F487350

General Info

Members Datasets Scaffolds Average Seq Length
979 588 769 226

Family's Representative Sequence

Representative Sequence 3300053094|Ga0500566_0003015|Ga0500566_0003015_6528_7301
Length 257
Sequence LRQVNADALILTDECKCIYLGVQLHRTAGIAAMTASLKLISHKLCPYVQRAVIALNEKGVPFERIDIDLARKPDWFLKLSPLGKVPVLVVTTEKGEVALFESNVICEYIEETQAGAKLHPVDALTRAEHRAWMEFGSAILGDLWGLETTTDPATFESKREALVAKFTRVEATLSAGPFFAGDGFSLVDAVFAPVFRYFDLFDELTELGIFRDLPKVRAWRAELAKRPSVRSAVDSNYPELLRAFLVRHDAHLLKLAA

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
5 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
6 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
7 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
8 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
9 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
10 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
11 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
12 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
13 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
14 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
15 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
16 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
17 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
18 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
19 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
20 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
21 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
22 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
23 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
24 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
25 2791355199
26 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
27 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
28 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
29 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
30 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
31 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
32 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
33 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
34 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
35 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
36 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
37 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
38 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
39 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
40 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
41 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
42 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
43 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
44 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
45 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
46 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
47 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
48 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
49 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
50 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
51 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
52 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
53 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
54 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
55 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
56 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
57 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
58 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
59 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
60 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
61 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
62 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
63 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
64 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
65 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
66 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
67 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
68 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
69 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
70 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
71 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
72 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
73 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
74 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
75 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
76 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
77 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
78 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
79 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
80 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
81 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
82 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
83 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
84 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
85 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
86 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
87 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
88 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
89 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
90 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
91 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
92 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
93 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
94 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
95 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
96 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
97 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
98 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
99 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
100 2922368715
101 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
102 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
103 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
104 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
105 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
106 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
107 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
108 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
109 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
110 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
111 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
112 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
113 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
114 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
115 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
116 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
117 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
118 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
119 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
120 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
121 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
122 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
123 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
124 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
125 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
126 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
127 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
128 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
129 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
130 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
131 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
132 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
133 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
134 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
135 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
136 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
137 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
138 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
139 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
140 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
141 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
142 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
143 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
144 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
145 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
146 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
147 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
148 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
149 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
150 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
151 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
152 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
153 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
154 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
155 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
156 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
157 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
158 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
159 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
160 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
161 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
162 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
163 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
164 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
165 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
166 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
167 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
168 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
169 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
170 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
171 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
172 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
173 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
174 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
175 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
176 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
177 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
178 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
179 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
180 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
181 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
182 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
183 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
184 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
185 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
186 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
187 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
188 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
189 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
190 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
191 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
192 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
193 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
194 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
195 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
196 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
197 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
198 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
199 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
200 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
201 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
202 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
203 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
204 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
205 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
206 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
207 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
208 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
209 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
210 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
211 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
212 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
213 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
214 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
215 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
216 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
217 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
218 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
219 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
220 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
221 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
222 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
223 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
224 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
225 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
226 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
227 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
228 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
229 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
230 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
231 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
232 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
233 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
234 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
235 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
236 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
237 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
238 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
239 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
240 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
241 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
242 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
243 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
244 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
245 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
246 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
247 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
248 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
249 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
250 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
251 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
252 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
253 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
254 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
255 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
256 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
257 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
258 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
259 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
260 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
261 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
262 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
263 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
264 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
265 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
266 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
267 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
268 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
269 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
270 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
271 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
272 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
273 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
274 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
275 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
276 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
277 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
278 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
279 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
280 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
281 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
282 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
283 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
284 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
285 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
286 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
287 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
288 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
289 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
290 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
291 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
292 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
293 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
294 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
295 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
296 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
297 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
299 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
302 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
303 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
304 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
305 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
306 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
309 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
313 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
314 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
315 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
316 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
317 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
318 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
319 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
320 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
321 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
322 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
323 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
324 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
325 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
326 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
327 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
328 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
329 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
330 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
331 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
332 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
333 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
334 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
335 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
336 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
337 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
338 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
339 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
340 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
341 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
342 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
343 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
344 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
345 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
346 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
347 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
348 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
349 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
350 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
351 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
352 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
353 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
354 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
355 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
356 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
357 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
358 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
359 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
360 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
361 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
362 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
363 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
364 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
365 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
366 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
367 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
368 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
369 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
370 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
371 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
372 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
373 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
374 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
375 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
376 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
377 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
378 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
379 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
380 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
381 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
382 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
383 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
384 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
385 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
386 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
387 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
388 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
389 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
390 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
391 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
392 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
393 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
394 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
395 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
396 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
397 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
398 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
399 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
400 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
401 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
402 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
403 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
404 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
405 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
406 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
407 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
408 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
409 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
410 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
411 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
412 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
413 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
414 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
415 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
416 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
417 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
418 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
419 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
420 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
421 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
422 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
423 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
424 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
425 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
426 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
427 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
428 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
429 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
430 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
431 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
432 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
433 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
434 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
435 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
436 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
437 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
438 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
439 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
440 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
441 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
442 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
443 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
444 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
445 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
446 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
447 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
448 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
449 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
450 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
451 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
452 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
453 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
454 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
455 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
456 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
457 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
458 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
459 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
460 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
461 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
462 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
463 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
464 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
465 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
466 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
467 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
468 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
469 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
470 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
471 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
472 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
473 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
474 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
475 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
476 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
477 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
478 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
479 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
480 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
481 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
482 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
483 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
484 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
485 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
486 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
487 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
488 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
489 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
490 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
491 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
492 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
493 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
494 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
495 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
496 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
497 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
498 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
499 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
500 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
501 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
502 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
503 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
504 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
505 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
506 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
507 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
508 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
509 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
510 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
511 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
512 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
513 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
514 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
515 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
516 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
517 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
518 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
519 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
520 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
521 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
522 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
523 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
524 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
525 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
526 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
527 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
528 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
529 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
530 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
531 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
532 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
533 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
534 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
535 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
536 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
537 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
538 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
539 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
540 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
541 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
542 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
543 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
544 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
545 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
546 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
547 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
548 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
549 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
550 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
551 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
552 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
553 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
554 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
555 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
556 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
557 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
558 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
559 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
560 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
561 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
562 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
563 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
564 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
565 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
566 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
567 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
568 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
569 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
570 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
571 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
572 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
573 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
574 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
575 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
576 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
577 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
578 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
579 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
580 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
581 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
582 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
583 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
584 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
585 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
586 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
587 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
588 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 78.71
Metatranscriptomes 0
Isolates 21.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.16
Nodule 18.49
Rhizoplane 5.31
Rhizosphere 46.27
Stem 0
Stem Tuber 0
Unclassified 12.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10000278 3300003187 Bacteria 58449
2 JGI25153J46596_10005243 3300003215 Bacteria 6820
3 JGI25153J46596_10005797 3300003215 Bacteria 6425
4 JGI25153J46596_10008097 3300003215 Bacteria 5069
5 JGI25153J46596_10031680 3300003215 Bacteria 1775
6 rootH1_10047895 3300003323 Bacteria 1362
7 JGI25160J50197_1004893 3300003354 Bacteria 5701
8 JGI25160J50197_1009460 3300003354 Bacteria 3612
9 JGI25404J52841_10017502 3300003659 Bacteria 1554
10 Ga0055539_1009369 3300003752 Bacteria 1216
11 Ga0055526_1000605 3300003771 Bacteria 27996
12 Ga0055531_10010493 3300003794 Bacteria 4594
13 Ga0055543_1008255 3300004625 Bacteria 2319
14 Ga0065165_1003559 3300005262 Bacteria 10766
15 Ga0065165_1003853 3300005262 Bacteria 9962
16 Ga0065165_1007827 3300005262 Bacteria 5143
17 Ga0065165_1042981 3300005262 Bacteria 1329
18 Ga0070658_10174148 3300005327 Bacteria 1809
19 Ga0070658_10250187 3300005327 Bacteria 1503
20 Ga0070676_10079145 3300005328 Bacteria 1990
21 Ga0070683_100212658 3300005329 Bacteria 1837
22 Ga0070670_100365130 3300005331 Bacteria 1270
23 Ga0070670_100379206 3300005331 Bacteria 1246
24 Ga0068869_100026636 3300005334 Bacteria 4025
25 Ga0068869_100067131 3300005334 Bacteria 2645
26 Ga0068869_100635811 3300005334 Bacteria 904
27 Ga0070682_100029405 3300005337 Bacteria 3308
28 Ga0070660_100506509 3300005339 Bacteria 1004
29 Ga0070660_100523613 3300005339 Bacteria 988
30 Ga0070691_10250513 3300005341 Bacteria 950
31 Ga0070687_100082853 3300005343 Bacteria 1755
32 Ga0070661_100451528 3300005344 Bacteria 1023
33 Ga0070661_100573369 3300005344 Bacteria 910
34 Ga0070668_100059536 3300005347 Bacteria 2956
35 Ga0070668_100152925 3300005347 Bacteria 1867
36 Ga0070668_100263336 3300005347 Bacteria 1434
37 Ga0070668_100434057 3300005347 Bacteria 1126
38 Ga0070669_100044424 3300005353 Bacteria 3238
39 Ga0070671_100165838 3300005355 Bacteria 1868
40 Ga0070671_100204154 3300005355 Bacteria 1676
41 Ga0070674_100001713 3300005356 Bacteria 11883
42 Ga0070673_100492665 3300005364 Bacteria 1108
43 Ga0070667_100266238 3300005367 Bacteria 1536
44 Ga0070667_100303199 3300005367 Bacteria 1439
45 Ga0070667_100402129 3300005367 Bacteria 1247
46 Ga0070667_100873454 3300005367 Bacteria 836
47 Ga0070709_10000102 3300005434 Bacteria 60511
48 Ga0070709_10654206 3300005434 Bacteria 814
49 Ga0070714_100207557 3300005435 Bacteria 1794
50 Ga0070713_100056985 3300005436 Bacteria 3251
51 Ga0070710_10026907 3300005437 Bacteria 3062
52 Ga0070711_100009189 3300005439 Bacteria 6075
53 Ga0070711_100029117 3300005439 Bacteria 3641
54 Ga0070700_100046846 3300005441 Bacteria 2673
55 Ga0070694_100038070 3300005444 Bacteria 3194
56 Ga0070663_100040534 3300005455 Bacteria 3261
57 Ga0070663_100042070 3300005455 Bacteria 3208
58 Ga0070663_100110269 3300005455 Bacteria 2067
59 Ga0070663_100128325 3300005455 Bacteria 1923
60 Ga0070663_100237786 3300005455 Bacteria 1436
61 Ga0070663_100275339 3300005455 Bacteria 1339
62 Ga0070678_100202885 3300005456 Bacteria 1638
63 Ga0070662_100316022 3300005457 Bacteria 1272
64 Ga0070662_100332339 3300005457 Bacteria 1242
65 Ga0068867_100264934 3300005459 Bacteria 1402
66 Ga0068853_100793245 3300005539 Bacteria 907
67 Ga0070672_100084279 3300005543 Bacteria 2552
68 Ga0070672_100563669 3300005543 Bacteria 990
69 Ga0070686_100164921 3300005544 Bacteria 1563
70 Ga0070695_100128497 3300005545 Bacteria 1744
71 Ga0070693_100309885 3300005547 Bacteria 1067
72 Ga0070665_100046983 3300005548 Bacteria 4333
73 Ga0070665_100074709 3300005548 Bacteria 3395
74 Ga0070665_100103128 3300005548 Bacteria 2856
75 Ga0070665_100135814 3300005548 Bacteria 2462
76 Ga0070665_100257128 3300005548 Bacteria 1747
77 Ga0070665_100421393 3300005548 Bacteria 1344
78 Ga0070665_100716609 3300005548 Bacteria 1013
79 Ga0070664_100804032 3300005564 Bacteria 879
80 Ga0068854_100152610 3300005578 Bacteria 1782
81 Ga0068856_100562442 3300005614 Bacteria 1162
82 Ga0070702_100102654 3300005615 Bacteria 1757
83 Ga0068852_100047313 3300005616 Bacteria 3669
84 Ga0068852_100155106 3300005616 Bacteria 2132
85 Ga0068852_100285594 3300005616 Bacteria 1592
86 Ga0068852_100808772 3300005616 Bacteria 952
87 Ga0068859_100286623 3300005617 Bacteria 1740
88 Ga0068859_100732241 3300005617 Bacteria 1078
89 Ga0068859_101448827 3300005617 Bacteria 758
90 Ga0068861_100074343 3300005719 Bacteria 2642
91 Ga0068861_100210520 3300005719 Bacteria 1637
92 Ga0068861_100214989 3300005719 Bacteria 1621
93 Ga0068851_10221727 3300005834 Bacteria 1063
94 Ga0068858_100259842 3300005842 Bacteria 1650
95 Ga0068858_100581314 3300005842 Bacteria 1085
96 Ga0068858_100664701 3300005842 Bacteria 1013
97 Ga0068860_100116621 3300005843 Bacteria 2555
98 Ga0068860_100340033 3300005843 Bacteria 1476
99 Ga0068862_100203900 3300005844 Bacteria 1784
100 Ga0068862_100275415 3300005844 Bacteria 1540
101 Ga0081455_10008967 3300005937 Bacteria 10335
102 Ga0081455_10025384 3300005937 Bacteria 5471
103 Ga0081455_10088923 3300005937 Bacteria 2508
104 Ga0081540_1002872 3300005983 Bacteria 13927
105 Ga0081540_1005006 3300005983 Bacteria 9958
106 Ga0081540_1011345 3300005983 Bacteria 5960
107 Ga0081540_1061218 3300005983 Bacteria 1796
108 Ga0081540_1132074 3300005983 Bacteria 1017
109 Ga0081539_10023708 3300005985 Bacteria 4010
110 Ga0070717_10131059 3300006028 Bacteria 2156
111 Ga0070717_10564707 3300006028 Bacteria 1031
112 Ga0075365_10014527 3300006038 Bacteria 4738
113 Ga0075365_10023123 3300006038 Bacteria 3905
114 Ga0075365_10071068 3300006038 Bacteria 2342
115 Ga0075365_10137634 3300006038 Bacteria 1693
116 Ga0075365_10263994 3300006038 Bacteria 1211
117 Ga0075368_10000972 3300006042 Bacteria 8938
118 Ga0075368_10071096 3300006042 Bacteria 1405
119 Ga0075363_100002023 3300006048 Bacteria 8086
120 Ga0075363_100014977 3300006048 Bacteria 3802
121 Ga0075363_100343536 3300006048 Bacteria 871
122 Ga0075364_10083184 3300006051 Bacteria 2118
123 Ga0075364_10304825 3300006051 Bacteria 1084
124 Ga0070716_100003040 3300006173 Bacteria 7828
125 Ga0070716_100111586 3300006173 Bacteria 1696
126 Ga0070716_100694222 3300006173 Bacteria 777
127 Ga0070712_100024704 3300006175 Bacteria 3986
128 Ga0070712_100159622 3300006175 Bacteria 1740
129 Ga0075362_10100576 3300006177 Bacteria 1351
130 Ga0075362_10139297 3300006177 Bacteria 1158
131 Ga0075367_10019361 3300006178 Bacteria 3772
132 Ga0075367_10128586 3300006178 Bacteria 1565
133 Ga0075369_10131273 3300006186 Bacteria 1138
134 Ga0075369_10174901 3300006186 Bacteria 987
135 Ga0075366_10015511 3300006195 Bacteria 4369
136 Ga0075366_10153166 3300006195 Bacteria 1396
137 Ga0075366_10155295 3300006195 Bacteria 1386
138 Ga0097621_100160117 3300006237 Bacteria 1934
139 Ga0097621_100229304 3300006237 Bacteria 1621
140 Ga0075370_10024437 3300006353 Bacteria 3337
141 Ga0075370_10083692 3300006353 Bacteria 1835
142 Ga0075370_10087012 3300006353 Bacteria 1800
143 Ga0075370_10107986 3300006353 Bacteria 1614
144 Ga0075370_10169096 3300006353 Bacteria 1285
145 Ga0068871_100128521 3300006358 Bacteria 2146
146 Ga0097620_100286621 3300006931 Bacteria 1740
147 Ga0097620_100732218 3300006931 Bacteria 1078
148 Ga0097620_101448530 3300006931 Bacteria 758
149 Ga0099825_1016421 3300006941 Bacteria 6377
150 Ga0099825_1043171 3300006941 Bacteria 1218
151 Ga0099824_1019706 3300006942 Bacteria 5163
152 Ga0099822_1029154 3300006943 Bacteria 4325
153 Ga0099794_10272688 3300007265 Bacteria 874
154 Ga0099795_10113316 3300007788 Bacteria 1077
155 Ga0105240_10004952 3300009093 Bacteria 20030
156 Ga0105240_11249868 3300009093 Bacteria 785
157 Ga0111539_10169993 3300009094 Bacteria 2547
158 Ga0105245_10069670 3300009098 Bacteria 3190
159 Ga0105245_10114523 3300009098 Bacteria 2512
160 Ga0105245_10139965 3300009098 Bacteria 2278
161 Ga0105245_10610653 3300009098 Bacteria 1118
162 Ga0105247_10242497 3300009101 Bacteria 1229
163 Ga0105247_10252361 3300009101 Bacteria 1206
164 Ga0105247_10270483 3300009101 Bacteria 1169
165 Ga0105243_10103573 3300009148 Bacteria 2367
166 Ga0105241_10018952 3300009174 Bacteria 5072
167 Ga0105241_10024442 3300009174 Bacteria 4486
168 Ga0105241_10045631 3300009174 Bacteria 3326
169 Ga0105241_10047038 3300009174 Bacteria 3279
170 Ga0105242_10042057 3300009176 Bacteria 3688
171 Ga0105242_10348251 3300009176 Bacteria 1368
172 Ga0105248_10234482 3300009177 Bacteria 2066
173 Ga0105248_10980101 3300009177 Bacteria 955
174 Ga0105237_10003659 3300009545 Bacteria 18128
175 Ga0105237_10004418 3300009545 Bacteria 16296
176 Ga0105237_10064248 3300009545 Bacteria 3667
177 Ga0105237_10078082 3300009545 Bacteria 3301
178 Ga0105237_10147574 3300009545 Bacteria 2347
179 Ga0105238_10250854 3300009551 Bacteria 1748
180 Ga0105238_10297162 3300009551 Bacteria 1598
181 Ga0105238_11144958 3300009551 Bacteria 801
182 Ga0105249_10339895 3300009553 Bacteria 1518
183 Ga0105249_10381946 3300009553 Bacteria 1435
184 Ga0105239_10073651 3300010375 Bacteria 3755
185 Ga0105239_10076073 3300010375 Bacteria 3692
186 Ga0105239_10135670 3300010375 Bacteria 2740
187 Ga0105239_10154360 3300010375 Bacteria 2563
188 Ga0105239_10453797 3300010375 Bacteria 1454
189 Ga0105246_10022234 3300011119 Bacteria 4091
190 Ga0105246_10170519 3300011119 Bacteria 1666
191 Ga0105246_10377482 3300011119 Bacteria 1170
192 Ga0157369_10024858 3300013105 Bacteria 6655
193 Ga0157369_11070370 3300013105 Bacteria 825
194 Ga0157374_10014207 3300013296 Bacteria 6962
195 Ga0157374_10061172 3300013296 Bacteria 3526
196 Ga0157374_11073197 3300013296 Bacteria 825
197 Ga0157378_10059393 3300013297 Bacteria 3412
198 Ga0157378_10276143 3300013297 Bacteria 1618
199 Ga0157378_10394437 3300013297 Bacteria 1362
200 Ga0163162_10035962 3300013306 Bacteria 4934
201 Ga0163162_10226476 3300013306 Bacteria 1999
202 Ga0163162_10337288 3300013306 Bacteria 1640
203 Ga0163162_10495284 3300013306 Bacteria 1353
204 Ga0157375_10011135 3300013308 Bacteria 7932
205 Ga0157375_10166248 3300013308 Bacteria 2351
206 Ga0163163_10027186 3300014325 Bacteria 5478
207 Ga0163163_10095655 3300014325 Bacteria 2990
208 Ga0163163_10538898 3300014325 Bacteria 1230
209 Ga0157380_10075045 3300014326 Bacteria 2747
210 Ga0157380_10158906 3300014326 Bacteria 1962
211 Ga0157380_10796884 3300014326 Bacteria 961
212 Ga0157380_10955184 3300014326 Bacteria 887
213 Ga0157379_10534837 3300014968 Bacteria 1089
214 Ga0157376_10070567 3300014969 Bacteria 2966
215 Ga0163161_10047673 3300017792 Bacteria 3093
216 Ga0214544_1000002 3300021320 Bacteria 753857
217 Ga0214542_1000001 3300021321 Bacteria 1018696
218 Ga0214545_1000001 3300021324 Bacteria 1092817
219 Ga0214543_1000001 3300021327 Bacteria 776921
220 Ga0213876_10000590 3300021384 Bacteria 27043
221 Ga0228711_1003229 3300022739 Bacteria 25290
222 Ga0228710_1000004 3300022740 Bacteria 250560
223 Ga0207425_1011874 3300025245 Bacteria 2061
224 Ga0209677_102879 3300025253 Bacteria 6043
225 Ga0209148_1000356 3300025254 Bacteria 58774
226 Ga0209148_1015210 3300025254 Bacteria 1348
227 Ga0209233_1005573 3300025261 Bacteria 4163
228 Ga0209233_1008736 3300025261 Bacteria 3114
229 Ga0209455_1004417 3300025272 Bacteria 4612
230 Ga0209455_1005739 3300025272 Bacteria 3778
231 Ga0209564_1011789 3300025295 Bacteria 3881
232 Ga0209564_1017513 3300025295 Bacteria 2787
233 Ga0209758_1000021 3300025297 Bacteria 697691
234 Ga0209758_1001565 3300025297 Bacteria 26240
235 Ga0209758_1001632 3300025297 Bacteria 25487
236 Ga0209758_1002055 3300025297 Bacteria 21535
237 Ga0209758_1003008 3300025297 Bacteria 16134
238 Ga0209758_1015860 3300025297 Bacteria 3871
239 Ga0209758_1028573 3300025297 Bacteria 2354
240 Ga0209758_1045447 3300025297 Bacteria 1594
241 Ga0209256_1013051 3300025299 Bacteria 3114
242 Ga0209256_1022670 3300025299 Bacteria 1894
243 Ga0209256_1022793 3300025299 Bacteria 1887
244 Ga0207426_1000960 3300025302 Bacteria 28422
245 Ga0207426_1004043 3300025302 Bacteria 7425
246 Ga0207426_1007501 3300025302 Bacteria 4555
247 Ga0207426_1024468 3300025302 Bacteria 2048
248 Ga0209257_1002332 3300025304 Bacteria 19132
249 Ga0209257_1032448 3300025304 Bacteria 1656
250 Ga0207656_10208313 3300025321 Bacteria 947
251 Ga0207692_10008486 3300025898 Bacteria 4251
252 Ga0207642_10256676 3300025899 Bacteria 995
253 Ga0207710_10287778 3300025900 Bacteria 828
254 Ga0207688_10031868 3300025901 Bacteria 2911
255 Ga0207688_10043194 3300025901 Bacteria 2510
256 Ga0207647_10022152 3300025904 Bacteria 4225
257 Ga0207647_10149602 3300025904 Bacteria 1365
258 Ga0207699_10000329 3300025906 Bacteria 25152
259 Ga0207645_10048851 3300025907 Bacteria 2702
260 Ga0207645_10201527 3300025907 Bacteria 1309
261 Ga0207643_10317974 3300025908 Bacteria 971
262 Ga0207654_10056558 3300025911 Bacteria 2276
263 Ga0207695_10000015 3300025913 Bacteria 803205
264 Ga0207671_10010345 3300025914 Bacteria 7706
265 Ga0207671_10113903 3300025914 Bacteria 2061
266 Ga0207671_10144130 3300025914 Bacteria 1837
267 Ga0207671_10420896 3300025914 Bacteria 1063
268 Ga0207693_10087845 3300025915 Bacteria 2436
269 Ga0207693_10229820 3300025915 Bacteria 1457
270 Ga0207663_10017254 3300025916 Bacteria 4019
271 Ga0207663_10321100 3300025916 Bacteria 1163
272 Ga0207662_10423627 3300025918 Bacteria 906
273 Ga0207657_10337021 3300025919 Bacteria 1191
274 Ga0207649_10316226 3300025920 Bacteria 1146
275 Ga0207649_10387824 3300025920 Bacteria 1042
276 Ga0207681_10701796 3300025923 Bacteria 841
277 Ga0207694_10091648 3300025924 Bacteria 2399
278 Ga0207687_10099546 3300025927 Bacteria 2136
279 Ga0207687_10103306 3300025927 Bacteria 2101
280 Ga0207687_10116470 3300025927 Bacteria 1992
281 Ga0207687_10212053 3300025927 Bacteria 1520
282 Ga0207700_10020197 3300025928 Bacteria 4518
283 Ga0207644_10061199 3300025931 Bacteria 2726
284 Ga0207644_10287633 3300025931 Bacteria 1321
285 Ga0207644_10345386 3300025931 Bacteria 1207
286 Ga0207706_10101612 3300025933 Bacteria 2530
287 Ga0207706_10143456 3300025933 Bacteria 2101
288 Ga0207706_10163203 3300025933 Bacteria 1958
289 Ga0207706_10329927 3300025933 Bacteria 1327
290 Ga0207686_10043601 3300025934 Bacteria 2750
291 Ga0207686_10354374 3300025934 Bacteria 1106
292 Ga0207686_10486743 3300025934 Bacteria 955
293 Ga0207709_10136741 3300025935 Bacteria 1679
294 Ga0207709_10185173 3300025935 Bacteria 1474
295 Ga0207709_10255823 3300025935 Bacteria 1281
296 Ga0207670_10279572 3300025936 Bacteria 1300
297 Ga0207665_10004009 3300025939 Bacteria 9833
298 Ga0207665_10039461 3300025939 Bacteria 3148
299 Ga0207691_10052421 3300025940 Bacteria 3726
300 Ga0207711_10041966 3300025941 Bacteria 3897
301 Ga0207711_10230972 3300025941 Bacteria 1694
302 Ga0207711_10285699 3300025941 Bacteria 1520
303 Ga0207689_10052058 3300025942 Bacteria 3374
304 Ga0207689_10136561 3300025942 Bacteria 2019
305 Ga0207689_10159937 3300025942 Bacteria 1856
306 Ga0207661_10119932 3300025944 Bacteria 2238
307 Ga0207667_10174714 3300025949 Bacteria 2207
308 Ga0207651_10521729 3300025960 Bacteria 1029
309 Ga0207712_10658888 3300025961 Bacteria 910
310 Ga0207668_10166829 3300025972 Bacteria 1722
311 Ga0207668_10191918 3300025972 Bacteria 1619
312 Ga0207640_10067463 3300025981 Bacteria 2394
313 Ga0207658_10581945 3300025986 Bacteria 1004
314 Ga0207658_10806321 3300025986 Bacteria 852
315 Ga0207677_10065885 3300026023 Bacteria 2529
316 Ga0207677_10899292 3300026023 Bacteria 798
317 Ga0207703_10039172 3300026035 Bacteria 3786
318 Ga0207703_10437452 3300026035 Bacteria 1220
319 Ga0207639_10057045 3300026041 Bacteria 2996
320 Ga0207678_10015879 3300026067 Bacteria 6617
321 Ga0207678_10062562 3300026067 Bacteria 3198
322 Ga0207678_10068817 3300026067 Bacteria 3036
323 Ga0207678_10077951 3300026067 Bacteria 2838
324 Ga0207678_10139110 3300026067 Bacteria 2072
325 Ga0207678_10321909 3300026067 Bacteria 1331
326 Ga0207678_10724308 3300026067 Bacteria 876
327 Ga0207708_10050499 3300026075 Bacteria 3166
328 Ga0207708_10064734 3300026075 Bacteria 2794
329 Ga0207702_10202301 3300026078 Bacteria 1842
330 Ga0207702_10493109 3300026078 Bacteria 1193
331 Ga0207641_10733977 3300026088 Bacteria 974
332 Ga0207648_10030521 3300026089 Bacteria 4773
333 Ga0207674_10160467 3300026116 Bacteria 2203
334 Ga0207675_100069860 3300026118 Bacteria 3282
335 Ga0207675_100093583 3300026118 Bacteria 2827
336 Ga0207675_100148299 3300026118 Bacteria 2232
337 Ga0207683_10093890 3300026121 Bacteria 2673
338 Ga0207683_10145027 3300026121 Bacteria 2140
339 Ga0207683_10207962 3300026121 Bacteria 1780
340 Ga0207683_10434435 3300026121 Bacteria 1210
341 Ga0207698_10097902 3300026142 Bacteria 2422
342 Ga0207698_10436478 3300026142 Bacteria 1260
343 Ga0209281_1000134 3300027111 Bacteria 185406
344 Ga0209389_1000008 3300027296 Bacteria 227385
345 Ga0209389_1000121 3300027296 Bacteria 70490
346 Ga0209589_1000003 3300027357 Bacteria 629130
347 Ga0209589_1002735 3300027357 Bacteria 30739
348 Ga0209489_100003 3300027361 Bacteria 663105
349 Ga0209489_103445 3300027361 Bacteria 30849
350 Ga0209489_108921 3300027361 Bacteria 13078
351 Ga0209700_100003 3300027363 Bacteria 663105
352 Ga0209700_100036 3300027363 Bacteria 187888
353 Ga0209282_1000013 3300027666 Bacteria 215053
354 Ga0209588_1029785 3300027671 Bacteria 1742
355 Ga0209813_10091017 3300027866 Bacteria 1024
356 Ga0268266_10000908 3300028379 Bacteria 38174
357 Ga0268266_10009000 3300028379 Bacteria 8832
358 Ga0268266_10032518 3300028379 Bacteria 4431
359 Ga0268266_10033096 3300028379 Bacteria 4396
360 Ga0268266_10078718 3300028379 Bacteria 2869
361 Ga0268266_10099482 3300028379 Bacteria 2560
362 Ga0268266_10174667 3300028379 Bacteria 1952
363 Ga0268266_10187397 3300028379 Bacteria 1887
364 Ga0268266_10303361 3300028379 Bacteria 1490
365 Ga0268266_10653334 3300028379 Bacteria 1012
366 Ga0268265_10141246 3300028380 Bacteria 2016
367 Ga0268265_10206115 3300028380 Bacteria 1709
368 Ga0268265_10213706 3300028380 Bacteria 1682
369 Ga0268265_10426736 3300028380 Bacteria 1232
370 Ga0268264_10000043 3300028381 Bacteria 371761
371 Ga0268264_10149549 3300028381 Bacteria 2092
372 Ga0268264_10835063 3300028381 Bacteria 922
373 Ga0268264_10873584 3300028381 Bacteria 901
374 Ga0265319_1024030 3300028563 Bacteria 2199
375 Ga0265323_10004720 3300028653 Bacteria 5844
376 Ga0307517_10000063 3300028786 Bacteria 144304
377 Ga0307515_10013876 3300028794 Bacteria 15001
378 Ga0307515_10215146 3300028794 Bacteria 1755
379 Ga0265338_10001398 3300028800 Bacteria 39299
380 Ga0265324_10016959 3300029957 Bacteria 2650
381 Ga0307511_10068966 3300030521 Bacteria 2605
382 Ga0307511_10075720 3300030521 Bacteria 2413
383 Ga0307513_10082231 3300031456 Bacteria 3316
384 Ga0307513_10232558 3300031456 Bacteria 1655
385 Ga0307509_10031401 3300031507 Bacteria 5864
386 Ga0307509_10145300 3300031507 Bacteria 2299
387 Ga0307509_10288881 3300031507 Bacteria 1395
388 Ga0307408_100488337 3300031548 Bacteria 1076
389 Ga0307516_10302379 3300031730 Bacteria 1275
390 Ga0307516_10514972 3300031730 Bacteria 850
391 Ga0307405_10299991 3300031731 Bacteria 1218
392 Ga0307413_10259937 3300031824 Bacteria 1294
393 Ga0307410_10689975 3300031852 Bacteria 860
394 Ga0307407_10352498 3300031903 Bacteria 1043
395 Ga0307412_10428883 3300031911 Bacteria 1083
396 Ga0315914_1000004 3300031967 Bacteria 288534
397 Ga0307409_100169629 3300031995 Bacteria 1919
398 Ga0307416_100284364 3300032002 Bacteria 1633
399 Ga0307414_11130445 3300032004 Bacteria 724
400 Ga0307411_10474580 3300032005 Bacteria 1052
401 Ga0307415_100297207 3300032126 Bacteria 1336
402 Ga0307507_10019203 3300033179 Bacteria 7710
403 Ga0307510_10005974 3300033180 Bacteria 14526
404 Ga0307510_10019835 3300033180 Bacteria 7874
405 Ga0307510_10285894 3300033180 Bacteria 1117
406 Ga0315913_1008800 3300033430 Bacteria 11917
407 Ga0315915_1000003 3300033464 Bacteria 407996
408 Ga0373945_0173799 3300035116 Bacteria 884
409 Ga0373943_0284368 3300035170 Bacteria 936
410 Ga0373927_0006201 3300035695 Bacteria 8163
411 Ga0373927_0054257 3300035695 Bacteria 2592
412 Ga0373947_0021215 3300035725 Bacteria 3759
413 Ga0373925_0020789 3300037068 Bacteria 4783
414 Ga0373925_0704691 3300037068 Bacteria 832
415 Ga0395900_0000361 3300037418 Bacteria 65918
416 Ga0395898_0038458 3300037466 Bacteria 4742
417 Ga0395898_0050887 3300037466 Bacteria 4053
418 Ga0395898_0115091 3300037466 Bacteria 2577
419 Ga0395905_0055572 3300037471 Bacteria 3705
420 Ga0395905_0245607 3300037471 Bacteria 1672
421 Ga0395905_0377766 3300037471 Bacteria 1311
422 Ga0395905_0877896 3300037471 Bacteria 800
423 Ga0395901_0070830 3300038443 Bacteria 3633
424 Ga0395901_0382326 3300038443 Bacteria 1449
425 Ga0436365_0209497 3300039437 Bacteria 14782
426 Ga0436365_1453814 3300039437 Bacteria 2108
427 Ga0436362_0782107 3300039453 Bacteria 2230
428 Ga0439465_0015219 3300041413 Bacteria 2400
429 Ga0451797_1357528 3300041453 Bacteria 874
430 Ga0451802_0191972 3300041460 Bacteria 1011
431 Ga0451802_0584264 3300041460 Bacteria 1004
432 Ga0451841_0902031 3300041498 Bacteria 766
433 Ga0451853_3426594 3300041512 Bacteria 1063
434 Ga0439458_0031327 3300042157 Bacteria 1268
435 Ga0466969_0018178 3300044656 Bacteria 3666
436 Ga0466972_0000271 3300044658 Bacteria 32697
437 Ga0466972_0021219 3300044658 Bacteria 3240
438 Ga0466972_0093909 3300044658 Bacteria 1422
439 Ga0466965_0424863 3300044683 Bacteria 737
440 Ga0466966_0001434 3300044684 Bacteria 15335
441 Ga0466966_0124745 3300044684 Bacteria 1580
442 Ga0466961_0000859 3300044693 Bacteria 18957
443 Ga0466964_0048807 3300044706 Bacteria 1732
444 Ga0453684_1055278 3300044712 Unclassified 861
445 Ga0466968_0018014 3300044735 Bacteria 2830
446 Ga0466970_0113648 3300044765 Bacteria 1480
447 Ga0466960_0276883 3300044901 Bacteria 939
448 Ga0466959_0015708 3300045049 Bacteria 5522
449 Ga0466967_0088482 3300045976 Bacteria 2810
450 Ga0466967_0370143 3300045976 Bacteria 1390
451 Ga0466967_0853109 3300045976 Bacteria 905
452 Ga0495617_009692 3300046452 Bacteria 3304
453 Ga0495617_139095 3300046452 Bacteria 776
454 Ga0495603_0170219 3300046455 Bacteria 1262
455 Ga0495603_0170358 3300046455 Bacteria 1261
456 Ga0495629_0006058 3300046459 Bacteria 8987
457 Ga0495629_0068528 3300046459 Bacteria 2476
458 Ga0495638_0047037 3300046460 Bacteria 2707
459 Ga0495638_0077244 3300046460 Bacteria 2027
460 Ga0495638_0141814 3300046460 Bacteria 1402
461 Ga0495651_0023553 3300046462 Bacteria 4787
462 Ga0495651_0147262 3300046462 Bacteria 1701
463 Ga0495653_0123207 3300046463 Bacteria 1844
464 Ga0495605_0072621 3300046474 Bacteria 1622
465 Ga0495605_0077924 3300046474 Bacteria 1554
466 Ga0495605_0130868 3300046474 Bacteria 1132
467 Ga0495639_0114942 3300046475 Bacteria 1280
468 Ga0495664_0048612 3300046477 Bacteria 2518
469 Ga0495664_0260384 3300046477 Bacteria 1049
470 Ga0495585_0033152 3300046492 Bacteria 2925
471 Ga0495585_0152662 3300046492 Bacteria 1203
472 Ga0495596_0037101 3300046500 Bacteria 1929
473 Ga0495607_0144477 3300046501 Bacteria 1224
474 Ga0495606_0102707 3300046507 Bacteria 1738
475 Ga0495606_0246227 3300046507 Bacteria 994
476 Ga0495608_0025762 3300046511 Bacteria 4014
477 Ga0495610_0187129 3300046512 Bacteria 857
478 Ga0495616_0046141 3300046513 Bacteria 2201
479 Ga0495616_0250067 3300046513 Bacteria 762
480 Ga0495618_0145573 3300046514 Bacteria 1515
481 Ga0495632_0048901 3300046519 Bacteria 2092
482 Ga0495632_0095839 3300046519 Bacteria 1402
483 Ga0495637_0121822 3300046520 Bacteria 1003
484 Ga0495643_0033392 3300046522 Bacteria 2847
485 Ga0495644_0067655 3300046523 Bacteria 1342
486 Ga0495648_0000843 3300046524 Bacteria 32321
487 Ga0495648_0094327 3300046524 Bacteria 1667
488 Ga0495648_0111938 3300046524 Bacteria 1484
489 Ga0495648_0113433 3300046524 Bacteria 1470
490 Ga0495642_0170212 3300046528 Bacteria 946
491 Ga0495652_0064466 3300046529 Bacteria 3081
492 Ga0495652_0087385 3300046529 Bacteria 2557
493 Ga0495652_0369328 3300046529 Bacteria 1023
494 Ga0495640_0096285 3300046533 Bacteria 1947
495 Ga0495640_0413112 3300046533 Bacteria 827
496 Ga0495587_0075077 3300046536 Bacteria 1963
497 Ga0495598_0028200 3300046537 Bacteria 1556
498 Ga0495621_0072072 3300046539 Bacteria 1274
499 Ga0495622_0025954 3300046557 Bacteria 2738
500 Ga0495622_0075161 3300046557 Bacteria 1557
501 Ga0495667_0089972 3300046559 Bacteria 1989
502 Ga0495656_0001311 3300046615 Bacteria 8098
503 Ga0495656_0228296 3300046615 Bacteria 933
504 Ga0495668_0301924 3300046616 Bacteria 878
505 Ga0495611_0085530 3300046648 Bacteria 1454
506 Ga0495611_0253731 3300046648 Bacteria 815
507 Ga0495625_0073563 3300046660 Bacteria 2395
508 Ga0495625_0100361 3300046660 Bacteria 1990
509 Ga0495625_0334838 3300046660 Bacteria 960
510 Ga0495635_0001593 3300046663 Bacteria 15272
511 Ga0495635_0091840 3300046663 Bacteria 2076
512 Ga0495659_0017086 3300046664 Bacteria 2400
513 Ga0495659_0116826 3300046664 Bacteria 1046
514 Ga0495661_0088308 3300046665 Bacteria 1770
515 Ga0495588_0074488 3300046674 Bacteria 1768
516 Ga0495588_0083574 3300046674 Bacteria 1668
517 Ga0495657_0045658 3300046675 Bacteria 2972
518 Ga0495647_0042142 3300046681 Bacteria 1742
519 Ga0495669_0022386 3300046684 Bacteria 2745
520 Ga0495669_0035016 3300046684 Bacteria 2215
521 Ga0495613_0060571 3300046689 Bacteria 2772
522 Ga0495624_0275643 3300046690 Bacteria 1016
523 Ga0495670_0036497 3300046691 Bacteria 2449
524 Ga0495671_0104647 3300046692 Bacteria 1382
525 Ga0495671_0211314 3300046692 Bacteria 940
526 Ga0495671_0265633 3300046692 Bacteria 827
527 Ga0495649_0130376 3300046694 Bacteria 1327
528 Ga0495600_0004863 3300046809 Bacteria 8069
529 Ga0495600_0015068 3300046809 Bacteria 4882
530 Ga0495600_0141931 3300046809 Bacteria 1558
531 Ga0495581_0186913 3300047315 Bacteria 1212
532 Ga0495604_0005473 3300047317 Bacteria 10070
533 Ga0495604_0040701 3300047317 Bacteria 3647
534 Ga0495604_0100607 3300047317 Bacteria 2125
535 Ga0495636_0062444 3300047318 Bacteria 1577
536 Ga0495674_0199322 3300047319 Bacteria 1661
537 Ga0495672_0005697 3300047320 Bacteria 9812
538 Ga0495672_0245691 3300047320 Bacteria 871
539 Ga0495676_0284684 3300047321 Bacteria 1118
540 Ga0495680_0057579 3300047322 Bacteria 3005
541 Ga0495680_0216518 3300047322 Bacteria 1369
542 Ga0495683_0122159 3300047323 Bacteria 1235
543 Ga0495683_0159000 3300047323 Bacteria 1046
544 Ga0495687_007099 3300047443 Bacteria 6683
545 Ga0495687_085658 3300047443 Bacteria 1221
546 Ga0495675_0022053 3300047444 Bacteria 4059
547 Ga0495677_0065757 3300047445 Bacteria 1348
548 Ga0495677_0070179 3300047445 Bacteria 1305
549 Ga0495685_101177 3300047447 Bacteria 952
550 Ga0495685_111153 3300047447 Bacteria 902
551 Ga0495673_0047442 3300047469 Bacteria 1898
552 Ga0495673_0056692 3300047469 Bacteria 1694
553 Ga0495673_0204983 3300047469 Bacteria 736
554 Ga0495686_0118038 3300047472 Bacteria 1584
555 Ga0495686_0220685 3300047472 Bacteria 1078
556 Ga0495686_0410340 3300047472 Bacteria 725
557 Ga0495602_0020088 3300048088 Bacteria 6607
558 Ga0495602_0110584 3300048088 Bacteria 2233
559 Ga0496100_0009036 3300048903 Bacteria 5583
560 Ga0496100_0317519 3300048903 Bacteria 1169
561 Ga0496100_0352566 3300048903 Bacteria 1112
562 Ga0496101_0008367 3300048904 Bacteria 6759
563 Ga0496101_0634424 3300048904 Bacteria 844
564 Ga0496102_0011800 3300048905 Bacteria 7540
565 Ga0496102_0026386 3300048905 Bacteria 5181
566 Ga0496102_0182582 3300048905 Bacteria 1977
567 Ga0496102_0592509 3300048905 Bacteria 1031
568 Ga0496102_0925225 3300048905 Bacteria 793
569 Ga0496103_0007167 3300048906 Bacteria 6650
570 Ga0496103_0523966 3300048906 Bacteria 757
571 Ga0496104_0022729 3300048907 Bacteria 5760
572 Ga0496104_0055696 3300048907 Bacteria 3739
573 Ga0496104_0162263 3300048907 Bacteria 2144
574 Ga0496104_0210964 3300048907 Bacteria 1853
575 Ga0496105_0000723 3300048908 Bacteria 22379
576 Ga0496105_0006361 3300048908 Bacteria 9071
577 Ga0496106_0000363 3300048909 Bacteria 32218
578 Ga0496106_0064377 3300048909 Bacteria 2789
579 Ga0496106_0567817 3300048909 Bacteria 910
580 Ga0496107_0016788 3300048910 Bacteria 5147
581 Ga0496107_0037819 3300048910 Bacteria 3464
582 Ga0496108_0009868 3300048911 Bacteria 7738
583 Ga0496108_0287976 3300048911 Bacteria 1430
584 Ga0496108_0429984 3300048911 Bacteria 1153
585 Ga0496108_0662974 3300048911 Bacteria 906
586 Ga0496109_0026435 3300048912 Bacteria 5176
587 Ga0496109_0073803 3300048912 Bacteria 3135
588 Ga0496109_0620853 3300048912 Bacteria 1017
589 Ga0496110_0086926 3300048913 Bacteria 2792
590 Ga0496110_0192439 3300048913 Bacteria 1852
591 Ga0496110_0221007 3300048913 Bacteria 1722
592 Ga0496110_0603917 3300048913 Bacteria 995
593 Ga0496110_0668297 3300048913 Bacteria 939
594 Ga0496111_0133918 3300048914 Bacteria 1835
595 Ga0496111_0210557 3300048914 Bacteria 1444
596 Ga0496111_0280041 3300048914 Bacteria 1237
597 Ga0496111_0345397 3300048914 Bacteria 1102
598 Ga0496112_0102082 3300048915 Bacteria 2838
599 Ga0496112_0323210 3300048915 Bacteria 1487
600 Ga0496113_0033172 3300048916 Bacteria 3757
601 Ga0496113_0048396 3300048916 Bacteria 3163
602 Ga0496113_0234569 3300048916 Bacteria 1463
603 Ga0496114_0019293 3300048917 Bacteria 5524
604 Ga0496114_0766262 3300048917 Bacteria 843
605 Ga0496115_0036614 3300048918 Bacteria 3886
606 Ga0496115_0064723 3300048918 Bacteria 2952
607 Ga0496115_0131838 3300048918 Bacteria 2060
608 Ga0496116_0015358 3300048919 Bacteria 6056
609 Ga0496117_0016367 3300048920 Bacteria 6261
610 Ga0496117_0020767 3300048920 Bacteria 5344
611 Ga0496117_0034263 3300048920 Bacteria 3828
612 Ga0496117_0090222 3300048920 Bacteria 1976
613 Ga0496118_0002080 3300048921 Bacteria 28152
614 Ga0496118_0033023 3300048921 Bacteria 4254
615 Ga0496118_0043275 3300048921 Bacteria 3542
616 Ga0496118_0048827 3300048921 Bacteria 3264
617 Ga0496118_0105709 3300048921 Bacteria 1886
618 Ga0496118_0109986 3300048921 Bacteria 1832
619 Ga0496118_0221324 3300048921 Bacteria 1101
620 Ga0496119_0015145 3300048922 Bacteria 5967
621 Ga0496119_0032219 3300048922 Bacteria 3497
622 Ga0496119_0100577 3300048922 Bacteria 1624
623 Ga0496119_0294714 3300048922 Bacteria 802
624 Ga0496120_0008406 3300048923 Bacteria 7493
625 Ga0496120_0036935 3300048923 Bacteria 2903
626 Ga0496121_0000183 3300048924 Bacteria 139168
627 Ga0496121_0007107 3300048924 Bacteria 13589
628 Ga0496121_0024365 3300048924 Bacteria 5789
629 Ga0496121_0038244 3300048924 Bacteria 4253
630 Ga0496121_0061806 3300048924 Bacteria 3071
631 Ga0496121_0087662 3300048924 Bacteria 2442
632 Ga0496121_0099299 3300048924 Bacteria 2250
633 Ga0496121_0222490 3300048924 Bacteria 1328
634 Ga0496121_0314308 3300048924 Bacteria 1057
635 Ga0496121_0375012 3300048924 Bacteria 940
636 Ga0496121_0382050 3300048924 Bacteria 928
637 Ga0496123_0338035 3300048926 Bacteria 705
638 Ga0496124_0026062 3300048927 Bacteria 5278
639 Ga0496124_0195816 3300048927 Bacteria 1542
640 Ga0496124_0506427 3300048927 Bacteria 808
641 Ga0496125_0000090 3300048928 Bacteria 214433
642 Ga0496125_0019582 3300048928 Bacteria 6377
643 Ga0496125_0047601 3300048928 Bacteria 3583
644 Ga0496125_0059056 3300048928 Bacteria 3093
645 Ga0496125_0087590 3300048928 Bacteria 2351
646 Ga0496125_0172478 3300048928 Bacteria 1452
647 Ga0496125_0246208 3300048928 Bacteria 1131
648 Ga0496126_0045449 3300048929 Bacteria 4035
649 Ga0496126_0062658 3300048929 Bacteria 3336
650 Ga0496126_0081062 3300048929 Bacteria 2870
651 Ga0496126_0114192 3300048929 Bacteria 2350
652 Ga0496126_0123558 3300048929 Bacteria 2242
653 Ga0496126_0152522 3300048929 Bacteria 1979
654 Ga0496126_0170172 3300048929 Bacteria 1856
655 Ga0496126_0184874 3300048929 Bacteria 1768
656 Ga0496126_0304248 3300048929 Bacteria 1314
657 Ga0496126_0442013 3300048929 Bacteria 1048
658 Ga0496126_0531191 3300048929 Bacteria 936
659 Ga0495682_0068584 3300049460 Bacteria 1277
660 Ga0501038_0307108 3300049574 Bacteria 1244
661 Ga0501039_0267350 3300049575 Bacteria 1344
662 Ga0501040_0741099 3300049576 Bacteria 711
663 Ga0501067_0021765 3300049583 Bacteria 3548
664 Ga0501067_0089918 3300049583 Bacteria 1704
665 nmdc:mga03683_183575_c1 3300050489 Bacteria 955
666 nmdc:mga03683_93737_c1 3300050489 Bacteria 1312
667 nmdc:mga03n38_174_c1 3300050490 Bacteria 14331
668 nmdc:mga03n38_226172_c1 3300050490 Bacteria 979
669 nmdc:mga03n38_256737_c1 3300050490 Bacteria 925
670 nmdc:mga03n38_286272_c1 3300050490 Bacteria 881
671 nmdc:mga00v17_105852_c1 3300050491 Bacteria 1295
672 nmdc:mga00v17_293482_c1 3300050491 Bacteria 1056
673 nmdc:mga00v17_438108_c1 3300050491 Bacteria 849
674 nmdc:mga00v17_80354_c1 3300050491 Bacteria 2035
675 nmdc:mga0yw44_16646_c1 3300050492 Bacteria 3978
676 nmdc:mga0yw44_19416_c1 3300050492 Bacteria 3748
677 nmdc:mga0yw44_44915_c1 3300050492 Bacteria 2646
678 nmdc:mga0yw44_53355_c1 3300050492 Bacteria 2455
679 nmdc:mga0yw44_551229_c1 3300050492 Bacteria 783
680 nmdc:mga0yw44_73926_c1 3300050492 Bacteria 2122
681 nmdc:mga0k408_113894_c1 3300050493 Bacteria 1599
682 nmdc:mga0k408_328552_c1 3300050493 Bacteria 912
683 nmdc:mga0k408_359424_c1 3300050493 Bacteria 868
684 nmdc:mga0k408_74779_c1 3300050493 Bacteria 1979
685 nmdc:mga06z11_118701_c1 3300050494 Bacteria 1473
686 nmdc:mga06z11_41493_c1 3300050494 Bacteria 2303
687 nmdc:mga06z11_5916_c1 3300050494 Bacteria 4942
688 nmdc:mga04h51_284552_c1 3300050495 Bacteria 670
689 nmdc:mga04h51_86619_c1 3300050495 Bacteria 1121
690 nmdc:mga07m45_9126_c2 3300050496 Bacteria 2735
691 nmdc:mga08y16_71990_c1 3300050511 Bacteria 3602
692 nmdc:mga0n895_261398_c1 3300050512 Bacteria 1756
693 nmdc:mga0rr50_771815_c1 3300050513 Bacteria 820
694 nmdc:mga0sz30_171887_c1 3300050516 Bacteria 961
695 nmdc:mga0sz30_233711_c1 3300050516 Bacteria 818
696 nmdc:mga0sz30_63444_c1 3300050516 Bacteria 1582
697 nmdc:mga0sz30_78228_c1 3300050516 Bacteria 1429
698 nmdc:mga0sz30_79771_c1 3300050516 Bacteria 1416
699 Ga0500635_0038891 3300053080 Bacteria 1580
700 Ga0500635_0271464 3300053080 Bacteria 667
701 Ga0495595_0353233 3300053084 Bacteria 742
702 Ga0500578_0282845 3300053086 Bacteria 989
703 Ga0500643_000015 3300053087 Bacteria 310312
704 Ga0500646_0120665 3300053090 Bacteria 843
705 Ga0500583_0053930 3300053092 Bacteria 1876
706 Ga0500651_0001806 3300053093 Bacteria 10963
707 Ga0500651_0087602 3300053093 Bacteria 1921
708 Ga0500566_0003015 3300053094 Bacteria 10070
709 Ga0500566_0213999 3300053094 Bacteria 963
710 Ga0500641_0017094 3300053096 Bacteria 2707
711 Ga0500641_0021736 3300053096 Bacteria 2450
712 Ga0500641_0035827 3300053096 Bacteria 1982
713 Ga0500556_0011155 3300053104 Bacteria 2655
714 Ga0500556_0044136 3300053104 Bacteria 1585
715 Ga0500556_0135455 3300053104 Bacteria 967
716 Ga0500557_000110 3300053105 Bacteria 23691
717 Ga0500562_002903 3300053108 Bacteria 4277
718 Ga0500562_006666 3300053108 Bacteria 2910
719 Ga0500569_097153 3300053109 Bacteria 961
720 Ga0500572_052954 3300053111 Bacteria 1214
721 Ga0500594_0052474 3300053118 Bacteria 1153
722 Ga0500595_011235 3300053119 Bacteria 3516
723 Ga0500595_017141 3300053119 Bacteria 2681
724 Ga0500595_020446 3300053119 Bacteria 2383
725 Ga0500595_025886 3300053119 Bacteria 2027
726 Ga0500595_034134 3300053119 Bacteria 1684
727 Ga0500626_081337 3300053128 Bacteria 1432
728 Ga0500642_0000086 3300053130 Bacteria 48427
729 Ga0500642_0198181 3300053130 Bacteria 935
730 Ga0500655_045904 3300053133 Bacteria 863
731 Ga0500658_0048609 3300053134 Bacteria 1725
732 Ga0500658_0095156 3300053134 Bacteria 1293
733 Ga0500559_0000381 3300053136 Bacteria 32402
734 Ga0500559_0005470 3300053136 Bacteria 5839
735 Ga0500559_0007575 3300053136 Bacteria 4798
736 Ga0500559_0044493 3300053136 Bacteria 1942
737 Ga0500564_200983 3300053138 Bacteria 819
738 Ga0500573_0106251 3300053140 Bacteria 1575
739 Ga0500577_0015553 3300053142 Bacteria 2379
740 Ga0500577_0041762 3300053142 Bacteria 1675
741 Ga0500588_0029208 3300053146 Bacteria 1571
742 Ga0500589_113169 3300053147 Bacteria 1161
743 Ga0500590_018545 3300053148 Bacteria 3601
744 Ga0500590_077322 3300053148 Bacteria 1642
745 Ga0500590_181490 3300053148 Bacteria 913
746 Ga0500604_0032156 3300053151 Bacteria 1544
747 Ga0500616_0000283 3300053153 Bacteria 74456
748 Ga0500616_0084020 3300053153 Bacteria 1593
749 Ga0500622_0002760 3300053156 Bacteria 12359
750 Ga0500622_0133100 3300053156 Bacteria 1193
751 Ga0500622_0141948 3300053156 Bacteria 1144
752 Ga0500633_0087101 3300053160 Bacteria 1137
753 Ga0500638_021213 3300053162 Bacteria 3067
754 Ga0500638_193647 3300053162 Bacteria 866
755 Ga0500638_211385 3300053162 Bacteria 812
756 Ga0500636_0000151 3300053177 Bacteria 35998
757 Ga0500636_0072873 3300053177 Bacteria 1989
758 Ga0500636_0077419 3300053177 Bacteria 1921
759 Ga0500636_0095242 3300053177 Bacteria 1699
760 Ga0500636_0107018 3300053177 Bacteria 1584
761 Ga0500636_0228166 3300053177 Bacteria 965
762 Ga0500570_083564 3300053724 Bacteria 1425
763 Ga0500625_000186 3300053729 Bacteria 13797
764 Ga0500609_019023 3300053731 Bacteria 936
765 Ga0500596_002002 3300053735 Bacteria 4074
766 Ga0500601_000153 3300053737 Bacteria 14318
767 Ga0500661_012907 3300055283 Bacteria 1506
768 Ga0466962_0167061 3300061719 Bacteria 1071
769 Ga0530510_0071208 3300061734 Bacteria 2524

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041498 Ga0451841_0902031 Ga0451841_0902031_10_606 197
2 iso_pu_bacteria 2935959822 2935966381 205
3 3300025920 Ga0207649_10316226 Ga0207649_103162261 206
4 iso_pu_bacteria 8019538911 8019544781 208
5 3300046512 Ga0495610_0187129 Ga0495610_0187129_215_847 209
6 3300047323 Ga0495683_0159000 Ga0495683_0159000_40_672 209
7 3300047469 Ga0495673_0204983 Ga0495673_0204983_82_714 209
8 3300048906 Ga0496103_0523966 Ga0496103_0523966_107_739 209
9 3300048922 Ga0496119_0294714 Ga0496119_0294714_17_649 209
10 3300048926 Ga0496123_0338035 Ga0496123_0338035_55_687 209
11 3300053080 Ga0500635_0271464 Ga0500635_0271464_15_647 209
12 3300053084 Ga0495595_0353233 Ga0495595_0353233_65_700 209
13 3300053148 Ga0500590_181490 Ga0500590_181490_269_901 209
14 3300046529 Ga0495652_0369328 Ga0495652_0369328_15_647 210
15 3300050492 nmdc:mga0yw44_551229_c1 nmdc:mga0yw44_551229_c1_139_771 210
16 3300050495 nmdc:mga04h51_284552_c1 nmdc:mga04h51_284552_c1_16_648 210
17 3300044712 Ga0453684_1055278 Ga0453684_1055278_45_689 212
18 3300050490 nmdc:mga03n38_226172_c1 nmdc:mga03n38_226172_c1_14_655 213
19 3300041413 Ga0439465_0015219 Ga0439465_0015219_11_670 219
20 iso_pu_bacteria 8016583857 8016591901 219
21 3300005548 Ga0070665_100135814 Ga0070665_1001358144 220
22 3300007788 Ga0099795_10113316 Ga0099795_101133162 220
23 3300053153 Ga0500616_0000283 Ga0500616_0000283_71823_72497 220
24 iso_pu_bacteria 2507262055 2507508686 220
25 iso_pu_bacteria 2508501009 2508542780 220
26 iso_pu_bacteria 2508501042 2508691459 220
27 iso_pu_bacteria 2508501128 2509150404 220
28 iso_pu_bacteria 2511231028 2511400297 220
29 iso_pu_bacteria 2513237094 2513639076 220
30 iso_pu_bacteria 2513237095 2513645954 220
31 iso_pu_bacteria 2513237102 2513700160 220
32 iso_pu_bacteria 2513237104 2513719552 220
33 iso_pu_bacteria 2513237139 2513872674 220
34 iso_pu_bacteria 2517093001 2517101336 220
35 iso_pu_bacteria 2524023205 2524440466 220
36 iso_pu_bacteria 2528768022 2528851201 220
37 iso_pu_bacteria 2744054633 2745075265 220
38 iso_pu_bacteria 2791355196 2793062503 220
39 iso_pu_bacteria 2802429603 2805915428 220
40 iso_pu_bacteria 2816332527 2818241005 220
41 iso_pu_bacteria 2824600985 2824603473 220
42 iso_pu_bacteria 2824609381 2824614752 220
43 iso_pu_bacteria 2824617872 2824626090 220
44 iso_pu_bacteria 2824626560 2824634421 220
45 iso_pu_bacteria 2824635225 2824642087 220
46 iso_pu_bacteria 2824644064 2824652217 220
47 iso_pu_bacteria 2824653114 2824654743 220
48 iso_pu_bacteria 2824661429 2824667437 220
49 iso_pu_bacteria 2824671348 2824675809 220
50 iso_pu_bacteria 2824679649 2824686282 220
51 iso_pu_bacteria 2824687955 2824693123 220
52 iso_pu_bacteria 2824696289 2824701991 220
53 iso_pu_bacteria 2824704595 2824711998 220
54 iso_pu_bacteria 2824714736 2824722882 220
55 iso_pu_bacteria 2824723954 2824732176 220
56 iso_pu_bacteria 2824746037 2824751583 220
57 iso_pu_bacteria 2824753945 2824756888 220
58 iso_pu_bacteria 2824763712 2824767481 220
59 iso_pu_bacteria 2838122688 2838123852 220
60 iso_pu_bacteria 2841941048 2841944021 220
61 iso_pu_bacteria 2841949485 2841949951 220
62 iso_pu_bacteria 2841957949 2841958570 220
63 iso_pu_bacteria 2841966195 2841966370 220
64 iso_pu_bacteria 2841974524 2841975103 220
65 iso_pu_bacteria 2841983080 2841983325 220
66 iso_pu_bacteria 2842038055 2842039169 220
67 iso_pu_bacteria 2842045827 2842047884 220
68 iso_pu_bacteria 2844315083 2844318994 220
69 iso_pu_bacteria 2847930680 2847936115 220
70 iso_pu_bacteria 2847939898 2847946467 220
71 iso_pu_bacteria 2849076700 2849079414 220
72 iso_pu_bacteria 2857509624 2857514420 220
73 iso_pu_bacteria 2874590934 2874593421 220
74 iso_pu_bacteria 2874612657 2874615212 220
75 iso_pu_bacteria 2874620515 2874627206 220
76 iso_pu_bacteria 2874628541 2874633304 220
77 iso_pu_bacteria 2874645413 2874648975 220
78 iso_pu_bacteria 2876761206 2876767071 220
79 iso_pu_bacteria 2876771140 2876773162 220
80 iso_pu_bacteria 2876818435 2876822052 220
81 iso_pu_bacteria 2879074833 2879077207 220
82 iso_pu_bacteria 2879083081 2879090094 220
83 iso_pu_bacteria 2879099564 2879103252 220
84 iso_pu_bacteria 2879127579 2879130024 220
85 iso_pu_bacteria 2879142872 2879147059 220
86 iso_pu_bacteria 2881364244 2881367033 220
87 iso_pu_bacteria 2881665667 2881671078 220
88 iso_pu_bacteria 2885366525 2885370570 220
89 iso_pu_bacteria 2888378607 2888383948 220
90 iso_pu_bacteria 2888388044 2888393906 220
91 iso_pu_bacteria 2888419890 2888424372 220
92 iso_pu_bacteria 2903727486 2903729082 220
93 iso_pu_bacteria 2904666416 2904671274 220
94 iso_pu_bacteria 2904711408 2904714507 220
95 iso_pu_bacteria 2906602504 2906610127 220
96 iso_pu_bacteria 2906626472 2906628574 220
97 iso_pu_bacteria 2906643746 2906650485 220
98 iso_pu_bacteria 2922368715 2922374273 220
99 iso_pu_bacteria 2922393267 2922396413 220
100 iso_pu_bacteria 2929615660 2929617950 220
101 iso_pu_bacteria 2929624759 2929627631 220
102 iso_pu_bacteria 2932784394 2932788271 220
103 iso_pu_bacteria 2932794094 2932797587 220
104 iso_pu_bacteria 2932801729 2932802904 220
105 iso_pu_bacteria 2932809354 2932810583 220
106 iso_pu_bacteria 2932818245 2932821273 220
107 iso_pu_bacteria 2932828146 2932831266 220
108 iso_pu_bacteria 2933577622 2933579879 220
109 iso_pu_bacteria 2935608549 2935608787 220
110 iso_pu_bacteria 2935616580 2935622941 220
111 iso_pu_bacteria 2935638405 2935642299 220
112 iso_pu_bacteria 2935648319 2935649942 220
113 iso_pu_bacteria 2935656913 2935661906 220
114 iso_pu_bacteria 2935665750 2935668397 220
115 iso_pu_bacteria 2935675223 2935680530 220
116 iso_pu_bacteria 2935684952 2935692798 220
117 iso_pu_bacteria 2935694250 2935700968 220
118 iso_pu_bacteria 2935703347 2935706255 220
119 iso_pu_bacteria 2935713505 2935721477 220
120 iso_pu_bacteria 2935722832 2935730395 220
121 iso_pu_bacteria 2935732158 2935740408 220
122 iso_pu_bacteria 2935741537 2935749672 220
123 iso_pu_bacteria 2935750917 2935759015 220
124 iso_pu_bacteria 2935760218 2935762653 220
125 iso_pu_bacteria 2935777560 2935778445 220
126 iso_pu_bacteria 2935801545 2935803252 220
127 iso_pu_bacteria 2935810662 2935814572 220
128 iso_pu_bacteria 2935819856 2935821948 220
129 iso_pu_bacteria 2935827899 2935831710 220
130 iso_pu_bacteria 2935837841 2935838578 220
131 iso_pu_bacteria 2935847175 2935847530 220
132 iso_pu_bacteria 2935855204 2935861189 220
133 iso_pu_bacteria 2935864058 2935865727 220
134 iso_pu_bacteria 2935873716 2935878228 220
135 iso_pu_bacteria 2935883170 2935885244 220
136 iso_pu_bacteria 2935984226 2935988274 220
137 iso_pu_bacteria 2935992306 2935994539 220
138 iso_pu_bacteria 2936002035 2936007662 220
139 iso_pu_bacteria 2936011229 2936012575 220
140 iso_pu_bacteria 2936019824 2936021139 220
141 iso_pu_bacteria 2936028420 2936029868 220
142 iso_pu_bacteria 2936037263 2936040129 220
143 iso_pu_bacteria 2936046547 2936047333 220
144 iso_pu_bacteria 2936055302 2936057509 220
145 iso_pu_bacteria 2940556831 2940564980 220
146 iso_pu_bacteria 2941531003 2941532645 220
147 iso_pu_bacteria 2941538514 2941538754 220
148 iso_pu_bacteria 3005483717 3005487250 220
149 iso_pu_bacteria 3005506211 3005510233 220
150 iso_pu_bacteria 3005587118 3005591038 220
151 iso_pu_bacteria 3005718088 3005722226 220
152 iso_pu_bacteria 8006926726 8006929990 220
153 iso_pu_bacteria 8016511872 8016513322 220
154 iso_pu_bacteria 8016522445 8016529712 220
155 iso_pu_bacteria 8016539877 8016548141 220
156 iso_pu_bacteria 8016548790 8016553981 220
157 iso_pu_bacteria 8016557553 8016562357 220
158 iso_pu_bacteria 8016566248 8016573276 220
159 iso_pu_bacteria 8016575299 8016577416 220
160 iso_pu_bacteria 8016595262 8016600162 220
161 iso_pu_bacteria 8016603502 8016610590 220
162 iso_pu_bacteria 8016613128 8016614340 220
163 iso_pu_bacteria 8017057580 8017063107 220
164 iso_pu_bacteria 8019530166 8019534693 220
165 iso_pu_bacteria 8019576017 8019582543 220
166 iso_pu_bacteria 8019586578 8019590327 220
167 iso_pu_bacteria 8019597564 8019601021 220
168 iso_pu_bacteria 8019629233 8019634571 220
169 iso_pu_bacteria 8019648815 8019658288 220
170 iso_pu_bacteria 8055742211 8055746460 220
171 iso_pu_bacteria 8056967851 8056967935 220
172 3300013297 Ga0157378_10059393 Ga0157378_100593934 221
173 iso_pu_bacteria 2876808645 2876809876 221
174 iso_pu_bacteria 2879110137 2879113590 221
175 iso_pu_bacteria 2885409591 2885412151 221
176 iso_pu_bacteria 2922386360 2922390881 221
177 iso_pu_bacteria 8006984368 8006987150 221
178 iso_pu_bacteria 2513237101 2513692419 222
179 iso_pu_bacteria 2721755755 2723845193 222
180 iso_pu_bacteria 2791355199 2793080886 222
181 iso_pu_bacteria 2824732956 2824738618 222
182 iso_pu_bacteria 2874604998 2874605093 222
183 iso_pu_bacteria 2889033259 2889039942 222
184 iso_pu_bacteria 2908775508 2908780082 222
185 iso_pu_bacteria 2922361189 2922365258 222
186 iso_pu_bacteria 3005594810 3005599137 222
187 iso_pu_bacteria 8006964411 8006965633 222
188 iso_pu_bacteria 8006994254 8006998836 222
189 iso_pu_bacteria 8056673599 8056673967 222
190 3300003215 JGI25153J46596_10005797 JGI25153J46596_100057973 223
191 3300003215 JGI25153J46596_10008097 JGI25153J46596_100080974 223
192 3300003215 JGI25153J46596_10031680 JGI25153J46596_100316802 223
193 3300003323 rootH1_10047895 rootH1_100478952 223
194 3300003354 JGI25160J50197_1004893 JGI25160J50197_10048935 223
195 3300003354 JGI25160J50197_1009460 JGI25160J50197_10094603 223
196 3300003752 Ga0055539_1009369 Ga0055539_10093692 223
197 3300003794 Ga0055531_10010493 Ga0055531_100104933 223
198 3300004625 Ga0055543_1008255 Ga0055543_10082552 223
199 3300005262 Ga0065165_1003559 Ga0065165_10035595 223
200 3300005262 Ga0065165_1003853 Ga0065165_10038536 223
201 3300005262 Ga0065165_1007827 Ga0065165_10078272 223
202 3300005262 Ga0065165_1042981 Ga0065165_10429812 223
203 3300005327 Ga0070658_10250187 Ga0070658_102501871 223
204 3300005331 Ga0070670_100379206 Ga0070670_1003792062 223
205 3300005337 Ga0070682_100029405 Ga0070682_1000294055 223
206 3300005355 Ga0070671_100204154 Ga0070671_1002041542 223
207 3300005367 Ga0070667_100402129 Ga0070667_1004021292 223
208 3300005434 Ga0070709_10000102 Ga0070709_1000010239 223
209 3300005434 Ga0070709_10654206 Ga0070709_106542061 223
210 3300005435 Ga0070714_100207557 Ga0070714_1002075572 223
211 3300005436 Ga0070713_100056985 Ga0070713_1000569853 223
212 3300005437 Ga0070710_10026907 Ga0070710_100269072 223
213 3300005439 Ga0070711_100009189 Ga0070711_1000091893 223
214 3300005439 Ga0070711_100029117 Ga0070711_1000291173 223
215 3300005455 Ga0070663_100042070 Ga0070663_1000420702 223
216 3300005455 Ga0070663_100237786 Ga0070663_1002377862 223
217 3300005456 Ga0070678_100202885 Ga0070678_1002028852 223
218 3300005457 Ga0070662_100316022 Ga0070662_1003160222 223
219 3300005539 Ga0068853_100793245 Ga0068853_1007932451 223
220 3300005543 Ga0070672_100563669 Ga0070672_1005636692 223
221 3300005547 Ga0070693_100309885 Ga0070693_1003098852 223
222 3300005548 Ga0070665_100046983 Ga0070665_1000469834 223
223 3300005548 Ga0070665_100257128 Ga0070665_1002571282 223
224 3300005548 Ga0070665_100421393 Ga0070665_1004213931 223
225 3300005578 Ga0068854_100152610 Ga0068854_1001526103 223
226 3300005614 Ga0068856_100562442 Ga0068856_1005624421 223
227 3300005616 Ga0068852_100047313 Ga0068852_1000473133 223
228 3300005616 Ga0068852_100155106 Ga0068852_1001551062 223
229 3300005616 Ga0068852_100808772 Ga0068852_1008087722 223
230 3300005617 Ga0068859_100286623 Ga0068859_1002866232 223
231 3300005842 Ga0068858_100664701 Ga0068858_1006647011 223
232 3300006028 Ga0070717_10131059 Ga0070717_101310592 223
233 3300006028 Ga0070717_10564707 Ga0070717_105647072 223
234 3300006038 Ga0075365_10071068 Ga0075365_100710684 223
235 3300006042 Ga0075368_10000972 Ga0075368_100009728 223
236 3300006048 Ga0075363_100014977 Ga0075363_1000149773 223
237 3300006051 Ga0075364_10083184 Ga0075364_100831844 223
238 3300006173 Ga0070716_100003040 Ga0070716_1000030405 223
239 3300006173 Ga0070716_100111586 Ga0070716_1001115862 223
240 3300006173 Ga0070716_100694222 Ga0070716_1006942221 223
241 3300006175 Ga0070712_100024704 Ga0070712_1000247043 223
242 3300006178 Ga0075367_10128586 Ga0075367_101285862 223
243 3300006186 Ga0075369_10131273 Ga0075369_101312732 223
244 3300006186 Ga0075369_10174901 Ga0075369_101749012 223
245 3300006195 Ga0075366_10015511 Ga0075366_100155114 223
246 3300006237 Ga0097621_100160117 Ga0097621_1001601172 223
247 3300006353 Ga0075370_10024437 Ga0075370_100244373 223
248 3300006353 Ga0075370_10087012 Ga0075370_100870121 223
249 3300006353 Ga0075370_10169096 Ga0075370_101690963 223
250 3300006931 Ga0097620_100286621 Ga0097620_1002866212 223
251 3300006941 Ga0099825_1016421 Ga0099825_10164216 223
252 3300006941 Ga0099825_1043171 Ga0099825_10431711 223
253 3300006942 Ga0099824_1019706 Ga0099824_10197065 223
254 3300006943 Ga0099822_1029154 Ga0099822_10291543 223
255 3300007265 Ga0099794_10272688 Ga0099794_102726882 223
256 3300009093 Ga0105240_10004952 Ga0105240_100049529 223
257 3300009093 Ga0105240_11249868 Ga0105240_112498681 223
258 3300009098 Ga0105245_10114523 Ga0105245_101145232 223
259 3300009101 Ga0105247_10242497 Ga0105247_102424972 223
260 3300009174 Ga0105241_10018952 Ga0105241_100189526 223
261 3300009174 Ga0105241_10024442 Ga0105241_100244427 223
262 3300009174 Ga0105241_10047038 Ga0105241_100470384 223
263 3300009545 Ga0105237_10003659 Ga0105237_1000365910 223
264 3300009545 Ga0105237_10004418 Ga0105237_100044189 223
265 3300009545 Ga0105237_10078082 Ga0105237_100780822 223
266 3300009551 Ga0105238_10297162 Ga0105238_102971622 223
267 3300009553 Ga0105249_10381946 Ga0105249_103819462 223
268 3300010375 Ga0105239_10073651 Ga0105239_100736513 223
269 3300010375 Ga0105239_10135670 Ga0105239_101356703 223
270 3300010375 Ga0105239_10453797 Ga0105239_104537972 223
271 3300013296 Ga0157374_10061172 Ga0157374_100611724 223
272 3300013296 Ga0157374_11073197 Ga0157374_110731972 223
273 3300013306 Ga0163162_10035962 Ga0163162_100359622 223
274 3300013306 Ga0163162_10337288 Ga0163162_103372882 223
275 3300014968 Ga0157379_10534837 Ga0157379_105348372 223
276 3300021320 Ga0214544_1000002 Ga0214544_1000002527 223
277 3300021321 Ga0214542_1000001 Ga0214542_1000001877 223
278 3300021324 Ga0214545_1000001 Ga0214545_1000001943 223
279 3300021327 Ga0214543_1000001 Ga0214543_1000001250 223
280 3300021384 Ga0213876_10000590 Ga0213876_100005905 223
281 3300025245 Ga0207425_1011874 Ga0207425_10118743 223
282 3300025253 Ga0209677_102879 Ga0209677_1028797 223
283 3300025254 Ga0209148_1000356 Ga0209148_100035619 223
284 3300025254 Ga0209148_1015210 Ga0209148_10152102 223
285 3300025261 Ga0209233_1005573 Ga0209233_10055732 223
286 3300025261 Ga0209233_1008736 Ga0209233_10087364 223
287 3300025272 Ga0209455_1004417 Ga0209455_10044173 223
288 3300025272 Ga0209455_1005739 Ga0209455_10057391 223
289 3300025295 Ga0209564_1011789 Ga0209564_10117894 223
290 3300025295 Ga0209564_1017513 Ga0209564_10175132 223
291 3300025297 Ga0209758_1000021 Ga0209758_1000021603 223
292 3300025297 Ga0209758_1001565 Ga0209758_100156513 223
293 3300025297 Ga0209758_1001632 Ga0209758_10016326 223
294 3300025297 Ga0209758_1002055 Ga0209758_10020557 223
295 3300025297 Ga0209758_1003008 Ga0209758_10030084 223
296 3300025297 Ga0209758_1028573 Ga0209758_10285732 223
297 3300025297 Ga0209758_1045447 Ga0209758_10454473 223
298 3300025299 Ga0209256_1013051 Ga0209256_10130513 223
299 3300025299 Ga0209256_1022670 Ga0209256_10226702 223
300 3300025299 Ga0209256_1022793 Ga0209256_10227933 223
301 3300025302 Ga0207426_1000960 Ga0207426_100096017 223
302 3300025302 Ga0207426_1004043 Ga0207426_10040434 223
303 3300025302 Ga0207426_1007501 Ga0207426_10075015 223
304 3300025302 Ga0207426_1024468 Ga0207426_10244682 223
305 3300025304 Ga0209257_1002332 Ga0209257_10023327 223
306 3300025304 Ga0209257_1032448 Ga0209257_10324482 223
307 3300025898 Ga0207692_10008486 Ga0207692_100084865 223
308 3300025900 Ga0207710_10287778 Ga0207710_102877782 223
309 3300025904 Ga0207647_10022152 Ga0207647_100221522 223
310 3300025904 Ga0207647_10149602 Ga0207647_101496022 223
311 3300025906 Ga0207699_10000329 Ga0207699_100003299 223
312 3300025911 Ga0207654_10056558 Ga0207654_100565582 223
313 3300025913 Ga0207695_10000015 Ga0207695_10000015196 223
314 3300025914 Ga0207671_10010345 Ga0207671_100103454 223
315 3300025914 Ga0207671_10113903 Ga0207671_101139032 223
316 3300025914 Ga0207671_10420896 Ga0207671_104208962 223
317 3300025915 Ga0207693_10229820 Ga0207693_102298202 223
318 3300025916 Ga0207663_10017254 Ga0207663_100172542 223
319 3300025916 Ga0207663_10321100 Ga0207663_103211002 223
320 3300025927 Ga0207687_10103306 Ga0207687_101033063 223
321 3300025928 Ga0207700_10020197 Ga0207700_100201973 223
322 3300025931 Ga0207644_10287633 Ga0207644_102876332 223
323 3300025935 Ga0207709_10185173 Ga0207709_101851732 223
324 3300025939 Ga0207665_10004009 Ga0207665_100040095 223
325 3300025939 Ga0207665_10039461 Ga0207665_100394613 223
326 3300025941 Ga0207711_10041966 Ga0207711_100419664 223
327 3300025961 Ga0207712_10658888 Ga0207712_106588881 223
328 3300025986 Ga0207658_10581945 Ga0207658_105819451 223
329 3300026067 Ga0207678_10068817 Ga0207678_100688174 223
330 3300026067 Ga0207678_10321909 Ga0207678_103219092 223
331 3300026078 Ga0207702_10202301 Ga0207702_102023012 223
332 3300026078 Ga0207702_10493109 Ga0207702_104931093 223
333 3300026121 Ga0207683_10207962 Ga0207683_102079622 223
334 3300026142 Ga0207698_10097902 Ga0207698_100979022 223
335 3300027296 Ga0209389_1000008 Ga0209389_1000008228 223
336 3300027296 Ga0209389_1000121 Ga0209389_100012154 223
337 3300027357 Ga0209589_1000003 Ga0209589_1000003487 223
338 3300027357 Ga0209589_1002735 Ga0209589_10027355 223
339 3300027361 Ga0209489_100003 Ga0209489_100003538 223
340 3300027361 Ga0209489_103445 Ga0209489_1034455 223
341 3300027361 Ga0209489_108921 Ga0209489_1089219 223
342 3300027363 Ga0209700_100003 Ga0209700_100003538 223
343 3300027363 Ga0209700_100036 Ga0209700_100036115 223
344 3300027671 Ga0209588_1029785 Ga0209588_10297852 223
345 3300028379 Ga0268266_10033096 Ga0268266_100330963 223
346 3300028379 Ga0268266_10099482 Ga0268266_100994823 223
347 3300028381 Ga0268264_10000043 Ga0268264_1000004393 223
348 3300028381 Ga0268264_10835063 Ga0268264_108350631 223
349 3300028563 Ga0265319_1024030 Ga0265319_10240302 223
350 3300028653 Ga0265323_10004720 Ga0265323_100047203 223
351 3300028800 Ga0265338_10001398 Ga0265338_1000139839 223
352 3300029957 Ga0265324_10016959 Ga0265324_100169593 223
353 3300030521 Ga0307511_10068966 Ga0307511_100689662 223
354 3300030521 Ga0307511_10075720 Ga0307511_100757202 223
355 3300031507 Ga0307509_10031401 Ga0307509_100314014 223
356 3300031507 Ga0307509_10288881 Ga0307509_102888811 223
357 3300031548 Ga0307408_100488337 Ga0307408_1004883372 223
358 3300031730 Ga0307516_10302379 Ga0307516_103023792 223
359 3300031824 Ga0307413_10259937 Ga0307413_102599372 223
360 3300033179 Ga0307507_10019203 Ga0307507_100192035 223
361 3300033180 Ga0307510_10285894 Ga0307510_102858942 223
362 3300035116 Ga0373945_0173799 Ga0373945_0173799_30_704 223
363 3300035170 Ga0373943_0284368 Ga0373943_0284368_79_756 223
364 3300035695 Ga0373927_0006201 Ga0373927_0006201_5562_6239 223
365 3300035695 Ga0373927_0054257 Ga0373927_0054257_37_714 223
366 3300035725 Ga0373947_0021215 Ga0373947_0021215_2027_2704 223
367 3300037068 Ga0373925_0020789 Ga0373925_0020789_138_815 223
368 3300037068 Ga0373925_0704691 Ga0373925_0704691_119_796 223
369 3300037418 Ga0395900_0000361 Ga0395900_0000361_24853_25530 223
370 3300037466 Ga0395898_0038458 Ga0395898_0038458_2347_3024 223
371 3300037466 Ga0395898_0050887 Ga0395898_0050887_1556_2233 223
372 3300037466 Ga0395898_0115091 Ga0395898_0115091_1510_2187 223
373 3300037471 Ga0395905_0055572 Ga0395905_0055572_2861_3538 223
374 3300037471 Ga0395905_0245607 Ga0395905_0245607_330_1007 223
375 3300037471 Ga0395905_0377766 Ga0395905_0377766_562_1239 223
376 3300038443 Ga0395901_0070830 Ga0395901_0070830_909_1586 223
377 3300038443 Ga0395901_0382326 Ga0395901_0382326_170_847 223
378 3300039437 Ga0436365_0209497 Ga0436365_0209497_4773_5450 223
379 3300039437 Ga0436365_1453814 Ga0436365_1453814_292_969 223
380 3300039453 Ga0436362_0782107 Ga0436362_0782107_261_938 223
381 3300041460 Ga0451802_0191972 Ga0451802_0191972_171_881 223
382 3300041512 Ga0451853_3426594 Ga0451853_3426594_40_750 223
383 3300044656 Ga0466969_0018178 Ga0466969_0018178_2591_3268 223
384 3300044658 Ga0466972_0000271 Ga0466972_0000271_25895_26605 223
385 3300044658 Ga0466972_0021219 Ga0466972_0021219_789_1466 223
386 3300044658 Ga0466972_0093909 Ga0466972_0093909_324_1001 223
387 3300044683 Ga0466965_0424863 Ga0466965_0424863_31_708 223
388 3300044684 Ga0466966_0001434 Ga0466966_0001434_6634_7311 223
389 3300044684 Ga0466966_0124745 Ga0466966_0124745_785_1462 223
390 3300044693 Ga0466961_0000859 Ga0466961_0000859_17388_18065 223
391 3300044706 Ga0466964_0048807 Ga0466964_0048807_341_1018 223
392 3300044735 Ga0466968_0018014 Ga0466968_0018014_831_1508 223
393 3300044765 Ga0466970_0113648 Ga0466970_0113648_91_768 223
394 3300044901 Ga0466960_0276883 Ga0466960_0276883_68_745 223
395 3300045049 Ga0466959_0015708 Ga0466959_0015708_3039_3716 223
396 3300045976 Ga0466967_0088482 Ga0466967_0088482_2119_2796 223
397 3300045976 Ga0466967_0370143 Ga0466967_0370143_518_1225 223
398 3300045976 Ga0466967_0853109 Ga0466967_0853109_152_829 223
399 3300046459 Ga0495629_0006058 Ga0495629_0006058_2773_3450 223
400 3300046460 Ga0495638_0047037 Ga0495638_0047037_1908_2618 223
401 3300046462 Ga0495651_0023553 Ga0495651_0023553_1699_2433 223
402 3300046462 Ga0495651_0147262 Ga0495651_0147262_797_1474 223
403 3300046463 Ga0495653_0123207 Ga0495653_0123207_792_1469 223
404 3300046474 Ga0495605_0072621 Ga0495605_0072621_458_1168 223
405 3300046477 Ga0495664_0048612 Ga0495664_0048612_587_1321 223
406 3300046500 Ga0495596_0037101 Ga0495596_0037101_308_985 223
407 3300046501 Ga0495607_0144477 Ga0495607_0144477_442_1152 223
408 3300046507 Ga0495606_0246227 Ga0495606_0246227_218_928 223
409 3300046511 Ga0495608_0025762 Ga0495608_0025762_1216_1950 223
410 3300046514 Ga0495618_0145573 Ga0495618_0145573_756_1433 223
411 3300046519 Ga0495632_0095839 Ga0495632_0095839_526_1203 223
412 3300046522 Ga0495643_0033392 Ga0495643_0033392_1451_2161 223
413 3300046524 Ga0495648_0000843 Ga0495648_0000843_23183_23860 223
414 3300046524 Ga0495648_0094327 Ga0495648_0094327_914_1591 223
415 3300046524 Ga0495648_0111938 Ga0495648_0111938_635_1345 223
416 3300046524 Ga0495648_0113433 Ga0495648_0113433_32_742 223
417 3300046529 Ga0495652_0064466 Ga0495652_0064466_965_1642 223
418 3300046529 Ga0495652_0087385 Ga0495652_0087385_185_919 223
419 3300046533 Ga0495640_0096285 Ga0495640_0096285_1006_1740 223
420 3300046533 Ga0495640_0413112 Ga0495640_0413112_81_758 223
421 3300046536 Ga0495587_0075077 Ga0495587_0075077_98_832 223
422 3300046557 Ga0495622_0025954 Ga0495622_0025954_1086_1763 223
423 3300046557 Ga0495622_0075161 Ga0495622_0075161_789_1466 223
424 3300046559 Ga0495667_0089972 Ga0495667_0089972_126_860 223
425 3300046648 Ga0495611_0253731 Ga0495611_0253731_13_690 223
426 3300046663 Ga0495635_0001593 Ga0495635_0001593_5606_6283 223
427 3300046663 Ga0495635_0091840 Ga0495635_0091840_1100_1834 223
428 3300046665 Ga0495661_0088308 Ga0495661_0088308_972_1649 223
429 3300046674 Ga0495588_0074488 Ga0495588_0074488_994_1704 223
430 3300046674 Ga0495588_0083574 Ga0495588_0083574_76_753 223
431 3300046675 Ga0495657_0045658 Ga0495657_0045658_1868_2602 223
432 3300046689 Ga0495613_0060571 Ga0495613_0060571_2053_2730 223
433 3300046690 Ga0495624_0275643 Ga0495624_0275643_68_778 223
434 3300046809 Ga0495600_0004863 Ga0495600_0004863_4888_5565 223
435 3300046809 Ga0495600_0015068 Ga0495600_0015068_2560_3294 223
436 3300047317 Ga0495604_0005473 Ga0495604_0005473_6474_7151 223
437 3300047317 Ga0495604_0040701 Ga0495604_0040701_992_1726 223
438 3300047317 Ga0495604_0100607 Ga0495604_0100607_133_810 223
439 3300047319 Ga0495674_0199322 Ga0495674_0199322_869_1600 223
440 3300047322 Ga0495680_0057579 Ga0495680_0057579_208_942 223
441 3300047443 Ga0495687_007099 Ga0495687_007099_5955_6665 223
442 3300047443 Ga0495687_085658 Ga0495687_085658_365_1072 223
443 3300047444 Ga0495675_0022053 Ga0495675_0022053_1304_2038 223
444 3300047445 Ga0495677_0070179 Ga0495677_0070179_237_911 223
445 3300047469 Ga0495673_0047442 Ga0495673_0047442_1164_1841 223
446 3300047472 Ga0495686_0118038 Ga0495686_0118038_423_1133 223
447 3300048088 Ga0495602_0020088 Ga0495602_0020088_1031_1765 223
448 3300048088 Ga0495602_0110584 Ga0495602_0110584_413_1090 223
449 3300048903 Ga0496100_0317519 Ga0496100_0317519_48_725 223
450 3300048905 Ga0496102_0011800 Ga0496102_0011800_347_1078 223
451 3300048905 Ga0496102_0182582 Ga0496102_0182582_388_1065 223
452 3300048907 Ga0496104_0022729 Ga0496104_0022729_4917_5594 223
453 3300048907 Ga0496104_0055696 Ga0496104_0055696_2498_3208 223
454 3300048907 Ga0496104_0210964 Ga0496104_0210964_362_1072 223
455 3300048908 Ga0496105_0000723 Ga0496105_0000723_693_1370 223
456 3300048909 Ga0496106_0000363 Ga0496106_0000363_940_1617 223
457 3300048910 Ga0496107_0037819 Ga0496107_0037819_1225_1935 223
458 3300048911 Ga0496108_0429984 Ga0496108_0429984_381_1091 223
459 3300048912 Ga0496109_0073803 Ga0496109_0073803_2445_3122 223
460 3300048912 Ga0496109_0620853 Ga0496109_0620853_36_746 223
461 3300048913 Ga0496110_0086926 Ga0496110_0086926_1013_1723 223
462 3300048913 Ga0496110_0603917 Ga0496110_0603917_287_964 223
463 3300048914 Ga0496111_0280041 Ga0496111_0280041_476_1186 223
464 3300048915 Ga0496112_0323210 Ga0496112_0323210_61_771 223
465 3300048916 Ga0496113_0234569 Ga0496113_0234569_481_1158 223
466 3300048918 Ga0496115_0064723 Ga0496115_0064723_137_847 223
467 3300048918 Ga0496115_0131838 Ga0496115_0131838_559_1236 223
468 3300048919 Ga0496116_0015358 Ga0496116_0015358_389_1099 223
469 3300048920 Ga0496117_0016367 Ga0496117_0016367_780_1457 223
470 3300048920 Ga0496117_0020767 Ga0496117_0020767_12_722 223
471 3300048920 Ga0496117_0034263 Ga0496117_0034263_1470_2147 223
472 3300048921 Ga0496118_0002080 Ga0496118_0002080_1778_2455 223
473 3300048921 Ga0496118_0033023 Ga0496118_0033023_1150_1860 223
474 3300048921 Ga0496118_0043275 Ga0496118_0043275_2827_3504 223
475 3300048921 Ga0496118_0048827 Ga0496118_0048827_2522_3199 223
476 3300048921 Ga0496118_0105709 Ga0496118_0105709_948_1625 223
477 3300048921 Ga0496118_0109986 Ga0496118_0109986_10_720 223
478 3300048921 Ga0496118_0221324 Ga0496118_0221324_11_742 223
479 3300048922 Ga0496119_0015145 Ga0496119_0015145_873_1550 223
480 3300048922 Ga0496119_0032219 Ga0496119_0032219_126_803 223
481 3300048922 Ga0496119_0100577 Ga0496119_0100577_725_1402 223
482 3300048923 Ga0496120_0008406 Ga0496120_0008406_5601_6278 223
483 3300048923 Ga0496120_0036935 Ga0496120_0036935_1748_2458 223
484 3300048924 Ga0496121_0000183 Ga0496121_0000183_62801_63478 223
485 3300048924 Ga0496121_0007107 Ga0496121_0007107_7292_7969 223
486 3300048924 Ga0496121_0024365 Ga0496121_0024365_4576_5286 223
487 3300048924 Ga0496121_0038244 Ga0496121_0038244_3445_4122 223
488 3300048924 Ga0496121_0061806 Ga0496121_0061806_2300_3010 223
489 3300048924 Ga0496121_0087662 Ga0496121_0087662_761_1477 223
490 3300048924 Ga0496121_0099299 Ga0496121_0099299_1373_2083 223
491 3300048924 Ga0496121_0222490 Ga0496121_0222490_332_1009 223
492 3300048924 Ga0496121_0314308 Ga0496121_0314308_239_916 223
493 3300048927 Ga0496124_0026062 Ga0496124_0026062_1014_1691 223
494 3300048928 Ga0496125_0000090 Ga0496125_0000090_154696_155373 223
495 3300048928 Ga0496125_0019582 Ga0496125_0019582_488_1165 223
496 3300048928 Ga0496125_0047601 Ga0496125_0047601_818_1528 223
497 3300048928 Ga0496125_0059056 Ga0496125_0059056_1314_2045 223
498 3300048928 Ga0496125_0087590 Ga0496125_0087590_436_1113 223
499 3300048929 Ga0496126_0081062 Ga0496126_0081062_1895_2572 223
500 3300048929 Ga0496126_0114192 Ga0496126_0114192_483_1160 223
501 3300048929 Ga0496126_0123558 Ga0496126_0123558_1351_2061 223
502 3300048929 Ga0496126_0152522 Ga0496126_0152522_855_1532 223
503 3300048929 Ga0496126_0170172 Ga0496126_0170172_20_697 223
504 3300048929 Ga0496126_0184874 Ga0496126_0184874_575_1252 223
505 3300048929 Ga0496126_0304248 Ga0496126_0304248_49_726 223
506 3300048929 Ga0496126_0442013 Ga0496126_0442013_144_839 223
507 3300049460 Ga0495682_0068584 Ga0495682_0068584_350_1027 223
508 3300050489 nmdc:mga03683_183575_c1 nmdc:mga03683_183575_c1_57_788 223
509 3300050490 nmdc:mga03n38_286272_c1 nmdc:mga03n38_286272_c1_43_720 223
510 3300050491 nmdc:mga00v17_293482_c1 nmdc:mga00v17_293482_c1_275_985 223
511 3300050491 nmdc:mga00v17_438108_c1 nmdc:mga00v17_438108_c1_125_835 223
512 3300050492 nmdc:mga0yw44_16646_c1 nmdc:mga0yw44_16646_c1_2883_3593 223
513 3300050492 nmdc:mga0yw44_53355_c1 nmdc:mga0yw44_53355_c1_736_1446 223
514 3300050493 nmdc:mga0k408_359424_c1 nmdc:mga0k408_359424_c1_15_749 223
515 3300050495 nmdc:mga04h51_86619_c1 nmdc:mga04h51_86619_c1_179_856 223
516 3300050516 nmdc:mga0sz30_171887_c1 nmdc:mga0sz30_171887_c1_111_839 223
517 3300050516 nmdc:mga0sz30_63444_c1 nmdc:mga0sz30_63444_c1_282_992 223
518 3300053080 Ga0500635_0038891 Ga0500635_0038891_523_1200 223
519 3300053086 Ga0500578_0282845 Ga0500578_0282845_260_967 223
520 3300053087 Ga0500643_000015 Ga0500643_000015_140466_141143 223
521 3300053093 Ga0500651_0001806 Ga0500651_0001806_1278_1955 223
522 3300053094 Ga0500566_0003015 Ga0500566_0003015_6528_7301 223
523 3300053094 Ga0500566_0213999 Ga0500566_0213999_38_733 223
524 3300053104 Ga0500556_0011155 Ga0500556_0011155_710_1420 223
525 3300053104 Ga0500556_0044136 Ga0500556_0044136_383_1060 223
526 3300053104 Ga0500556_0135455 Ga0500556_0135455_199_876 223
527 3300053105 Ga0500557_000110 Ga0500557_000110_3255_3965 223
528 3300053108 Ga0500562_002903 Ga0500562_002903_3183_3893 223
529 3300053109 Ga0500569_097153 Ga0500569_097153_216_923 223
530 3300053111 Ga0500572_052954 Ga0500572_052954_98_793 223
531 3300053119 Ga0500595_011235 Ga0500595_011235_2054_2731 223
532 3300053119 Ga0500595_017141 Ga0500595_017141_896_1606 223
533 3300053119 Ga0500595_020446 Ga0500595_020446_918_1649 223
534 3300053119 Ga0500595_025886 Ga0500595_025886_928_1605 223
535 3300053128 Ga0500626_081337 Ga0500626_081337_454_1164 223
536 3300053130 Ga0500642_0000086 Ga0500642_0000086_40178_40891 223
537 3300053130 Ga0500642_0198181 Ga0500642_0198181_245_922 223
538 3300053133 Ga0500655_045904 Ga0500655_045904_101_811 223
539 3300053134 Ga0500658_0048609 Ga0500658_0048609_458_1168 223
540 3300053136 Ga0500559_0000381 Ga0500559_0000381_10946_11665 223
541 3300053136 Ga0500559_0005470 Ga0500559_0005470_843_1520 223
542 3300053136 Ga0500559_0007575 Ga0500559_0007575_2550_3245 223
543 3300053136 Ga0500559_0044493 Ga0500559_0044493_439_1116 223
544 3300053138 Ga0500564_200983 Ga0500564_200983_47_724 223
545 3300053140 Ga0500573_0106251 Ga0500573_0106251_387_1064 223
546 3300053142 Ga0500577_0015553 Ga0500577_0015553_587_1297 223
547 3300053146 Ga0500588_0029208 Ga0500588_0029208_633_1310 223
548 3300053148 Ga0500590_077322 Ga0500590_077322_376_1053 223
549 3300053153 Ga0500616_0084020 Ga0500616_0084020_549_1226 223
550 3300053156 Ga0500622_0002760 Ga0500622_0002760_831_1508 223
551 3300053156 Ga0500622_0133100 Ga0500622_0133100_195_905 223
552 3300053156 Ga0500622_0141948 Ga0500622_0141948_245_922 223
553 3300053162 Ga0500638_021213 Ga0500638_021213_2250_2927 223
554 3300053162 Ga0500638_193647 Ga0500638_193647_79_774 223
555 3300053162 Ga0500638_211385 Ga0500638_211385_95_772 223
556 3300053177 Ga0500636_0000151 Ga0500636_0000151_3054_3749 223
557 3300053177 Ga0500636_0072873 Ga0500636_0072873_820_1497 223
558 3300053177 Ga0500636_0077419 Ga0500636_0077419_428_1135 223
559 3300053177 Ga0500636_0095242 Ga0500636_0095242_475_1152 223
560 3300053177 Ga0500636_0107018 Ga0500636_0107018_573_1304 223
561 3300053177 Ga0500636_0228166 Ga0500636_0228166_115_792 223
562 3300053724 Ga0500570_083564 Ga0500570_083564_202_879 223
563 3300053729 Ga0500625_000186 Ga0500625_000186_9777_10487 223
564 3300053731 Ga0500609_019023 Ga0500609_019023_122_799 223
565 3300053735 Ga0500596_002002 Ga0500596_002002_1150_1869 223
566 3300053737 Ga0500601_000153 Ga0500601_000153_7989_8720 223
567 3300055283 Ga0500661_012907 Ga0500661_012907_133_864 223
568 3300061719 Ga0466962_0167061 Ga0466962_0167061_295_972 223
569 iso_pu_bacteria 2513237089 2513603498 223
570 iso_pu_bacteria 2513237092 2513623135 223
571 iso_pu_bacteria 2513237161 2514011949 223
572 iso_pu_bacteria 2515154112 2515628264 223
573 iso_pu_bacteria 2517487022 2517571860 223
574 iso_pu_bacteria 2617270735 2617348918 223
575 iso_pu_bacteria 2617270741 2617375862 223
576 iso_pu_bacteria 2802428859 2802724384 223
577 iso_pu_bacteria 2802428860 2802729951 223
578 iso_pu_bacteria 2802428861 2802737295 223
579 iso_pu_bacteria 2824773399 2824777683 223
580 iso_pu_bacteria 2915980308 2915982634 223
581 iso_pu_bacteria 2916061851 2916063980 223
582 iso_pu_bacteria 2921250672 2921256391 223
583 iso_pu_bacteria 2935769743 2935773198 223
584 iso_pu_bacteria 2935785616 2935790437 223
585 iso_pu_bacteria 2935793552 2935798166 223
586 iso_pu_bacteria 2935908558 2935909203 223
587 iso_pu_bacteria 2935916978 2935919924 223
588 iso_pu_bacteria 2935926038 2935926223 223
589 iso_pu_bacteria 2935934488 2935934673 223
590 iso_pu_bacteria 2935942939 2935943123 223
591 iso_pu_bacteria 2935951376 2935951561 223
592 iso_pu_bacteria 2935967501 2935967686 223
593 iso_pu_bacteria 2935975950 2935977116 223
594 iso_pu_bacteria 2937029754 2937030520 223
595 iso_pu_bacteria 2937078374 2937083860 223
596 iso_pu_bacteria 2957375807 2957377954 223
597 iso_pu_bacteria 2960631154 2960635309 223
598 iso_pu_bacteria 2960680706 2960682594 223
599 iso_pu_bacteria 2960693952 2960697837 223
600 iso_pu_bacteria 2967686174 2967688516 223
601 iso_pu_bacteria 2977544691 2977546991 223
602 iso_pu_bacteria 3005710791 3005714796 223
603 iso_pu_bacteria 8016622563 8016626646 223
604 iso_pu_bacteria 8019547302 8019553755 223
605 iso_pu_bacteria 8019619141 8019628029 223
606 iso_pu_bacteria 8019638758 8019645144 223
607 iso_pu_bacteria 8019659431 8019662466 223
608 iso_pu_bacteria 8019668869 8019671965 223
609 iso_pu_bacteria 8019678201 8019684128 223
610 iso_pu_bacteria 8019687851 8019689968 223
611 3300003659 JGI25404J52841_10017502 JGI25404J52841_100175023 224
612 3300005327 Ga0070658_10174148 Ga0070658_101741483 224
613 3300005328 Ga0070676_10079145 Ga0070676_100791452 224
614 3300005329 Ga0070683_100212658 Ga0070683_1002126582 224
615 3300005331 Ga0070670_100365130 Ga0070670_1003651302 224
616 3300005334 Ga0068869_100026636 Ga0068869_1000266363 224
617 3300005334 Ga0068869_100067131 Ga0068869_1000671313 224
618 3300005334 Ga0068869_100635811 Ga0068869_1006358111 224
619 3300005339 Ga0070660_100506509 Ga0070660_1005065092 224
620 3300005339 Ga0070660_100523613 Ga0070660_1005236131 224
621 3300005341 Ga0070691_10250513 Ga0070691_102505131 224
622 3300005343 Ga0070687_100082853 Ga0070687_1000828532 224
623 3300005344 Ga0070661_100451528 Ga0070661_1004515281 224
624 3300005344 Ga0070661_100573369 Ga0070661_1005733691 224
625 3300005347 Ga0070668_100059536 Ga0070668_1000595363 224
626 3300005347 Ga0070668_100152925 Ga0070668_1001529252 224
627 3300005347 Ga0070668_100263336 Ga0070668_1002633362 224
628 3300005347 Ga0070668_100434057 Ga0070668_1004340572 224
629 3300005353 Ga0070669_100044424 Ga0070669_1000444243 224
630 3300005355 Ga0070671_100165838 Ga0070671_1001658383 224
631 3300005356 Ga0070674_100001713 Ga0070674_1000017134 224
632 3300005364 Ga0070673_100492665 Ga0070673_1004926652 224
633 3300005367 Ga0070667_100266238 Ga0070667_1002662382 224
634 3300005367 Ga0070667_100303199 Ga0070667_1003031991 224
635 3300005367 Ga0070667_100873454 Ga0070667_1008734541 224
636 3300005441 Ga0070700_100046846 Ga0070700_1000468462 224
637 3300005444 Ga0070694_100038070 Ga0070694_1000380703 224
638 3300005455 Ga0070663_100040534 Ga0070663_1000405342 224
639 3300005455 Ga0070663_100110269 Ga0070663_1001102692 224
640 3300005455 Ga0070663_100128325 Ga0070663_1001283252 224
641 3300005455 Ga0070663_100275339 Ga0070663_1002753392 224
642 3300005457 Ga0070662_100332339 Ga0070662_1003323392 224
643 3300005459 Ga0068867_100264934 Ga0068867_1002649341 224
644 3300005543 Ga0070672_100084279 Ga0070672_1000842793 224
645 3300005544 Ga0070686_100164921 Ga0070686_1001649211 224
646 3300005545 Ga0070695_100128497 Ga0070695_1001284972 224
647 3300005548 Ga0070665_100074709 Ga0070665_1000747093 224
648 3300005548 Ga0070665_100103128 Ga0070665_1001031282 224
649 3300005548 Ga0070665_100716609 Ga0070665_1007166092 224
650 3300005564 Ga0070664_100804032 Ga0070664_1008040321 224
651 3300005615 Ga0070702_100102654 Ga0070702_1001026542 224
652 3300005616 Ga0068852_100285594 Ga0068852_1002855942 224
653 3300005617 Ga0068859_100732241 Ga0068859_1007322412 224
654 3300005617 Ga0068859_101448827 Ga0068859_1014488271 224
655 3300005719 Ga0068861_100074343 Ga0068861_1000743432 224
656 3300005719 Ga0068861_100210520 Ga0068861_1002105202 224
657 3300005719 Ga0068861_100214989 Ga0068861_1002149891 224
658 3300005834 Ga0068851_10221727 Ga0068851_102217272 224
659 3300005842 Ga0068858_100259842 Ga0068858_1002598423 224
660 3300005842 Ga0068858_100581314 Ga0068858_1005813142 224
661 3300005843 Ga0068860_100116621 Ga0068860_1001166212 224
662 3300005843 Ga0068860_100340033 Ga0068860_1003400332 224
663 3300005844 Ga0068862_100203900 Ga0068862_1002039003 224
664 3300005844 Ga0068862_100275415 Ga0068862_1002754153 224
665 3300005937 Ga0081455_10008967 Ga0081455_100089672 224
666 3300005937 Ga0081455_10088923 Ga0081455_100889234 224
667 3300005983 Ga0081540_1002872 Ga0081540_10028725 224
668 3300005983 Ga0081540_1005006 Ga0081540_100500610 224
669 3300005983 Ga0081540_1011345 Ga0081540_10113455 224
670 3300005983 Ga0081540_1061218 Ga0081540_10612183 224
671 3300005983 Ga0081540_1132074 Ga0081540_11320741 224
672 3300005985 Ga0081539_10023708 Ga0081539_100237083 224
673 3300006038 Ga0075365_10014527 Ga0075365_100145274 224
674 3300006038 Ga0075365_10023123 Ga0075365_100231235 224
675 3300006038 Ga0075365_10137634 Ga0075365_101376342 224
676 3300006038 Ga0075365_10263994 Ga0075365_102639942 224
677 3300006042 Ga0075368_10071096 Ga0075368_100710962 224
678 3300006048 Ga0075363_100002023 Ga0075363_1000020233 224
679 3300006048 Ga0075363_100343536 Ga0075363_1003435361 224
680 3300006051 Ga0075364_10304825 Ga0075364_103048252 224
681 3300006175 Ga0070712_100159622 Ga0070712_1001596222 224
682 3300006177 Ga0075362_10100576 Ga0075362_101005761 224
683 3300006178 Ga0075367_10019361 Ga0075367_100193612 224
684 3300006195 Ga0075366_10153166 Ga0075366_101531662 224
685 3300006195 Ga0075366_10155295 Ga0075366_101552951 224
686 3300006237 Ga0097621_100229304 Ga0097621_1002293041 224
687 3300006353 Ga0075370_10083692 Ga0075370_100836922 224
688 3300006353 Ga0075370_10107986 Ga0075370_101079863 224
689 3300006358 Ga0068871_100128521 Ga0068871_1001285212 224
690 3300006931 Ga0097620_100732218 Ga0097620_1007322181 224
691 3300006931 Ga0097620_101448530 Ga0097620_1014485301 224
692 3300009094 Ga0111539_10169993 Ga0111539_101699933 224
693 3300009098 Ga0105245_10069670 Ga0105245_100696703 224
694 3300009098 Ga0105245_10139965 Ga0105245_101399653 224
695 3300009098 Ga0105245_10610653 Ga0105245_106106531 224
696 3300009101 Ga0105247_10252361 Ga0105247_102523611 224
697 3300009101 Ga0105247_10270483 Ga0105247_102704832 224
698 3300009148 Ga0105243_10103573 Ga0105243_101035732 224
699 3300009174 Ga0105241_10045631 Ga0105241_100456313 224
700 3300009176 Ga0105242_10042057 Ga0105242_100420574 224
701 3300009176 Ga0105242_10348251 Ga0105242_103482512 224
702 3300009177 Ga0105248_10234482 Ga0105248_102344822 224
703 3300009177 Ga0105248_10980101 Ga0105248_109801011 224
704 3300009545 Ga0105237_10064248 Ga0105237_100642481 224
705 3300009545 Ga0105237_10147574 Ga0105237_101475742 224
706 3300009551 Ga0105238_10250854 Ga0105238_102508542 224
707 3300009551 Ga0105238_11144958 Ga0105238_111449581 224
708 3300009553 Ga0105249_10339895 Ga0105249_103398952 224
709 3300010375 Ga0105239_10076073 Ga0105239_100760731 224
710 3300010375 Ga0105239_10154360 Ga0105239_101543601 224
711 3300011119 Ga0105246_10022234 Ga0105246_100222343 224
712 3300011119 Ga0105246_10170519 Ga0105246_101705192 224
713 3300011119 Ga0105246_10377482 Ga0105246_103774821 224
714 3300013105 Ga0157369_11070370 Ga0157369_110703701 224
715 3300013296 Ga0157374_10014207 Ga0157374_100142077 224
716 3300013297 Ga0157378_10276143 Ga0157378_102761431 224
717 3300013297 Ga0157378_10394437 Ga0157378_103944371 224
718 3300013306 Ga0163162_10226476 Ga0163162_102264762 224
719 3300013306 Ga0163162_10495284 Ga0163162_104952841 224
720 3300013308 Ga0157375_10011135 Ga0157375_100111355 224
721 3300013308 Ga0157375_10166248 Ga0157375_101662483 224
722 3300014325 Ga0163163_10027186 Ga0163163_100271865 224
723 3300014325 Ga0163163_10095655 Ga0163163_100956553 224
724 3300014325 Ga0163163_10538898 Ga0163163_105388982 224
725 3300014326 Ga0157380_10075045 Ga0157380_100750453 224
726 3300014326 Ga0157380_10158906 Ga0157380_101589062 224
727 3300014326 Ga0157380_10796884 Ga0157380_107968841 224
728 3300014326 Ga0157380_10955184 Ga0157380_109551842 224
729 3300014969 Ga0157376_10070567 Ga0157376_100705672 224
730 3300017792 Ga0163161_10047673 Ga0163161_100476732 224
731 3300025297 Ga0209758_1015860 Ga0209758_10158603 224
732 3300025321 Ga0207656_10208313 Ga0207656_102083131 224
733 3300025899 Ga0207642_10256676 Ga0207642_102566761 224
734 3300025901 Ga0207688_10031868 Ga0207688_100318683 224
735 3300025901 Ga0207688_10043194 Ga0207688_100431943 224
736 3300025907 Ga0207645_10048851 Ga0207645_100488513 224
737 3300025907 Ga0207645_10201527 Ga0207645_102015272 224
738 3300025908 Ga0207643_10317974 Ga0207643_103179741 224
739 3300025914 Ga0207671_10144130 Ga0207671_101441302 224
740 3300025915 Ga0207693_10087845 Ga0207693_100878453 224
741 3300025918 Ga0207662_10423627 Ga0207662_104236271 224
742 3300025919 Ga0207657_10337021 Ga0207657_103370211 224
743 3300025920 Ga0207649_10387824 Ga0207649_103878241 224
744 3300025923 Ga0207681_10701796 Ga0207681_107017961 224
745 3300025924 Ga0207694_10091648 Ga0207694_100916482 224
746 3300025927 Ga0207687_10099546 Ga0207687_100995462 224
747 3300025927 Ga0207687_10116470 Ga0207687_101164702 224
748 3300025927 Ga0207687_10212053 Ga0207687_102120532 224
749 3300025931 Ga0207644_10061199 Ga0207644_100611993 224
750 3300025931 Ga0207644_10345386 Ga0207644_103453861 224
751 3300025933 Ga0207706_10101612 Ga0207706_101016123 224
752 3300025933 Ga0207706_10143456 Ga0207706_101434562 224
753 3300025933 Ga0207706_10163203 Ga0207706_101632033 224
754 3300025933 Ga0207706_10329927 Ga0207706_103299272 224
755 3300025934 Ga0207686_10043601 Ga0207686_100436012 224
756 3300025934 Ga0207686_10354374 Ga0207686_103543742 224
757 3300025934 Ga0207686_10486743 Ga0207686_104867432 224
758 3300025935 Ga0207709_10136741 Ga0207709_101367412 224
759 3300025935 Ga0207709_10255823 Ga0207709_102558232 224
760 3300025936 Ga0207670_10279572 Ga0207670_102795722 224
761 3300025940 Ga0207691_10052421 Ga0207691_100524214 224
762 3300025941 Ga0207711_10230972 Ga0207711_102309722 224
763 3300025941 Ga0207711_10285699 Ga0207711_102856992 224
764 3300025942 Ga0207689_10052058 Ga0207689_100520584 224
765 3300025942 Ga0207689_10136561 Ga0207689_101365611 224
766 3300025942 Ga0207689_10159937 Ga0207689_101599372 224
767 3300025944 Ga0207661_10119932 Ga0207661_101199322 224
768 3300025949 Ga0207667_10174714 Ga0207667_101747142 224
769 3300025960 Ga0207651_10521729 Ga0207651_105217291 224
770 3300025972 Ga0207668_10166829 Ga0207668_101668293 224
771 3300025972 Ga0207668_10191918 Ga0207668_101919181 224
772 3300025981 Ga0207640_10067463 Ga0207640_100674633 224
773 3300025986 Ga0207658_10806321 Ga0207658_108063211 224
774 3300026023 Ga0207677_10065885 Ga0207677_100658852 224
775 3300026023 Ga0207677_10899292 Ga0207677_108992922 224
776 3300026035 Ga0207703_10039172 Ga0207703_100391723 224
777 3300026035 Ga0207703_10437452 Ga0207703_104374522 224
778 3300026041 Ga0207639_10057045 Ga0207639_100570452 224
779 3300026067 Ga0207678_10015879 Ga0207678_100158795 224
780 3300026067 Ga0207678_10062562 Ga0207678_100625623 224
781 3300026067 Ga0207678_10077951 Ga0207678_100779513 224
782 3300026067 Ga0207678_10139110 Ga0207678_101391101 224
783 3300026067 Ga0207678_10724308 Ga0207678_107243081 224
784 3300026075 Ga0207708_10050499 Ga0207708_100504994 224
785 3300026075 Ga0207708_10064734 Ga0207708_100647342 224
786 3300026088 Ga0207641_10733977 Ga0207641_107339772 224
787 3300026089 Ga0207648_10030521 Ga0207648_100305214 224
788 3300026116 Ga0207674_10160467 Ga0207674_101604672 224
789 3300026118 Ga0207675_100069860 Ga0207675_1000698602 224
790 3300026118 Ga0207675_100093583 Ga0207675_1000935833 224
791 3300026118 Ga0207675_100148299 Ga0207675_1001482992 224
792 3300026121 Ga0207683_10093890 Ga0207683_100938903 224
793 3300026121 Ga0207683_10145027 Ga0207683_101450272 224
794 3300026121 Ga0207683_10434435 Ga0207683_104344351 224
795 3300026142 Ga0207698_10436478 Ga0207698_104364783 224
796 3300027866 Ga0209813_10091017 Ga0209813_100910172 224
797 3300028379 Ga0268266_10000908 Ga0268266_100009085 224
798 3300028379 Ga0268266_10009000 Ga0268266_100090006 224
799 3300028379 Ga0268266_10032518 Ga0268266_100325184 224
800 3300028379 Ga0268266_10078718 Ga0268266_100787184 224
801 3300028379 Ga0268266_10174667 Ga0268266_101746671 224
802 3300028379 Ga0268266_10187397 Ga0268266_101873972 224
803 3300028379 Ga0268266_10303361 Ga0268266_103033612 224
804 3300028379 Ga0268266_10653334 Ga0268266_106533341 224
805 3300028380 Ga0268265_10141246 Ga0268265_101412461 224
806 3300028380 Ga0268265_10206115 Ga0268265_102061152 224
807 3300028380 Ga0268265_10213706 Ga0268265_102137062 224
808 3300028380 Ga0268265_10426736 Ga0268265_104267362 224
809 3300028381 Ga0268264_10149549 Ga0268264_101495492 224
810 3300028381 Ga0268264_10873584 Ga0268264_108735841 224
811 3300028786 Ga0307517_10000063 Ga0307517_10000063142 224
812 3300028794 Ga0307515_10013876 Ga0307515_100138764 224
813 3300028794 Ga0307515_10215146 Ga0307515_102151462 224
814 3300031456 Ga0307513_10082231 Ga0307513_100822313 224
815 3300031456 Ga0307513_10232558 Ga0307513_102325583 224
816 3300031507 Ga0307509_10145300 Ga0307509_101453002 224
817 3300031730 Ga0307516_10514972 Ga0307516_105149722 224
818 3300031731 Ga0307405_10299991 Ga0307405_102999912 224
819 3300031852 Ga0307410_10689975 Ga0307410_106899751 224
820 3300031903 Ga0307407_10352498 Ga0307407_103524981 224
821 3300031911 Ga0307412_10428883 Ga0307412_104288831 224
822 3300031995 Ga0307409_100169629 Ga0307409_1001696293 224
823 3300032002 Ga0307416_100284364 Ga0307416_1002843641 224
824 3300032004 Ga0307414_11130445 Ga0307414_111304451 224
825 3300032005 Ga0307411_10474580 Ga0307411_104745801 224
826 3300032126 Ga0307415_100297207 Ga0307415_1002972071 224
827 3300033180 Ga0307510_10005974 Ga0307510_100059745 224
828 3300033180 Ga0307510_10019835 Ga0307510_100198355 224
829 3300037471 Ga0395905_0877896 Ga0395905_0877896_39_716 224
830 3300041453 Ga0451797_1357528 Ga0451797_1357528_137_850 224
831 3300041460 Ga0451802_0584264 Ga0451802_0584264_24_701 224
832 3300042157 Ga0439458_0031327 Ga0439458_0031327_99_776 224
833 3300046452 Ga0495617_009692 Ga0495617_009692_2050_2724 224
834 3300046452 Ga0495617_139095 Ga0495617_139095_19_696 224
835 3300046455 Ga0495603_0170219 Ga0495603_0170219_49_726 224
836 3300046455 Ga0495603_0170358 Ga0495603_0170358_116_793 224
837 3300046459 Ga0495629_0068528 Ga0495629_0068528_1309_1986 224
838 3300046460 Ga0495638_0077244 Ga0495638_0077244_457_1131 224
839 3300046460 Ga0495638_0141814 Ga0495638_0141814_143_868 224
840 3300046474 Ga0495605_0077924 Ga0495605_0077924_329_1006 224
841 3300046474 Ga0495605_0130868 Ga0495605_0130868_420_1097 224
842 3300046475 Ga0495639_0114942 Ga0495639_0114942_280_957 224
843 3300046477 Ga0495664_0260384 Ga0495664_0260384_255_980 224
844 3300046492 Ga0495585_0033152 Ga0495585_0033152_1928_2602 224
845 3300046492 Ga0495585_0152662 Ga0495585_0152662_282_959 224
846 3300046507 Ga0495606_0102707 Ga0495606_0102707_309_1007 224
847 3300046513 Ga0495616_0046141 Ga0495616_0046141_964_1638 224
848 3300046513 Ga0495616_0250067 Ga0495616_0250067_63_737 224
849 3300046519 Ga0495632_0048901 Ga0495632_0048901_1118_1792 224
850 3300046520 Ga0495637_0121822 Ga0495637_0121822_284_961 224
851 3300046523 Ga0495644_0067655 Ga0495644_0067655_649_1326 224
852 3300046528 Ga0495642_0170212 Ga0495642_0170212_234_911 224
853 3300046537 Ga0495598_0028200 Ga0495598_0028200_451_1128 224
854 3300046539 Ga0495621_0072072 Ga0495621_0072072_107_784 224
855 3300046615 Ga0495656_0001311 Ga0495656_0001311_6316_6993 224
856 3300046615 Ga0495656_0228296 Ga0495656_0228296_28_705 224
857 3300046616 Ga0495668_0301924 Ga0495668_0301924_83_760 224
858 3300046648 Ga0495611_0085530 Ga0495611_0085530_186_863 224
859 3300046660 Ga0495625_0073563 Ga0495625_0073563_367_1044 224
860 3300046660 Ga0495625_0100361 Ga0495625_0100361_84_761 224
861 3300046660 Ga0495625_0334838 Ga0495625_0334838_61_735 224
862 3300046664 Ga0495659_0017086 Ga0495659_0017086_1524_2246 224
863 3300046664 Ga0495659_0116826 Ga0495659_0116826_146_823 224
864 3300046681 Ga0495647_0042142 Ga0495647_0042142_848_1525 224
865 3300046684 Ga0495669_0022386 Ga0495669_0022386_250_927 224
866 3300046684 Ga0495669_0035016 Ga0495669_0035016_56_733 224
867 3300046691 Ga0495670_0036497 Ga0495670_0036497_500_1177 224
868 3300046692 Ga0495671_0104647 Ga0495671_0104647_300_977 224
869 3300046692 Ga0495671_0211314 Ga0495671_0211314_68_745 224
870 3300046692 Ga0495671_0265633 Ga0495671_0265633_74_751 224
871 3300046694 Ga0495649_0130376 Ga0495649_0130376_286_1023 224
872 3300046809 Ga0495600_0141931 Ga0495600_0141931_776_1453 224
873 3300047315 Ga0495581_0186913 Ga0495581_0186913_62_736 224
874 3300047318 Ga0495636_0062444 Ga0495636_0062444_203_880 224
875 3300047320 Ga0495672_0005697 Ga0495672_0005697_4800_5513 224
876 3300047320 Ga0495672_0245691 Ga0495672_0245691_141_854 224
877 3300047321 Ga0495676_0284684 Ga0495676_0284684_34_711 224
878 3300047322 Ga0495680_0216518 Ga0495680_0216518_90_767 224
879 3300047323 Ga0495683_0122159 Ga0495683_0122159_158_835 224
880 3300047445 Ga0495677_0065757 Ga0495677_0065757_542_1219 224
881 3300047447 Ga0495685_101177 Ga0495685_101177_225_902 224
882 3300047447 Ga0495685_111153 Ga0495685_111153_193_870 224
883 3300047469 Ga0495673_0056692 Ga0495673_0056692_171_848 224
884 3300047472 Ga0495686_0220685 Ga0495686_0220685_103_780 224
885 3300047472 Ga0495686_0410340 Ga0495686_0410340_29_703 224
886 3300048903 Ga0496100_0009036 Ga0496100_0009036_1351_2070 224
887 3300048903 Ga0496100_0352566 Ga0496100_0352566_279_956 224
888 3300048904 Ga0496101_0008367 Ga0496101_0008367_6058_6735 224
889 3300048904 Ga0496101_0634424 Ga0496101_0634424_76_753 224
890 3300048905 Ga0496102_0026386 Ga0496102_0026386_3708_4427 224
891 3300048905 Ga0496102_0592509 Ga0496102_0592509_312_989 224
892 3300048905 Ga0496102_0925225 Ga0496102_0925225_62_739 224
893 3300048906 Ga0496103_0007167 Ga0496103_0007167_4763_5482 224
894 3300048907 Ga0496104_0162263 Ga0496104_0162263_1041_1718 224
895 3300048908 Ga0496105_0006361 Ga0496105_0006361_4038_4757 224
896 3300048909 Ga0496106_0064377 Ga0496106_0064377_727_1446 224
897 3300048909 Ga0496106_0567817 Ga0496106_0567817_176_850 224
898 3300048910 Ga0496107_0016788 Ga0496107_0016788_3105_3824 224
899 3300048911 Ga0496108_0009868 Ga0496108_0009868_5033_5752 224
900 3300048911 Ga0496108_0287976 Ga0496108_0287976_700_1374 224
901 3300048911 Ga0496108_0662974 Ga0496108_0662974_176_853 224
902 3300048912 Ga0496109_0026435 Ga0496109_0026435_4235_4954 224
903 3300048913 Ga0496110_0192439 Ga0496110_0192439_266_940 224
904 3300048913 Ga0496110_0221007 Ga0496110_0221007_151_876 224
905 3300048913 Ga0496110_0668297 Ga0496110_0668297_248_925 224
906 3300048914 Ga0496111_0133918 Ga0496111_0133918_28_702 224
907 3300048914 Ga0496111_0210557 Ga0496111_0210557_87_764 224
908 3300048914 Ga0496111_0345397 Ga0496111_0345397_413_1090 224
909 3300048915 Ga0496112_0102082 Ga0496112_0102082_1777_2451 224
910 3300048916 Ga0496113_0033172 Ga0496113_0033172_2467_3186 224
911 3300048916 Ga0496113_0048396 Ga0496113_0048396_1893_2567 224
912 3300048917 Ga0496114_0019293 Ga0496114_0019293_2168_2887 224
913 3300048917 Ga0496114_0766262 Ga0496114_0766262_13_690 224
914 3300048918 Ga0496115_0036614 Ga0496115_0036614_1688_2407 224
915 3300048920 Ga0496117_0090222 Ga0496117_0090222_343_1020 224
916 3300048924 Ga0496121_0375012 Ga0496121_0375012_14_691 224
917 3300048924 Ga0496121_0382050 Ga0496121_0382050_155_829 224
918 3300048927 Ga0496124_0195816 Ga0496124_0195816_233_907 224
919 3300048927 Ga0496124_0506427 Ga0496124_0506427_59_736 224
920 3300048928 Ga0496125_0172478 Ga0496125_0172478_522_1199 224
921 3300048928 Ga0496125_0246208 Ga0496125_0246208_172_846 224
922 3300048929 Ga0496126_0045449 Ga0496126_0045449_1256_1933 224
923 3300048929 Ga0496126_0062658 Ga0496126_0062658_41_718 224
924 3300048929 Ga0496126_0531191 Ga0496126_0531191_42_719 224
925 3300049574 Ga0501038_0307108 Ga0501038_0307108_406_1131 224
926 3300049575 Ga0501039_0267350 Ga0501039_0267350_375_1100 224
927 3300049576 Ga0501040_0741099 Ga0501040_0741099_23_700 224
928 3300049583 Ga0501067_0021765 Ga0501067_0021765_874_1551 224
929 3300050490 nmdc:mga03n38_174_c1 nmdc:mga03n38_174_c1_10179_10856 224
930 3300050491 nmdc:mga00v17_105852_c1 nmdc:mga00v17_105852_c1_479_1156 224
931 3300050491 nmdc:mga00v17_80354_c1 nmdc:mga00v17_80354_c1_552_1226 224
932 3300050492 nmdc:mga0yw44_19416_c1 nmdc:mga0yw44_19416_c1_1486_2163 224
933 3300050492 nmdc:mga0yw44_44915_c1 nmdc:mga0yw44_44915_c1_963_1640 224
934 3300050492 nmdc:mga0yw44_73926_c1 nmdc:mga0yw44_73926_c1_959_1633 224
935 3300050493 nmdc:mga0k408_113894_c1 nmdc:mga0k408_113894_c1_872_1549 224
936 3300050493 nmdc:mga0k408_328552_c1 nmdc:mga0k408_328552_c1_43_720 224
937 3300050493 nmdc:mga0k408_74779_c1 nmdc:mga0k408_74779_c1_1100_1774 224
938 3300050494 nmdc:mga06z11_118701_c1 nmdc:mga06z11_118701_c1_214_891 224
939 3300050494 nmdc:mga06z11_41493_c1 nmdc:mga06z11_41493_c1_938_1615 224
940 3300050494 nmdc:mga06z11_5916_c1 nmdc:mga06z11_5916_c1_20_697 224
941 3300050496 nmdc:mga07m45_9126_c2 nmdc:mga07m45_9126_c2_614_1291 224
942 3300050511 nmdc:mga08y16_71990_c1 nmdc:mga08y16_71990_c1_1612_2289 224
943 3300050512 nmdc:mga0n895_261398_c1 nmdc:mga0n895_261398_c1_1045_1719 224
944 3300050513 nmdc:mga0rr50_771815_c1 nmdc:mga0rr50_771815_c1_109_783 224
945 3300050516 nmdc:mga0sz30_233711_c1 nmdc:mga0sz30_233711_c1_127_804 224
946 3300050516 nmdc:mga0sz30_78228_c1 nmdc:mga0sz30_78228_c1_153_830 224
947 3300050516 nmdc:mga0sz30_79771_c1 nmdc:mga0sz30_79771_c1_131_805 224
948 3300053090 Ga0500646_0120665 Ga0500646_0120665_71_748 224
949 3300053092 Ga0500583_0053930 Ga0500583_0053930_197_874 224
950 3300053093 Ga0500651_0087602 Ga0500651_0087602_176_853 224
951 3300053096 Ga0500641_0017094 Ga0500641_0017094_1690_2367 224
952 3300053096 Ga0500641_0021736 Ga0500641_0021736_455_1132 224
953 3300053096 Ga0500641_0035827 Ga0500641_0035827_930_1607 224
954 3300053108 Ga0500562_006666 Ga0500562_006666_1818_2495 224
955 3300053118 Ga0500594_0052474 Ga0500594_0052474_186_863 224
956 3300053119 Ga0500595_034134 Ga0500595_034134_97_774 224
957 3300053134 Ga0500658_0095156 Ga0500658_0095156_233_910 224
958 3300053142 Ga0500577_0041762 Ga0500577_0041762_565_1242 224
959 3300053147 Ga0500589_113169 Ga0500589_113169_76_753 224
960 3300053148 Ga0500590_018545 Ga0500590_018545_2787_3464 224
961 3300053151 Ga0500604_0032156 Ga0500604_0032156_532_1221 224
962 3300053160 Ga0500633_0087101 Ga0500633_0087101_217_894 224
963 3300061734 Ga0530510_0071208 Ga0530510_0071208_87_770 224
964 3300005937 Ga0081455_10025384 Ga0081455_100253842 225
965 3300006177 Ga0075362_10139297 Ga0075362_101392972 225
966 3300013105 Ga0157369_10024858 Ga0157369_100248586 225
967 3300049583 Ga0501067_0089918 Ga0501067_0089918_423_1103 225
968 3300050489 nmdc:mga03683_93737_c1 nmdc:mga03683_93737_c1_445_1125 225
969 3300050490 nmdc:mga03n38_256737_c1 nmdc:mga03n38_256737_c1_183_863 225
970 3300022739 Ga0228711_1003229 Ga0228711_100322921 226
971 3300022740 Ga0228710_1000004 Ga0228710_100000443 226
972 3300027111 Ga0209281_1000134 Ga0209281_100013421 226
973 3300027666 Ga0209282_1000013 Ga0209282_100001313 226
974 3300031967 Ga0315914_1000004 Ga0315914_100000448 226
975 3300033430 Ga0315913_1008800 Ga0315913_10088005 226
976 3300033464 Ga0315915_1000003 Ga0315915_1000003155 226
977 3300003187 JGI25151J46595_10000278 JGI25151J46595_1000027839 227
978 3300003215 JGI25153J46596_10005243 JGI25153J46596_100052433 227
979 3300003771 Ga0055526_1000605 Ga0055526_100060519 227

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02798

GST_N

Glutathione S-transferase, N-terminal domain

35

111

0.94

PF00043

GST_C

Glutathione S-transferase, C-terminal domain

129

227

0.92

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

44

112

0.9

PF13410

GST_C_2

Glutathione S-transferase, C-terminal domain

152

222

0.9

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

39

117

0.89

PF14497

GST_C_3

Glutathione S-transferase, C-terminal domain

145

236

0.85

PF22441

CLIC-like_N

CLIC-like N-terminal domain

33

115

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
5j5n-assembly1.cif.gz_B crystal structure of the r39w mutant of populus trichocarpa glutathione transferase ptgstu30 in complex with glutathione 0.8773 1 215
3lfl-assembly2.cif.gz_C crystal structure of human glutathione transferase omega 1, delta 155 0.8761 3 209
5j4u-assembly1.cif.gz_A-2 crystal structure of a glutathione s-transferase ptgstu30 from populus trichocarpa in complex with gsh 0.875 1 215
5g5a-assembly2.cif.gz_D glutathione transferase u25 from arabidopsis thaliana in complex with glutathione disulfide 0.8744 3 217
7dwe-assembly1.cif.gz_A crystal structure of a glutathione s-transferase sbgstu7 from salix babylonica in complex with glutathione 0.87 4 215
ID Description Score Start End Superfamily
3rbtA01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9166 3 79 3.40.30.10
af_Q8BWM0_87_178_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9049 2 77 3.40.30.10
af_Q9VSL2_5_102_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9029 3 79 3.40.30.10
1z9hA01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9021 3 79 3.40.30.10
3q19A01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8998 4 86 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A7Y3SRF5-F1-model_v4 deleted 0.9717 1 227
AF-A0A7W5UA01-F1-model_v4 glutathione transferase (EC 2.5.1.18) 0.9687 3 222 GO:0004364
GO:0005737
AF-A0A7Y6T8E8-F1-model_v4 deleted 0.9668 1 223
AF-A0A2W6SQW3-F1-model_v4 glutathione transferase (EC 2.5.1.18) 0.9628 2 221 GO:0005737
GO:0016740
AF-A0A6G6YNS6-F1-model_v4 glutathione transferase (EC 2.5.1.18) 0.959 1 223 GO:0005737

Feature Viewer

pLDDT pTM Quality
92.63 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map