | 177 |
| 970 | 3300050507 | nmdc:mga05p37_21359_c1 | nmdc:mga05p37_21359_c1_382_921 | 177 |
| 971 | 3300050508 | nmdc:mga09592_1507_c1 | nmdc:mga09592_1507_c1_11187_11726 | 177 |
| 972 | 3300050509 | nmdc:mga0qj67_625084_c1 | nmdc:mga0qj67_625084_c1_269_808 | 177 |
| 973 | 3300050510 | nmdc:mga06r32_372966_c1 | nmdc:mga06r32_372966_c1_20_559 | 177 |
| 974 | 3300050511 | nmdc:mga08y16_275352_c1 | nmdc:mga08y16_275352_c1_654_1193 | 177 |
| 975 | 3300050512 | nmdc:mga0n895_862014_c1 | nmdc:mga0n895_862014_c1_249_800 | 177 |
| 976 | 3300050515 | nmdc:mga0a205_704416_c1 | nmdc:mga0a205_704416_c1_301_840 | 177 |
| 977 | 3300053156 | Ga0500622_0000875 | Ga0500622_0000875_5687_6226 | 177 |
| 978 | 3300059421 | Ga0590071_086766 | Ga0590071_086766_155_697 | 177 |
| 979 | 3300059424 | Ga0590075_039292 | Ga0590075_039292_653_1189 | 177 |
| 980 | 3300059424 | Ga0590075_162080 | Ga0590075_162080_37_576 | 177 |
| 981 | 3300061719 | Ga0466962_0140193 | Ga0466962_0140193_401_937 | 177 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3d63-assembly1.cif.gz_C-3 | crystal structure of inorganic pyrophosphatase from burkholderia pseudomallei | 0.9304 | 4 | 174 |
| 4xel-assembly1.cif.gz_A | crystal structure of inorganic pyrophosphatase (ppase) from pseudomonas aeruginosa | 0.9296 | 2 | 174 |
| 4xel-assembly2.cif.gz_B | crystal structure of inorganic pyrophosphatase (ppase) from pseudomonas aeruginosa | 0.9282 | 2 | 174 |
| 4xel-assembly1.cif.gz_A | crystal structure of inorganic pyrophosphatase (ppase) from pseudomonas aeruginosa | 0.9193 | 2 | 174 |
| 4xel-assembly2.cif.gz_B | crystal structure of inorganic pyrophosphatase (ppase) from pseudomonas aeruginosa | 0.9178 | 2 | 174 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1i40A00 | Alpha Beta;Alpha-Beta Complex;Inorganic Pyrophosphatase;Inorganic pyrophosphatase | 0.9095 | 2 | 175 | 3.90.80.10 |
| 3q5vB00 | Alpha Beta;Alpha-Beta Complex;Inorganic Pyrophosphatase;Inorganic pyrophosphatase | 0.9022 | 3 | 175 | 3.90.80.10 |
| 1i40A00 | Alpha Beta;Alpha-Beta Complex;Inorganic Pyrophosphatase;Inorganic pyrophosphatase | 0.8995 | 2 | 175 | 3.90.80.10 |
| af_Q4DDK6_17_177_1.25.40.20 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Ankyrin repeat-containing domain | 0.8938 | 28 | 43 | 1.25.40.20 |
| 3emjE00 | Alpha Beta;Alpha-Beta Complex;Inorganic Pyrophosphatase;Inorganic pyrophosphatase | 0.8894 | 17 | 171 | 3.90.80.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3D5Q6T3-F1-model_v4 | inorganic diphosphatase (EC 3.6.1.1) | 0.9839 | 50 | 174 |
GO:0000287
GO:0004427 GO:0005737 GO:0006796 |
| AF-A0A257JFP8-F1-model_v4 | inorganic diphosphatase (EC 3.6.1.1) | 0.9823 | 68 | 176 |
GO:0000287
GO:0004427 GO:0005737 GO:0006796 |
| AF-A0A7R8ZVX2-F1-model_v4 | inorganic diphosphatase (EC 3.6.1.1) | 0.9776 | 55 | 175 |
GO:0000287
GO:0004427 GO:0005737 GO:0006796 |
| AF-A0A3M6FPT4-F1-model_v4 | inorganic diphosphatase (EC 3.6.1.1) | 0.9746 | 73 | 174 |
GO:0000287
GO:0004427 GO:0005737 GO:0006796 |
| AF-A0A1Y5ETG5-F1-model_v4 | inorganic diphosphatase (EC 3.6.1.1) | 0.9737 | 57 | 175 |
GO:0000287
GO:0004427 GO:0005737 GO:0006796 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar