F487402

General Info

Members Datasets Scaffolds Average Seq Length
981 393 981 181

Family's Representative Sequence

Representative Sequence 3300046524|Ga0495648_0090864|Ga0495648_0090864_828_1376
Length 182
Sequence MSLHLVSPGAKAPEEFNVIIEIPMNADPIKYEVDKESGALFVDRFMTTAMHYPCNYGYVPRTLADDGDPVDVLVITPFPLTPGVVVTCRAIGVLMMDDEAGDAKLLAVPTTKILPIYDHWQKPEDINQMRLKAIQHFFEHYKDLEPNKWVKVKGWEGPEAAKAEITSGMKAYDADQAKKAGK

Samples

Sample ID Description Type Environment
1 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
2 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
3 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
4 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
5 3300003503 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM Metagenome Rhizosphere
6 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
7 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
8 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
9 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
10 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
11 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
12 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
13 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
14 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
15 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
16 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
17 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
18 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
19 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
22 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
23 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
24 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
25 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
26 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
27 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
28 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
29 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
30 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
31 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
32 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
35 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
38 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
39 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
40 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
41 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
42 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
43 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
44 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
45 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
46 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
47 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
48 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
49 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
50 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
51 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
52 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
53 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
54 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
55 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
56 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
57 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
58 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
59 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
60 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
61 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
62 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
63 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
64 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
65 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
66 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
67 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
68 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
69 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
70 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
71 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
72 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
73 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
74 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
75 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
76 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
77 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
78 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
79 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
80 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
81 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
82 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
83 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
84 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
85 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
86 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
87 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
88 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
89 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
91 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
92 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
93 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
94 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
95 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
96 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
97 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
98 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
99 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
101 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
102 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
103 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
104 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
105 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
106 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
107 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
108 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
109 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
110 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
111 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
112 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
113 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
114 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
115 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
116 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
117 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
118 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
119 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
120 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
121 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
122 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
123 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
124 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
125 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
126 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
127 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
128 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
129 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
135 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
137 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
138 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
140 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
203 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
204 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
206 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
208 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
209 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
213 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
214 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
215 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
216 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
217 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
218 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
219 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
220 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
221 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
222 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
223 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
224 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
225 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
226 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
227 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
228 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
229 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
230 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
231 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
232 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
233 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
234 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
235 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
236 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
237 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
238 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
239 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
240 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
241 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
242 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
243 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
244 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
245 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
246 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
247 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
248 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
249 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
250 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
251 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
252 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
253 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
254 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
255 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
256 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
257 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
258 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
259 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
260 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
261 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
262 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
263 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
264 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
265 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
266 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
267 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
268 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
269 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
270 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
271 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
272 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
273 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
274 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
275 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
276 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
277 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
278 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
279 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
280 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
281 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
282 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
283 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
284 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
285 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
286 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
287 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
288 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
289 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
290 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
291 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
292 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
293 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
294 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
295 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
296 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
297 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
298 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
299 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
300 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
301 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
302 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
303 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
304 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
305 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
306 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
307 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
308 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
309 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
310 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
311 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
312 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
313 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
314 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
315 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
316 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
317 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
318 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
319 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
320 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
321 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
322 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
323 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
324 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
325 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
326 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
327 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
328 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
329 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
330 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
331 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
332 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
333 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
334 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
335 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
336 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
337 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
338 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
339 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
340 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
341 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
342 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
343 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
344 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
345 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
346 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
347 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
348 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
349 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
350 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
351 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
352 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
353 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
354 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
355 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
356 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
357 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
358 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
359 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
360 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
361 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
362 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
363 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
364 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
365 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
366 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
367 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
368 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
369 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
370 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
371 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
372 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
373 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
374 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
375 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
376 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
377 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
378 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
379 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
380 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
381 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
382 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
383 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
384 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
385 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
386 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
387 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
388 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
389 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
390 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
391 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
392 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
393 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.55
Metatranscriptomes 2.45
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.25
Nodule 0.1
Rhizoplane 2.24
Rhizosphere 82.36
Stem 0
Stem Tuber 0
Unclassified 2.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25150J39212_1003483 3300002774 Bacteria 3674
2 JGI25150J39212_1024682 3300002774 Bacteria 883
3 JGI25159J45721_1009081 3300002987 Bacteria 2660
4 JGI25160J50197_1001459 3300003354 Bacteria 11787
5 JGI25161J50226_1000015 3300003374 Bacteria 183773
6 JGI25161J50226_1008780 3300003374 Bacteria 1515
7 JGI26141J51220_1007754 3300003503 Bacteria 688
8 Ga0055539_1005175 3300003752 Bacteria 1703
9 Ga0055533_1000006 3300003756 Bacteria 635559
10 Ga0055525_1001050 3300003759 Bacteria 7136
11 Ga0055535_1000702 3300003761 Bacteria 25845
12 Ga0055529_1000340 3300003763 Bacteria 52215
13 Ga0055526_1003568 3300003771 Bacteria 9797
14 Ga0055524_1000016 3300003775 Bacteria 244926
15 Ga0055524_1002380 3300003775 Bacteria 9743
16 Ga0055534_1000697 3300003784 Bacteria 16609
17 Ga0055530_10000243 3300003791 Bacteria 49150
18 Ga0055530_10031028 3300003791 Bacteria 1407
19 Ga0055540_1000031 3300003792 Bacteria 177859
20 Ga0055540_1005908 3300003792 Bacteria 5000
21 Ga0055540_1040189 3300003792 Bacteria 1015
22 Ga0055531_10000358 3300003794 Bacteria 44456
23 Ga0055531_10001823 3300003794 Bacteria 15098
24 Ga0055531_10009351 3300003794 Bacteria 5018
25 Ga0055531_10018799 3300003794 Bacteria 2833
26 Ga0055543_1000749 3300004625 Bacteria 16336
27 Ga0065165_1000184 3300005262 Bacteria 109539
28 Ga0065165_1001656 3300005262 Bacteria 22573
29 Ga0065712_10414260 3300005290 Bacteria 718
30 Ga0070658_10100190 3300005327 Bacteria 2394
31 Ga0070658_10133246 3300005327 Bacteria 2072
32 Ga0070658_10202913 3300005327 Bacteria 1673
33 Ga0070658_10355992 3300005327 Bacteria 1253
34 Ga0070658_10381235 3300005327 Bacteria 1210
35 Ga0070658_11084150 3300005327 Bacteria 697
36 Ga0070676_10003114 3300005328 Bacteria 8566
37 Ga0070683_100046468 3300005329 Bacteria 4011
38 Ga0070690_100096829 3300005330 Bacteria 1951
39 Ga0070690_100108266 3300005330 Bacteria 1851
40 Ga0070670_100103661 3300005331 Bacteria 2450
41 Ga0070670_100109374 3300005331 Bacteria 2381
42 Ga0070670_100112783 3300005331 Bacteria 2344
43 Ga0070677_10060395 3300005333 Bacteria 1562
44 Ga0068869_100008595 3300005334 Bacteria 6594
45 Ga0068869_100094463 3300005334 Bacteria 2254
46 Ga0068869_100478998 3300005334 Bacteria 1036
47 Ga0068869_100540583 3300005334 Bacteria 977
48 Ga0070666_10026213 3300005335 Bacteria 3805
49 Ga0070666_10047978 3300005335 Bacteria 2868
50 Ga0070680_100003443 3300005336 Bacteria 11816
51 Ga0070680_100236703 3300005336 Bacteria 1543
52 Ga0070680_100301955 3300005336 Bacteria 1358
53 Ga0070680_100707356 3300005336 Bacteria 867
54 Ga0070682_100561892 3300005337 Bacteria 895
55 Ga0068868_100005289 3300005338 Bacteria 9069
56 Ga0068868_100052727 3300005338 Bacteria 3202
57 Ga0068868_100061443 3300005338 Bacteria 2976
58 Ga0068868_100593224 3300005338 Bacteria 981
59 Ga0070660_100116604 3300005339 Bacteria 2129
60 Ga0070660_100626551 3300005339 Bacteria 900
61 Ga0070660_101281453 3300005339 Bacteria 622
62 Ga0070661_100001017 3300005344 Bacteria 19866
63 Ga0070661_100003350 3300005344 Bacteria 11047
64 Ga0070661_100003668 3300005344 Bacteria 10577
65 Ga0070661_100009848 3300005344 Bacteria 6630
66 Ga0070661_100244661 3300005344 Bacteria 1382
67 Ga0070661_100292187 3300005344 Bacteria 1267
68 Ga0070668_100052979 3300005347 Bacteria 3129
69 Ga0070668_100128808 3300005347 Bacteria 2029
70 Ga0070668_100295979 3300005347 Bacteria 1356
71 Ga0070668_100470585 3300005347 Bacteria 1084
72 Ga0070668_100819777 3300005347 Bacteria 828
73 Ga0070669_100064909 3300005353 Bacteria 2689
74 Ga0070669_100120123 3300005353 Bacteria 2004
75 Ga0070669_100144552 3300005353 Bacteria 1837
76 Ga0070669_100290021 3300005353 Bacteria 1313
77 Ga0070669_100316324 3300005353 Bacteria 1259
78 Ga0070675_100004442 3300005354 Bacteria 10691
79 Ga0070675_100040042 3300005354 Bacteria 3825
80 Ga0070675_100051871 3300005354 Bacteria 3372
81 Ga0070675_100127239 3300005354 Bacteria 2168
82 Ga0070671_100001374 3300005355 Bacteria 18233
83 Ga0070671_100002406 3300005355 Bacteria 14465
84 Ga0070671_100083652 3300005355 Bacteria 2668
85 Ga0070671_100267940 3300005355 Bacteria 1452
86 Ga0070671_100431894 3300005355 Bacteria 1129
87 Ga0070674_100107477 3300005356 Bacteria 2043
88 Ga0070674_100275481 3300005356 Bacteria 1331
89 Ga0070674_100285037 3300005356 Bacteria 1311
90 Ga0070673_100011989 3300005364 Bacteria 5935
91 Ga0070673_100028745 3300005364 Bacteria 4139
92 Ga0070673_100060774 3300005364 Bacteria 2995
93 Ga0070673_100134464 3300005364 Bacteria 2079
94 Ga0070673_100169243 3300005364 Bacteria 1864
95 Ga0070673_100355852 3300005364 Bacteria 1300
96 Ga0070673_100538360 3300005364 Bacteria 1060
97 Ga0070688_100092870 3300005365 Bacteria 1975
98 Ga0070688_100847574 3300005365 Bacteria 718
99 Ga0070659_100008648 3300005366 Bacteria 7447
100 Ga0070659_100009656 3300005366 Bacteria 7093
101 Ga0070659_100010955 3300005366 Bacteria 6694
102 Ga0070659_100034650 3300005366 Bacteria 3927
103 Ga0070659_100141291 3300005366 Bacteria 1960
104 Ga0070659_100411493 3300005366 Bacteria 1143
105 Ga0070667_100011503 3300005367 Bacteria 7319
106 Ga0070667_100117594 3300005367 Bacteria 2309
107 Ga0070667_100241234 3300005367 Bacteria 1614
108 Ga0070709_10030621 3300005434 Bacteria 3231
109 Ga0070714_100173379 3300005435 Bacteria 1959
110 Ga0070713_100000130 3300005436 Bacteria 49533
111 Ga0070705_100017028 3300005440 Bacteria 3786
112 Ga0070700_100256201 3300005441 Bacteria 1258
113 Ga0070708_101176366 3300005445 Bacteria 717
114 Ga0070663_100003894 3300005455 Bacteria 8699
115 Ga0070663_100109842 3300005455 Bacteria 2071
116 Ga0070663_100199084 3300005455 Bacteria 1562
117 Ga0070678_100196536 3300005456 Bacteria 1662
118 Ga0070678_100281519 3300005456 Bacteria 1406
119 Ga0070662_100008653 3300005457 Bacteria 6642
120 Ga0070662_100035270 3300005457 Bacteria 3532
121 Ga0070662_100055900 3300005457 Bacteria 2864
122 Ga0070662_100251718 3300005457 Bacteria 1420
123 Ga0070662_100382564 3300005457 Bacteria 1159
124 Ga0070681_10244657 3300005458 Bacteria 1707
125 Ga0070681_10271022 3300005458 Bacteria 1609
126 Ga0068867_100003867 3300005459 Bacteria 10534
127 Ga0068867_100022367 3300005459 Bacteria 4520
128 Ga0068867_100041971 3300005459 Bacteria 3343
129 Ga0068867_100048475 3300005459 Bacteria 3125
130 Ga0068867_100058206 3300005459 Bacteria 2863
131 Ga0068867_100087816 3300005459 Bacteria 2355
132 Ga0068867_100178516 3300005459 Bacteria 1687
133 Ga0068867_100357333 3300005459 Bacteria 1221
134 Ga0070706_100118675 3300005467 Bacteria 2465
135 Ga0070707_100203639 3300005468 Bacteria 1929
136 Ga0070698_100264266 3300005471 Bacteria 1653
137 Ga0070699_101629698 3300005518 Bacteria 591
138 Ga0070679_100025230 3300005530 Bacteria 5830
139 Ga0070679_100028347 3300005530 Bacteria 5520
140 Ga0068853_100016064 3300005539 Bacteria 6156
141 Ga0068853_100016533 3300005539 Bacteria 6075
142 Ga0068853_100116503 3300005539 Bacteria 2379
143 Ga0068853_100169118 3300005539 Bacteria 1977
144 Ga0068853_100624162 3300005539 Bacteria 1025
145 Ga0068853_100873844 3300005539 Bacteria 863
146 Ga0070672_100002447 3300005543 Bacteria 11784
147 Ga0070672_100023360 3300005543 Bacteria 4556
148 Ga0070672_100096280 3300005543 Bacteria 2395
149 Ga0070672_100400394 3300005543 Bacteria 1176
150 Ga0070672_100719987 3300005543 Bacteria 874
151 Ga0070686_100240166 3300005544 Bacteria 1319
152 Ga0070686_100374691 3300005544 Bacteria 1076
153 Ga0070695_100162631 3300005545 Bacteria 1568
154 Ga0070693_100116592 3300005547 Bacteria 1651
155 Ga0070665_100232077 3300005548 Bacteria 1845
156 Ga0070704_100058372 3300005549 Bacteria 2748
157 Ga0068855_100020005 3300005563 Bacteria 8038
158 Ga0068855_100089265 3300005563 Bacteria 3559
159 Ga0068855_100107592 3300005563 Bacteria 3203
160 Ga0068855_100192672 3300005563 Bacteria 2298
161 Ga0068855_100262901 3300005563 Bacteria 1922
162 Ga0070664_100007230 3300005564 Bacteria 8956
163 Ga0070664_100015534 3300005564 Bacteria 6230
164 Ga0070664_100172576 3300005564 Bacteria 1919
165 Ga0070664_100377837 3300005564 Bacteria 1293
166 Ga0070664_100501624 3300005564 Bacteria 1119
167 Ga0068857_100133458 3300005577 Bacteria 2241
168 Ga0068857_100162416 3300005577 Bacteria 2027
169 Ga0068854_100010927 3300005578 Bacteria 5890
170 Ga0068854_100014879 3300005578 Bacteria 5137
171 Ga0068854_100307993 3300005578 Bacteria 1284
172 Ga0068854_100361197 3300005578 Bacteria 1191
173 Ga0068854_100852354 3300005578 Bacteria 798
174 Ga0068856_100000937 3300005614 Bacteria 31230
175 Ga0068856_100031144 3300005614 Bacteria 5218
176 Ga0068856_100147214 3300005614 Bacteria 2363
177 Ga0068856_100444718 3300005614 Bacteria 1317
178 Ga0068856_100712745 3300005614 Bacteria 1024
179 Ga0070702_100168051 3300005615 Bacteria 1424
180 Ga0068852_100099190 3300005616 Bacteria 2625
181 Ga0068852_100117707 3300005616 Bacteria 2427
182 Ga0068852_100141142 3300005616 Bacteria 2229
183 Ga0068852_100208568 3300005616 Bacteria 1852
184 Ga0068852_100482686 3300005616 Bacteria 1232
185 Ga0068852_100711964 3300005616 Bacteria 1014
186 Ga0068852_101005196 3300005616 Bacteria 853
187 Ga0068859_100123948 3300005617 Bacteria 2652
188 Ga0068859_100441896 3300005617 Bacteria 1397
189 Ga0068859_101763367 3300005617 Bacteria 684
190 Ga0068864_100011853 3300005618 Bacteria 7199
191 Ga0068864_100046809 3300005618 Bacteria 3712
192 Ga0068864_100055254 3300005618 Bacteria 3427
193 Ga0068866_10014255 3300005718 Bacteria 3506
194 Ga0068861_100031456 3300005719 Bacteria 3899
195 Ga0068861_100036313 3300005719 Bacteria 3656
196 Ga0068863_100148557 3300005841 Bacteria 2242
197 Ga0068863_100202444 3300005841 Bacteria 1910
198 Ga0068863_100780030 3300005841 Bacteria 953
199 Ga0068863_100868468 3300005841 Bacteria 901
200 Ga0068863_100952990 3300005841 Bacteria 860
201 Ga0068858_100054024 3300005842 Bacteria 3715
202 Ga0068858_100146464 3300005842 Bacteria 2218
203 Ga0068858_100532627 3300005842 Bacteria 1136
204 Ga0068860_100000678 3300005843 Bacteria 39403
205 Ga0068860_100024635 3300005843 Bacteria 5810
206 Ga0068860_100248454 3300005843 Bacteria 1732
207 Ga0068862_100003264 3300005844 Bacteria 14033
208 Ga0068862_100017965 3300005844 Bacteria 5891
209 Ga0068862_100080001 3300005844 Bacteria 2833
210 Ga0068862_100150910 3300005844 Bacteria 2068
211 Ga0068862_100163746 3300005844 Bacteria 1987
212 Ga0068862_100838872 3300005844 Bacteria 900
213 Ga0068862_101634610 3300005844 Bacteria 652
214 Ga0081539_10041122 3300005985 Bacteria 2706
215 Ga0075365_10008403 3300006038 Bacteria 5857
216 Ga0075365_10008748 3300006038 Bacteria 5772
217 Ga0075365_10028653 3300006038 Bacteria 3552
218 Ga0075365_10147299 3300006038 Bacteria 1637
219 Ga0075368_10014094 3300006042 Bacteria 2947
220 Ga0075363_100025312 3300006048 Bacteria 3025
221 Ga0075363_100033613 3300006048 Bacteria 2672
222 Ga0075363_100202375 3300006048 Bacteria 1135
223 Ga0075363_100334914 3300006048 Bacteria 882
224 Ga0075363_100693279 3300006048 Bacteria 615
225 Ga0075364_10101510 3300006051 Bacteria 1915
226 Ga0075364_10139438 3300006051 Bacteria 1630
227 Ga0075364_10154474 3300006051 Bacteria 1547
228 Ga0075364_10183979 3300006051 Bacteria 1414
229 Ga0070712_100315479 3300006175 Bacteria 1270
230 Ga0075362_10004144 3300006177 Bacteria 5171
231 Ga0075362_10012281 3300006177 Bacteria 3399
232 Ga0075362_10016593 3300006177 Bacteria 3018
233 Ga0075362_10152765 3300006177 Bacteria 1108
234 Ga0075367_10020025 3300006178 Bacteria 3720
235 Ga0075367_10055393 3300006178 Bacteria 2353
236 Ga0075367_10084616 3300006178 Bacteria 1923
237 Ga0075367_10116234 3300006178 Bacteria 1645
238 Ga0075367_10177445 3300006178 Bacteria 1328
239 Ga0075367_10213445 3300006178 Bacteria 1207
240 Ga0075366_10013879 3300006195 Bacteria 4592
241 Ga0075366_10020363 3300006195 Bacteria 3849
242 Ga0075366_10022395 3300006195 Bacteria 3675
243 Ga0075366_10026318 3300006195 Bacteria 3406
244 Ga0075366_10044832 3300006195 Bacteria 2622
245 Ga0075366_10052485 3300006195 Bacteria 2422
246 Ga0075366_10064797 3300006195 Bacteria 2173
247 Ga0075366_10088105 3300006195 Bacteria 1858
248 Ga0075366_10114371 3300006195 Bacteria 1625
249 Ga0075366_10130349 3300006195 Bacteria 1517
250 Ga0075366_10143213 3300006195 Bacteria 1446
251 Ga0097621_100068313 3300006237 Bacteria 2931
252 Ga0097621_100096690 3300006237 Bacteria 2478
253 Ga0097621_100542168 3300006237 Bacteria 1058
254 Ga0075370_10000607 3300006353 Bacteria 13847
255 Ga0075370_10003963 3300006353 Bacteria 7113
256 Ga0075370_10009619 3300006353 Bacteria 5029
257 Ga0075370_10017562 3300006353 Bacteria 3868
258 Ga0075370_10018992 3300006353 Bacteria 3734
259 Ga0075370_10056841 3300006353 Bacteria 2224
260 Ga0075370_10144595 3300006353 Bacteria 1391
261 Ga0075370_10187168 3300006353 Bacteria 1219
262 Ga0075370_10191401 3300006353 Bacteria 1205
263 Ga0068871_100129517 3300006358 Bacteria 2138
264 Ga0068871_100218700 3300006358 Bacteria 1649
265 Ga0068871_100522893 3300006358 Bacteria 1072
266 Ga0068871_100606574 3300006358 Bacteria 996
267 Ga0075428_100121466 3300006844 Bacteria 2844
268 Ga0075428_100271198 3300006844 Bacteria 1826
269 Ga0075431_100009882 3300006847 Bacteria 9579
270 Ga0075429_100000463 3300006880 Bacteria 30330
271 Ga0068865_100002721 3300006881 Bacteria 10495
272 Ga0068865_100059260 3300006881 Bacteria 2677
273 Ga0097620_100123944 3300006931 Bacteria 2652
274 Ga0097620_100441896 3300006931 Bacteria 1397
275 Ga0097620_101763187 3300006931 Bacteria 684
276 Ga0099823_1000039 3300006944 Bacteria 61476
277 Ga0105240_10026368 3300009093 Bacteria 7624
278 Ga0105240_10026912 3300009093 Bacteria 7540
279 Ga0105240_10064807 3300009093 Bacteria 4538
280 Ga0105240_10835949 3300009093 Bacteria 995
281 Ga0111539_10842640 3300009094 Bacteria 1067
282 Ga0111539_11825265 3300009094 Bacteria 705
283 Ga0105245_10086581 3300009098 Bacteria 2874
284 Ga0105245_11373214 3300009098 Bacteria 756
285 Ga0114129_10018075 3300009147 Bacteria 10043
286 Ga0114129_10077730 3300009147 Bacteria 4616
287 Ga0105243_10044991 3300009148 Bacteria 3466
288 Ga0105243_10093501 3300009148 Bacteria 2481
289 Ga0105243_10144779 3300009148 Bacteria 2032
290 Ga0105243_10191615 3300009148 Bacteria 1786
291 Ga0105242_10262339 3300009176 Bacteria 1561
292 Ga0105242_10638813 3300009176 Bacteria 1033
293 Ga0105242_11007014 3300009176 Bacteria 841
294 Ga0105248_10006076 3300009177 Bacteria 13254
295 Ga0105248_10116226 3300009177 Bacteria 3017
296 Ga0105248_10158577 3300009177 Bacteria 2553
297 Ga0105248_10447586 3300009177 Bacteria 1455
298 Ga0105248_10853246 3300009177 Bacteria 1028
299 Ga0105248_11258934 3300009177 Bacteria 837
300 Ga0105237_10000784 3300009545 Bacteria 43457
301 Ga0105237_10154894 3300009545 Bacteria 2288
302 Ga0105237_10639506 3300009545 Bacteria 1071
303 Ga0105238_10033583 3300009551 Bacteria 5221
304 Ga0105238_10326403 3300009551 Bacteria 1521
305 Ga0105238_10926360 3300009551 Bacteria 890
306 Ga0105238_11708558 3300009551 Bacteria 660
307 Ga0105249_10055139 3300009553 Bacteria 3635
308 Ga0105249_10109205 3300009553 Bacteria 2612
309 Ga0105249_11874964 3300009553 Bacteria 672
310 Ga0105239_10017475 3300010375 Bacteria 7931
311 Ga0105239_10035331 3300010375 Bacteria 5489
312 Ga0105239_10439208 3300010375 Bacteria 1480
313 Ga0105246_10124310 3300011119 Bacteria 1917
314 Ga0105246_10266759 3300011119 Bacteria 1367
315 Ga0105246_10819111 3300011119 Bacteria 828
316 Ga0105246_11511185 3300011119 Bacteria 631
317 Ga0157319_1000009 3300012497 Bacteria 227971
318 Ga0157373_10009401 3300013100 Bacteria 7218
319 Ga0157373_10014120 3300013100 Bacteria 5855
320 Ga0157373_10201252 3300013100 Bacteria 1404
321 Ga0157371_10003553 3300013102 Bacteria 14068
322 Ga0157371_10186726 3300013102 Bacteria 1483
323 Ga0157371_10527989 3300013102 Bacteria 873
324 Ga0157370_10011086 3300013104 Bacteria 9449
325 Ga0157370_10016304 3300013104 Bacteria 7528
326 Ga0157370_10021276 3300013104 Bacteria 6466
327 Ga0157370_10069410 3300013104 Bacteria 3328
328 Ga0157369_10007076 3300013105 Bacteria 12938
329 Ga0157369_10009390 3300013105 Bacteria 11184
330 Ga0157369_10065405 3300013105 Bacteria 3913
331 Ga0157369_10139689 3300013105 Bacteria 2564
332 Ga0157369_10205427 3300013105 Bacteria 2066
333 Ga0157374_10117423 3300013296 Bacteria 2564
334 Ga0157374_10435906 3300013296 Bacteria 1310
335 Ga0157374_10498262 3300013296 Bacteria 1222
336 Ga0157378_10003415 3300013297 Bacteria 14098
337 Ga0157378_10004517 3300013297 Bacteria 12208
338 Ga0157378_10041933 3300013297 Bacteria 4061
339 Ga0157378_10051563 3300013297 Bacteria 3661
340 Ga0157378_10276787 3300013297 Bacteria 1616
341 Ga0157378_10517891 3300013297 Bacteria 1194
342 Ga0157378_10524014 3300013297 Bacteria 1187
343 Ga0163162_10013003 3300013306 Bacteria 8123
344 Ga0163162_10066107 3300013306 Bacteria 3664
345 Ga0163162_10461464 3300013306 Bacteria 1402
346 Ga0163162_10921910 3300013306 Bacteria 986
347 Ga0157372_10002684 3300013307 Bacteria 19245
348 Ga0157372_10140032 3300013307 Bacteria 2787
349 Ga0157372_10205402 3300013307 Bacteria 2283
350 Ga0157372_10235394 3300013307 Bacteria 2124
351 Ga0157372_10349207 3300013307 Bacteria 1723
352 Ga0157372_10402936 3300013307 Bacteria 1594
353 Ga0157372_10562488 3300013307 Bacteria 1329
354 Ga0157372_11043954 3300013307 Bacteria 946
355 Ga0157375_10100019 3300013308 Bacteria 2979
356 Ga0157375_10249533 3300013308 Bacteria 1935
357 Ga0157375_10350313 3300013308 Bacteria 1642
358 Ga0163163_10106185 3300014325 Bacteria 2834
359 Ga0157380_10030768 3300014326 Bacteria 4114
360 Ga0157380_10155746 3300014326 Bacteria 1980
361 Ga0157380_10559661 3300014326 Bacteria 1123
362 Ga0182008_10351666 3300014497 Bacteria 782
363 Ga0157377_10218330 3300014745 Bacteria 1219
364 Ga0157377_10538668 3300014745 Bacteria 823
365 Ga0157377_10614920 3300014745 Bacteria 777
366 Ga0157379_10059549 3300014968 Bacteria 3414
367 Ga0157379_10093284 3300014968 Bacteria 2701
368 Ga0157379_10791041 3300014968 Bacteria 895
369 Ga0157376_10014203 3300014969 Bacteria 5968
370 Ga0157376_10165688 3300014969 Bacteria 2008
371 Ga0157376_10319603 3300014969 Bacteria 1475
372 Ga0157376_10339627 3300014969 Bacteria 1434
373 Ga0157376_10927008 3300014969 Bacteria 890
374 Ga0182007_10027607 3300015262 Bacteria 1955
375 Ga0163161_10062740 3300017792 Bacteria 2708
376 Ga0163161_10385129 3300017792 Bacteria 1121
377 Ga0213872_10000003 3300021361 Bacteria 366948
378 Ga0213872_10000004 3300021361 Bacteria 306230
379 Ga0213872_10049430 3300021361 Bacteria 1910
380 Ga0209674_100003 3300025226 Bacteria 2196646
381 Ga0209563_100010 3300025230 Bacteria 1337457
382 Ga0209258_100060 3300025242 Bacteria 319881
383 Ga0209677_100026 3300025253 Bacteria 382520
384 Ga0209677_106728 3300025253 Bacteria 2640
385 Ga0209148_1008101 3300025254 Bacteria 2132
386 Ga0209759_1000663 3300025256 Bacteria 31934
387 Ga0209455_1000093 3300025272 Bacteria 220487
388 Ga0209673_1010377 3300025273 Bacteria 3930
389 Ga0209673_1011036 3300025273 Bacteria 3756
390 Ga0209673_1067835 3300025273 Bacteria 861
391 Ga0209564_1000003 3300025295 Bacteria 1585848
392 Ga0209050_1019110 3300025298 Bacteria 2623
393 Ga0209256_1001390 3300025299 Bacteria 25244
394 Ga0209256_1021613 3300025299 Bacteria 1969
395 Ga0209051_1000140 3300025303 Bacteria 135919
396 Ga0209051_1001698 3300025303 Bacteria 17649
397 Ga0209257_1000012 3300025304 Bacteria 1111138
398 Ga0209257_1000045 3300025304 Bacteria 484429
399 Ga0209257_1001619 3300025304 Bacteria 25820
400 Ga0209257_1002501 3300025304 Bacteria 18143
401 Ga0207697_10081189 3300025315 Bacteria 1366
402 Ga0207656_10003677 3300025321 Bacteria 5306
403 Ga0207682_10020313 3300025893 Bacteria 2607
404 Ga0207682_10045037 3300025893 Bacteria 1810
405 Ga0207642_10058363 3300025899 Bacteria 1780
406 Ga0207642_10122933 3300025899 Bacteria 1342
407 Ga0207688_10082222 3300025901 Bacteria 1840
408 Ga0207688_10226644 3300025901 Bacteria 1127
409 Ga0207680_10234937 3300025903 Bacteria 1261
410 Ga0207680_10545585 3300025903 Bacteria 827
411 Ga0207647_10180276 3300025904 Bacteria 1227
412 Ga0207699_10173423 3300025906 Bacteria 1445
413 Ga0207645_10001190 3300025907 Bacteria 21497
414 Ga0207645_10035276 3300025907 Bacteria 3212
415 Ga0207645_10061879 3300025907 Bacteria 2391
416 Ga0207645_10116159 3300025907 Bacteria 1735
417 Ga0207643_10019116 3300025908 Bacteria 3754
418 Ga0207643_10138836 3300025908 Bacteria 1451
419 Ga0207643_10435912 3300025908 Bacteria 832
420 Ga0207705_10036481 3300025909 Bacteria 3518
421 Ga0207705_10859350 3300025909 Bacteria 703
422 Ga0207684_10045154 3300025910 Bacteria 3738
423 Ga0207654_10456993 3300025911 Bacteria 896
424 Ga0207695_10018064 3300025913 Bacteria 8165
425 Ga0207695_10030121 3300025913 Bacteria 5979
426 Ga0207695_10099170 3300025913 Bacteria 2911
427 Ga0207695_10499108 3300025913 Bacteria 1099
428 Ga0207695_10709983 3300025913 Bacteria 886
429 Ga0207695_10801652 3300025913 Bacteria 822
430 Ga0207671_10220348 3300025914 Bacteria 1486
431 Ga0207660_10051575 3300025917 Bacteria 2925
432 Ga0207660_10072521 3300025917 Bacteria 2508
433 Ga0207662_10156985 3300025918 Bacteria 1451
434 Ga0207657_10018458 3300025919 Bacteria 6657
435 Ga0207657_10035340 3300025919 Bacteria 4482
436 Ga0207657_10113026 3300025919 Bacteria 2241
437 Ga0207657_10116858 3300025919 Bacteria 2197
438 Ga0207657_10611274 3300025919 Bacteria 850
439 Ga0207649_10014385 3300025920 Bacteria 4429
440 Ga0207649_10027192 3300025920 Bacteria 3354
441 Ga0207649_10175747 3300025920 Bacteria 1495
442 Ga0207649_10984124 3300025920 Bacteria 663
443 Ga0207652_10021537 3300025921 Bacteria 5320
444 Ga0207652_10046811 3300025921 Bacteria 3692
445 Ga0207652_10442167 3300025921 Bacteria 1172
446 Ga0207652_11212238 3300025921 Bacteria 656
447 Ga0207681_10068098 3300025923 Bacteria 2471
448 Ga0207694_10006337 3300025924 Bacteria 9030
449 Ga0207694_10006652 3300025924 Bacteria 8782
450 Ga0207694_10650963 3300025924 Bacteria 888
451 Ga0207650_10000900 3300025925 Bacteria 22446
452 Ga0207650_10132089 3300025925 Bacteria 1955
453 Ga0207650_10799132 3300025925 Bacteria 799
454 Ga0207659_10004818 3300025926 Bacteria 8182
455 Ga0207659_10021623 3300025926 Bacteria 4274
456 Ga0207659_10030715 3300025926 Bacteria 3673
457 Ga0207659_10052521 3300025926 Bacteria 2904
458 Ga0207659_10072244 3300025926 Bacteria 2522
459 Ga0207659_10235315 3300025926 Bacteria 1479
460 Ga0207659_10279495 3300025926 Bacteria 1364
461 Ga0207687_10048767 3300025927 Bacteria 2942
462 Ga0207687_10196620 3300025927 Bacteria 1573
463 Ga0207687_10249590 3300025927 Bacteria 1410
464 Ga0207687_10902448 3300025927 Bacteria 756
465 Ga0207700_10000262 3300025928 Bacteria 31393
466 Ga0207664_10322557 3300025929 Bacteria 1363
467 Ga0207644_10012179 3300025931 Bacteria 5708
468 Ga0207644_10081730 3300025931 Bacteria 2388
469 Ga0207644_10097386 3300025931 Bacteria 2203
470 Ga0207644_10120098 3300025931 Bacteria 2000
471 Ga0207644_10232733 3300025931 Bacteria 1464
472 Ga0207644_10375554 3300025931 Bacteria 1159
473 Ga0207644_10397442 3300025931 Bacteria 1126
474 Ga0207690_10032871 3300025932 Bacteria 3332
475 Ga0207690_10066926 3300025932 Bacteria 2462
476 Ga0207690_10074322 3300025932 Bacteria 2354
477 Ga0207690_10124324 3300025932 Bacteria 1879
478 Ga0207706_10000045 3300025933 Bacteria 120758
479 Ga0207706_10003498 3300025933 Bacteria 15001
480 Ga0207706_10097737 3300025933 Bacteria 2582
481 Ga0207686_10059943 3300025934 Bacteria 2407
482 Ga0207709_10100467 3300025935 Bacteria 1911
483 Ga0207709_10104151 3300025935 Bacteria 1882
484 Ga0207709_10104840 3300025935 Bacteria 1877
485 Ga0207670_10017790 3300025936 Bacteria 4304
486 Ga0207670_10235473 3300025936 Bacteria 1408
487 Ga0207670_10316726 3300025936 Bacteria 1226
488 Ga0207669_10094383 3300025937 Bacteria 1957
489 Ga0207669_10107269 3300025937 Bacteria 1862
490 Ga0207669_10216156 3300025937 Bacteria 1403
491 Ga0207704_10103926 3300025938 Bacteria 1901
492 Ga0207691_10013008 3300025940 Bacteria 7968
493 Ga0207691_10014607 3300025940 Bacteria 7484
494 Ga0207691_10044537 3300025940 Bacteria 4083
495 Ga0207691_10119141 3300025940 Bacteria 2341
496 Ga0207711_10012329 3300025941 Bacteria 7105
497 Ga0207711_10119369 3300025941 Bacteria 2353
498 Ga0207711_10200226 3300025941 Bacteria 1822
499 Ga0207711_10597961 3300025941 Bacteria 1029
500 Ga0207689_10020361 3300025942 Bacteria 5585
501 Ga0207689_10035080 3300025942 Bacteria 4167
502 Ga0207689_10081629 3300025942 Bacteria 2658
503 Ga0207689_10113327 3300025942 Bacteria 2229
504 Ga0207689_10200002 3300025942 Bacteria 1649
505 Ga0207689_10396096 3300025942 Bacteria 1151
506 Ga0207679_10000279 3300025945 Bacteria 38594
507 Ga0207679_10009086 3300025945 Bacteria 6350
508 Ga0207679_10111289 3300025945 Bacteria 2162
509 Ga0207679_10195290 3300025945 Bacteria 1686
510 Ga0207679_10318076 3300025945 Bacteria 1347
511 Ga0207679_10385851 3300025945 Bacteria 1229
512 Ga0207679_11467526 3300025945 Bacteria 626
513 Ga0207667_10012656 3300025949 Bacteria 9696
514 Ga0207667_10043079 3300025949 Bacteria 4791
515 Ga0207667_10083607 3300025949 Bacteria 3305
516 Ga0207667_10161785 3300025949 Bacteria 2302
517 Ga0207667_10179516 3300025949 Bacteria 2174
518 Ga0207667_10493162 3300025949 Bacteria 1243
519 Ga0207651_10006141 3300025960 Bacteria 6247
520 Ga0207651_10015175 3300025960 Bacteria 4470
521 Ga0207651_10030873 3300025960 Bacteria 3418
522 Ga0207651_10112746 3300025960 Bacteria 2045
523 Ga0207651_10173688 3300025960 Bacteria 1702
524 Ga0207651_10269997 3300025960 Bacteria 1400
525 Ga0207712_10069351 3300025961 Bacteria 2529
526 Ga0207668_10282294 3300025972 Bacteria 1362
527 Ga0207640_10276066 3300025981 Bacteria 1317
528 Ga0207658_10322841 3300025986 Bacteria 1337
529 Ga0207658_10475361 3300025986 Bacteria 1110
530 Ga0207677_10014503 3300026023 Bacteria 4603
531 Ga0207677_10058377 3300026023 Bacteria 2656
532 Ga0207677_10105045 3300026023 Bacteria 2089
533 Ga0207677_10324713 3300026023 Bacteria 1280
534 Ga0207677_10355356 3300026023 Bacteria 1229
535 Ga0207677_10419687 3300026023 Bacteria 1139
536 Ga0207703_10038338 3300026035 Bacteria 3823
537 Ga0207703_10103802 3300026035 Bacteria 2414
538 Ga0207703_10117595 3300026035 Bacteria 2278
539 Ga0207703_10172623 3300026035 Bacteria 1903
540 Ga0207639_10003482 3300026041 Bacteria 10594
541 Ga0207639_10043795 3300026041 Bacteria 3362
542 Ga0207639_10047438 3300026041 Bacteria 3247
543 Ga0207639_10154489 3300026041 Bacteria 1926
544 Ga0207639_10246566 3300026041 Bacteria 1556
545 Ga0207639_10570673 3300026041 Bacteria 1041
546 Ga0207678_10099991 3300026067 Bacteria 2477
547 Ga0207708_10163986 3300026075 Bacteria 1756
548 Ga0207702_10009898 3300026078 Bacteria 7992
549 Ga0207702_10503655 3300026078 Bacteria 1181
550 Ga0207702_10947705 3300026078 Bacteria 853
551 Ga0207641_10033004 3300026088 Bacteria 4301
552 Ga0207641_10033151 3300026088 Bacteria 4292
553 Ga0207641_10037100 3300026088 Bacteria 4070
554 Ga0207641_10155795 3300026088 Bacteria 2072
555 Ga0207648_10000839 3300026089 Bacteria 34622
556 Ga0207648_10012441 3300026089 Bacteria 7967
557 Ga0207648_10021693 3300026089 Bacteria 5771
558 Ga0207648_10059325 3300026089 Bacteria 3337
559 Ga0207648_10125892 3300026089 Bacteria 2254
560 Ga0207648_10186196 3300026089 Bacteria 1839
561 Ga0207648_10254825 3300026089 Bacteria 1565
562 Ga0207648_10292811 3300026089 Bacteria 1458
563 Ga0207676_10041647 3300026095 Bacteria 3527
564 Ga0207676_10713779 3300026095 Bacteria 972
565 Ga0207674_10024176 3300026116 Bacteria 6496
566 Ga0207674_10060362 3300026116 Bacteria 3835
567 Ga0207674_10089913 3300026116 Bacteria 3062
568 Ga0207674_10277867 3300026116 Bacteria 1622
569 Ga0207675_100014777 3300026118 Bacteria 7283
570 Ga0207675_100020138 3300026118 Bacteria 6222
571 Ga0207675_100035648 3300026118 Bacteria 4640
572 Ga0207675_100267249 3300026118 Bacteria 1659
573 Ga0207683_10040196 3300026121 Bacteria 4079
574 Ga0207683_10051101 3300026121 Bacteria 3621
575 Ga0207683_10126900 3300026121 Bacteria 2293
576 Ga0207683_10373255 3300026121 Bacteria 1310
577 Ga0207683_10458389 3300026121 Bacteria 1176
578 Ga0207698_10636810 3300026142 Bacteria 1055
579 Ga0209996_1017210 3300027395 Bacteria 998
580 Ga0209968_1001019 3300027526 Bacteria 4307
581 Ga0209970_1001463 3300027614 Bacteria 4125
582 Ga0209983_1000576 3300027665 Bacteria 7944
583 Ga0209983_1003615 3300027665 Bacteria 3280
584 Ga0209971_1001545 3300027682 Bacteria 5694
585 Ga0209971_1005862 3300027682 Bacteria 2910
586 Ga0209966_1000029 3300027695 Bacteria 65037
587 Ga0209998_10000768 3300027717 Bacteria 8347
588 Ga0209813_10106099 3300027866 Bacteria 962
589 Ga0209974_10002778 3300027876 Bacteria 6345
590 Ga0268266_10437405 3300028379 Bacteria 1242
591 Ga0268265_10030474 3300028380 Bacteria 3885
592 Ga0268265_10047991 3300028380 Bacteria 3203
593 Ga0268265_10063432 3300028380 Bacteria 2842
594 Ga0268265_10112322 3300028380 Bacteria 2227
595 Ga0268265_10133804 3300028380 Bacteria 2065
596 Ga0268265_10138928 3300028380 Bacteria 2031
597 Ga0268264_10005634 3300028381 Bacteria 10610
598 Ga0268264_10037292 3300028381 Bacteria 4007
599 Ga0268264_10088901 3300028381 Bacteria 2659
600 Ga0307517_10194429 3300028786 Bacteria 1281
601 Ga0307517_10283162 3300028786 Bacteria 943
602 Ga0307517_10349679 3300028786 Bacteria 803
603 Ga0307515_10000178 3300028794 Bacteria 157107
604 Ga0307515_10007082 3300028794 Bacteria 22278
605 Ga0307515_10013694 3300028794 Bacteria 15113
606 Ga0307515_10186577 3300028794 Bacteria 2001
607 Ga0307515_10221093 3300028794 Bacteria 1712
608 Ga0265338_10184741 3300028800 Bacteria 1586
609 Ga0265332_10000033 3300031238 Bacteria 153334
610 Ga0265332_10005892 3300031238 Bacteria 5607
611 Ga0265325_10129797 3300031241 Bacteria 1208
612 Ga0265329_10035652 3300031242 Bacteria 1605
613 Ga0265339_10107418 3300031249 Bacteria 1447
614 Ga0265331_10005725 3300031250 Bacteria 7451
615 Ga0265331_10055884 3300031250 Bacteria 1876
616 Ga0265327_10000043 3300031251 Bacteria 285108
617 Ga0265316_10039638 3300031344 Bacteria 3782
618 Ga0307513_10000010 3300031456 Bacteria 360812
619 Ga0307513_10000121 3300031456 Bacteria 109551
620 Ga0307513_10018754 3300031456 Bacteria 8259
621 Ga0307509_10457407 3300031507 Bacteria 969
622 Ga0307408_100000008 3300031548 Bacteria 456355
623 Ga0307408_100165763 3300031548 Bacteria 1759
624 Ga0307408_101194529 3300031548 Bacteria 709
625 Ga0316575_10044571 3300031665 Bacteria 1760
626 Ga0316575_10048459 3300031665 Bacteria 1689
627 Ga0316579_10049839 3300031691 Bacteria 1957
628 Ga0316579_10288578 3300031691 Bacteria 793
629 Ga0265314_10006842 3300031711 Bacteria 9991
630 Ga0265314_10008368 3300031711 Bacteria 8865
631 Ga0265314_10336950 3300031711 Bacteria 834
632 Ga0265342_10024495 3300031712 Bacteria 3809
633 Ga0265342_10030598 3300031712 Bacteria 3335
634 Ga0316576_10001775 3300031727 Bacteria 11922
635 Ga0316576_10002619 3300031727 Bacteria 10287
636 Ga0316576_10023686 3300031727 Bacteria 4280
637 Ga0316576_10032757 3300031727 Bacteria 3695
638 Ga0316576_10033884 3300031727 Bacteria 3637
639 Ga0316576_10036603 3300031727 Bacteria 3508
640 Ga0316576_10067573 3300031727 Bacteria 2631
641 Ga0316576_10158509 3300031727 Bacteria 1706
642 Ga0316576_10391654 3300031727 Bacteria 1030
643 Ga0316578_10000798 3300031728 Bacteria 11661
644 Ga0316578_10013746 3300031728 Bacteria 4302
645 Ga0316578_10030496 3300031728 Bacteria 3066
646 Ga0316578_10047399 3300031728 Bacteria 2507
647 Ga0316578_10059235 3300031728 Bacteria 2252
648 Ga0316578_10090417 3300031728 Bacteria 1827
649 Ga0316578_10182017 3300031728 Bacteria 1266
650 Ga0307516_10002378 3300031730 Bacteria 25205
651 Ga0307516_10005887 3300031730 Bacteria 14509
652 Ga0307516_10570200 3300031730 Bacteria 786
653 Ga0316577_10009861 3300031733 Bacteria 5147
654 Ga0316577_10152920 3300031733 Bacteria 1300
655 Ga0316577_10175676 3300031733 Bacteria 1209
656 Ga0307413_10198960 3300031824 Bacteria 1445
657 Ga0307410_10005441 3300031852 Bacteria 6741
658 Ga0307410_10018840 3300031852 Bacteria 4181
659 Ga0307406_10010235 3300031901 Bacteria 5286
660 Ga0307406_10053466 3300031901 Bacteria 2572
661 Ga0307412_10058043 3300031911 Bacteria 2587
662 Ga0307412_10134042 3300031911 Bacteria 1804
663 Ga0307412_10249010 3300031911 Bacteria 1379
664 Ga0307412_10370111 3300031911 Bacteria 1157
665 Ga0307412_10910244 3300031911 Bacteria 771
666 Ga0307412_11157869 3300031911 Bacteria 691
667 Ga0307409_100812105 3300031995 Bacteria 943
668 Ga0307416_100014325 3300032002 Bacteria 5429
669 Ga0307416_101732301 3300032002 Bacteria 729
670 Ga0307414_10007104 3300032004 Bacteria 6283
671 Ga0307414_10044693 3300032004 Bacteria 3028
672 Ga0307411_10001688 3300032005 Bacteria 9254
673 Ga0307411_10020197 3300032005 Bacteria 3868
674 Ga0307415_100069326 3300032126 Bacteria 2472
675 Ga0307415_100069811 3300032126 Bacteria 2465
676 Ga0307415_101278943 3300032126 Bacteria 694
677 Ga0316583_10010416 3300032133 Bacteria 3352
678 Ga0316583_10054187 3300032133 Bacteria 1410
679 Ga0316585_10050155 3300032137 Bacteria 1339
680 Ga0316585_10064366 3300032137 Bacteria 1187
681 Ga0316580_10002360 3300032139 Bacteria 5177
682 Ga0316580_10007122 3300032139 Bacteria 3321
683 Ga0316580_10029510 3300032139 Bacteria 1697
684 Ga0316580_10067803 3300032139 Bacteria 1093
685 Ga0316580_10160385 3300032139 Bacteria 690
686 Ga0316593_10005398 3300032168 Bacteria 3367
687 Ga0316593_10035709 3300032168 Bacteria 1636
688 Ga0316593_10063194 3300032168 Bacteria 1269
689 Ga0316593_10092979 3300032168 Bacteria 1063
690 Ga0316592_1003645 3300033524 Bacteria 2796
691 Ga0316592_1006282 3300033524 Bacteria 2285
692 Ga0316592_1019878 3300033524 Bacteria 1423
693 Ga0316586_1005635 3300033527 Bacteria 1770
694 Ga0316586_1017679 3300033527 Bacteria 1152
695 Ga0316588_1004499 3300033528 Bacteria 2646
696 Ga0316588_1008935 3300033528 Bacteria 2077
697 Ga0316588_1026379 3300033528 Bacteria 1345
698 Ga0316588_1031547 3300033528 Bacteria 1244
699 Ga0316588_1032277 3300033528 Bacteria 1231
700 Ga0316588_1141172 3300033528 Bacteria 615
701 Ga0316587_1000383 3300033529 Bacteria 4304
702 Ga0316587_1002976 3300033529 Bacteria 2324
703 Ga0316587_1039632 3300033529 Bacteria 849
704 Ga0316596_1000394 3300033541 Bacteria 7244
705 Ga0316596_1002261 3300033541 Bacteria 4085
706 Ga0316596_1010352 3300033541 Bacteria 2254
707 Ga0316596_1027499 3300033541 Bacteria 1468
708 Ga0316596_1050225 3300033541 Bacteria 1103
709 Ga0373948_0007970 3300034817 Bacteria 1794
710 Ga0373959_0026928 3300034820 Bacteria 1139
711 Ga0373934_0033151 3300035086 Bacteria 2027
712 Ga0373949_0033932 3300035090 Bacteria 1228
713 Ga0373952_0000782 3300035092 Bacteria 5725
714 Ga0373939_0003522 3300035114 Bacteria 3677
715 Ga0373939_0089969 3300035114 Bacteria 1036
716 Ga0373945_0122326 3300035116 Bacteria 1036
717 Ga0373943_0175733 3300035170 Bacteria 1174
718 Ga0373946_0114156 3300035171 Bacteria 1226
719 Ga0373962_0049958 3300035242 Bacteria 1203
720 Ga0316574_0005456 3300035398 Bacteria 6780
721 Ga0316574_0085608 3300035398 Bacteria 2005
722 Ga0316574_0244048 3300035398 Bacteria 1148
723 Ga0316574_0285703 3300035398 Bacteria 1050
724 Ga0316574_0339714 3300035398 Bacteria 951
725 Ga0373931_0001103 3300035691 Bacteria 11455
726 Ga0373931_0155375 3300035691 Bacteria 1337
727 Ga0373927_0097286 3300035695 Bacteria 1913
728 Ga0373947_0280795 3300035725 Bacteria 1107
729 Ga0373947_0310403 3300035725 Bacteria 1053
730 Ga0373937_0134367 3300036401 Bacteria 2312
731 Ga0373937_0268384 3300036401 Bacteria 1610
732 Ga0316582_0008735 3300036647 Bacteria 5456
733 Ga0316582_0251500 3300036647 Bacteria 1211
734 Ga0316582_0322223 3300036647 Bacteria 1062
735 Ga0316582_0688999 3300036647 Bacteria 702
736 Ga0316584_0002169 3300036712 Bacteria 12292
737 Ga0316584_0002768 3300036712 Bacteria 11217
738 Ga0316584_0079540 3300036712 Bacteria 2456
739 Ga0316584_0211980 3300036712 Bacteria 1425
740 Ga0316584_0314817 3300036712 Bacteria 1130
741 Ga0316584_0420334 3300036712 Bacteria 949
742 Ga0316584_0541647 3300036712 Bacteria 813
743 Ga0373925_0011540 3300037068 Bacteria 6393
744 Ga0373925_0332102 3300037068 Bacteria 1232
745 Ga0395899_0001756 3300037312 Bacteria 17997
746 Ga0395899_0108877 3300037312 Bacteria 1994
747 Ga0395900_0004771 3300037418 Bacteria 14288
748 Ga0395900_0030415 3300037418 Bacteria 5546
749 Ga0395900_0060539 3300037418 Bacteria 3896
750 Ga0395900_0188924 3300037418 Bacteria 2090
751 Ga0395900_0227543 3300037418 Bacteria 1877
752 Ga0395900_0365348 3300037418 Bacteria 1414
753 Ga0395898_0009054 3300037466 Bacteria 10483
754 Ga0395898_0053216 3300037466 Bacteria 3954
755 Ga0395898_0098846 3300037466 Bacteria 2802
756 Ga0395898_0609028 3300037466 Bacteria 1035
757 Ga0395898_0771871 3300037466 Bacteria 902
758 Ga0395905_0000766 3300037471 Bacteria 42342
759 Ga0395905_0001291 3300037471 Bacteria 30780
760 Ga0395905_0012118 3300037471 Bacteria 8305
761 Ga0395905_0014796 3300037471 Bacteria 7440
762 Ga0395905_0016964 3300037471 Bacteria 6914
763 Ga0395905_0020727 3300037471 Bacteria 6223
764 Ga0395905_0026748 3300037471 Bacteria 5440
765 Ga0395905_0068703 3300037471 Bacteria 3318
766 Ga0395905_0092246 3300037471 Bacteria 2840
767 Ga0395905_0099460 3300037471 Bacteria 2731
768 Ga0395905_0124829 3300037471 Bacteria 2420
769 Ga0395905_0206586 3300037471 Bacteria 1840
770 Ga0395905_0284423 3300037471 Bacteria 1540
771 Ga0395905_0942309 3300037471 Bacteria 766
772 Ga0436364_0110021 3300037853 Bacteria 921
773 Ga0395901_0008851 3300038443 Bacteria 10191
774 Ga0395901_0019770 3300038443 Bacteria 6886
775 Ga0395901_0058625 3300038443 Bacteria 4004
776 Ga0395901_0086077 3300038443 Bacteria 3286
777 Ga0395901_0366081 3300038443 Bacteria 1486
778 Ga0436361_0287447 3300039447 Bacteria 113524
779 Ga0436361_0678114 3300039447 Bacteria 29523
780 Ga0436361_1178843 3300039447 Bacteria 1056
781 Ga0439453_0022910 3300041408 Bacteria 1136
782 Ga0451798_0103100 3300041458 Bacteria 612
783 Ga0451798_0705620 3300041458 Bacteria 629
784 Ga0451849_0427330 3300041505 Bacteria 929
785 Ga0439431_0005395 3300041997 Bacteria 2824
786 Ga0439437_015198 3300042000 Bacteria 903
787 Ga0439449_0013312 3300042007 Bacteria 3095
788 Ga0439457_011808 3300042014 Bacteria 1977
789 Ga0439462_0000705 3300042015 Bacteria 6854
790 Ga0450888_013593 3300042126 Bacteria 977
791 Ga0450891_001234 3300042129 Bacteria 2659
792 Ga0450892_002535 3300042130 Bacteria 1552
793 Ga0450902_039386 3300042137 Bacteria 803
794 Ga0450889_004023 3300042144 Bacteria 1451
795 Ga0439435_0077011 3300042436 Bacteria 996
796 Ga0450893_0005510 3300042532 Bacteria 2033
797 Ga0451577_0053739 3300042876 Bacteria 3595
798 Ga0451577_0069012 3300042876 Bacteria 3152
799 Ga0451577_0101947 3300042876 Bacteria 2564
800 Ga0451577_0354764 3300042876 Bacteria 1330
801 Ga0451577_0355963 3300042876 Bacteria 1328
802 Ga0451577_0413853 3300042876 Bacteria 1224
803 Ga0466969_0016587 3300044656 Bacteria 3852
804 Ga0466969_0023883 3300044656 Bacteria 3146
805 Ga0466972_0037986 3300044658 Bacteria 2352
806 Ga0453683_0002126 3300044673 Bacteria 15797
807 Ga0466965_0077858 3300044683 Bacteria 1674
808 Ga0466966_0003258 3300044684 Bacteria 10703
809 Ga0466966_0108259 3300044684 Bacteria 1714
810 Ga0466966_0276151 3300044684 Bacteria 1011
811 Ga0466961_0099700 3300044693 Bacteria 1830
812 Ga0466961_0101036 3300044693 Bacteria 1817
813 Ga0466963_0295644 3300044694 Bacteria 1139
814 Ga0466963_0312675 3300044694 Bacteria 1105
815 Ga0466963_0334919 3300044694 Bacteria 1065
816 Ga0466964_0051982 3300044706 Bacteria 1683
817 Ga0453684_0010561 3300044712 Bacteria 15762
818 Ga0453684_0039888 3300044712 Bacteria 6387
819 Ga0453684_0040403 3300044712 Bacteria 6334
820 Ga0453684_0196771 3300044712 Bacteria 2353
821 Ga0453684_0295646 3300044712 Bacteria 1842
822 Ga0453684_0398824 3300044712 Bacteria 1541
823 Ga0453684_0441204 3300044712 Bacteria 1451
824 Ga0453684_0668228 3300044712 Bacteria 1132
825 Ga0466971_0033519 3300044719 Bacteria 2301
826 Ga0466970_0011494 3300044765 Bacteria 4513
827 Ga0466957_0010823 3300044842 Bacteria 5245
828 Ga0466957_0062916 3300044842 Bacteria 2280
829 Ga0466957_0602662 3300044842 Bacteria 769
830 Ga0466959_0024293 3300045049 Bacteria 4488
831 Ga0466959_0029610 3300045049 Bacteria 4056
832 Ga0451576_0005135 3300045051 Bacteria 16590
833 Ga0451576_0027293 3300045051 Bacteria 6134
834 Ga0451576_0040243 3300045051 Bacteria 4949
835 Ga0451576_0135333 3300045051 Bacteria 2569
836 Ga0451576_0326585 3300045051 Bacteria 1606
837 Ga0451576_0357068 3300045051 Bacteria 1530
838 Ga0466958_0026784 3300045836 Bacteria 3407
839 Ga0466958_0879166 3300045836 Bacteria 585
840 Ga0495650_0009489 3300046471 Bacteria 5526
841 Ga0495605_0352638 3300046474 Bacteria 617
842 Ga0495583_0001275 3300046506 Bacteria 26345
843 Ga0495606_0021187 3300046507 Bacteria 4764
844 Ga0495606_0024795 3300046507 Bacteria 4312
845 Ga0495632_0010763 3300046519 Bacteria 5390
846 Ga0495648_0090864 3300046524 Bacteria 1710
847 Ga0495642_0065383 3300046528 Bacteria 1514
848 Ga0495652_0607795 3300046529 Bacteria 745
849 Ga0495654_0166021 3300046530 Bacteria 966
850 Ga0495598_0060682 3300046537 Bacteria 1166
851 Ga0495621_0008072 3300046539 Bacteria 3140
852 Ga0495621_0087741 3300046539 Bacteria 1169
853 Ga0495597_0016988 3300046542 Bacteria 3430
854 Ga0495633_0261256 3300046558 Bacteria 789
855 Ga0495656_0026669 3300046615 Bacteria 2302
856 Ga0495668_0090235 3300046616 Bacteria 1679
857 Ga0495625_0039914 3300046660 Bacteria 3426
858 Ga0495625_0114983 3300046660 Bacteria 1836
859 Ga0495588_0335815 3300046674 Bacteria 795
860 Ga0495647_0146392 3300046681 Bacteria 1010
861 Ga0495669_0019999 3300046684 Bacteria 2893
862 Ga0495671_0173846 3300046692 Bacteria 1046
863 Ga0495649_0002640 3300046694 Bacteria 12495
864 Ga0495649_0012323 3300046694 Bacteria 4982
865 Ga0495589_0033363 3300046794 Bacteria 2586
866 Ga0495600_0046717 3300046809 Bacteria 2824
867 Ga0495660_0138009 3300046810 Bacteria 1216
868 Ga0495687_000790 3300047443 Bacteria 34028
869 Ga0495687_014895 3300047443 Bacteria 3974
870 Ga0495685_089313 3300047447 Bacteria 1022
871 Ga0495686_0006292 3300047472 Bacteria 9129
872 Ga0496100_0252142 3300048903 Bacteria 1306
873 Ga0496101_0026022 3300048904 Bacteria 4065
874 Ga0496102_0041398 3300048905 Bacteria 4171
875 Ga0496103_0082579 3300048906 Bacteria 2022
876 Ga0496105_0138860 3300048908 Bacteria 2001
877 Ga0496105_0285447 3300048908 Bacteria 1330
878 Ga0496106_0007016 3300048909 Bacteria 8320
879 Ga0496106_0228967 3300048909 Bacteria 1484
880 Ga0496106_0622549 3300048909 Bacteria 864
881 Ga0496107_0003667 3300048910 Bacteria 10323
882 Ga0496108_0100651 3300048911 Bacteria 2465
883 Ga0496108_0811767 3300048911 Bacteria 807
884 Ga0496109_0688124 3300048912 Bacteria 960
885 Ga0496110_0082466 3300048913 Bacteria 2868
886 Ga0496110_0392366 3300048913 Bacteria 1265
887 Ga0496110_0485215 3300048913 Bacteria 1126
888 Ga0496114_0040304 3300048917 Bacteria 3866
889 Ga0496114_0321718 3300048917 Bacteria 1367
890 Ga0496114_0892279 3300048917 Bacteria 770
891 Ga0496115_0110638 3300048918 Bacteria 2257
892 Ga0496126_0073906 3300048929 Bacteria 3029
893 Ga0496126_0098894 3300048929 Bacteria 2556
894 Ga0501321_033060 3300049537 Bacteria 699
895 Ga0501031_0344540 3300049568 Bacteria 965
896 Ga0501032_0042298 3300049569 Bacteria 3091
897 Ga0501033_0003126 3300049570 Bacteria 13757
898 Ga0501034_0144355 3300049571 Bacteria 2358
899 Ga0501036_0048691 3300049572 Bacteria 3588
900 Ga0501036_0373238 3300049572 Bacteria 1191
901 Ga0501038_0001778 3300049574 Bacteria 20024
902 Ga0501038_0002840 3300049574 Bacteria 16115
903 Ga0501038_0016852 3300049574 Bacteria 6613
904 Ga0501039_0185429 3300049575 Bacteria 1636
905 Ga0501043_0117673 3300049579 Bacteria 2085
906 Ga0501043_0208325 3300049579 Bacteria 1515
907 Ga0501046_0212720 3300049580 Bacteria 1434
908 Ga0501047_0051037 3300049581 Bacteria 3995
909 Ga0501047_0129991 3300049581 Bacteria 2399
910 Ga0501047_0201281 3300049581 Bacteria 1852
911 Ga0501067_0044231 3300049583 Bacteria 2474
912 Ga0501067_0126021 3300049583 Bacteria 1425
913 Ga0501068_0087775 3300049584 Bacteria 1916
914 Ga0501070_0020843 3300049586 Bacteria 5499
915 Ga0501072_0151564 3300049588 Bacteria 1848
916 Ga0501074_0049464 3300049590 Bacteria 3035
917 Ga0501206_044493 3300049653 Bacteria 693
918 Ga0501249_123915 3300049679 Bacteria 633
919 Ga0501080_0012284 3300049742 Bacteria 7845
920 Ga0501080_0223535 3300049742 Bacteria 1722
921 Ga0501083_0020376 3300049744 Bacteria 4613
922 Ga0501268_009130 3300049765 Bacteria 1518
923 Ga0501035_0040039 3300049822 Bacteria 4237
924 Ga0501035_0335483 3300049822 Bacteria 1268
925 Ga0501044_0000190 3300049823 Bacteria 77415
926 Ga0501044_0007285 3300049823 Bacteria 12155
927 Ga0501044_0199944 3300049823 Bacteria 1957
928 Ga0501044_0411221 3300049823 Bacteria 1264
929 nmdc:mga03683_404348_c1 3300050489 Bacteria 652
930 nmdc:mga03683_9197_c1 3300050489 Bacteria 3504
931 nmdc:mga03n38_22608_c1 3300050490 Bacteria 2548
932 nmdc:mga00v17_479592_c1 3300050491 Bacteria 807
933 nmdc:mga0yw44_81222_c1 3300050492 Bacteria 2032
934 nmdc:mga0yw44_84203_c1 3300050492 Bacteria 1999
935 nmdc:mga0yw44_89251_c1 3300050492 Bacteria 1945
936 nmdc:mga0k408_103702_c1 3300050493 Bacteria 1678
937 nmdc:mga0k408_11575_c1 3300050493 Bacteria 4808
938 nmdc:mga0k408_1329_c1 3300050493 Bacteria 13372
939 nmdc:mga0k408_148_c1 3300050493 Bacteria 35989
940 nmdc:mga0k408_166294_c1 3300050493 Bacteria 1314
941 nmdc:mga0k408_19570_c1 3300050493 Bacteria 3785
942 nmdc:mga0k408_20110_c1 3300050493 Bacteria 3736
943 nmdc:mga0k408_209017_c1 3300050493 Bacteria 1165
944 nmdc:mga0k408_229191_c1 3300050493 Bacteria 1109
945 nmdc:mga0k408_24729_c1 3300050493 Bacteria 3397
946 nmdc:mga0k408_460634_c1 3300050493 Bacteria 755
947 nmdc:mga0k408_485201_c1 3300050493 Bacteria 733
948 nmdc:mga0k408_50348_c1 3300050493 Bacteria 2412
949 nmdc:mga0k408_55388_c1 3300050493 Bacteria 2300
950 nmdc:mga06z11_15349_c1 3300050494 Bacteria 3417
951 nmdc:mga06z11_161280_c1 3300050494 Bacteria 1282
952 nmdc:mga06z11_194338_c1 3300050494 Bacteria 1176
953 nmdc:mga06z11_203047_c1 3300050494 Bacteria 1152
954 nmdc:mga06z11_330043_c1 3300050494 Bacteria 911
955 nmdc:mga06z11_49023_c1 3300050494 Bacteria 2152
956 nmdc:mga04h51_7088_c1 3300050495 Bacteria 2941
957 nmdc:mga07m45_138780_c1 3300050496 Bacteria 1408
958 nmdc:mga07m45_1748_c1 3300050496 Bacteria 10008
959 nmdc:mga07m45_295207_c1 3300050496 Bacteria 943
960 nmdc:mga07m45_39199_c1 3300050496 Bacteria 2647
961 nmdc:mga07m45_7066_c1 3300050496 Bacteria 5714
962 nmdc:mga05p37_21359_c1 3300050507 Bacteria 7840
963 nmdc:mga05p37_329145_c2 3300050507 Bacteria 855
964 nmdc:mga09592_1507_c1 3300050508 Bacteria 18749
965 nmdc:mga0qj67_625084_c1 3300050509 Bacteria 860
966 nmdc:mga06r32_372966_c1 3300050510 Bacteria 1410
967 nmdc:mga08y16_275352_c1 3300050511 Bacteria 1737
968 nmdc:mga0n895_862014_c1 3300050512 Bacteria 893
969 nmdc:mga0rr50_723454_c1 3300050513 Bacteria 849
970 nmdc:mga0a205_704416_c1 3300050515 Bacteria 859
971 nmdc:mga0sz30_66687_c1 3300050516 Bacteria 1545
972 nmdc:mga0sz30_72880_c1 3300050516 Bacteria 1480
973 Ga0495619_0329632 3300053085 Bacteria 1057
974 Ga0500569_002749 3300053109 Bacteria 3504
975 Ga0500568_0040985 3300053139 Bacteria 1862
976 Ga0500622_0000875 3300053156 Bacteria 25652
977 Ga0590071_086766 3300059421 Bacteria 781
978 Ga0590075_039292 3300059424 Bacteria 1207
979 Ga0590075_162080 3300059424 Bacteria 590
980 Ga0466962_0033010 3300061719 Bacteria 2476
981 Ga0466962_0140193 3300061719 Bacteria 1171

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300014745 Ga0157377_10614920 Ga0157377_106149201 175
2 3300046524 Ga0495648_0090864 Ga0495648_0090864_828_1376 175
3 3300003752 Ga0055539_1005175 Ga0055539_10051752 176
4 3300003756 Ga0055533_1000006 Ga0055533_1000006141 176
5 3300003759 Ga0055525_1001050 Ga0055525_10010502 176
6 3300003761 Ga0055535_1000702 Ga0055535_10007022 176
7 3300003763 Ga0055529_1000340 Ga0055529_100034026 176
8 3300005290 Ga0065712_10414260 Ga0065712_104142601 176
9 3300005327 Ga0070658_10355992 Ga0070658_103559922 176
10 3300005327 Ga0070658_10381235 Ga0070658_103812352 176
11 3300005328 Ga0070676_10003114 Ga0070676_100031143 176
12 3300005338 Ga0068868_100005289 Ga0068868_1000052894 176
13 3300005344 Ga0070661_100003350 Ga0070661_1000033508 176
14 3300005347 Ga0070668_100470585 Ga0070668_1004705852 176
15 3300005353 Ga0070669_100120123 Ga0070669_1001201232 176
16 3300005354 Ga0070675_100004442 Ga0070675_10000444210 176
17 3300005354 Ga0070675_100127239 Ga0070675_1001272392 176
18 3300005355 Ga0070671_100083652 Ga0070671_1000836523 176
19 3300005355 Ga0070671_100267940 Ga0070671_1002679402 176
20 3300005356 Ga0070674_100285037 Ga0070674_1002850372 176
21 3300005364 Ga0070673_100011989 Ga0070673_1000119892 176
22 3300005364 Ga0070673_100060774 Ga0070673_1000607742 176
23 3300005364 Ga0070673_100169243 Ga0070673_1001692432 176
24 3300005365 Ga0070688_100847574 Ga0070688_1008475741 176
25 3300005366 Ga0070659_100141291 Ga0070659_1001412912 176
26 3300005445 Ga0070708_101176366 Ga0070708_1011763661 176
27 3300005455 Ga0070663_100109842 Ga0070663_1001098422 176
28 3300005457 Ga0070662_100008653 Ga0070662_1000086537 176
29 3300005457 Ga0070662_100382564 Ga0070662_1003825641 176
30 3300005459 Ga0068867_100003867 Ga0068867_1000038674 176
31 3300005459 Ga0068867_100178516 Ga0068867_1001785162 176
32 3300005467 Ga0070706_100118675 Ga0070706_1001186752 176
33 3300005468 Ga0070707_100203639 Ga0070707_1002036392 176
34 3300005471 Ga0070698_100264266 Ga0070698_1002642662 176
35 3300005539 Ga0068853_100016533 Ga0068853_1000165335 176
36 3300005539 Ga0068853_100169118 Ga0068853_1001691182 176
37 3300005539 Ga0068853_100624162 Ga0068853_1006241621 176
38 3300005543 Ga0070672_100002447 Ga0070672_10000244711 176
39 3300005547 Ga0070693_100116592 Ga0070693_1001165923 176
40 3300005563 Ga0068855_100262901 Ga0068855_1002629012 176
41 3300005577 Ga0068857_100162416 Ga0068857_1001624162 176
42 3300005578 Ga0068854_100852354 Ga0068854_1008523541 176
43 3300005616 Ga0068852_100117707 Ga0068852_1001177072 176
44 3300005616 Ga0068852_100141142 Ga0068852_1001411423 176
45 3300005719 Ga0068861_100036313 Ga0068861_1000363133 176
46 3300005841 Ga0068863_100952990 Ga0068863_1009529901 176
47 3300005844 Ga0068862_101634610 Ga0068862_1016346101 176
48 3300006038 Ga0075365_10028653 Ga0075365_100286533 176
49 3300006048 Ga0075363_100033613 Ga0075363_1000336132 176
50 3300006048 Ga0075363_100334914 Ga0075363_1003349142 176
51 3300006051 Ga0075364_10101510 Ga0075364_101015102 176
52 3300006177 Ga0075362_10004144 Ga0075362_100041442 176
53 3300006177 Ga0075362_10016593 Ga0075362_100165933 176
54 3300006178 Ga0075367_10055393 Ga0075367_100553932 176
55 3300006178 Ga0075367_10084616 Ga0075367_100846162 176
56 3300006178 Ga0075367_10116234 Ga0075367_101162342 176
57 3300006178 Ga0075367_10177445 Ga0075367_101774452 176
58 3300006195 Ga0075366_10020363 Ga0075366_100203633 176
59 3300006195 Ga0075366_10022395 Ga0075366_100223953 176
60 3300006195 Ga0075366_10026318 Ga0075366_100263182 176
61 3300006195 Ga0075366_10044832 Ga0075366_100448323 176
62 3300006195 Ga0075366_10052485 Ga0075366_100524852 176
63 3300006353 Ga0075370_10000607 Ga0075370_1000060714 176
64 3300006353 Ga0075370_10003963 Ga0075370_100039634 176
65 3300006353 Ga0075370_10009619 Ga0075370_100096192 176
66 3300006353 Ga0075370_10018992 Ga0075370_100189923 176
67 3300006353 Ga0075370_10187168 Ga0075370_101871682 176
68 3300006881 Ga0068865_100059260 Ga0068865_1000592603 176
69 3300009093 Ga0105240_10026912 Ga0105240_100269122 176
70 3300009147 Ga0114129_10077730 Ga0114129_100777303 176
71 3300009545 Ga0105237_10639506 Ga0105237_106395061 176
72 3300010375 Ga0105239_10035331 Ga0105239_100353314 176
73 3300010375 Ga0105239_10439208 Ga0105239_104392081 176
74 3300011119 Ga0105246_10124310 Ga0105246_101243102 176
75 3300013100 Ga0157373_10014120 Ga0157373_100141203 176
76 3300013104 Ga0157370_10011086 Ga0157370_1001108610 176
77 3300013105 Ga0157369_10139689 Ga0157369_101396891 176
78 3300013296 Ga0157374_10435906 Ga0157374_104359061 176
79 3300013297 Ga0157378_10051563 Ga0157378_100515633 176
80 3300013307 Ga0157372_10562488 Ga0157372_105624882 176
81 3300013308 Ga0157375_10249533 Ga0157375_102495333 176
82 3300014497 Ga0182008_10351666 Ga0182008_103516661 176
83 3300014745 Ga0157377_10218330 Ga0157377_102183302 176
84 3300021361 Ga0213872_10000003 Ga0213872_100000039 176
85 3300025226 Ga0209674_100003 Ga0209674_1000031195 176
86 3300025230 Ga0209563_100010 Ga0209563_100010923 176
87 3300025242 Ga0209258_100060 Ga0209258_100060116 176
88 3300025253 Ga0209677_100026 Ga0209677_10002612 176
89 3300025253 Ga0209677_106728 Ga0209677_1067282 176
90 3300025254 Ga0209148_1008101 Ga0209148_10081012 176
91 3300025256 Ga0209759_1000663 Ga0209759_10006637 176
92 3300025272 Ga0209455_1000093 Ga0209455_1000093122 176
93 3300025899 Ga0207642_10122933 Ga0207642_101229331 176
94 3300025901 Ga0207688_10226644 Ga0207688_102266441 176
95 3300025903 Ga0207680_10234937 Ga0207680_102349371 176
96 3300025907 Ga0207645_10001190 Ga0207645_100011902 176
97 3300025908 Ga0207643_10019116 Ga0207643_100191163 176
98 3300025908 Ga0207643_10435912 Ga0207643_104359121 176
99 3300025910 Ga0207684_10045154 Ga0207684_100451542 176
100 3300025913 Ga0207695_10018064 Ga0207695_100180647 176
101 3300025913 Ga0207695_10499108 Ga0207695_104991081 176
102 3300025918 Ga0207662_10156985 Ga0207662_101569852 176
103 3300025919 Ga0207657_10035340 Ga0207657_100353404 176
104 3300025921 Ga0207652_11212238 Ga0207652_112122381 176
105 3300025923 Ga0207681_10068098 Ga0207681_100680982 176
106 3300025925 Ga0207650_10799132 Ga0207650_107991321 176
107 3300025926 Ga0207659_10021623 Ga0207659_100216232 176
108 3300025926 Ga0207659_10030715 Ga0207659_100307152 176
109 3300025927 Ga0207687_10048767 Ga0207687_100487673 176
110 3300025927 Ga0207687_10249590 Ga0207687_102495901 176
111 3300025931 Ga0207644_10097386 Ga0207644_100973862 176
112 3300025931 Ga0207644_10120098 Ga0207644_101200981 176
113 3300025932 Ga0207690_10124324 Ga0207690_101243242 176
114 3300025933 Ga0207706_10003498 Ga0207706_1000349811 176
115 3300025938 Ga0207704_10103926 Ga0207704_101039262 176
116 3300025940 Ga0207691_10044537 Ga0207691_100445372 176
117 3300025942 Ga0207689_10020361 Ga0207689_100203613 176
118 3300025942 Ga0207689_10200002 Ga0207689_102000022 176
119 3300025945 Ga0207679_10111289 Ga0207679_101112892 176
120 3300025945 Ga0207679_11467526 Ga0207679_114675261 176
121 3300025949 Ga0207667_10493162 Ga0207667_104931622 176
122 3300025960 Ga0207651_10006141 Ga0207651_100061416 176
123 3300025960 Ga0207651_10112746 Ga0207651_101127462 176
124 3300026023 Ga0207677_10014503 Ga0207677_100145032 176
125 3300026023 Ga0207677_10419687 Ga0207677_104196872 176
126 3300026067 Ga0207678_10099991 Ga0207678_100999912 176
127 3300026089 Ga0207648_10012441 Ga0207648_100124413 176
128 3300026116 Ga0207674_10060362 Ga0207674_100603622 176
129 3300026118 Ga0207675_100020138 Ga0207675_1000201384 176
130 3300026118 Ga0207675_100267249 Ga0207675_1002672492 176
131 3300027526 Ga0209968_1001019 Ga0209968_10010192 176
132 3300027695 Ga0209966_1000029 Ga0209966_10000292 176
133 3300028786 Ga0307517_10194429 Ga0307517_101944292 176
134 3300028786 Ga0307517_10283162 Ga0307517_102831621 176
135 3300028786 Ga0307517_10349679 Ga0307517_103496792 176
136 3300031250 Ga0265331_10055884 Ga0265331_100558842 176
137 3300031251 Ga0265327_10000043 Ga0265327_100000439 176
138 3300031507 Ga0307509_10457407 Ga0307509_104574072 176
139 3300031548 Ga0307408_101194529 Ga0307408_1011945291 176
140 3300031730 Ga0307516_10002378 Ga0307516_1000237814 176
141 3300031911 Ga0307412_10370111 Ga0307412_103701111 176
142 3300032168 Ga0316593_10005398 Ga0316593_100053981 176
143 3300033541 Ga0316596_1027499 Ga0316596_10274992 176
144 3300035086 Ga0373934_0033151 Ga0373934_0033151_621_1172 176
145 3300036401 Ga0373937_0268384 Ga0373937_0268384_983_1525 176
146 3300036647 Ga0316582_0251500 Ga0316582_0251500_315_860 176
147 3300037312 Ga0395899_0108877 Ga0395899_0108877_973_1524 176
148 3300038443 Ga0395901_0008851 Ga0395901_0008851_5966_6517 176
149 3300039447 Ga0436361_0678114 Ga0436361_0678114_2161_2700 176
150 3300039447 Ga0436361_1178843 Ga0436361_1178843_224_766 176
151 3300044656 Ga0466969_0016587 Ga0466969_0016587_2420_2962 176
152 3300044683 Ga0466965_0077858 Ga0466965_0077858_104_646 176
153 3300044684 Ga0466966_0108259 Ga0466966_0108259_904_1446 176
154 3300044693 Ga0466961_0099700 Ga0466961_0099700_766_1308 176
155 3300044706 Ga0466964_0051982 Ga0466964_0051982_644_1186 176
156 3300044719 Ga0466971_0033519 Ga0466971_0033519_483_1025 176
157 3300044765 Ga0466970_0011494 Ga0466970_0011494_2166_2708 176
158 3300044842 Ga0466957_0010823 Ga0466957_0010823_1527_2069 176
159 3300045049 Ga0466959_0029610 Ga0466959_0029610_3134_3676 176
160 3300045836 Ga0466958_0026784 Ga0466958_0026784_2639_3181 176
161 3300046471 Ga0495650_0009489 Ga0495650_0009489_787_1326 176
162 3300046474 Ga0495605_0352638 Ga0495605_0352638_20_556 176
163 3300046506 Ga0495583_0001275 Ga0495583_0001275_25457_26008 176
164 3300046507 Ga0495606_0024795 Ga0495606_0024795_2554_3105 176
165 3300046519 Ga0495632_0010763 Ga0495632_0010763_4406_4942 176
166 3300046529 Ga0495652_0607795 Ga0495652_0607795_177_728 176
167 3300046530 Ga0495654_0166021 Ga0495654_0166021_252_788 176
168 3300046537 Ga0495598_0060682 Ga0495598_0060682_591_1130 176
169 3300046539 Ga0495621_0008072 Ga0495621_0008072_838_1377 176
170 3300046542 Ga0495597_0016988 Ga0495597_0016988_2116_2652 176
171 3300046616 Ga0495668_0090235 Ga0495668_0090235_418_969 176
172 3300046660 Ga0495625_0039914 Ga0495625_0039914_2815_3351 176
173 3300046660 Ga0495625_0114983 Ga0495625_0114983_299_850 176
174 3300046684 Ga0495669_0019999 Ga0495669_0019999_784_1335 176
175 3300046692 Ga0495671_0173846 Ga0495671_0173846_257_808 176
176 3300046694 Ga0495649_0002640 Ga0495649_0002640_2258_2794 176
177 3300046694 Ga0495649_0012323 Ga0495649_0012323_3645_4196 176
178 3300046794 Ga0495589_0033363 Ga0495589_0033363_805_1356 176
179 3300046810 Ga0495660_0138009 Ga0495660_0138009_572_1108 176
180 3300047443 Ga0495687_000790 Ga0495687_000790_9986_10522 176
181 3300047443 Ga0495687_014895 Ga0495687_014895_1813_2349 176
182 3300047472 Ga0495686_0006292 Ga0495686_0006292_6634_7176 176
183 3300048908 Ga0496105_0285447 Ga0496105_0285447_387_929 176
184 3300048909 Ga0496106_0228967 Ga0496106_0228967_407_949 176
185 3300050489 nmdc:mga03683_9197_c1 nmdc:mga03683_9197_c1_342_878 176
186 3300050490 nmdc:mga03n38_22608_c1 nmdc:mga03n38_22608_c1_508_1044 176
187 3300050492 nmdc:mga0yw44_81222_c1 nmdc:mga0yw44_81222_c1_560_1096 176
188 3300050493 nmdc:mga0k408_1329_c1 nmdc:mga0k408_1329_c1_10883_11419 176
189 3300050493 nmdc:mga0k408_148_c1 nmdc:mga0k408_148_c1_27301_27837 176
190 3300050493 nmdc:mga0k408_19570_c1 nmdc:mga0k408_19570_c1_960_1511 176
191 3300050493 nmdc:mga0k408_50348_c1 nmdc:mga0k408_50348_c1_1124_1660 176
192 3300050494 nmdc:mga06z11_15349_c1 nmdc:mga06z11_15349_c1_1247_1783 176
193 3300050494 nmdc:mga06z11_161280_c1 nmdc:mga06z11_161280_c1_289_825 176
194 3300050494 nmdc:mga06z11_194338_c1 nmdc:mga06z11_194338_c1_267_803 176
195 3300050495 nmdc:mga04h51_7088_c1 nmdc:mga04h51_7088_c1_1408_1944 176
196 3300050496 nmdc:mga07m45_1748_c1 nmdc:mga07m45_1748_c1_7061_7597 176
197 3300050496 nmdc:mga07m45_7066_c1 nmdc:mga07m45_7066_c1_1738_2274 176
198 3300050507 nmdc:mga05p37_329145_c2 nmdc:mga05p37_329145_c2_300_836 176
199 3300050513 nmdc:mga0rr50_723454_c1 nmdc:mga0rr50_723454_c1_123_662 176
200 3300050516 nmdc:mga0sz30_66687_c1 nmdc:mga0sz30_66687_c1_206_742 176
201 3300050516 nmdc:mga0sz30_72880_c1 nmdc:mga0sz30_72880_c1_355_891 176
202 3300053085 Ga0495619_0329632 Ga0495619_0329632_186_737 176
203 3300053109 Ga0500569_002749 Ga0500569_002749_2412_2957 176
204 3300053139 Ga0500568_0040985 Ga0500568_0040985_627_1163 176
205 3300061719 Ga0466962_0033010 Ga0466962_0033010_901_1443 176
206 3300002774 JGI25150J39212_1003483 JGI25150J39212_10034831 177
207 3300002774 JGI25150J39212_1024682 JGI25150J39212_10246821 177
208 3300002987 JGI25159J45721_1009081 JGI25159J45721_10090812 177
209 3300003354 JGI25160J50197_1001459 JGI25160J50197_100145914 177
210 3300003374 JGI25161J50226_1000015 JGI25161J50226_100001586 177
211 3300003374 JGI25161J50226_1008780 JGI25161J50226_10087802 177
212 3300003503 JGI26141J51220_1007754 JGI26141J51220_10077542 177
213 3300003771 Ga0055526_1003568 Ga0055526_10035682 177
214 3300003775 Ga0055524_1000016 Ga0055524_1000016159 177
215 3300003775 Ga0055524_1002380 Ga0055524_10023802 177
216 3300003784 Ga0055534_1000697 Ga0055534_10006972 177
217 3300003791 Ga0055530_10000243 Ga0055530_1000024349 177
218 3300003791 Ga0055530_10031028 Ga0055530_100310282 177
219 3300003792 Ga0055540_1000031 Ga0055540_1000031168 177
220 3300003792 Ga0055540_1005908 Ga0055540_10059082 177
221 3300003792 Ga0055540_1040189 Ga0055540_10401891 177
222 3300003794 Ga0055531_10000358 Ga0055531_1000035840 177
223 3300003794 Ga0055531_10001823 Ga0055531_100018233 177
224 3300003794 Ga0055531_10009351 Ga0055531_100093514 177
225 3300003794 Ga0055531_10018799 Ga0055531_100187992 177
226 3300004625 Ga0055543_1000749 Ga0055543_100074917 177
227 3300005262 Ga0065165_1000184 Ga0065165_100018460 177
228 3300005262 Ga0065165_1001656 Ga0065165_100165610 177
229 3300005327 Ga0070658_10100190 Ga0070658_101001902 177
230 3300005327 Ga0070658_10133246 Ga0070658_101332463 177
231 3300005327 Ga0070658_10202913 Ga0070658_102029132 177
232 3300005327 Ga0070658_11084150 Ga0070658_110841501 177
233 3300005329 Ga0070683_100046468 Ga0070683_1000464682 177
234 3300005330 Ga0070690_100096829 Ga0070690_1000968292 177
235 3300005330 Ga0070690_100108266 Ga0070690_1001082662 177
236 3300005331 Ga0070670_100103661 Ga0070670_1001036612 177
237 3300005331 Ga0070670_100109374 Ga0070670_1001093742 177
238 3300005331 Ga0070670_100112783 Ga0070670_1001127832 177
239 3300005333 Ga0070677_10060395 Ga0070677_100603952 177
240 3300005334 Ga0068869_100008595 Ga0068869_1000085957 177
241 3300005334 Ga0068869_100094463 Ga0068869_1000944633 177
242 3300005334 Ga0068869_100478998 Ga0068869_1004789982 177
243 3300005334 Ga0068869_100540583 Ga0068869_1005405832 177
244 3300005335 Ga0070666_10026213 Ga0070666_100262134 177
245 3300005335 Ga0070666_10047978 Ga0070666_100479782 177
246 3300005336 Ga0070680_100003443 Ga0070680_1000034432 177
247 3300005336 Ga0070680_100236703 Ga0070680_1002367032 177
248 3300005336 Ga0070680_100301955 Ga0070680_1003019551 177
249 3300005336 Ga0070680_100707356 Ga0070680_1007073561 177
250 3300005337 Ga0070682_100561892 Ga0070682_1005618921 177
251 3300005338 Ga0068868_100052727 Ga0068868_1000527272 177
252 3300005338 Ga0068868_100061443 Ga0068868_1000614432 177
253 3300005338 Ga0068868_100593224 Ga0068868_1005932242 177
254 3300005339 Ga0070660_100116604 Ga0070660_1001166043 177
255 3300005339 Ga0070660_100626551 Ga0070660_1006265511 177
256 3300005339 Ga0070660_101281453 Ga0070660_1012814531 177
257 3300005344 Ga0070661_100001017 Ga0070661_1000010172 177
258 3300005344 Ga0070661_100003668 Ga0070661_1000036687 177
259 3300005344 Ga0070661_100009848 Ga0070661_1000098483 177
260 3300005344 Ga0070661_100244661 Ga0070661_1002446612 177
261 3300005344 Ga0070661_100292187 Ga0070661_1002921871 177
262 3300005347 Ga0070668_100052979 Ga0070668_1000529792 177
263 3300005347 Ga0070668_100128808 Ga0070668_1001288082 177
264 3300005347 Ga0070668_100295979 Ga0070668_1002959792 177
265 3300005347 Ga0070668_100819777 Ga0070668_1008197771 177
266 3300005353 Ga0070669_100064909 Ga0070669_1000649094 177
267 3300005353 Ga0070669_100144552 Ga0070669_1001445522 177
268 3300005353 Ga0070669_100290021 Ga0070669_1002900212 177
269 3300005353 Ga0070669_100316324 Ga0070669_1003163242 177
270 3300005354 Ga0070675_100040042 Ga0070675_1000400422 177
271 3300005354 Ga0070675_100051871 Ga0070675_1000518714 177
272 3300005355 Ga0070671_100001374 Ga0070671_10000137417 177
273 3300005355 Ga0070671_100002406 Ga0070671_1000024063 177
274 3300005355 Ga0070671_100431894 Ga0070671_1004318942 177
275 3300005356 Ga0070674_100107477 Ga0070674_1001074773 177
276 3300005356 Ga0070674_100275481 Ga0070674_1002754812 177
277 3300005364 Ga0070673_100028745 Ga0070673_1000287451 177
278 3300005364 Ga0070673_100134464 Ga0070673_1001344642 177
279 3300005364 Ga0070673_100355852 Ga0070673_1003558522 177
280 3300005364 Ga0070673_100538360 Ga0070673_1005383602 177
281 3300005365 Ga0070688_100092870 Ga0070688_1000928702 177
282 3300005366 Ga0070659_100008648 Ga0070659_1000086482 177
283 3300005366 Ga0070659_100009656 Ga0070659_1000096564 177
284 3300005366 Ga0070659_100010955 Ga0070659_1000109557 177
285 3300005366 Ga0070659_100034650 Ga0070659_1000346502 177
286 3300005366 Ga0070659_100411493 Ga0070659_1004114933 177
287 3300005367 Ga0070667_100011503 Ga0070667_1000115039 177
288 3300005367 Ga0070667_100117594 Ga0070667_1001175942 177
289 3300005367 Ga0070667_100241234 Ga0070667_1002412342 177
290 3300005434 Ga0070709_10030621 Ga0070709_100306213 177
291 3300005435 Ga0070714_100173379 Ga0070714_1001733791 177
292 3300005436 Ga0070713_100000130 Ga0070713_10000013033 177
293 3300005440 Ga0070705_100017028 Ga0070705_1000170282 177
294 3300005441 Ga0070700_100256201 Ga0070700_1002562012 177
295 3300005455 Ga0070663_100003894 Ga0070663_1000038947 177
296 3300005455 Ga0070663_100199084 Ga0070663_1001990842 177
297 3300005456 Ga0070678_100196536 Ga0070678_1001965362 177
298 3300005456 Ga0070678_100281519 Ga0070678_1002815192 177
299 3300005457 Ga0070662_100035270 Ga0070662_1000352702 177
300 3300005457 Ga0070662_100055900 Ga0070662_1000559003 177
301 3300005457 Ga0070662_100251718 Ga0070662_1002517182 177
302 3300005458 Ga0070681_10244657 Ga0070681_102446571 177
303 3300005458 Ga0070681_10271022 Ga0070681_102710222 177
304 3300005459 Ga0068867_100022367 Ga0068867_1000223672 177
305 3300005459 Ga0068867_100041971 Ga0068867_1000419712 177
306 3300005459 Ga0068867_100048475 Ga0068867_1000484752 177
307 3300005459 Ga0068867_100058206 Ga0068867_1000582062 177
308 3300005459 Ga0068867_100087816 Ga0068867_1000878162 177
309 3300005459 Ga0068867_100357333 Ga0068867_1003573331 177
310 3300005518 Ga0070699_101629698 Ga0070699_1016296981 177
311 3300005530 Ga0070679_100025230 Ga0070679_1000252303 177
312 3300005530 Ga0070679_100028347 Ga0070679_1000283475 177
313 3300005539 Ga0068853_100016064 Ga0068853_1000160646 177
314 3300005539 Ga0068853_100116503 Ga0068853_1001165032 177
315 3300005539 Ga0068853_100873844 Ga0068853_1008738441 177
316 3300005543 Ga0070672_100023360 Ga0070672_1000233604 177
317 3300005543 Ga0070672_100096280 Ga0070672_1000962803 177
318 3300005543 Ga0070672_100400394 Ga0070672_1004003942 177
319 3300005543 Ga0070672_100719987 Ga0070672_1007199871 177
320 3300005544 Ga0070686_100240166 Ga0070686_1002401662 177
321 3300005544 Ga0070686_100374691 Ga0070686_1003746912 177
322 3300005545 Ga0070695_100162631 Ga0070695_1001626312 177
323 3300005548 Ga0070665_100232077 Ga0070665_1002320772 177
324 3300005549 Ga0070704_100058372 Ga0070704_1000583722 177
325 3300005563 Ga0068855_100020005 Ga0068855_1000200057 177
326 3300005563 Ga0068855_100089265 Ga0068855_1000892654 177
327 3300005563 Ga0068855_100107592 Ga0068855_1001075923 177
328 3300005563 Ga0068855_100192672 Ga0068855_1001926722 177
329 3300005564 Ga0070664_100007230 Ga0070664_1000072307 177
330 3300005564 Ga0070664_100015534 Ga0070664_1000155344 177
331 3300005564 Ga0070664_100172576 Ga0070664_1001725762 177
332 3300005564 Ga0070664_100377837 Ga0070664_1003778372 177
333 3300005564 Ga0070664_100501624 Ga0070664_1005016241 177
334 3300005577 Ga0068857_100133458 Ga0068857_1001334583 177
335 3300005578 Ga0068854_100010927 Ga0068854_1000109272 177
336 3300005578 Ga0068854_100014879 Ga0068854_1000148797 177
337 3300005578 Ga0068854_100307993 Ga0068854_1003079932 177
338 3300005578 Ga0068854_100361197 Ga0068854_1003611972 177
339 3300005614 Ga0068856_100000937 Ga0068856_1000009378 177
340 3300005614 Ga0068856_100031144 Ga0068856_1000311447 177
341 3300005614 Ga0068856_100147214 Ga0068856_1001472143 177
342 3300005614 Ga0068856_100444718 Ga0068856_1004447183 177
343 3300005614 Ga0068856_100712745 Ga0068856_1007127451 177
344 3300005615 Ga0070702_100168051 Ga0070702_1001680512 177
345 3300005616 Ga0068852_100099190 Ga0068852_1000991903 177
346 3300005616 Ga0068852_100208568 Ga0068852_1002085682 177
347 3300005616 Ga0068852_100482686 Ga0068852_1004826861 177
348 3300005616 Ga0068852_100711964 Ga0068852_1007119641 177
349 3300005616 Ga0068852_101005196 Ga0068852_1010051962 177
350 3300005617 Ga0068859_100123948 Ga0068859_1001239481 177
351 3300005617 Ga0068859_100441896 Ga0068859_1004418962 177
352 3300005617 Ga0068859_101763367 Ga0068859_1017633672 177
353 3300005618 Ga0068864_100011853 Ga0068864_1000118533 177
354 3300005618 Ga0068864_100046809 Ga0068864_1000468095 177
355 3300005618 Ga0068864_100055254 Ga0068864_1000552542 177
356 3300005718 Ga0068866_10014255 Ga0068866_100142552 177
357 3300005719 Ga0068861_100031456 Ga0068861_1000314562 177
358 3300005841 Ga0068863_100148557 Ga0068863_1001485573 177
359 3300005841 Ga0068863_100202444 Ga0068863_1002024442 177
360 3300005841 Ga0068863_100780030 Ga0068863_1007800303 177
361 3300005841 Ga0068863_100868468 Ga0068863_1008684682 177
362 3300005842 Ga0068858_100054024 Ga0068858_1000540244 177
363 3300005842 Ga0068858_100146464 Ga0068858_1001464641 177
364 3300005842 Ga0068858_100532627 Ga0068858_1005326272 177
365 3300005843 Ga0068860_100000678 Ga0068860_1000006785 177
366 3300005843 Ga0068860_100024635 Ga0068860_1000246351 177
367 3300005843 Ga0068860_100248454 Ga0068860_1002484542 177
368 3300005844 Ga0068862_100003264 Ga0068862_1000032649 177
369 3300005844 Ga0068862_100017965 Ga0068862_1000179652 177
370 3300005844 Ga0068862_100080001 Ga0068862_1000800011 177
371 3300005844 Ga0068862_100150910 Ga0068862_1001509102 177
372 3300005844 Ga0068862_100163746 Ga0068862_1001637462 177
373 3300005844 Ga0068862_100838872 Ga0068862_1008388722 177
374 3300005985 Ga0081539_10041122 Ga0081539_100411222 177
375 3300006038 Ga0075365_10008403 Ga0075365_100084035 177
376 3300006038 Ga0075365_10008748 Ga0075365_100087486 177
377 3300006038 Ga0075365_10147299 Ga0075365_101472992 177
378 3300006042 Ga0075368_10014094 Ga0075368_100140942 177
379 3300006048 Ga0075363_100025312 Ga0075363_1000253122 177
380 3300006048 Ga0075363_100202375 Ga0075363_1002023752 177
381 3300006048 Ga0075363_100693279 Ga0075363_1006932791 177
382 3300006051 Ga0075364_10139438 Ga0075364_101394382 177
383 3300006051 Ga0075364_10154474 Ga0075364_101544742 177
384 3300006051 Ga0075364_10183979 Ga0075364_101839792 177
385 3300006175 Ga0070712_100315479 Ga0070712_1003154792 177
386 3300006177 Ga0075362_10012281 Ga0075362_100122812 177
387 3300006177 Ga0075362_10152765 Ga0075362_101527652 177
388 3300006178 Ga0075367_10020025 Ga0075367_100200252 177
389 3300006178 Ga0075367_10213445 Ga0075367_102134452 177
390 3300006195 Ga0075366_10013879 Ga0075366_100138792 177
391 3300006195 Ga0075366_10064797 Ga0075366_100647972 177
392 3300006195 Ga0075366_10088105 Ga0075366_100881052 177
393 3300006195 Ga0075366_10114371 Ga0075366_101143712 177
394 3300006195 Ga0075366_10130349 Ga0075366_101303492 177
395 3300006195 Ga0075366_10143213 Ga0075366_101432132 177
396 3300006237 Ga0097621_100068313 Ga0097621_1000683132 177
397 3300006237 Ga0097621_100096690 Ga0097621_1000966902 177
398 3300006237 Ga0097621_100542168 Ga0097621_1005421682 177
399 3300006353 Ga0075370_10017562 Ga0075370_100175622 177
400 3300006353 Ga0075370_10056841 Ga0075370_100568413 177
401 3300006353 Ga0075370_10144595 Ga0075370_101445952 177
402 3300006353 Ga0075370_10191401 Ga0075370_101914012 177
403 3300006358 Ga0068871_100129517 Ga0068871_1001295172 177
404 3300006358 Ga0068871_100218700 Ga0068871_1002187002 177
405 3300006358 Ga0068871_100522893 Ga0068871_1005228931 177
406 3300006358 Ga0068871_100606574 Ga0068871_1006065742 177
407 3300006844 Ga0075428_100121466 Ga0075428_1001214665 177
408 3300006844 Ga0075428_100271198 Ga0075428_1002711982 177
409 3300006847 Ga0075431_100009882 Ga0075431_1000098822 177
410 3300006880 Ga0075429_100000463 Ga0075429_10000046324 177
411 3300006881 Ga0068865_100002721 Ga0068865_1000027213 177
412 3300006931 Ga0097620_100123944 Ga0097620_1001239442 177
413 3300006931 Ga0097620_100441896 Ga0097620_1004418962 177
414 3300006931 Ga0097620_101763187 Ga0097620_1017631871 177
415 3300006944 Ga0099823_1000039 Ga0099823_100003925 177
416 3300009093 Ga0105240_10026368 Ga0105240_100263684 177
417 3300009093 Ga0105240_10064807 Ga0105240_100648074 177
418 3300009093 Ga0105240_10835949 Ga0105240_108359492 177
419 3300009094 Ga0111539_10842640 Ga0111539_108426401 177
420 3300009094 Ga0111539_11825265 Ga0111539_118252651 177
421 3300009098 Ga0105245_10086581 Ga0105245_100865812 177
422 3300009098 Ga0105245_11373214 Ga0105245_113732141 177
423 3300009147 Ga0114129_10018075 Ga0114129_100180752 177
424 3300009148 Ga0105243_10044991 Ga0105243_100449912 177
425 3300009148 Ga0105243_10093501 Ga0105243_100935012 177
426 3300009148 Ga0105243_10144779 Ga0105243_101447792 177
427 3300009148 Ga0105243_10191615 Ga0105243_101916152 177
428 3300009176 Ga0105242_10262339 Ga0105242_102623392 177
429 3300009176 Ga0105242_10638813 Ga0105242_106388132 177
430 3300009176 Ga0105242_11007014 Ga0105242_110070141 177
431 3300009177 Ga0105248_10006076 Ga0105248_100060767 177
432 3300009177 Ga0105248_10116226 Ga0105248_101162263 177
433 3300009177 Ga0105248_10158577 Ga0105248_101585772 177
434 3300009177 Ga0105248_10447586 Ga0105248_104475862 177
435 3300009177 Ga0105248_10853246 Ga0105248_108532461 177
436 3300009177 Ga0105248_11258934 Ga0105248_112589342 177
437 3300009545 Ga0105237_10000784 Ga0105237_100007842 177
438 3300009545 Ga0105237_10154894 Ga0105237_101548943 177
439 3300009551 Ga0105238_10033583 Ga0105238_100335832 177
440 3300009551 Ga0105238_10326403 Ga0105238_103264032 177
441 3300009551 Ga0105238_10926360 Ga0105238_109263601 177
442 3300009551 Ga0105238_11708558 Ga0105238_117085581 177
443 3300009553 Ga0105249_10055139 Ga0105249_100551392 177
444 3300009553 Ga0105249_10109205 Ga0105249_101092052 177
445 3300009553 Ga0105249_11874964 Ga0105249_118749641 177
446 3300010375 Ga0105239_10017475 Ga0105239_100174754 177
447 3300011119 Ga0105246_10266759 Ga0105246_102667592 177
448 3300011119 Ga0105246_10819111 Ga0105246_108191111 177
449 3300011119 Ga0105246_11511185 Ga0105246_115111851 177
450 3300012497 Ga0157319_1000009 Ga0157319_100000971 177
451 3300013100 Ga0157373_10009401 Ga0157373_100094019 177
452 3300013100 Ga0157373_10201252 Ga0157373_102012522 177
453 3300013102 Ga0157371_10003553 Ga0157371_100035535 177
454 3300013102 Ga0157371_10186726 Ga0157371_101867262 177
455 3300013102 Ga0157371_10527989 Ga0157371_105279891 177
456 3300013104 Ga0157370_10016304 Ga0157370_100163042 177
457 3300013104 Ga0157370_10021276 Ga0157370_100212768 177
458 3300013104 Ga0157370_10069410 Ga0157370_100694104 177
459 3300013105 Ga0157369_10007076 Ga0157369_100070763 177
460 3300013105 Ga0157369_10009390 Ga0157369_1000939010 177
461 3300013105 Ga0157369_10065405 Ga0157369_100654053 177
462 3300013105 Ga0157369_10205427 Ga0157369_102054272 177
463 3300013296 Ga0157374_10117423 Ga0157374_101174232 177
464 3300013296 Ga0157374_10498262 Ga0157374_104982621 177
465 3300013297 Ga0157378_10003415 Ga0157378_100034152 177
466 3300013297 Ga0157378_10004517 Ga0157378_100045177 177
467 3300013297 Ga0157378_10041933 Ga0157378_100419334 177
468 3300013297 Ga0157378_10276787 Ga0157378_102767872 177
469 3300013297 Ga0157378_10517891 Ga0157378_105178911 177
470 3300013297 Ga0157378_10524014 Ga0157378_105240142 177
471 3300013306 Ga0163162_10013003 Ga0163162_100130032 177
472 3300013306 Ga0163162_10066107 Ga0163162_100661073 177
473 3300013306 Ga0163162_10461464 Ga0163162_104614642 177
474 3300013306 Ga0163162_10921910 Ga0163162_109219102 177
475 3300013307 Ga0157372_10002684 Ga0157372_1000268411 177
476 3300013307 Ga0157372_10140032 Ga0157372_101400323 177
477 3300013307 Ga0157372_10205402 Ga0157372_102054023 177
478 3300013307 Ga0157372_10235394 Ga0157372_102353942 177
479 3300013307 Ga0157372_10349207 Ga0157372_103492073 177
480 3300013307 Ga0157372_10402936 Ga0157372_104029362 177
481 3300013307 Ga0157372_11043954 Ga0157372_110439541 177
482 3300013308 Ga0157375_10100019 Ga0157375_101000191 177
483 3300013308 Ga0157375_10350313 Ga0157375_103503132 177
484 3300014325 Ga0163163_10106185 Ga0163163_101061854 177
485 3300014326 Ga0157380_10030768 Ga0157380_100307682 177
486 3300014326 Ga0157380_10155746 Ga0157380_101557461 177
487 3300014326 Ga0157380_10559661 Ga0157380_105596612 177
488 3300014745 Ga0157377_10538668 Ga0157377_105386682 177
489 3300014968 Ga0157379_10059549 Ga0157379_100595492 177
490 3300014968 Ga0157379_10093284 Ga0157379_100932844 177
491 3300014968 Ga0157379_10791041 Ga0157379_107910412 177
492 3300014969 Ga0157376_10014203 Ga0157376_100142035 177
493 3300014969 Ga0157376_10165688 Ga0157376_101656883 177
494 3300014969 Ga0157376_10319603 Ga0157376_103196032 177
495 3300014969 Ga0157376_10339627 Ga0157376_103396272 177
496 3300014969 Ga0157376_10927008 Ga0157376_109270081 177
497 3300015262 Ga0182007_10027607 Ga0182007_100276072 177
498 3300017792 Ga0163161_10062740 Ga0163161_100627402 177
499 3300017792 Ga0163161_10385129 Ga0163161_103851292 177
500 3300021361 Ga0213872_10000004 Ga0213872_10000004146 177
501 3300021361 Ga0213872_10049430 Ga0213872_100494302 177
502 3300025273 Ga0209673_1010377 Ga0209673_10103772 177
503 3300025273 Ga0209673_1011036 Ga0209673_10110362 177
504 3300025273 Ga0209673_1067835 Ga0209673_10678351 177
505 3300025295 Ga0209564_1000003 Ga0209564_1000003444 177
506 3300025298 Ga0209050_1019110 Ga0209050_10191103 177
507 3300025299 Ga0209256_1001390 Ga0209256_100139010 177
508 3300025299 Ga0209256_1021613 Ga0209256_10216131 177
509 3300025303 Ga0209051_1000140 Ga0209051_100014053 177
510 3300025303 Ga0209051_1001698 Ga0209051_10016985 177
511 3300025304 Ga0209257_1000012 Ga0209257_1000012787 177
512 3300025304 Ga0209257_1000045 Ga0209257_1000045193 177
513 3300025304 Ga0209257_1001619 Ga0209257_100161912 177
514 3300025304 Ga0209257_1002501 Ga0209257_100250110 177
515 3300025315 Ga0207697_10081189 Ga0207697_100811891 177
516 3300025321 Ga0207656_10003677 Ga0207656_100036773 177
517 3300025893 Ga0207682_10020313 Ga0207682_100203132 177
518 3300025893 Ga0207682_10045037 Ga0207682_100450372 177
519 3300025899 Ga0207642_10058363 Ga0207642_100583632 177
520 3300025901 Ga0207688_10082222 Ga0207688_100822222 177
521 3300025903 Ga0207680_10545585 Ga0207680_105455852 177
522 3300025904 Ga0207647_10180276 Ga0207647_101802762 177
523 3300025906 Ga0207699_10173423 Ga0207699_101734232 177
524 3300025907 Ga0207645_10035276 Ga0207645_100352764 177
525 3300025907 Ga0207645_10061879 Ga0207645_100618792 177
526 3300025907 Ga0207645_10116159 Ga0207645_101161592 177
527 3300025908 Ga0207643_10138836 Ga0207643_101388362 177
528 3300025909 Ga0207705_10036481 Ga0207705_100364814 177
529 3300025909 Ga0207705_10859350 Ga0207705_108593501 177
530 3300025911 Ga0207654_10456993 Ga0207654_104569931 177
531 3300025913 Ga0207695_10030121 Ga0207695_100301213 177
532 3300025913 Ga0207695_10099170 Ga0207695_100991702 177
533 3300025913 Ga0207695_10709983 Ga0207695_107099831 177
534 3300025913 Ga0207695_10801652 Ga0207695_108016521 177
535 3300025914 Ga0207671_10220348 Ga0207671_102203482 177
536 3300025917 Ga0207660_10051575 Ga0207660_100515752 177
537 3300025917 Ga0207660_10072521 Ga0207660_100725212 177
538 3300025919 Ga0207657_10018458 Ga0207657_100184583 177
539 3300025919 Ga0207657_10113026 Ga0207657_101130262 177
540 3300025919 Ga0207657_10116858 Ga0207657_101168583 177
541 3300025919 Ga0207657_10611274 Ga0207657_106112741 177
542 3300025920 Ga0207649_10014385 Ga0207649_100143853 177
543 3300025920 Ga0207649_10027192 Ga0207649_100271922 177
544 3300025920 Ga0207649_10175747 Ga0207649_101757472 177
545 3300025920 Ga0207649_10984124 Ga0207649_109841241 177
546 3300025921 Ga0207652_10021537 Ga0207652_100215372 177
547 3300025921 Ga0207652_10046811 Ga0207652_100468111 177
548 3300025921 Ga0207652_10442167 Ga0207652_104421671 177
549 3300025924 Ga0207694_10006337 Ga0207694_100063375 177
550 3300025924 Ga0207694_10006652 Ga0207694_1000665210 177
551 3300025924 Ga0207694_10650963 Ga0207694_106509631 177
552 3300025925 Ga0207650_10000900 Ga0207650_1000090019 177
553 3300025925 Ga0207650_10132089 Ga0207650_101320892 177
554 3300025926 Ga0207659_10004818 Ga0207659_100048187 177
555 3300025926 Ga0207659_10052521 Ga0207659_100525212 177
556 3300025926 Ga0207659_10072244 Ga0207659_100722441 177
557 3300025926 Ga0207659_10235315 Ga0207659_102353152 177
558 3300025926 Ga0207659_10279495 Ga0207659_102794952 177
559 3300025927 Ga0207687_10196620 Ga0207687_101966202 177
560 3300025927 Ga0207687_10902448 Ga0207687_109024481 177
561 3300025928 Ga0207700_10000262 Ga0207700_1000026225 177
562 3300025929 Ga0207664_10322557 Ga0207664_103225572 177
563 3300025931 Ga0207644_10012179 Ga0207644_100121795 177
564 3300025931 Ga0207644_10081730 Ga0207644_100817301 177
565 3300025931 Ga0207644_10232733 Ga0207644_102327332 177
566 3300025931 Ga0207644_10375554 Ga0207644_103755541 177
567 3300025931 Ga0207644_10397442 Ga0207644_103974422 177
568 3300025932 Ga0207690_10032871 Ga0207690_100328714 177
569 3300025932 Ga0207690_10066926 Ga0207690_100669261 177
570 3300025932 Ga0207690_10074322 Ga0207690_100743222 177
571 3300025933 Ga0207706_10000045 Ga0207706_1000004538 177
572 3300025933 Ga0207706_10097737 Ga0207706_100977372 177
573 3300025934 Ga0207686_10059943 Ga0207686_100599432 177
574 3300025935 Ga0207709_10100467 Ga0207709_101004672 177
575 3300025935 Ga0207709_10104151 Ga0207709_101041512 177
576 3300025935 Ga0207709_10104840 Ga0207709_101048401 177
577 3300025936 Ga0207670_10017790 Ga0207670_100177906 177
578 3300025936 Ga0207670_10235473 Ga0207670_102354731 177
579 3300025936 Ga0207670_10316726 Ga0207670_103167262 177
580 3300025937 Ga0207669_10094383 Ga0207669_100943831 177
581 3300025937 Ga0207669_10107269 Ga0207669_101072692 177
582 3300025937 Ga0207669_10216156 Ga0207669_102161561 177
583 3300025940 Ga0207691_10013008 Ga0207691_100130082 177
584 3300025940 Ga0207691_10014607 Ga0207691_100146072 177
585 3300025940 Ga0207691_10119141 Ga0207691_101191413 177
586 3300025941 Ga0207711_10012329 Ga0207711_100123294 177
587 3300025941 Ga0207711_10119369 Ga0207711_101193692 177
588 3300025941 Ga0207711_10200226 Ga0207711_102002262 177
589 3300025941 Ga0207711_10597961 Ga0207711_105979611 177
590 3300025942 Ga0207689_10035080 Ga0207689_100350801 177
591 3300025942 Ga0207689_10081629 Ga0207689_100816292 177
592 3300025942 Ga0207689_10113327 Ga0207689_101133272 177
593 3300025942 Ga0207689_10396096 Ga0207689_103960962 177
594 3300025945 Ga0207679_10000279 Ga0207679_1000027914 177
595 3300025945 Ga0207679_10009086 Ga0207679_100090863 177
596 3300025945 Ga0207679_10195290 Ga0207679_101952902 177
597 3300025945 Ga0207679_10318076 Ga0207679_103180762 177
598 3300025945 Ga0207679_10385851 Ga0207679_103858512 177
599 3300025949 Ga0207667_10012656 Ga0207667_100126562 177
600 3300025949 Ga0207667_10043079 Ga0207667_100430796 177
601 3300025949 Ga0207667_10083607 Ga0207667_100836072 177
602 3300025949 Ga0207667_10161785 Ga0207667_101617854 177
603 3300025949 Ga0207667_10179516 Ga0207667_101795162 177
604 3300025960 Ga0207651_10015175 Ga0207651_100151754 177
605 3300025960 Ga0207651_10030873 Ga0207651_100308733 177
606 3300025960 Ga0207651_10173688 Ga0207651_101736882 177
607 3300025960 Ga0207651_10269997 Ga0207651_102699972 177
608 3300025961 Ga0207712_10069351 Ga0207712_100693512 177
609 3300025972 Ga0207668_10282294 Ga0207668_102822942 177
610 3300025981 Ga0207640_10276066 Ga0207640_102760662 177
611 3300025986 Ga0207658_10322841 Ga0207658_103228412 177
612 3300025986 Ga0207658_10475361 Ga0207658_104753611 177
613 3300026023 Ga0207677_10058377 Ga0207677_100583772 177
614 3300026023 Ga0207677_10105045 Ga0207677_101050452 177
615 3300026023 Ga0207677_10324713 Ga0207677_103247131 177
616 3300026023 Ga0207677_10355356 Ga0207677_103553561 177
617 3300026035 Ga0207703_10038338 Ga0207703_100383384 177
618 3300026035 Ga0207703_10103802 Ga0207703_101038023 177
619 3300026035 Ga0207703_10117595 Ga0207703_101175951 177
620 3300026035 Ga0207703_10172623 Ga0207703_101726232 177
621 3300026041 Ga0207639_10003482 Ga0207639_1000348210 177
622 3300026041 Ga0207639_10043795 Ga0207639_100437952 177
623 3300026041 Ga0207639_10047438 Ga0207639_100474382 177
624 3300026041 Ga0207639_10154489 Ga0207639_101544893 177
625 3300026041 Ga0207639_10246566 Ga0207639_102465662 177
626 3300026041 Ga0207639_10570673 Ga0207639_105706731 177
627 3300026075 Ga0207708_10163986 Ga0207708_101639862 177
628 3300026078 Ga0207702_10009898 Ga0207702_100098984 177
629 3300026078 Ga0207702_10503655 Ga0207702_105036552 177
630 3300026078 Ga0207702_10947705 Ga0207702_109477051 177
631 3300026088 Ga0207641_10033004 Ga0207641_100330042 177
632 3300026088 Ga0207641_10033151 Ga0207641_100331515 177
633 3300026088 Ga0207641_10037100 Ga0207641_100371004 177
634 3300026088 Ga0207641_10155795 Ga0207641_101557952 177
635 3300026089 Ga0207648_10000839 Ga0207648_1000083929 177
636 3300026089 Ga0207648_10021693 Ga0207648_100216933 177
637 3300026089 Ga0207648_10059325 Ga0207648_100593252 177
638 3300026089 Ga0207648_10125892 Ga0207648_101258922 177
639 3300026089 Ga0207648_10186196 Ga0207648_101861962 177
640 3300026089 Ga0207648_10254825 Ga0207648_102548252 177
641 3300026089 Ga0207648_10292811 Ga0207648_102928112 177
642 3300026095 Ga0207676_10041647 Ga0207676_100416472 177
643 3300026095 Ga0207676_10713779 Ga0207676_107137792 177
644 3300026116 Ga0207674_10024176 Ga0207674_100241765 177
645 3300026116 Ga0207674_10089913 Ga0207674_100899134 177
646 3300026116 Ga0207674_10277867 Ga0207674_102778673 177
647 3300026118 Ga0207675_100014777 Ga0207675_1000147772 177
648 3300026118 Ga0207675_100035648 Ga0207675_1000356486 177
649 3300026121 Ga0207683_10040196 Ga0207683_100401964 177
650 3300026121 Ga0207683_10051101 Ga0207683_100511015 177
651 3300026121 Ga0207683_10126900 Ga0207683_101269002 177
652 3300026121 Ga0207683_10373255 Ga0207683_103732552 177
653 3300026121 Ga0207683_10458389 Ga0207683_104583891 177
654 3300026142 Ga0207698_10636810 Ga0207698_106368102 177
655 3300027395 Ga0209996_1017210 Ga0209996_10172102 177
656 3300027614 Ga0209970_1001463 Ga0209970_10014633 177
657 3300027665 Ga0209983_1000576 Ga0209983_10005769 177
658 3300027665 Ga0209983_1003615 Ga0209983_10036151 177
659 3300027682 Ga0209971_1001545 Ga0209971_10015455 177
660 3300027682 Ga0209971_1005862 Ga0209971_10058623 177
661 3300027717 Ga0209998_10000768 Ga0209998_100007684 177
662 3300027866 Ga0209813_10106099 Ga0209813_101060991 177
663 3300027876 Ga0209974_10002778 Ga0209974_100027787 177
664 3300028379 Ga0268266_10437405 Ga0268266_104374052 177
665 3300028380 Ga0268265_10030474 Ga0268265_100304741 177
666 3300028380 Ga0268265_10047991 Ga0268265_100479913 177
667 3300028380 Ga0268265_10063432 Ga0268265_100634322 177
668 3300028380 Ga0268265_10112322 Ga0268265_101123221 177
669 3300028380 Ga0268265_10133804 Ga0268265_101338042 177
670 3300028380 Ga0268265_10138928 Ga0268265_101389282 177
671 3300028381 Ga0268264_10005634 Ga0268264_100056343 177
672 3300028381 Ga0268264_10037292 Ga0268264_100372926 177
673 3300028381 Ga0268264_10088901 Ga0268264_100889012 177
674 3300028794 Ga0307515_10000178 Ga0307515_1000017831 177
675 3300028794 Ga0307515_10007082 Ga0307515_1000708211 177
676 3300028794 Ga0307515_10013694 Ga0307515_1001369411 177
677 3300028794 Ga0307515_10186577 Ga0307515_101865772 177
678 3300028794 Ga0307515_10221093 Ga0307515_102210932 177
679 3300028800 Ga0265338_10184741 Ga0265338_101847413 177
680 3300031238 Ga0265332_10000033 Ga0265332_1000003399 177
681 3300031238 Ga0265332_10005892 Ga0265332_100058924 177
682 3300031241 Ga0265325_10129797 Ga0265325_101297972 177
683 3300031242 Ga0265329_10035652 Ga0265329_100356522 177
684 3300031249 Ga0265339_10107418 Ga0265339_101074182 177
685 3300031250 Ga0265331_10005725 Ga0265331_100057257 177
686 3300031344 Ga0265316_10039638 Ga0265316_100396382 177
687 3300031456 Ga0307513_10000010 Ga0307513_10000010297 177
688 3300031456 Ga0307513_10000121 Ga0307513_1000012136 177
689 3300031456 Ga0307513_10018754 Ga0307513_100187545 177
690 3300031548 Ga0307408_100000008 Ga0307408_100000008154 177
691 3300031548 Ga0307408_100165763 Ga0307408_1001657632 177
692 3300031665 Ga0316575_10044571 Ga0316575_100445713 177
693 3300031665 Ga0316575_10048459 Ga0316575_100484591 177
694 3300031691 Ga0316579_10049839 Ga0316579_100498392 177
695 3300031691 Ga0316579_10288578 Ga0316579_102885782 177
696 3300031711 Ga0265314_10006842 Ga0265314_100068423 177
697 3300031711 Ga0265314_10008368 Ga0265314_100083682 177
698 3300031711 Ga0265314_10336950 Ga0265314_103369501 177
699 3300031712 Ga0265342_10024495 Ga0265342_100244954 177
700 3300031712 Ga0265342_10030598 Ga0265342_100305983 177
701 3300031727 Ga0316576_10001775 Ga0316576_100017752 177
702 3300031727 Ga0316576_10002619 Ga0316576_1000261912 177
703 3300031727 Ga0316576_10023686 Ga0316576_100236863 177
704 3300031727 Ga0316576_10032757 Ga0316576_100327574 177
705 3300031727 Ga0316576_10033884 Ga0316576_100338841 177
706 3300031727 Ga0316576_10036603 Ga0316576_100366034 177
707 3300031727 Ga0316576_10067573 Ga0316576_100675733 177
708 3300031727 Ga0316576_10158509 Ga0316576_101585091 177
709 3300031727 Ga0316576_10391654 Ga0316576_103916541 177
710 3300031728 Ga0316578_10000798 Ga0316578_1000079810 177
711 3300031728 Ga0316578_10013746 Ga0316578_100137463 177
712 3300031728 Ga0316578_10030496 Ga0316578_100304962 177
713 3300031728 Ga0316578_10047399 Ga0316578_100473993 177
714 3300031728 Ga0316578_10059235 Ga0316578_100592351 177
715 3300031728 Ga0316578_10090417 Ga0316578_100904172 177
716 3300031728 Ga0316578_10182017 Ga0316578_101820171 177
717 3300031730 Ga0307516_10005887 Ga0307516_100058879 177
718 3300031730 Ga0307516_10570200 Ga0307516_105702002 177
719 3300031733 Ga0316577_10009861 Ga0316577_100098616 177
720 3300031733 Ga0316577_10152920 Ga0316577_101529202 177
721 3300031733 Ga0316577_10175676 Ga0316577_101756761 177
722 3300031824 Ga0307413_10198960 Ga0307413_101989602 177
723 3300031852 Ga0307410_10005441 Ga0307410_100054418 177
724 3300031852 Ga0307410_10018840 Ga0307410_100188402 177
725 3300031901 Ga0307406_10010235 Ga0307406_100102352 177
726 3300031901 Ga0307406_10053466 Ga0307406_100534662 177
727 3300031911 Ga0307412_10058043 Ga0307412_100580433 177
728 3300031911 Ga0307412_10134042 Ga0307412_101340422 177
729 3300031911 Ga0307412_10249010 Ga0307412_102490101 177
730 3300031911 Ga0307412_10910244 Ga0307412_109102442 177
731 3300031911 Ga0307412_11157869 Ga0307412_111578691 177
732 3300031995 Ga0307409_100812105 Ga0307409_1008121052 177
733 3300032002 Ga0307416_100014325 Ga0307416_1000143253 177
734 3300032002 Ga0307416_101732301 Ga0307416_1017323011 177
735 3300032004 Ga0307414_10007104 Ga0307414_100071048 177
736 3300032004 Ga0307414_10044693 Ga0307414_100446932 177
737 3300032005 Ga0307411_10001688 Ga0307411_100016882 177
738 3300032005 Ga0307411_10020197 Ga0307411_100201972 177
739 3300032126 Ga0307415_100069326 Ga0307415_1000693262 177
740 3300032126 Ga0307415_100069811 Ga0307415_1000698112 177
741 3300032126 Ga0307415_101278943 Ga0307415_1012789431 177
742 3300032133 Ga0316583_10010416 Ga0316583_100104164 177
743 3300032133 Ga0316583_10054187 Ga0316583_100541871 177
744 3300032137 Ga0316585_10050155 Ga0316585_100501552 177
745 3300032137 Ga0316585_10064366 Ga0316585_100643662 177
746 3300032139 Ga0316580_10002360 Ga0316580_100023606 177
747 3300032139 Ga0316580_10007122 Ga0316580_100071222 177
748 3300032139 Ga0316580_10029510 Ga0316580_100295101 177
749 3300032139 Ga0316580_10067803 Ga0316580_100678032 177
750 3300032139 Ga0316580_10160385 Ga0316580_101603851 177
751 3300032168 Ga0316593_10035709 Ga0316593_100357091 177
752 3300032168 Ga0316593_10063194 Ga0316593_100631941 177
753 3300032168 Ga0316593_10092979 Ga0316593_100929791 177
754 3300033524 Ga0316592_1003645 Ga0316592_10036455 177
755 3300033524 Ga0316592_1006282 Ga0316592_10062822 177
756 3300033524 Ga0316592_1019878 Ga0316592_10198782 177
757 3300033527 Ga0316586_1005635 Ga0316586_10056353 177
758 3300033527 Ga0316586_1017679 Ga0316586_10176792 177
759 3300033528 Ga0316588_1004499 Ga0316588_10044994 177
760 3300033528 Ga0316588_1008935 Ga0316588_10089351 177
761 3300033528 Ga0316588_1026379 Ga0316588_10263792 177
762 3300033528 Ga0316588_1031547 Ga0316588_10315472 177
763 3300033528 Ga0316588_1032277 Ga0316588_10322772 177
764 3300033528 Ga0316588_1141172 Ga0316588_11411721 177
765 3300033529 Ga0316587_1000383 Ga0316587_10003834 177
766 3300033529 Ga0316587_1002976 Ga0316587_10029763 177
767 3300033529 Ga0316587_1039632 Ga0316587_10396322 177
768 3300033541 Ga0316596_1000394 Ga0316596_10003945 177
769 3300033541 Ga0316596_1002261 Ga0316596_10022613 177
770 3300033541 Ga0316596_1010352 Ga0316596_10103522 177
771 3300033541 Ga0316596_1050225 Ga0316596_10502251 177
772 3300034817 Ga0373948_0007970 Ga0373948_0007970_963_1502 177
773 3300034820 Ga0373959_0026928 Ga0373959_0026928_58_597 177
774 3300035090 Ga0373949_0033932 Ga0373949_0033932_657_1193 177
775 3300035092 Ga0373952_0000782 Ga0373952_0000782_3139_3687 177
776 3300035114 Ga0373939_0003522 Ga0373939_0003522_441_980 177
777 3300035114 Ga0373939_0089969 Ga0373939_0089969_53_595 177
778 3300035116 Ga0373945_0122326 Ga0373945_0122326_325_867 177
779 3300035170 Ga0373943_0175733 Ga0373943_0175733_281_823 177
780 3300035171 Ga0373946_0114156 Ga0373946_0114156_41_595 177
781 3300035242 Ga0373962_0049958 Ga0373962_0049958_599_1138 177
782 3300035398 Ga0316574_0005456 Ga0316574_0005456_5389_5937 177
783 3300035398 Ga0316574_0085608 Ga0316574_0085608_40_588 177
784 3300035398 Ga0316574_0244048 Ga0316574_0244048_198_746 177
785 3300035398 Ga0316574_0285703 Ga0316574_0285703_149_697 177
786 3300035398 Ga0316574_0339714 Ga0316574_0339714_154_702 177
787 3300035691 Ga0373931_0001103 Ga0373931_0001103_7384_7923 177
788 3300035691 Ga0373931_0155375 Ga0373931_0155375_176_715 177
789 3300035695 Ga0373927_0097286 Ga0373927_0097286_1027_1566 177
790 3300035725 Ga0373947_0280795 Ga0373947_0280795_87_629 177
791 3300035725 Ga0373947_0310403 Ga0373947_0310403_440_979 177
792 3300036401 Ga0373937_0134367 Ga0373937_0134367_1502_2044 177
793 3300036647 Ga0316582_0008735 Ga0316582_0008735_104_652 177
794 3300036647 Ga0316582_0322223 Ga0316582_0322223_318_866 177
795 3300036647 Ga0316582_0688999 Ga0316582_0688999_97_645 177
796 3300036712 Ga0316584_0002169 Ga0316584_0002169_5271_5819 177
797 3300036712 Ga0316584_0002768 Ga0316584_0002768_2820_3368 177
798 3300036712 Ga0316584_0079540 Ga0316584_0079540_1598_2146 177
799 3300036712 Ga0316584_0211980 Ga0316584_0211980_849_1397 177
800 3300036712 Ga0316584_0314817 Ga0316584_0314817_398_946 177
801 3300036712 Ga0316584_0420334 Ga0316584_0420334_337_885 177
802 3300036712 Ga0316584_0541647 Ga0316584_0541647_174_722 177
803 3300037068 Ga0373925_0011540 Ga0373925_0011540_1219_1758 177
804 3300037068 Ga0373925_0332102 Ga0373925_0332102_417_971 177
805 3300037312 Ga0395899_0001756 Ga0395899_0001756_5481_6017 177
806 3300037418 Ga0395900_0004771 Ga0395900_0004771_9510_10046 177
807 3300037418 Ga0395900_0030415 Ga0395900_0030415_4408_4950 177
808 3300037418 Ga0395900_0060539 Ga0395900_0060539_1761_2297 177
809 3300037418 Ga0395900_0188924 Ga0395900_0188924_210_746 177
810 3300037418 Ga0395900_0227543 Ga0395900_0227543_328_885 177
811 3300037418 Ga0395900_0365348 Ga0395900_0365348_525_1073 177
812 3300037466 Ga0395898_0009054 Ga0395898_0009054_6680_7216 177
813 3300037466 Ga0395898_0053216 Ga0395898_0053216_385_942 177
814 3300037466 Ga0395898_0098846 Ga0395898_0098846_1198_1734 177
815 3300037466 Ga0395898_0609028 Ga0395898_0609028_239_781 177
816 3300037466 Ga0395898_0771871 Ga0395898_0771871_260_805 177
817 3300037471 Ga0395905_0000766 Ga0395905_0000766_34722_35258 177
818 3300037471 Ga0395905_0001291 Ga0395905_0001291_9250_9786 177
819 3300037471 Ga0395905_0012118 Ga0395905_0012118_7702_8238 177
820 3300037471 Ga0395905_0014796 Ga0395905_0014796_4138_4674 177
821 3300037471 Ga0395905_0016964 Ga0395905_0016964_1970_2506 177
822 3300037471 Ga0395905_0020727 Ga0395905_0020727_5617_6153 177
823 3300037471 Ga0395905_0026748 Ga0395905_0026748_2290_2835 177
824 3300037471 Ga0395905_0068703 Ga0395905_0068703_724_1260 177
825 3300037471 Ga0395905_0092246 Ga0395905_0092246_1884_2444 177
826 3300037471 Ga0395905_0099460 Ga0395905_0099460_1854_2396 177
827 3300037471 Ga0395905_0124829 Ga0395905_0124829_1123_1659 177
828 3300037471 Ga0395905_0206586 Ga0395905_0206586_663_1199 177
829 3300037471 Ga0395905_0284423 Ga0395905_0284423_873_1412 177
830 3300037471 Ga0395905_0942309 Ga0395905_0942309_192_749 177
831 3300037853 Ga0436364_0110021 Ga0436364_0110021_74_634 177
832 3300038443 Ga0395901_0019770 Ga0395901_0019770_17_553 177
833 3300038443 Ga0395901_0058625 Ga0395901_0058625_3083_3619 177
834 3300038443 Ga0395901_0086077 Ga0395901_0086077_1012_1569 177
835 3300038443 Ga0395901_0366081 Ga0395901_0366081_142_678 177
836 3300039447 Ga0436361_0287447 Ga0436361_0287447_93628_94197 177
837 3300041408 Ga0439453_0022910 Ga0439453_0022910_425_997 177
838 3300041458 Ga0451798_0103100 Ga0451798_0103100_27_566 177
839 3300041458 Ga0451798_0705620 Ga0451798_0705620_53_598 177
840 3300041505 Ga0451849_0427330 Ga0451849_0427330_287_829 177
841 3300041997 Ga0439431_0005395 Ga0439431_0005395_1371_1913 177
842 3300042000 Ga0439437_015198 Ga0439437_015198_95_634 177
843 3300042007 Ga0439449_0013312 Ga0439449_0013312_1699_2235 177
844 3300042014 Ga0439457_011808 Ga0439457_011808_527_1063 177
845 3300042015 Ga0439462_0000705 Ga0439462_0000705_5411_5947 177
846 3300042126 Ga0450888_013593 Ga0450888_013593_364_903 177
847 3300042129 Ga0450891_001234 Ga0450891_001234_2033_2572 177
848 3300042130 Ga0450892_002535 Ga0450892_002535_760_1299 177
849 3300042137 Ga0450902_039386 Ga0450902_039386_24_563 177
850 3300042144 Ga0450889_004023 Ga0450889_004023_587_1126 177
851 3300042436 Ga0439435_0077011 Ga0439435_0077011_84_626 177
852 3300042532 Ga0450893_0005510 Ga0450893_0005510_927_1466 177
853 3300042876 Ga0451577_0053739 Ga0451577_0053739_1562_2098 177
854 3300042876 Ga0451577_0069012 Ga0451577_0069012_1630_2178 177
855 3300042876 Ga0451577_0101947 Ga0451577_0101947_1714_2250 177
856 3300042876 Ga0451577_0354764 Ga0451577_0354764_403_939 177
857 3300042876 Ga0451577_0355963 Ga0451577_0355963_129_671 177
858 3300042876 Ga0451577_0413853 Ga0451577_0413853_655_1191 177
859 3300044656 Ga0466969_0023883 Ga0466969_0023883_485_1021 177
860 3300044658 Ga0466972_0037986 Ga0466972_0037986_1078_1614 177
861 3300044673 Ga0453683_0002126 Ga0453683_0002126_9864_10403 177
862 3300044684 Ga0466966_0003258 Ga0466966_0003258_877_1413 177
863 3300044684 Ga0466966_0276151 Ga0466966_0276151_116_652 177
864 3300044693 Ga0466961_0101036 Ga0466961_0101036_133_669 177
865 3300044694 Ga0466963_0295644 Ga0466963_0295644_212_748 177
866 3300044694 Ga0466963_0312675 Ga0466963_0312675_301_840 177
867 3300044694 Ga0466963_0334919 Ga0466963_0334919_406_1053 177
868 3300044712 Ga0453684_0010561 Ga0453684_0010561_2627_3169 177
869 3300044712 Ga0453684_0039888 Ga0453684_0039888_1750_2292 177
870 3300044712 Ga0453684_0040403 Ga0453684_0040403_284_820 177
871 3300044712 Ga0453684_0196771 Ga0453684_0196771_1408_1944 177
872 3300044712 Ga0453684_0295646 Ga0453684_0295646_742_1278 177
873 3300044712 Ga0453684_0398824 Ga0453684_0398824_984_1523 177
874 3300044712 Ga0453684_0441204 Ga0453684_0441204_787_1323 177
875 3300044712 Ga0453684_0668228 Ga0453684_0668228_276_812 177
876 3300044842 Ga0466957_0062916 Ga0466957_0062916_1717_2253 177
877 3300044842 Ga0466957_0602662 Ga0466957_0602662_188_724 177
878 3300045049 Ga0466959_0024293 Ga0466959_0024293_3493_4029 177
879 3300045051 Ga0451576_0005135 Ga0451576_0005135_10538_11074 177
880 3300045051 Ga0451576_0027293 Ga0451576_0027293_4632_5177 177
881 3300045051 Ga0451576_0040243 Ga0451576_0040243_967_1503 177
882 3300045051 Ga0451576_0135333 Ga0451576_0135333_1902_2438 177
883 3300045051 Ga0451576_0326585 Ga0451576_0326585_817_1356 177
884 3300045051 Ga0451576_0357068 Ga0451576_0357068_295_963 177
885 3300045836 Ga0466958_0879166 Ga0466958_0879166_22_567 177
886 3300046507 Ga0495606_0021187 Ga0495606_0021187_665_1204 177
887 3300046528 Ga0495642_0065383 Ga0495642_0065383_48_590 177
888 3300046539 Ga0495621_0087741 Ga0495621_0087741_463_1017 177
889 3300046558 Ga0495633_0261256 Ga0495633_0261256_91_645 177
890 3300046615 Ga0495656_0026669 Ga0495656_0026669_1729_2271 177
891 3300046674 Ga0495588_0335815 Ga0495588_0335815_234_776 177
892 3300046681 Ga0495647_0146392 Ga0495647_0146392_437_991 177
893 3300046809 Ga0495600_0046717 Ga0495600_0046717_540_1079 177
894 3300047447 Ga0495685_089313 Ga0495685_089313_58_600 177
895 3300048903 Ga0496100_0252142 Ga0496100_0252142_369_923 177
896 3300048904 Ga0496101_0026022 Ga0496101_0026022_1903_2442 177
897 3300048905 Ga0496102_0041398 Ga0496102_0041398_722_1261 177
898 3300048906 Ga0496103_0082579 Ga0496103_0082579_721_1260 177
899 3300048908 Ga0496105_0138860 Ga0496105_0138860_351_905 177
900 3300048909 Ga0496106_0007016 Ga0496106_0007016_2008_2547 177
901 3300048909 Ga0496106_0622549 Ga0496106_0622549_255_803 177
902 3300048910 Ga0496107_0003667 Ga0496107_0003667_3181_3720 177
903 3300048911 Ga0496108_0100651 Ga0496108_0100651_1809_2363 177
904 3300048911 Ga0496108_0811767 Ga0496108_0811767_65_613 177
905 3300048912 Ga0496109_0688124 Ga0496109_0688124_230_784 177
906 3300048913 Ga0496110_0082466 Ga0496110_0082466_24_563 177
907 3300048913 Ga0496110_0392366 Ga0496110_0392366_173_721 177
908 3300048913 Ga0496110_0485215 Ga0496110_0485215_267_806 177
909 3300048917 Ga0496114_0040304 Ga0496114_0040304_32_580 177
910 3300048917 Ga0496114_0321718 Ga0496114_0321718_557_1096 177
911 3300048917 Ga0496114_0892279 Ga0496114_0892279_210_749 177
912 3300048918 Ga0496115_0110638 Ga0496115_0110638_792_1340 177
913 3300048929 Ga0496126_0073906 Ga0496126_0073906_92_631 177
914 3300048929 Ga0496126_0098894 Ga0496126_0098894_20_610 177
915 3300049537 Ga0501321_033060 Ga0501321_033060_20_556 177
916 3300049568 Ga0501031_0344540 Ga0501031_0344540_208_744 177
917 3300049569 Ga0501032_0042298 Ga0501032_0042298_2353_2901 177
918 3300049570 Ga0501033_0003126 Ga0501033_0003126_9237_9785 177
919 3300049571 Ga0501034_0144355 Ga0501034_0144355_382_930 177
920 3300049572 Ga0501036_0048691 Ga0501036_0048691_2015_2563 177
921 3300049572 Ga0501036_0373238 Ga0501036_0373238_249_785 177
922 3300049574 Ga0501038_0001778 Ga0501038_0001778_1680_2228 177
923 3300049574 Ga0501038_0002840 Ga0501038_0002840_702_1250 177
924 3300049574 Ga0501038_0016852 Ga0501038_0016852_763_1311 177
925 3300049575 Ga0501039_0185429 Ga0501039_0185429_751_1299 177
926 3300049579 Ga0501043_0117673 Ga0501043_0117673_1348_1896 177
927 3300049579 Ga0501043_0208325 Ga0501043_0208325_213_761 177
928 3300049580 Ga0501046_0212720 Ga0501046_0212720_464_1000 177
929 3300049581 Ga0501047_0051037 Ga0501047_0051037_1458_2006 177
930 3300049581 Ga0501047_0129991 Ga0501047_0129991_206_754 177
931 3300049581 Ga0501047_0201281 Ga0501047_0201281_393_929 177
932 3300049583 Ga0501067_0044231 Ga0501067_0044231_29_577 177
933 3300049583 Ga0501067_0126021 Ga0501067_0126021_491_1030 177
934 3300049584 Ga0501068_0087775 Ga0501068_0087775_928_1476 177
935 3300049586 Ga0501070_0020843 Ga0501070_0020843_1228_1776 177
936 3300049588 Ga0501072_0151564 Ga0501072_0151564_913_1461 177
937 3300049590 Ga0501074_0049464 Ga0501074_0049464_2078_2632 177
938 3300049653 Ga0501206_044493 Ga0501206_044493_122_661 177
939 3300049679 Ga0501249_123915 Ga0501249_123915_68_604 177
940 3300049742 Ga0501080_0012284 Ga0501080_0012284_5965_6513 177
941 3300049742 Ga0501080_0223535 Ga0501080_0223535_263_799 177
942 3300049744 Ga0501083_0020376 Ga0501083_0020376_3064_3618 177
943 3300049765 Ga0501268_009130 Ga0501268_009130_230_766 177
944 3300049822 Ga0501035_0040039 Ga0501035_0040039_436_972 177
945 3300049822 Ga0501035_0335483 Ga0501035_0335483_662_1198 177
946 3300049823 Ga0501044_0000190 Ga0501044_0000190_28758_29306 177
947 3300049823 Ga0501044_0007285 Ga0501044_0007285_3897_4445 177
948 3300049823 Ga0501044_0199944 Ga0501044_0199944_905_1441 177
949 3300049823 Ga0501044_0411221 Ga0501044_0411221_127_675 177
950 3300050489 nmdc:mga03683_404348_c1 nmdc:mga03683_404348_c1_68_607 177
951 3300050491 nmdc:mga00v17_479592_c1 nmdc:mga00v17_479592_c1_23_571 177
952 3300050492 nmdc:mga0yw44_84203_c1 nmdc:mga0yw44_84203_c1_607_1143 177
953 3300050492 nmdc:mga0yw44_89251_c1 nmdc:mga0yw44_89251_c1_754_1290 177
954 3300050493 nmdc:mga0k408_103702_c1 nmdc:mga0k408_103702_c1_971_1519 177
955 3300050493 nmdc:mga0k408_11575_c1 nmdc:mga0k408_11575_c1_4122_4661 177
956 3300050493 nmdc:mga0k408_166294_c1 nmdc:mga0k408_166294_c1_134_673 177
957 3300050493 nmdc:mga0k408_20110_c1 nmdc:mga0k408_20110_c1_2538_3077 177
958 3300050493 nmdc:mga0k408_209017_c1 nmdc:mga0k408_209017_c1_340_879 177
959 3300050493 nmdc:mga0k408_229191_c1 nmdc:mga0k408_229191_c1_529_1077 177
960 3300050493 nmdc:mga0k408_24729_c1 nmdc:mga0k408_24729_c1_942_1490 177
961 3300050493 nmdc:mga0k408_460634_c1 nmdc:mga0k408_460634_c1_114_650 177
962 3300050493 nmdc:mga0k408_485201_c1 nmdc:mga0k408_485201_c1_172_708 177
963 3300050493 nmdc:mga0k408_55388_c1 nmdc:mga0k408_55388_c1_1296_1835 177
964 3300050494 nmdc:mga06z11_203047_c1 nmdc:mga06z11_203047_c1_198_737 177
965 3300050494 nmdc:mga06z11_330043_c1 nmdc:mga06z11_330043_c1_364_900 177
966 3300050494 nmdc:mga06z11_49023_c1 nmdc:mga06z11_49023_c1_1293_1832 177
967 3300050496 nmdc:mga07m45_138780_c1 nmdc:mga07m45_138780_c1_822_1361 177
968 3300050496 nmdc:mga07m45_295207_c1 nmdc:mga07m45_295207_c1_357_896 177
969 3300050496 nmdc:mga07m45_39199_c1 nmdc:mga07m45_39199_c1_845_1384 177
970 3300050507 nmdc:mga05p37_21359_c1 nmdc:mga05p37_21359_c1_382_921 177
971 3300050508 nmdc:mga09592_1507_c1 nmdc:mga09592_1507_c1_11187_11726 177
972 3300050509 nmdc:mga0qj67_625084_c1 nmdc:mga0qj67_625084_c1_269_808 177
973 3300050510 nmdc:mga06r32_372966_c1 nmdc:mga06r32_372966_c1_20_559 177
974 3300050511 nmdc:mga08y16_275352_c1 nmdc:mga08y16_275352_c1_654_1193 177
975 3300050512 nmdc:mga0n895_862014_c1 nmdc:mga0n895_862014_c1_249_800 177
976 3300050515 nmdc:mga0a205_704416_c1 nmdc:mga0a205_704416_c1_301_840 177
977 3300053156 Ga0500622_0000875 Ga0500622_0000875_5687_6226 177
978 3300059421 Ga0590071_086766 Ga0590071_086766_155_697 177
979 3300059424 Ga0590075_039292 Ga0590075_039292_653_1189 177
980 3300059424 Ga0590075_162080 Ga0590075_162080_37_576 177
981 3300061719 Ga0466962_0140193 Ga0466962_0140193_401_937 177

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00719

Pyrophosphatase

Inorganic pyrophosphatase

18

173

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3d63-assembly1.cif.gz_C-3 crystal structure of inorganic pyrophosphatase from burkholderia pseudomallei 0.9304 4 174
4xel-assembly1.cif.gz_A crystal structure of inorganic pyrophosphatase (ppase) from pseudomonas aeruginosa 0.9296 2 174
4xel-assembly2.cif.gz_B crystal structure of inorganic pyrophosphatase (ppase) from pseudomonas aeruginosa 0.9282 2 174
4xel-assembly1.cif.gz_A crystal structure of inorganic pyrophosphatase (ppase) from pseudomonas aeruginosa 0.9193 2 174
4xel-assembly2.cif.gz_B crystal structure of inorganic pyrophosphatase (ppase) from pseudomonas aeruginosa 0.9178 2 174
ID Description Score Start End Superfamily
1i40A00 Alpha Beta;Alpha-Beta Complex;Inorganic Pyrophosphatase;Inorganic pyrophosphatase 0.9095 2 175 3.90.80.10
3q5vB00 Alpha Beta;Alpha-Beta Complex;Inorganic Pyrophosphatase;Inorganic pyrophosphatase 0.9022 3 175 3.90.80.10
1i40A00 Alpha Beta;Alpha-Beta Complex;Inorganic Pyrophosphatase;Inorganic pyrophosphatase 0.8995 2 175 3.90.80.10
af_Q4DDK6_17_177_1.25.40.20 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Ankyrin repeat-containing domain 0.8938 28 43 1.25.40.20
3emjE00 Alpha Beta;Alpha-Beta Complex;Inorganic Pyrophosphatase;Inorganic pyrophosphatase 0.8894 17 171 3.90.80.10
ID Description Score Start End GO Terms
AF-A0A3D5Q6T3-F1-model_v4 inorganic diphosphatase (EC 3.6.1.1) 0.9839 50 174 GO:0000287
GO:0004427
GO:0005737
GO:0006796
AF-A0A257JFP8-F1-model_v4 inorganic diphosphatase (EC 3.6.1.1) 0.9823 68 176 GO:0000287
GO:0004427
GO:0005737
GO:0006796
AF-A0A7R8ZVX2-F1-model_v4 inorganic diphosphatase (EC 3.6.1.1) 0.9776 55 175 GO:0000287
GO:0004427
GO:0005737
GO:0006796
AF-A0A3M6FPT4-F1-model_v4 inorganic diphosphatase (EC 3.6.1.1) 0.9746 73 174 GO:0000287
GO:0004427
GO:0005737
GO:0006796
AF-A0A1Y5ETG5-F1-model_v4 inorganic diphosphatase (EC 3.6.1.1) 0.9737 57 175 GO:0000287
GO:0004427
GO:0005737
GO:0006796

Feature Viewer

pLDDT pTM Quality
90.22 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map