F487299

General Info

Members Datasets Scaffolds Average Seq Length
978 400 960 138

Family's Representative Sequence

Representative Sequence 3300013104|Ga0157370_10778863|Ga0157370_107788632
Length 140
Sequence MALERTFSIIKPDATRRNITGKIIALIEANGLRVVASKRIRMTRQQAEGFYAVHKERPFYGELVEQMIGGPVVVQVLEGENAIIKYREVMGATNPEEAVPGTIRKEFALNMGENSVHGSDSPENAKTEIKFFFTDAEIVG

Samples

Sample ID Description Type Environment
1 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
2 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
3 2608642108 Pantoea agglomerans NFPP29 Isolate Rhizoplane
4 2648501693 Pantoea ananatis B1-9 Isolate Rhizosphere
5 2684622997 Pantoea ananatis NFIX48 Isolate Rhizoplane
6 2808606414 Pantoea sp. SJZ147 Isolate Rhizosphere
7 2844528606 Pantoea sp. R-72498 v. 2 Isolate Unclassified
8 2847797336 Pantoea ananatis NN08200 Isolate Unclassified
9 2865014394 Pantoea sp. R-71966 Isolate Unclassified
10 2876601092 Pantoea endophytica 596 Isolate Unclassified
11 2881609920 Pantoea sp. ARC607 Isolate Rhizosphere
12 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
13 2945951305 Pantoea agglomerans W2I1 Isolate Rhizosphere
14 2978975091 Pantoea anthophila SORGH_AS 797 Isolate Unclassified
15 2984494565 Pantoea ananatis SORGH_AS197 Isolate Aerial Root
16 2990261002 Pantoea ananatis SORGH_AS213 Isolate Aerial Root
17 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
18 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
19 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
22 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
23 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
24 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
25 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
26 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
27 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
28 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
29 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
30 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
31 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
32 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
33 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
34 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
35 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
36 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
37 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
38 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
39 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
40 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
41 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
42 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
43 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
44 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
45 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
46 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
47 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
48 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
49 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
50 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
51 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
52 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
53 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
54 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
55 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
56 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
57 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
58 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
59 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
60 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
61 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
62 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
63 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
64 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
65 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
66 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
67 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
68 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
69 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
70 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
71 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
72 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
73 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
74 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
75 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
76 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
77 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
78 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
79 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
80 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
81 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
82 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
83 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
84 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
85 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
86 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
87 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
88 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
89 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
90 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
91 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
92 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
93 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
95 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
96 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
97 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
98 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
99 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
100 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
101 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
102 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
103 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
104 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
105 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
106 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
107 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
108 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
109 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
110 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
111 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
112 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
113 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
114 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
115 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
116 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
117 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
118 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
119 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
120 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
121 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
122 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
123 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
124 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
125 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
126 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
127 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
128 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
129 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
130 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
131 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
132 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
133 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
134 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
135 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
136 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
137 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
138 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
139 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
140 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
141 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
142 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
143 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
144 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
145 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
146 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
203 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
204 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
208 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
209 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
210 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
211 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
212 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
213 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
214 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
215 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
216 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
217 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
218 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
219 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
220 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
221 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
222 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
223 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
224 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
225 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
226 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
227 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
228 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
229 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
230 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
231 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
232 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
233 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
234 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
235 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
236 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
237 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
238 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
239 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
240 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
241 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
242 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
243 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
244 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
245 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
246 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
247 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
248 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
249 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
250 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
251 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
252 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
253 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
254 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
255 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
256 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
257 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
258 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
259 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
260 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
261 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
262 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
263 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
264 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
265 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
266 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
267 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
268 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
269 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
270 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
271 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
272 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
273 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
274 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
275 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
276 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
277 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
278 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
279 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
280 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
281 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
282 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
283 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
284 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
285 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
286 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
287 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
288 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
289 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
290 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
291 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
292 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
293 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
294 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
295 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
296 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
297 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
298 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
299 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
300 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
301 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
302 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
303 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
304 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
305 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
306 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
307 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
308 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
309 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
310 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
311 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
312 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
313 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
314 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
315 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
316 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
317 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
318 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
319 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
320 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
321 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
322 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
323 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
324 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
325 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
326 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
327 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
328 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
329 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
330 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
331 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
332 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
333 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
334 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
335 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
336 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
337 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
338 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
339 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
340 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
341 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
342 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
343 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
344 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
345 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
346 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
347 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
348 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
349 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
350 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
351 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
352 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
353 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
354 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
355 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
356 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
357 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
358 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
359 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
360 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
361 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
362 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
363 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
364 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
365 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
366 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
367 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
368 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
369 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
370 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
371 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
372 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
373 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
374 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
375 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
376 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
377 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
378 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
379 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
380 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
381 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
382 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
383 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
384 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
385 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
386 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
387 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
388 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
389 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
390 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
391 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
392 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
393 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
394 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
395 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
396 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
397 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
398 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
399 8016733728 Pantoea sp. SORGH_AS 659 Isolate Unclassified
400 8019499862 Kluyvera sp. 1366 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.55
Metatranscriptomes 0.61
Isolates 1.84

Biome Distribution

Category Percentage (%)
Aerial Root 0.2
Bulb 0
Endosphere 2.76
Nodule 0
Rhizoplane 2.45
Rhizosphere 91
Stem 0
Stem Tuber 0
Unclassified 3.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10243124 3300003203 Bacteria 528
2 Ga0065715_10350156 3300005293 Bacteria 952
3 Ga0065707_10005793 3300005295 Bacteria 4042
4 Ga0065707_10512314 3300005295 Bacteria 748
5 Ga0070658_10059170 3300005327 Bacteria 3120
6 Ga0070676_10004905 3300005328 Bacteria 7088
7 Ga0070683_100171249 3300005329 Bacteria 2061
8 Ga0070690_100016281 3300005330 Bacteria 4450
9 Ga0070670_100024993 3300005331 Bacteria 5139
10 Ga0070670_100299431 3300005331 Bacteria 1406
11 Ga0070670_100652273 3300005331 Bacteria 944
12 Ga0070670_101358526 3300005331 Bacteria 651
13 Ga0070677_10210617 3300005333 Bacteria 943
14 Ga0068869_101024769 3300005334 Bacteria 719
15 Ga0070666_10096283 3300005335 Bacteria 2037
16 Ga0070666_10389840 3300005335 Bacteria 1001
17 Ga0070666_10564455 3300005335 Bacteria 829
18 Ga0070680_100016205 3300005336 Bacteria 5861
19 Ga0070680_100126478 3300005336 Bacteria 2136
20 Ga0070680_100197373 3300005336 Bacteria 1696
21 Ga0070680_100386735 3300005336 Bacteria 1192
22 Ga0070680_100860824 3300005336 Bacteria 781
23 Ga0070682_100000035 3300005337 Bacteria 150016
24 Ga0070682_100392110 3300005337 Bacteria 1048
25 Ga0068868_100264100 3300005338 Bacteria 1453
26 Ga0068868_100312725 3300005338 Bacteria 1337
27 Ga0068868_100328456 3300005338 Bacteria 1305
28 Ga0070660_100023622 3300005339 Bacteria 4556
29 Ga0070660_100137008 3300005339 Bacteria 1961
30 Ga0070660_100546524 3300005339 Bacteria 966
31 Ga0070689_100144658 3300005340 Bacteria 1914
32 Ga0070689_100246628 3300005340 Bacteria 1473
33 Ga0070689_100619926 3300005340 Bacteria 939
34 Ga0070687_100051272 3300005343 Bacteria 2136
35 Ga0070687_101105960 3300005343 Bacteria 580
36 Ga0070661_100008889 3300005344 Bacteria 6952
37 Ga0070661_100027663 3300005344 Bacteria 4085
38 Ga0070661_100754952 3300005344 Bacteria 796
39 Ga0070692_11047784 3300005345 Bacteria 573
40 Ga0070668_100213689 3300005347 Bacteria 1588
41 Ga0070668_101307667 3300005347 Bacteria 659
42 Ga0070669_100191698 3300005353 Bacteria 1604
43 Ga0070669_100224737 3300005353 Bacteria 1485
44 Ga0070669_100309031 3300005353 Bacteria 1274
45 Ga0070669_101323243 3300005353 Unclassified 624
46 Ga0070675_100007339 3300005354 Bacteria 8507
47 Ga0070675_100011756 3300005354 Bacteria 6857
48 Ga0070675_100117308 3300005354 Bacteria 2259
49 Ga0070675_100118121 3300005354 Bacteria 2251
50 Ga0070675_100161591 3300005354 Bacteria 1926
51 Ga0070675_100444097 3300005354 Bacteria 1162
52 Ga0070675_100682381 3300005354 Viruses 935
53 Ga0070671_100014366 3300005355 Bacteria 6396
54 Ga0070671_100016291 3300005355 Bacteria 6012
55 Ga0070671_100308936 3300005355 Bacteria 1347
56 Ga0070674_100004717 3300005356 Bacteria 7799
57 Ga0070674_100070771 3300005356 Bacteria 2465
58 Ga0070674_100089702 3300005356 Bacteria 2215
59 Ga0070674_100100452 3300005356 Bacteria 2106
60 Ga0070674_100902262 3300005356 Bacteria 770
61 Ga0070674_101283134 3300005356 Bacteria 652
62 Ga0070673_100001825 3300005364 Bacteria 12719
63 Ga0070673_100012360 3300005364 Bacteria 5860
64 Ga0070673_100034826 3300005364 Bacteria 3814
65 Ga0070673_101200008 3300005364 Bacteria 711
66 Ga0070673_101508236 3300005364 Bacteria 634
67 Ga0070688_100437836 3300005365 Bacteria 975
68 Ga0070659_100612076 3300005366 Bacteria 937
69 Ga0070667_100348291 3300005367 Bacteria 1341
70 Ga0070667_100969762 3300005367 Bacteria 793
71 Ga0070713_100003643 3300005436 Bacteria 10193
72 Ga0070713_100068677 3300005436 Bacteria 2987
73 Ga0070713_100380630 3300005436 Bacteria 1315
74 Ga0070701_10212838 3300005438 Bacteria 1148
75 Ga0070701_11094547 3300005438 Bacteria 560
76 Ga0070701_11198964 3300005438 Unclassified 538
77 Ga0070705_100672958 3300005440 Bacteria 810
78 Ga0070700_100027077 3300005441 Bacteria 3395
79 Ga0070700_100059804 3300005441 Bacteria 2400
80 Ga0070700_100391884 3300005441 Bacteria 1042
81 Ga0070663_100005932 3300005455 Bacteria 7309
82 Ga0070663_100148931 3300005455 Bacteria 1793
83 Ga0070663_101229794 3300005455 Bacteria 659
84 Ga0070678_100232589 3300005456 Bacteria 1537
85 Ga0070678_100251862 3300005456 Bacteria 1481
86 Ga0070678_100267319 3300005456 Bacteria 1441
87 Ga0070678_100643101 3300005456 Bacteria 951
88 Ga0070678_101045567 3300005456 Bacteria 752
89 Ga0070678_101319216 3300005456 Bacteria 672
90 Ga0070662_101367258 3300005457 Unclassified 610
91 Ga0070681_10019189 3300005458 Bacteria 6843
92 Ga0070681_10386725 3300005458 Bacteria 1310
93 Ga0068867_100001976 3300005459 Bacteria 14295
94 Ga0068867_100257001 3300005459 Bacteria 1423
95 Ga0068867_100894192 3300005459 Bacteria 799
96 Ga0070685_10013898 3300005466 Bacteria 4259
97 Ga0070685_10043106 3300005466 Bacteria 2579
98 Ga0070685_10182558 3300005466 Bacteria 1352
99 Ga0070698_100149275 3300005471 Bacteria 2286
100 Ga0070698_100780796 3300005471 Bacteria 899
101 Ga0070698_100939676 3300005471 Bacteria 811
102 Ga0070698_101801867 3300005471 Bacteria 565
103 Ga0070699_100198406 3300005518 Bacteria 1784
104 Ga0070679_100206714 3300005530 Bacteria 1928
105 Ga0070679_100302551 3300005530 Bacteria 1550
106 Ga0070684_100081768 3300005535 Bacteria 2859
107 Ga0070684_100250800 3300005535 Bacteria 1618
108 Ga0070684_101475018 3300005535 Bacteria 641
109 Ga0070684_101517437 3300005535 Bacteria 632
110 Ga0070697_100049091 3300005536 Bacteria 3424
111 Ga0068853_100005152 3300005539 Bacteria 10215
112 Ga0068853_100028505 3300005539 Bacteria 4698
113 Ga0068853_100102808 3300005539 Bacteria 2529
114 Ga0068853_100137168 3300005539 Bacteria 2194
115 Ga0068853_100246164 3300005539 Bacteria 1640
116 Ga0070672_100018076 3300005543 Bacteria 5089
117 Ga0070672_100031727 3300005543 Bacteria 3980
118 Ga0070672_100099015 3300005543 Bacteria 2362
119 Ga0070672_100354547 3300005543 Bacteria 1251
120 Ga0070672_101993736 3300005543 Bacteria 523
121 Ga0070695_100062705 3300005545 Bacteria 2414
122 Ga0070696_100777012 3300005546 Bacteria 787
123 Ga0070665_100000839 3300005548 Bacteria 40097
124 Ga0070665_100311134 3300005548 Bacteria 1579
125 Ga0070665_100382985 3300005548 Bacteria 1414
126 Ga0070665_100595402 3300005548 Bacteria 1119
127 Ga0070665_100741933 3300005548 Bacteria 995
128 Ga0070665_101180264 3300005548 Bacteria 776
129 Ga0070665_101398522 3300005548 Bacteria 709
130 Ga0070665_101901620 3300005548 Bacteria 601
131 Ga0070704_100014629 3300005549 Bacteria 4906
132 Ga0070704_101341769 3300005549 Bacteria 655
133 Ga0068855_100025034 3300005563 Bacteria 7143
134 Ga0068855_100118445 3300005563 Bacteria 3033
135 Ga0068855_100450522 3300005563 Bacteria 1404
136 Ga0068855_100542524 3300005563 Bacteria 1260
137 Ga0068855_100919981 3300005563 Bacteria 923
138 Ga0070664_100016791 3300005564 Bacteria 6008
139 Ga0070664_100512074 3300005564 Bacteria 1107
140 Ga0068857_100100694 3300005577 Bacteria 2592
141 Ga0068857_101561824 3300005577 Bacteria 644
142 Ga0068854_100004717 3300005578 Bacteria 8590
143 Ga0068854_100015515 3300005578 Bacteria 5049
144 Ga0068854_100028425 3300005578 Bacteria 3864
145 Ga0068854_100271546 3300005578 Bacteria 1362
146 Ga0068854_101020626 3300005578 Unclassified 733
147 Ga0068856_100077852 3300005614 Bacteria 3286
148 Ga0068856_100205345 3300005614 Bacteria 1985
149 Ga0068856_100301755 3300005614 Bacteria 1619
150 Ga0070702_100927566 3300005615 Bacteria 684
151 Ga0068852_100005648 3300005616 Bacteria 8972
152 Ga0068852_100034648 3300005616 Bacteria 4203
153 Ga0068852_100154208 3300005616 Bacteria 2138
154 Ga0068852_100586799 3300005616 Bacteria 1118
155 Ga0068852_100599731 3300005616 Bacteria 1105
156 Ga0068859_100000040 3300005617 Bacteria 162782
157 Ga0068859_100000468 3300005617 Bacteria 39887
158 Ga0068859_100093442 3300005617 Bacteria 3059
159 Ga0068859_101607846 3300005617 Bacteria 718
160 Ga0068859_102497575 3300005617 Bacteria 569
161 Ga0068859_102559106 3300005617 Bacteria 562
162 Ga0068864_100029316 3300005618 Bacteria 4659
163 Ga0068864_100277696 3300005618 Bacteria 1563
164 Ga0068864_100843259 3300005618 Bacteria 903
165 Ga0068866_10057567 3300005718 Bacteria 2004
166 Ga0068861_100103017 3300005719 Bacteria 2274
167 Ga0068861_100193131 3300005719 Bacteria 1703
168 Ga0068851_10005621 3300005834 Bacteria 5693
169 Ga0068851_10415286 3300005834 Bacteria 794
170 Ga0068870_10032208 3300005840 Bacteria 2663
171 Ga0068870_10237853 3300005840 Bacteria 1123
172 Ga0068863_100000307 3300005841 Bacteria 50304
173 Ga0068863_100360734 3300005841 Bacteria 1417
174 Ga0068863_100369372 3300005841 Bacteria 1400
175 Ga0068863_100622559 3300005841 Bacteria 1069
176 Ga0068863_101474573 3300005841 Unclassified 689
177 Ga0068863_101863406 3300005841 Bacteria 611
178 Ga0068858_100016825 3300005842 Bacteria 6868
179 Ga0068858_100026210 3300005842 Bacteria 5419
180 Ga0068858_100048034 3300005842 Bacteria 3956
181 Ga0068858_100371418 3300005842 Bacteria 1372
182 Ga0068858_100689252 3300005842 Bacteria 994
183 Ga0068860_100003051 3300005843 Bacteria 17296
184 Ga0068860_100008532 3300005843 Bacteria 10210
185 Ga0068860_100402722 3300005843 Bacteria 1354
186 Ga0068860_101355042 3300005843 Bacteria 732
187 Ga0081455_10220993 3300005937 Bacteria 1404
188 Ga0081540_1055956 3300005983 Bacteria 1918
189 Ga0081539_10027575 3300005985 Bacteria 3593
190 Ga0081539_10337301 3300005985 Unclassified 637
191 Ga0070717_10031295 3300006028 Bacteria 4279
192 Ga0075365_10080806 3300006038 Bacteria 2201
193 Ga0075368_10040666 3300006042 Bacteria 1825
194 Ga0075368_10089583 3300006042 Bacteria 1258
195 Ga0075364_10232614 3300006051 Bacteria 1251
196 Ga0075364_10558624 3300006051 Bacteria 782
197 Ga0070716_101082612 3300006173 Bacteria 638
198 Ga0070712_100489098 3300006175 Bacteria 1030
199 Ga0070712_100961073 3300006175 Bacteria 738
200 Ga0075367_10039305 3300006178 Bacteria 2758
201 Ga0075367_10249356 3300006178 Bacteria 1113
202 Ga0075367_10651814 3300006178 Bacteria 669
203 Ga0075366_10008607 3300006195 Bacteria 5682
204 Ga0075366_10152577 3300006195 Bacteria 1399
205 Ga0097621_100097468 3300006237 Bacteria 2469
206 Ga0097621_100160348 3300006237 Bacteria 1933
207 Ga0097621_100329929 3300006237 Bacteria 1353
208 Ga0097621_100898233 3300006237 Bacteria 825
209 Ga0075370_10032032 3300006353 Bacteria 2936
210 Ga0068871_100338928 3300006358 Bacteria 1327
211 Ga0068871_100362735 3300006358 Bacteria 1284
212 Ga0075428_100017091 3300006844 Bacteria 8015
213 Ga0075428_100308190 3300006844 Bacteria 1702
214 Ga0075428_100379392 3300006844 Bacteria 1516
215 Ga0075428_100532853 3300006844 Bacteria 1256
216 Ga0075430_100010683 3300006846 Bacteria 7779
217 Ga0075430_100069350 3300006846 Bacteria 2958
218 Ga0075430_100148983 3300006846 Bacteria 1949
219 Ga0075430_100160396 3300006846 Bacteria 1872
220 Ga0075430_100244826 3300006846 Bacteria 1486
221 Ga0075430_100433226 3300006846 Bacteria 1085
222 Ga0075430_100465898 3300006846 Bacteria 1043
223 Ga0075430_100768500 3300006846 Bacteria 794
224 Ga0075431_100040014 3300006847 Bacteria 4830
225 Ga0075431_100195183 3300006847 Bacteria 2073
226 Ga0075431_100472410 3300006847 Bacteria 1248
227 Ga0075431_100472933 3300006847 Bacteria 1247
228 Ga0075431_100752429 3300006847 Bacteria 950
229 Ga0075431_101234424 3300006847 Bacteria 710
230 Ga0075434_100068600 3300006871 Bacteria 3533
231 Ga0075434_100229839 3300006871 Bacteria 1874
232 Ga0075429_100093654 3300006880 Bacteria 2620
233 Ga0075429_100720730 3300006880 Bacteria 874
234 Ga0068865_100144165 3300006881 Bacteria 1799
235 Ga0068865_100334624 3300006881 Bacteria 1222
236 Ga0068865_100547007 3300006881 Bacteria 972
237 Ga0075436_100026351 3300006914 Bacteria 4003
238 Ga0075436_100354341 3300006914 Bacteria 1058
239 Ga0075436_100776596 3300006914 Bacteria 712
240 Ga0097620_100000040 3300006931 Bacteria 162782
241 Ga0097620_100000468 3300006931 Bacteria 39887
242 Ga0097620_100093447 3300006931 Bacteria 3059
243 Ga0097620_101607696 3300006931 Bacteria 718
244 Ga0097620_102496979 3300006931 Bacteria 569
245 Ga0097620_102558995 3300006931 Bacteria 562
246 Ga0075435_101896748 3300007076 Bacteria 523
247 Ga0099794_10081792 3300007265 Bacteria 1594
248 Ga0099794_10204433 3300007265 Bacteria 1012
249 Ga0099795_10004626 3300007788 Bacteria 3573
250 Ga0105240_10012404 3300009093 Bacteria 11765
251 Ga0105240_10028438 3300009093 Bacteria 7303
252 Ga0105240_10152968 3300009093 Bacteria 2746
253 Ga0111539_10012966 3300009094 Bacteria 10430
254 Ga0111539_10087032 3300009094 Bacteria 3671
255 Ga0111539_10129573 3300009094 Bacteria 2954
256 Ga0111539_10174269 3300009094 Bacteria 2513
257 Ga0111539_10184332 3300009094 Bacteria 2438
258 Ga0111539_10235811 3300009094 Bacteria 2130
259 Ga0111539_10384417 3300009094 Bacteria 1634
260 Ga0111539_10476842 3300009094 Bacteria 1453
261 Ga0111539_10497423 3300009094 Bacteria 1420
262 Ga0111539_11709641 3300009094 Bacteria 730
263 Ga0111539_13455072 3300009094 Bacteria 507
264 Ga0105245_10083279 3300009098 Bacteria 2928
265 Ga0105245_10211792 3300009098 Bacteria 1865
266 Ga0105245_10358461 3300009098 Bacteria 1447
267 Ga0105245_10458327 3300009098 Bacteria 1285
268 Ga0105245_11198718 3300009098 Bacteria 807
269 Ga0105247_10051805 3300009101 Bacteria 2529
270 Ga0105247_10179215 3300009101 Bacteria 1413
271 Ga0105247_10793578 3300009101 Bacteria 722
272 Ga0105247_10879786 3300009101 Bacteria 690
273 Ga0114129_10053937 3300009147 Bacteria 5638
274 Ga0114129_10069113 3300009147 Bacteria 4923
275 Ga0114129_11135531 3300009147 Bacteria 976
276 Ga0105243_10829076 3300009148 Bacteria 914
277 Ga0105243_11127985 3300009148 Bacteria 794
278 Ga0105243_12777543 3300009148 Bacteria 530
279 Ga0105241_10114161 3300009174 Bacteria 2166
280 Ga0105241_10552086 3300009174 Unclassified 1034
281 Ga0105241_10613271 3300009174 Bacteria 984
282 Ga0105241_11649018 3300009174 Bacteria 622
283 Ga0105242_10042077 3300009176 Bacteria 3687
284 Ga0105242_11940941 3300009176 Bacteria 630
285 Ga0105248_10000090 3300009177 Bacteria 101891
286 Ga0105248_10157617 3300009177 Bacteria 2561
287 Ga0105248_10666579 3300009177 Bacteria 1174
288 Ga0105248_11291532 3300009177 Bacteria 825
289 Ga0105248_11298006 3300009177 Bacteria 823
290 Ga0105237_11749043 3300009545 Bacteria 629
291 Ga0105237_11819665 3300009545 Bacteria 617
292 Ga0105238_10009190 3300009551 Bacteria 9895
293 Ga0105238_10009677 3300009551 Bacteria 9648
294 Ga0105238_10136633 3300009551 Bacteria 2429
295 Ga0105238_10403448 3300009551 Bacteria 1360
296 Ga0105249_10813068 3300009553 Bacteria 999
297 Ga0105249_10877083 3300009553 Bacteria 964
298 Ga0105249_10917346 3300009553 Bacteria 943
299 Ga0105249_12221722 3300009553 Bacteria 621
300 Ga0099796_10018181 3300010159 Bacteria 2106
301 Ga0099796_10335200 3300010159 Bacteria 649
302 Ga0105239_10007066 3300010375 Bacteria 12922
303 Ga0105239_10118954 3300010375 Bacteria 2932
304 Ga0105239_10962653 3300010375 Bacteria 981
305 Ga0105239_12410490 3300010375 Bacteria 613
306 Ga0105239_12445264 3300010375 Bacteria 608
307 Ga0105246_10376112 3300011119 Bacteria 1172
308 Ga0105246_10872153 3300011119 Bacteria 805
309 Ga0157373_10267520 3300013100 Bacteria 1210
310 Ga0157373_10291151 3300013100 Bacteria 1158
311 Ga0157371_10034623 3300013102 Bacteria 3621
312 Ga0157371_10653258 3300013102 Bacteria 785
313 Ga0157370_10070956 3300013104 Bacteria 3287
314 Ga0157370_10112532 3300013104 Bacteria 2544
315 Ga0157370_10231297 3300013104 Bacteria 1711
316 Ga0157370_10778863 3300013104 Bacteria 871
317 Ga0157370_11012175 3300013104 Bacteria 752
318 Ga0157369_10014955 3300013105 Bacteria 8759
319 Ga0157374_10000008 3300013296 Bacteria 588863
320 Ga0157374_10480122 3300013296 Bacteria 1246
321 Ga0157374_10740794 3300013296 Bacteria 997
322 Ga0157374_11993646 3300013296 Bacteria 607
323 Ga0157378_10280588 3300013297 Bacteria 1606
324 Ga0157378_10463408 3300013297 Bacteria 1260
325 Ga0157378_10477684 3300013297 Bacteria 1241
326 Ga0157378_10779530 3300013297 Bacteria 981
327 Ga0157378_11024300 3300013297 Unclassified 861
328 Ga0163162_10067408 3300013306 Bacteria 3629
329 Ga0163162_10668003 3300013306 Bacteria 1162
330 Ga0157372_10219749 3300013307 Bacteria 2202
331 Ga0157372_10483777 3300013307 Bacteria 1443
332 Ga0157372_11669647 3300013307 Bacteria 733
333 Ga0157372_12049114 3300013307 Bacteria 657
334 Ga0157375_10000860 3300013308 Bacteria 26402
335 Ga0157375_10598570 3300013308 Bacteria 1262
336 Ga0163163_10000017 3300014325 Bacteria 208781
337 Ga0163163_10015978 3300014325 Bacteria 6957
338 Ga0163163_10044160 3300014325 Bacteria 4371
339 Ga0163163_10106869 3300014325 Bacteria 2825
340 Ga0163163_10115176 3300014325 Bacteria 2720
341 Ga0163163_10655996 3300014325 Bacteria 1113
342 Ga0163163_11069072 3300014325 Bacteria 870
343 Ga0163163_12769509 3300014325 Bacteria 547
344 Ga0157380_10000592 3300014326 Bacteria 22301
345 Ga0157380_10027828 3300014326 Bacteria 4303
346 Ga0157380_10041295 3300014326 Bacteria 3599
347 Ga0157380_10070065 3300014326 Bacteria 2832
348 Ga0157380_10595598 3300014326 Bacteria 1093
349 Ga0157380_10598470 3300014326 Bacteria 1090
350 Ga0157380_11552319 3300014326 Bacteria 716
351 Ga0157380_11701603 3300014326 Bacteria 688
352 Ga0182008_10239927 3300014497 Bacteria 932
353 Ga0157377_10000007 3300014745 Bacteria 402005
354 Ga0157377_10118117 3300014745 Bacteria 1603
355 Ga0157377_10607175 3300014745 Bacteria 781
356 Ga0157379_10000365 3300014968 Bacteria 36359
357 Ga0157379_10008665 3300014968 Bacteria 8857
358 Ga0157379_10025258 3300014968 Bacteria 5276
359 Ga0157379_10390423 3300014968 Bacteria 1278
360 Ga0157376_10036646 3300014969 Bacteria 3975
361 Ga0157376_10397616 3300014969 Bacteria 1331
362 Ga0157376_10464511 3300014969 Bacteria 1237
363 Ga0157376_11481517 3300014969 Bacteria 711
364 Ga0163161_10394336 3300017792 Bacteria 1109
365 Ga0206356_11229896 3300020070 Bacteria 1577
366 Ga0206352_10061836 3300020078 Bacteria 816
367 Ga0206354_10876749 3300020081 Bacteria 869
368 Ga0154015_1512287 3300020610 Bacteria 1325
369 Ga0213873_10132782 3300021358 Unclassified 738
370 Ga0213876_10000008 3300021384 Bacteria 506740
371 Ga0213876_10520272 3300021384 Bacteria 633
372 Ga0213875_10190403 3300021388 Bacteria 964
373 Ga0228598_1007044 3300024227 Bacteria 2306
374 Ga0207656_10001311 3300025321 Bacteria 8183
375 Ga0207656_10004442 3300025321 Bacteria 4900
376 Ga0207656_10249660 3300025321 Bacteria 869
377 Ga0207682_10033397 3300025893 Bacteria 2071
378 Ga0207682_10101100 3300025893 Bacteria 1260
379 Ga0207682_10139590 3300025893 Bacteria 1087
380 Ga0207682_10167217 3300025893 Bacteria 999
381 Ga0207682_10207424 3300025893 Bacteria 903
382 Ga0207710_10024756 3300025900 Bacteria 2587
383 Ga0207710_10312966 3300025900 Bacteria 795
384 Ga0207688_10090086 3300025901 Bacteria 1760
385 Ga0207680_10044560 3300025903 Bacteria 2610
386 Ga0207680_10233687 3300025903 Bacteria 1264
387 Ga0207699_10192682 3300025906 Bacteria 1376
388 Ga0207645_10022662 3300025907 Bacteria 4083
389 Ga0207645_10123074 3300025907 Bacteria 1685
390 Ga0207645_10629284 3300025907 Bacteria 729
391 Ga0207643_10034115 3300025908 Bacteria 2850
392 Ga0207643_10972299 3300025908 Bacteria 549
393 Ga0207705_10248703 3300025909 Bacteria 1356
394 Ga0207707_10326273 3300025912 Bacteria 1325
395 Ga0207707_10342284 3300025912 Bacteria 1289
396 Ga0207695_10007106 3300025913 Bacteria 14343
397 Ga0207695_10494094 3300025913 Bacteria 1106
398 Ga0207695_10932069 3300025913 Bacteria 748
399 Ga0207695_11280134 3300025913 Bacteria 614
400 Ga0207671_10460783 3300025914 Bacteria 1013
401 Ga0207660_10122482 3300025917 Bacteria 1971
402 Ga0207660_10149133 3300025917 Bacteria 1795
403 Ga0207660_10382759 3300025917 Bacteria 1131
404 Ga0207662_10107890 3300025918 Bacteria 1733
405 Ga0207662_10224059 3300025918 Bacteria 1226
406 Ga0207662_10408934 3300025918 Bacteria 921
407 Ga0207662_10910704 3300025918 Bacteria 623
408 Ga0207657_10044776 3300025919 Bacteria 3888
409 Ga0207657_10501061 3300025919 Bacteria 951
410 Ga0207649_10001031 3300025920 Bacteria 17152
411 Ga0207649_10187784 3300025920 Bacteria 1451
412 Ga0207649_10541971 3300025920 Bacteria 889
413 Ga0207652_10158236 3300025921 Bacteria 2030
414 Ga0207681_10051558 3300025923 Bacteria 2788
415 Ga0207681_10135222 3300025923 Bacteria 1828
416 Ga0207681_10188670 3300025923 Bacteria 1575
417 Ga0207681_10200913 3300025923 Bacteria 1531
418 Ga0207681_10238304 3300025923 Bacteria 1415
419 Ga0207694_10006307 3300025924 Bacteria 9055
420 Ga0207694_10246106 3300025924 Bacteria 1462
421 Ga0207694_11294337 3300025924 Bacteria 616
422 Ga0207650_10036593 3300025925 Bacteria 3572
423 Ga0207650_10045226 3300025925 Bacteria 3239
424 Ga0207650_10148131 3300025925 Bacteria 1850
425 Ga0207659_10004193 3300025926 Bacteria 8709
426 Ga0207659_10033427 3300025926 Bacteria 3540
427 Ga0207659_10083746 3300025926 Bacteria 2365
428 Ga0207659_10109367 3300025926 Bacteria 2098
429 Ga0207659_10154248 3300025926 Bacteria 1796
430 Ga0207659_10155706 3300025926 Bacteria 1789
431 Ga0207659_10554655 3300025926 Bacteria 977
432 Ga0207659_10637438 3300025926 Bacteria 910
433 Ga0207659_11376772 3300025926 Bacteria 605
434 Ga0207687_10174541 3300025927 Bacteria 1660
435 Ga0207687_10434616 3300025927 Bacteria 1086
436 Ga0207700_10024321 3300025928 Bacteria 4191
437 Ga0207700_10339249 3300025928 Bacteria 1306
438 Ga0207644_10017759 3300025931 Bacteria 4810
439 Ga0207644_10025280 3300025931 Bacteria 4083
440 Ga0207644_10203721 3300025931 Bacteria 1561
441 Ga0207644_10353999 3300025931 Bacteria 1193
442 Ga0207706_10086949 3300025933 Bacteria 2748
443 Ga0207686_10038026 3300025934 Bacteria 2909
444 Ga0207709_10252033 3300025935 Bacteria 1290
445 Ga0207670_10019893 3300025936 Bacteria 4111
446 Ga0207670_10057836 3300025936 Bacteria 2631
447 Ga0207670_10106572 3300025936 Bacteria 2011
448 Ga0207670_11814575 3300025936 Bacteria 519
449 Ga0207669_10093212 3300025937 Bacteria 1967
450 Ga0207669_10148738 3300025937 Bacteria 1637
451 Ga0207669_10633988 3300025937 Bacteria 872
452 Ga0207669_11129724 3300025937 Bacteria 662
453 Ga0207704_10128793 3300025938 Bacteria 1748
454 Ga0207691_10039249 3300025940 Bacteria 4380
455 Ga0207691_10354554 3300025940 Bacteria 1255
456 Ga0207691_10853150 3300025940 Bacteria 764
457 Ga0207711_10015097 3300025941 Bacteria 6414
458 Ga0207711_11122502 3300025941 Bacteria 727
459 Ga0207689_10178242 3300025942 Bacteria 1753
460 Ga0207679_10264398 3300025945 Bacteria 1469
461 Ga0207679_10370026 3300025945 Bacteria 1254
462 Ga0207667_10020673 3300025949 Bacteria 7314
463 Ga0207667_10092286 3300025949 Bacteria 3128
464 Ga0207667_10127751 3300025949 Bacteria 2619
465 Ga0207667_11075202 3300025949 Bacteria 789
466 Ga0207651_10011976 3300025960 Bacteria 4882
467 Ga0207651_10078395 3300025960 Bacteria 2369
468 Ga0207651_10414477 3300025960 Bacteria 1148
469 Ga0207651_10971831 3300025960 Bacteria 758
470 Ga0207651_11229421 3300025960 Bacteria 673
471 Ga0207712_10310996 3300025961 Bacteria 1296
472 Ga0207712_11419553 3300025961 Bacteria 621
473 Ga0207668_10105912 3300025972 Bacteria 2100
474 Ga0207668_11281483 3300025972 Bacteria 659
475 Ga0207668_11634536 3300025972 Unclassified 582
476 Ga0207640_10003993 3300025981 Bacteria 7968
477 Ga0207640_10014708 3300025981 Bacteria 4511
478 Ga0207640_10198484 3300025981 Bacteria 1518
479 Ga0207640_10496838 3300025981 Bacteria 1015
480 Ga0207640_10673962 3300025981 Bacteria 884
481 Ga0207658_10366286 3300025986 Bacteria 1259
482 Ga0207658_11470553 3300025986 Bacteria 623
483 Ga0207677_10079440 3300026023 Bacteria 2346
484 Ga0207677_10229607 3300026023 Bacteria 1494
485 Ga0207677_11103982 3300026023 Bacteria 723
486 Ga0207677_11158489 3300026023 Bacteria 707
487 Ga0207677_11437837 3300026023 Bacteria 636
488 Ga0207703_10007529 3300026035 Bacteria 8639
489 Ga0207703_10046911 3300026035 Bacteria 3482
490 Ga0207703_11032863 3300026035 Bacteria 789
491 Ga0207639_10002270 3300026041 Bacteria 12928
492 Ga0207639_10058301 3300026041 Bacteria 2969
493 Ga0207639_10146333 3300026041 Bacteria 1974
494 Ga0207639_10302296 3300026041 Bacteria 1415
495 Ga0207639_10584226 3300026041 Bacteria 1029
496 Ga0207639_11256340 3300026041 Bacteria 695
497 Ga0207678_10006322 3300026067 Bacteria 10518
498 Ga0207678_10036396 3300026067 Bacteria 4284
499 Ga0207678_10039306 3300026067 Bacteria 4107
500 Ga0207678_10049950 3300026067 Bacteria 3614
501 Ga0207678_10111317 3300026067 Bacteria 2335
502 Ga0207678_10619502 3300026067 Bacteria 949
503 Ga0207678_11122327 3300026067 Bacteria 696
504 Ga0207678_11356572 3300026067 Unclassified 629
505 Ga0207678_11538258 3300026067 Unclassified 587
506 Ga0207708_10001790 3300026075 Bacteria 15846
507 Ga0207708_10053891 3300026075 Bacteria 3065
508 Ga0207708_10064508 3300026075 Bacteria 2798
509 Ga0207708_10097167 3300026075 Bacteria 2276
510 Ga0207702_10044412 3300026078 Bacteria 3735
511 Ga0207702_10165396 3300026078 Bacteria 2023
512 Ga0207702_10385591 3300026078 Bacteria 1348
513 Ga0207641_10032537 3300026088 Bacteria 4329
514 Ga0207641_10289199 3300026088 Bacteria 1544
515 Ga0207641_11491457 3300026088 Bacteria 678
516 Ga0207648_10000077 3300026089 Bacteria 93009
517 Ga0207648_10211315 3300026089 Bacteria 1723
518 Ga0207648_10605294 3300026089 Bacteria 1010
519 Ga0207648_11890251 3300026089 Bacteria 558
520 Ga0207676_10050527 3300026095 Bacteria 3242
521 Ga0207676_10082496 3300026095 Bacteria 2615
522 Ga0207676_10133403 3300026095 Bacteria 2115
523 Ga0207674_10010061 3300026116 Bacteria 10758
524 Ga0207674_10086625 3300026116 Bacteria 3127
525 Ga0207674_10126790 3300026116 Bacteria 2518
526 Ga0207674_10167782 3300026116 Bacteria 2149
527 Ga0207675_100073156 3300026118 Bacteria 3207
528 Ga0207675_100382424 3300026118 Bacteria 1384
529 Ga0207675_101058313 3300026118 Bacteria 830
530 Ga0207683_10157463 3300026121 Bacteria 2052
531 Ga0207683_10189771 3300026121 Bacteria 1865
532 Ga0207683_10293896 3300026121 Bacteria 1486
533 Ga0207683_10628288 3300026121 Bacteria 995
534 Ga0207683_10715479 3300026121 Bacteria 929
535 Ga0207683_10869864 3300026121 Bacteria 837
536 Ga0207683_11608632 3300026121 Bacteria 599
537 Ga0207698_10009294 3300026142 Bacteria 6259
538 Ga0207698_10072672 3300026142 Bacteria 2735
539 Ga0207698_10098755 3300026142 Bacteria 2413
540 Ga0207698_10852266 3300026142 Bacteria 916
541 Ga0207698_12085776 3300026142 Bacteria 581
542 Ga0207698_12252496 3300026142 Bacteria 557
543 Ga0209179_1020163 3300027512 Bacteria 1291
544 Ga0209588_1098108 3300027671 Bacteria 943
545 Ga0209966_1010275 3300027695 Bacteria 1684
546 Ga0209974_10022919 3300027876 Bacteria 2067
547 Ga0209974_10050323 3300027876 Bacteria 1399
548 Ga0207428_10002456 3300027907 Bacteria 18510
549 Ga0207428_10024210 3300027907 Bacteria 5100
550 Ga0207428_10520266 3300027907 Bacteria 862
551 Ga0207428_10720380 3300027907 Bacteria 712
552 Ga0268266_10000072 3300028379 Bacteria 232245
553 Ga0268266_10096295 3300028379 Bacteria 2601
554 Ga0268266_10459131 3300028379 Unclassified 1212
555 Ga0268266_10562553 3300028379 Bacteria 1093
556 Ga0268266_11044778 3300028379 Bacteria 790
557 Ga0268266_11695301 3300028379 Bacteria 607
558 Ga0268266_11769120 3300028379 Bacteria 593
559 Ga0268266_11868853 3300028379 Bacteria 575
560 Ga0268265_10344981 3300028380 Bacteria 1357
561 Ga0268265_11948244 3300028380 Bacteria 595
562 Ga0268264_10002191 3300028381 Bacteria 17369
563 Ga0268264_10006064 3300028381 Bacteria 10213
564 Ga0268264_10499926 3300028381 Bacteria 1186
565 Ga0265338_10027640 3300028800 Bacteria 5686
566 Ga0265338_10151094 3300028800 Bacteria 1804
567 Ga0265338_10265119 3300028800 Bacteria 1261
568 Ga0265324_10061787 3300029957 Bacteria 1280
569 Ga0265330_10004069 3300031235 Bacteria 7500
570 Ga0265330_10052275 3300031235 Bacteria 1790
571 Ga0265328_10121476 3300031239 Bacteria 974
572 Ga0265325_10000124 3300031241 Bacteria 53002
573 Ga0265325_10040624 3300031241 Bacteria 2442
574 Ga0265340_10031662 3300031247 Bacteria 2644
575 Ga0265340_10300569 3300031247 Bacteria 712
576 Ga0265339_10000277 3300031249 Bacteria 41496
577 Ga0265339_10000521 3300031249 Bacteria 30036
578 Ga0265316_10000629 3300031344 Bacteria 39308
579 Ga0265316_10089557 3300031344 Bacteria 2348
580 Ga0265316_10190979 3300031344 Bacteria 1521
581 Ga0307408_100003848 3300031548 Bacteria 10213
582 Ga0265313_10000588 3300031595 Bacteria 37769
583 Ga0265313_10002031 3300031595 Bacteria 18150
584 Ga0316575_10057546 3300031665 Bacteria 1550
585 Ga0265314_10094029 3300031711 Bacteria 1944
586 Ga0265342_10010188 3300031712 Bacteria 6545
587 Ga0307405_10000655 3300031731 Bacteria 13337
588 Ga0307405_10326121 3300031731 Bacteria 1175
589 Ga0307405_10420470 3300031731 Bacteria 1052
590 Ga0307405_10812331 3300031731 Bacteria 784
591 Ga0307413_10096316 3300031824 Bacteria 1942
592 Ga0307413_10440517 3300031824 Bacteria 1031
593 Ga0307410_10009942 3300031852 Bacteria 5364
594 Ga0307406_11724478 3300031901 Unclassified 555
595 Ga0307407_10005789 3300031903 Bacteria 5408
596 Ga0307407_10293894 3300031903 Bacteria 1130
597 Ga0307412_10070651 3300031911 Bacteria 2381
598 Ga0307412_10086408 3300031911 Bacteria 2182
599 Ga0307412_11384330 3300031911 Bacteria 636
600 Ga0307412_11617794 3300031911 Bacteria 592
601 Ga0307409_100003910 3300031995 Bacteria 8245
602 Ga0307409_100539628 3300031995 Bacteria 1143
603 Ga0307409_100796478 3300031995 Bacteria 952
604 Ga0307409_101477333 3300031995 Bacteria 707
605 Ga0307416_100003573 3300032002 Bacteria 9171
606 Ga0307416_100184416 3300032002 Bacteria 1960
607 Ga0307416_100224917 3300032002 Bacteria 1803
608 Ga0307416_100799254 3300032002 Bacteria 1039
609 Ga0307416_100927573 3300032002 Bacteria 972
610 Ga0307416_100931553 3300032002 Bacteria 970
611 Ga0307416_100996683 3300032002 Bacteria 941
612 Ga0307416_101010352 3300032002 Bacteria 935
613 Ga0307416_103214251 3300032002 Bacteria 547
614 Ga0307416_103262883 3300032002 Bacteria 543
615 Ga0307414_10582474 3300032004 Unclassified 1001
616 Ga0307414_10676175 3300032004 Bacteria 933
617 Ga0307411_10001781 3300032005 Bacteria 9096
618 Ga0307411_10257847 3300032005 Bacteria 1375
619 Ga0307411_11897516 3300032005 Bacteria 554
620 Ga0307415_100011537 3300032126 Bacteria 5063
621 Ga0307415_101640370 3300032126 Bacteria 619
622 Ga0316588_1176508 3300033528 Unclassified 553
623 Ga0316596_1114729 3300033541 Unclassified 732
624 Ga0373959_0000006 3300034820 Bacteria 73733
625 Ga0373934_0196307 3300035086 Bacteria 830
626 Ga0373944_0417183 3300035089 Bacteria 519
627 Ga0373951_0273422 3300035091 Bacteria 514
628 Ga0373952_0026644 3300035092 Bacteria 1257
629 Ga0373945_0348062 3300035116 Bacteria 642
630 Ga0373945_0455302 3300035116 Bacteria 566
631 Ga0373954_0049694 3300035118 Bacteria 1967
632 Ga0373955_0044923 3300035172 Bacteria 2382
633 Ga0316574_0027123 3300035398 Bacteria 3449
634 Ga0316574_0079546 3300035398 Unclassified 2079
635 Ga0316574_0091842 3300035398 Bacteria 1936
636 Ga0373931_0075955 3300035691 Bacteria 1844
637 Ga0373935_0224909 3300035692 Bacteria 1305
638 Ga0373927_1121750 3300035695 Bacteria 519
639 Ga0373933_0047018 3300035724 Bacteria 2565
640 Ga0373947_1114798 3300035725 Unclassified 538
641 Ga0373937_0001949 3300036401 Bacteria 17281
642 Ga0373937_0134651 3300036401 Bacteria 2309
643 Ga0373937_0344060 3300036401 Bacteria 1412
644 Ga0373937_0813751 3300036401 Bacteria 882
645 Ga0316584_0036328 3300036712 Unclassified 3656
646 Ga0373925_0003799 3300037068 Bacteria 11608
647 Ga0373925_0143043 3300037068 Bacteria 1873
648 Ga0395899_0612193 3300037312 Bacteria 692
649 Ga0395900_0319329 3300037418 Bacteria 1534
650 Ga0395900_0707454 3300037418 Bacteria 940
651 Ga0395898_0359431 3300037466 Bacteria 1388
652 Ga0395898_0509743 3300037466 Bacteria 1144
653 Ga0395898_0566628 3300037466 Bacteria 1078
654 Ga0436364_0229532 3300037853 Bacteria 1873
655 Ga0436364_0324904 3300037853 Bacteria 5220
656 Ga0436364_1075915 3300037853 Bacteria 9351
657 Ga0395901_0661471 3300038443 Bacteria 1046
658 Ga0400484_07775 3300038725 Bacteria 5999
659 Ga0400490_10514 3300038726 Bacteria 1629
660 Ga0400490_50905 3300038726 Bacteria 65742
661 Ga0400491_28577 3300038727 Bacteria 8184
662 Ga0400485_17143 3300038735 Bacteria 18739
663 Ga0400488_12509 3300038741 Bacteria 1958
664 Ga0400488_61775 3300038741 Bacteria 1209
665 Ga0400486_16511 3300038742 Bacteria 11583
666 Ga0400483_008789 3300039062 Unclassified 1339
667 Ga0400489_07561 3300039093 Bacteria 1221
668 Ga0400489_35047 3300039093 Bacteria 73845
669 Ga0400487_00767 3300039110 Bacteria 7422
670 Ga0436365_0324434 3300039437 Bacteria 2803
671 Ga0436365_0546808 3300039437 Bacteria 630
672 Ga0436365_0973417 3300039437 Bacteria 57549
673 Ga0436365_1380816 3300039437 Bacteria 816
674 Ga0436363_1032628 3300039450 Bacteria 1573
675 Ga0436362_1054863 3300039453 Bacteria 6750
676 Ga0451789_0527783 3300041443 Bacteria 677
677 Ga0451791_0577217 3300041451 Bacteria 932
678 Ga0451798_1001455 3300041458 Bacteria 660
679 Ga0451798_1010594 3300041458 Unclassified 612
680 Ga0451802_1374578 3300041460 Bacteria 754
681 Ga0451804_1178722 3300041463 Bacteria 722
682 Ga0451807_0101166 3300041486 Bacteria 732
683 Ga0451839_1101301 3300041496 Bacteria 707
684 Ga0451849_0083480 3300041505 Bacteria 636
685 Ga0451853_0993517 3300041512 Bacteria 572
686 Ga0451853_1851339 3300041512 Bacteria 994
687 Ga0451853_3591999 3300041512 Bacteria 589
688 Ga0439431_0124628 3300041997 Bacteria 720
689 Ga0439431_0278491 3300041997 Unclassified 501
690 Ga0439433_0044345 3300041999 Bacteria 1040
691 Ga0439433_0090420 3300041999 Bacteria 752
692 Ga0439433_0182863 3300041999 Bacteria 549
693 Ga0439443_041728 3300042003 Bacteria 785
694 Ga0439449_0077694 3300042007 Bacteria 1224
695 Ga0439457_034358 3300042014 Bacteria 1127
696 Ga0439462_0030219 3300042015 Bacteria 1433
697 Ga0439462_0037247 3300042015 Bacteria 1295
698 Ga0439462_0105888 3300042015 Bacteria 777
699 Ga0450922_045110 3300042124 Bacteria 505
700 Ga0450895_034085 3300042132 Bacteria 504
701 Ga0450896_078439 3300042133 Bacteria 554
702 Ga0439446_0021847 3300042156 Bacteria 1810
703 Ga0439446_0059487 3300042156 Bacteria 1153
704 Ga0439446_0144531 3300042156 Bacteria 779
705 Ga0439434_0004722 3300042435 Bacteria 3992
706 Ga0439434_0106819 3300042435 Bacteria 905
707 Ga0439435_0013044 3300042436 Bacteria 2025
708 Ga0439464_0053692 3300042439 Bacteria 1170
709 Ga0439460_0045238 3300042461 Bacteria 1305
710 Ga0451577_0011198 3300042876 Bacteria 8505
711 Ga0451577_0089131 3300042876 Unclassified 2753
712 Ga0451577_0195978 3300042876 Bacteria 1823
713 Ga0451577_0200088 3300042876 Bacteria 1803
714 Ga0451577_0475111 3300042876 Bacteria 1135
715 Ga0451577_0495909 3300042876 Bacteria 1109
716 Ga0451577_0502082 3300042876 Bacteria 1101
717 Ga0451577_0816842 3300042876 Bacteria 842
718 Ga0451577_1328782 3300042876 Bacteria 639
719 Ga0439440_0033688 3300042993 Bacteria 1222
720 Ga0453683_0171190 3300044673 Bacteria 1376
721 Ga0453683_0196832 3300044673 Bacteria 1280
722 Ga0453683_0434910 3300044673 Bacteria 848
723 Ga0453683_0792224 3300044673 Bacteria 624
724 Ga0453684_0006795 3300044712 Bacteria 21521
725 Ga0453684_0014729 3300044712 Bacteria 12466
726 Ga0453684_0025039 3300044712 Bacteria 8684
727 Ga0453684_0035956 3300044712 Bacteria 6834
728 Ga0453684_0116646 3300044712 Bacteria 3233
729 Ga0453684_0132428 3300044712 Bacteria 2990
730 Ga0453684_0553098 3300044712 Unclassified 1267
731 Ga0453684_0605922 3300044712 Bacteria 1200
732 Ga0453684_2089324 3300044712 Bacteria 568
733 Ga0451576_0000956 3300045051 Bacteria 54199
734 Ga0451576_0225806 3300045051 Bacteria 1955
735 Ga0451576_0893860 3300045051 Bacteria 932
736 Ga0451576_1283628 3300045051 Unclassified 763
737 Ga0451576_1812629 3300045051 Bacteria 631
738 Ga0451576_2325761 3300045051 Unclassified 549
739 Ga0495592_0628498 3300046454 Bacteria 652
740 Ga0495603_0018770 3300046455 Bacteria 4186
741 Ga0495629_0022981 3300046459 Bacteria 4444
742 Ga0495638_0007866 3300046460 Bacteria 7605
743 Ga0495638_0030256 3300046460 Bacteria 3487
744 Ga0495580_0011289 3300046472 Bacteria 6913
745 Ga0495580_0291328 3300046472 Bacteria 1113
746 Ga0495639_0009532 3300046475 Bacteria 4167
747 Ga0495662_0291902 3300046476 Bacteria 802
748 Ga0495664_0140157 3300046477 Bacteria 1466
749 Ga0495594_0129558 3300046499 Bacteria 1428
750 Ga0495594_0133768 3300046499 Bacteria 1405
751 Ga0495608_0353175 3300046511 Bacteria 905
752 Ga0495618_0275526 3300046514 Bacteria 1050
753 Ga0495628_0062260 3300046516 Bacteria 2925
754 Ga0495630_0559952 3300046517 Bacteria 876
755 Ga0495648_0391502 3300046524 Bacteria 624
756 Ga0495663_0172998 3300046525 Bacteria 745
757 Ga0495666_0005554 3300046526 Bacteria 6354
758 Ga0495665_0005040 3300046531 Bacteria 7123
759 Ga0495665_0077382 3300046531 Bacteria 1751
760 Ga0495640_0043425 3300046533 Bacteria 3131
761 Ga0495622_0277241 3300046557 Bacteria 734
762 Ga0495633_0079535 3300046558 Bacteria 1526
763 Ga0495634_0093925 3300046642 Bacteria 1944
764 Ga0495647_0000571 3300046681 Bacteria 10870
765 Ga0495658_0007179 3300046683 Bacteria 5502
766 Ga0495658_0050305 3300046683 Bacteria 2357
767 Ga0495613_0015997 3300046689 Bacteria 5584
768 Ga0495613_0135472 3300046689 Bacteria 1762
769 Ga0495613_0886801 3300046689 Unclassified 578
770 Ga0495624_0215506 3300046690 Bacteria 1164
771 Ga0495670_0560480 3300046691 Bacteria 622
772 Ga0495589_0245621 3300046794 Bacteria 837
773 Ga0495581_0005976 3300047315 Bacteria 7050
774 Ga0495604_0070562 3300047317 Bacteria 2645
775 Ga0495636_0393257 3300047318 Bacteria 659
776 Ga0495674_0040657 3300047319 Bacteria 4157
777 Ga0495674_0248044 3300047319 Bacteria 1466
778 Ga0495676_0031186 3300047321 Bacteria 4511
779 Ga0495593_0018936 3300047673 Bacteria 3863
780 Ga0495602_0083542 3300048088 Bacteria 2675
781 Ga0495614_0041847 3300048089 Bacteria 1965
782 Ga0496100_0473832 3300048903 Bacteria 962
783 Ga0496100_1086932 3300048903 Bacteria 630
784 Ga0496104_0237980 3300048907 Bacteria 1733
785 Ga0496105_0458009 3300048908 Bacteria 1006
786 Ga0496108_0460699 3300048911 Bacteria 1111
787 Ga0496108_1003131 3300048911 Bacteria 713
788 Ga0496109_0302128 3300048912 Bacteria 1509
789 Ga0496109_0434127 3300048912 Bacteria 1241
790 Ga0496109_0806525 3300048912 Bacteria 877
791 Ga0496109_0899992 3300048912 Bacteria 823
792 Ga0496109_1124964 3300048912 Bacteria 722
793 Ga0496112_1414553 3300048915 Bacteria 610
794 Ga0496113_0228752 3300048916 Bacteria 1483
795 Ga0496114_0129125 3300048917 Bacteria 2181
796 Ga0496114_1201194 3300048917 Bacteria 644
797 Ga0496125_0187350 3300048928 Bacteria 1370
798 Ga0501290_020932 3300049513 Unclassified 895
799 Ga0501299_003607 3300049522 Bacteria 2255
800 Ga0501031_0029982 3300049568 Bacteria 3548
801 Ga0501032_0096139 3300049569 Bacteria 1963
802 Ga0501032_0346337 3300049569 Bacteria 957
803 Ga0501033_0092758 3300049570 Bacteria 2208
804 Ga0501033_0256371 3300049570 Bacteria 1239
805 Ga0501034_0009195 3300049571 Bacteria 10366
806 Ga0501034_0288502 3300049571 Bacteria 1579
807 Ga0501036_0030301 3300049572 Bacteria 4572
808 Ga0501036_0231535 3300049572 Bacteria 1550
809 Ga0501036_0920754 3300049572 Bacteria 717
810 Ga0501037_0508608 3300049573 Unclassified 816
811 Ga0501038_0041127 3300049574 Bacteria 4032
812 Ga0501038_0250362 3300049574 Bacteria 1404
813 Ga0501038_0441386 3300049574 Bacteria 1002
814 Ga0501038_0609392 3300049574 Bacteria 825
815 Ga0501039_0127623 3300049575 Bacteria 1995
816 Ga0501040_0125122 3300049576 Bacteria 1806
817 Ga0501040_0313026 3300049576 Unclassified 1123
818 Ga0501041_0048882 3300049577 Bacteria 2576
819 Ga0501041_0290288 3300049577 Bacteria 1030
820 Ga0501042_0129327 3300049578 Bacteria 1820
821 Ga0501042_0556685 3300049578 Bacteria 833
822 Ga0501042_0659131 3300049578 Bacteria 761
823 Ga0501043_0103882 3300049579 Bacteria 2232
824 Ga0501043_0216620 3300049579 Bacteria 1482
825 Ga0501046_0246999 3300049580 Bacteria 1315
826 Ga0501046_0364830 3300049580 Bacteria 1047
827 Ga0501046_0405158 3300049580 Bacteria 985
828 Ga0501046_0834782 3300049580 Bacteria 645
829 Ga0501046_0878687 3300049580 Bacteria 626
830 Ga0501046_1269744 3300049580 Bacteria 504
831 Ga0501047_0001174 3300049581 Bacteria 25954
832 Ga0501047_0192643 3300049581 Bacteria 1901
833 Ga0501048_0798599 3300049582 Bacteria 678
834 Ga0501048_0877791 3300049582 Bacteria 645
835 Ga0501048_0977663 3300049582 Bacteria 609
836 Ga0501048_1015926 3300049582 Bacteria 596
837 Ga0501068_0419141 3300049584 Bacteria 864
838 Ga0501070_0047126 3300049586 Bacteria 3583
839 Ga0501070_0596073 3300049586 Bacteria 881
840 Ga0501071_0064966 3300049587 Bacteria 2649
841 Ga0501071_0094075 3300049587 Bacteria 2204
842 Ga0501071_0599595 3300049587 Bacteria 847
843 Ga0501071_0933235 3300049587 Bacteria 670
844 Ga0501072_0013236 3300049588 Bacteria 6319
845 Ga0501072_0184273 3300049588 Bacteria 1666
846 Ga0501073_0000842 3300049589 Bacteria 21848
847 Ga0501073_0039381 3300049589 Bacteria 3349
848 Ga0501073_0165887 3300049589 Bacteria 1529
849 Ga0501073_0183524 3300049589 Bacteria 1448
850 Ga0501073_0311642 3300049589 Bacteria 1086
851 Ga0501075_0037185 3300049591 Bacteria 3636
852 Ga0501075_0227424 3300049591 Bacteria 1423
853 Ga0501075_0299797 3300049591 Bacteria 1225
854 Ga0501075_0443871 3300049591 Bacteria 989
855 Ga0501075_0709344 3300049591 Bacteria 766
856 Ga0501076_0021140 3300049592 Bacteria 4987
857 Ga0501076_0060494 3300049592 Bacteria 3014
858 Ga0501076_0214800 3300049592 Bacteria 1572
859 Ga0501076_0360818 3300049592 Bacteria 1194
860 Ga0501077_0112643 3300049593 Bacteria 1725
861 Ga0501249_023517 3300049679 Bacteria 1353
862 Ga0501229_063525 3300049706 Unclassified 567
863 Ga0501234_070624 3300049707 Unclassified 603
864 Ga0501079_0305094 3300049741 Bacteria 1246
865 Ga0501080_0049961 3300049742 Bacteria 3893
866 Ga0501080_0146765 3300049742 Bacteria 2181
867 Ga0501081_0119802 3300049743 Bacteria 1873
868 Ga0501081_0218636 3300049743 Bacteria 1385
869 Ga0501081_0571635 3300049743 Bacteria 845
870 Ga0501081_1009826 3300049743 Unclassified 629
871 Ga0501081_1239875 3300049743 Bacteria 565
872 Ga0501267_041421 3300049764 Unclassified 575
873 Ga0501273_006920 3300049770 Bacteria 1325
874 Ga0501283_025994 3300049779 Unclassified 961
875 Ga0501035_0138889 3300049822 Bacteria 2113
876 Ga0501035_0595293 3300049822 Bacteria 902
877 Ga0501035_1260706 3300049822 Bacteria 571
878 Ga0501035_1522115 3300049822 Bacteria 510
879 Ga0501044_0203071 3300049823 Bacteria 1939
880 Ga0501044_0496191 3300049823 Bacteria 1122
881 Ga0501044_0773963 3300049823 Bacteria 840
882 Ga0501045_0079391 3300049824 Bacteria 2419
883 Ga0501045_0247064 3300049824 Bacteria 1328
884 Ga0501045_0664602 3300049824 Unclassified 770
885 nmdc:mga03n38_134423_c1 3300050490 Bacteria 1229
886 nmdc:mga00v17_255223_c1 3300050491 Bacteria 1137
887 nmdc:mga00v17_298329_c1 3300050491 Bacteria 1047
888 nmdc:mga00v17_53025_c1 3300050491 Bacteria 2471
889 nmdc:mga00v17_64952_c1 3300050491 Bacteria 2250
890 nmdc:mga0yw44_11740_c1 3300050492 Bacteria 4538
891 nmdc:mga0k408_149532_c2 3300050493 Bacteria 1002
892 nmdc:mga0k408_37903_c1 3300050493 Bacteria 1884
893 nmdc:mga0k408_631782_c1 3300050493 Bacteria 630
894 nmdc:mga06z11_223245_c1 3300050494 Bacteria 1102
895 nmdc:mga06z11_484490_c1 3300050494 Bacteria 749
896 nmdc:mga07m45_36229_c1 3300050496 Bacteria 2747
897 nmdc:mga07m45_86012_c1 3300050496 Bacteria 1798
898 nmdc:mga07m45_89282_c1 3300050496 Bacteria 1765
899 nmdc:mga05p37_1659682_c1 3300050507 Bacteria 626
900 nmdc:mga05p37_476857_c1 3300050507 Bacteria 1438
901 nmdc:mga05p37_503656_c1 3300050507 Bacteria 1389
902 nmdc:mga09592_1520402_c1 3300050508 Bacteria 544
903 nmdc:mga09592_547467_c1 3300050508 Bacteria 994
904 nmdc:mga09592_940956_c1 3300050508 Bacteria 725
905 nmdc:mga0qj67_1070389_c1 3300050509 Bacteria 631
906 nmdc:mga0qj67_1504440_c1 3300050509 Bacteria 518
907 nmdc:mga0qj67_17312_c1 3300050509 Bacteria 5478
908 nmdc:mga0qj67_225639_c1 3300050509 Unclassified 1520
909 nmdc:mga0qj67_310499_c1 3300050509 Bacteria 1277
910 nmdc:mga0qj67_312957_c1 3300050509 Bacteria 1271
911 nmdc:mga0qj67_608058_c1 3300050509 Bacteria 874
912 nmdc:mga06r32_14950_c1 3300050510 Bacteria 7044
913 nmdc:mga06r32_1711606_c1 3300050510 Bacteria 566
914 nmdc:mga06r32_368653_c1 3300050510 Bacteria 1419
915 nmdc:mga06r32_499574_c1 3300050510 Bacteria 1193
916 nmdc:mga06r32_767296_c1 3300050510 Bacteria 926
917 nmdc:mga06r32_867484_c1 3300050510 Bacteria 860
918 nmdc:mga06r32_979069_c1 3300050510 Bacteria 799
919 nmdc:mga08y16_126640_c1 3300050511 Bacteria 2656
920 nmdc:mga08y16_1369_c1 3300050511 Bacteria 24366
921 nmdc:mga08y16_215065_c1 3300050511 Bacteria 1990
922 nmdc:mga08y16_4286_c1 3300050511 Bacteria 14889
923 nmdc:mga08y16_442795_c1 3300050511 Bacteria 1326
924 nmdc:mga08y16_761213_c1 3300050511 Bacteria 964
925 nmdc:mga08y16_78703_c1 3300050511 Bacteria 3437
926 nmdc:mga0n895_122840_c1 3300050512 Bacteria 2618
927 nmdc:mga0n895_25335_c1 3300050512 Bacteria 5603
928 nmdc:mga0rr50_1855643_c1 3300050513 Bacteria 507
929 nmdc:mga0rr50_835197_c1 3300050513 Bacteria 786
930 nmdc:mga08x19_4109_c1 3300050514 Bacteria 8637
931 nmdc:mga08x19_468248_c1 3300050514 Bacteria 888
932 nmdc:mga08x19_7041_c1 3300050514 Bacteria 6676
933 nmdc:mga08x19_815279_c1 3300050514 Unclassified 663
934 Ga0500616_0070674 3300053153 Bacteria 1781
935 Ga0500611_051238 3300053727 Bacteria 946
936 Ga0501084_0016296 3300054114 Bacteria 6171
937 Ga0501084_0735392 3300054114 Bacteria 831
938 Ga0501084_1173081 3300054114 Bacteria 644
939 Ga0501084_1215078 3300054114 Bacteria 632
940 Ga0501084_1239844 3300054114 Bacteria 625
941 Ga0501084_1703246 3300054114 Bacteria 527
942 Ga0590071_000060 3300059421 Bacteria 29173
943 Ga0590071_020967 3300059421 Bacteria 1539
944 Ga0590074_000203 3300059423 Bacteria 7654
945 Ga0590074_124798 3300059423 Unclassified 514
946 Ga0590075_000338 3300059424 Bacteria 13058
947 Ga0590075_006284 3300059424 Bacteria 2818
948 Ga0590077_000202 3300059426 Bacteria 17335
949 Ga0590077_019779 3300059426 Bacteria 1427
950 Ga0501082_0140198 3300060353 Bacteria 2099
951 Ga0501082_0333227 3300060353 Bacteria 1322
952 Ga0501082_0524458 3300060353 Bacteria 1035
953 Ga0501082_0738902 3300060353 Unclassified 861
954 Ga0530510_0093709 3300061734 Bacteria 2193
955 Ga0530510_0432574 3300061734 Bacteria 994
956 Ga0530510_0691743 3300061734 Bacteria 777
957 Ga0530510_0734462 3300061734 Bacteria 753
958 Ga0530510_0955878 3300061734 Bacteria 655
959 Ga0530510_1234127 3300061734 Bacteria 573
960 Ga0530510_1300903 3300061734 Bacteria 558

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025907 Ga0207645_10629284 Ga0207645_106292842 131
2 3300049580 Ga0501046_0878687 Ga0501046_0878687_87_491 132
3 3300048928 Ga0496125_0187350 Ga0496125_0187350_236_640 134
4 3300049580 Ga0501046_0246999 Ga0501046_0246999_73_483 135
5 3300049742 Ga0501080_0146765 Ga0501080_0146765_1477_1887 135
6 3300049743 Ga0501081_0119802 Ga0501081_0119802_1273_1683 135
7 3300060353 Ga0501082_0140198 Ga0501082_0140198_1487_1894 135
8 3300005295 Ga0065707_10005793 Ga0065707_100057932 136
9 3300005331 Ga0070670_101358526 Ga0070670_1013585261 136
10 3300005336 Ga0070680_100197373 Ga0070680_1001973731 136
11 3300005336 Ga0070680_100860824 Ga0070680_1008608242 136
12 3300005343 Ga0070687_101105960 Ga0070687_1011059601 136
13 3300005354 Ga0070675_100444097 Ga0070675_1004440972 136
14 3300005354 Ga0070675_100682381 Ga0070675_1006823812 136
15 3300005356 Ga0070674_100089702 Ga0070674_1000897023 136
16 3300005364 Ga0070673_101508236 Ga0070673_1015082361 136
17 3300005367 Ga0070667_100969762 Ga0070667_1009697622 136
18 3300005438 Ga0070701_10212838 Ga0070701_102128382 136
19 3300005440 Ga0070705_100672958 Ga0070705_1006729581 136
20 3300005441 Ga0070700_100059804 Ga0070700_1000598042 136
21 3300005441 Ga0070700_100391884 Ga0070700_1003918842 136
22 3300005456 Ga0070678_100267319 Ga0070678_1002673192 136
23 3300005535 Ga0070684_101475018 Ga0070684_1014750182 136
24 3300005543 Ga0070672_101993736 Ga0070672_1019937361 136
25 3300005546 Ga0070696_100777012 Ga0070696_1007770122 136
26 3300005615 Ga0070702_100927566 Ga0070702_1009275661 136
27 3300005841 Ga0068863_100622559 Ga0068863_1006225592 136
28 3300005842 Ga0068858_100689252 Ga0068858_1006892522 136
29 3300005843 Ga0068860_101355042 Ga0068860_1013550422 136
30 3300006237 Ga0097621_100329929 Ga0097621_1003299292 136
31 3300006237 Ga0097621_100898233 Ga0097621_1008982332 136
32 3300006844 Ga0075428_100379392 Ga0075428_1003793922 136
33 3300006846 Ga0075430_100148983 Ga0075430_1001489833 136
34 3300006846 Ga0075430_100160396 Ga0075430_1001603962 136
35 3300006847 Ga0075431_100472410 Ga0075431_1004724102 136
36 3300006871 Ga0075434_100068600 Ga0075434_1000686004 136
37 3300006880 Ga0075429_100720730 Ga0075429_1007207302 136
38 3300006881 Ga0068865_100547007 Ga0068865_1005470072 136
39 3300009094 Ga0111539_10012966 Ga0111539_100129665 136
40 3300009094 Ga0111539_10087032 Ga0111539_100870325 136
41 3300009094 Ga0111539_10129573 Ga0111539_101295732 136
42 3300009094 Ga0111539_10184332 Ga0111539_101843324 136
43 3300009094 Ga0111539_10235811 Ga0111539_102358113 136
44 3300009094 Ga0111539_10497423 Ga0111539_104974233 136
45 3300009094 Ga0111539_11709641 Ga0111539_117096412 136
46 3300009094 Ga0111539_13455072 Ga0111539_134550721 136
47 3300009147 Ga0114129_10069113 Ga0114129_100691135 136
48 3300009148 Ga0105243_12777543 Ga0105243_127775431 136
49 3300009177 Ga0105248_10157617 Ga0105248_101576173 136
50 3300009553 Ga0105249_10877083 Ga0105249_108770833 136
51 3300013297 Ga0157378_10463408 Ga0157378_104634082 136
52 3300013308 Ga0157375_10598570 Ga0157375_105985702 136
53 3300014325 Ga0163163_10000017 Ga0163163_1000001773 136
54 3300014325 Ga0163163_12769509 Ga0163163_127695091 136
55 3300014326 Ga0157380_10000592 Ga0157380_100005927 136
56 3300014326 Ga0157380_10027828 Ga0157380_100278285 136
57 3300014326 Ga0157380_10070065 Ga0157380_100700652 136
58 3300014326 Ga0157380_11552319 Ga0157380_115523191 136
59 3300014745 Ga0157377_10118117 Ga0157377_101181172 136
60 3300014969 Ga0157376_10036646 Ga0157376_100366465 136
61 3300025917 Ga0207660_10382759 Ga0207660_103827592 136
62 3300025918 Ga0207662_10408934 Ga0207662_104089342 136
63 3300025918 Ga0207662_10910704 Ga0207662_109107042 136
64 3300025926 Ga0207659_10083746 Ga0207659_100837462 136
65 3300025926 Ga0207659_10155706 Ga0207659_101557062 136
66 3300025936 Ga0207670_10057836 Ga0207670_100578362 136
67 3300025940 Ga0207691_10853150 Ga0207691_108531501 136
68 3300025986 Ga0207658_11470553 Ga0207658_114705532 136
69 3300026023 Ga0207677_11437837 Ga0207677_114378372 136
70 3300026041 Ga0207639_11256340 Ga0207639_112563402 136
71 3300026075 Ga0207708_10053891 Ga0207708_100538914 136
72 3300026075 Ga0207708_10064508 Ga0207708_100645084 136
73 3300026089 Ga0207648_11890251 Ga0207648_118902511 136
74 3300026121 Ga0207683_10157463 Ga0207683_101574632 136
75 3300026121 Ga0207683_10715479 Ga0207683_107154792 136
76 3300026121 Ga0207683_10869864 Ga0207683_108698642 136
77 3300026142 Ga0207698_10852266 Ga0207698_108522662 136
78 3300027907 Ga0207428_10002456 Ga0207428_100024567 136
79 3300027907 Ga0207428_10024210 Ga0207428_100242104 136
80 3300031731 Ga0307405_10812331 Ga0307405_108123312 136
81 3300031903 Ga0307407_10293894 Ga0307407_102938942 136
82 3300031911 Ga0307412_10070651 Ga0307412_100706513 136
83 3300031911 Ga0307412_11617794 Ga0307412_116177942 136
84 3300032002 Ga0307416_100224917 Ga0307416_1002249172 136
85 3300032002 Ga0307416_100996683 Ga0307416_1009966832 136
86 3300032002 Ga0307416_101010352 Ga0307416_1010103522 136
87 3300032002 Ga0307416_103214251 Ga0307416_1032142512 136
88 3300032005 Ga0307411_10257847 Ga0307411_102578471 136
89 3300035695 Ga0373927_1121750 Ga0373927_1121750_87_503 136
90 3300041458 Ga0451798_1001455 Ga0451798_1001455_75_485 136
91 3300041458 Ga0451798_1010594 Ga0451798_1010594_53_469 136
92 3300041463 Ga0451804_1178722 Ga0451804_1178722_236_646 136
93 3300041486 Ga0451807_0101166 Ga0451807_0101166_132_542 136
94 3300041496 Ga0451839_1101301 Ga0451839_1101301_168_578 136
95 3300041512 Ga0451853_3591999 Ga0451853_3591999_86_496 136
96 3300041999 Ga0439433_0182863 Ga0439433_0182863_128_538 136
97 3300042003 Ga0439443_041728 Ga0439443_041728_112_522 136
98 3300042124 Ga0450922_045110 Ga0450922_045110_81_491 136
99 3300042132 Ga0450895_034085 Ga0450895_034085_36_446 136
100 3300042133 Ga0450896_078439 Ga0450896_078439_64_474 136
101 3300042156 Ga0439446_0144531 Ga0439446_0144531_109_519 136
102 3300042436 Ga0439435_0013044 Ga0439435_0013044_701_1111 136
103 3300046525 Ga0495663_0172998 Ga0495663_0172998_168_578 136
104 3300046691 Ga0495670_0560480 Ga0495670_0560480_147_557 136
105 3300048908 Ga0496105_0458009 Ga0496105_0458009_244_657 136
106 3300048917 Ga0496114_0129125 Ga0496114_0129125_1455_1868 136
107 3300049569 Ga0501032_0346337 Ga0501032_0346337_308_724 136
108 3300049571 Ga0501034_0009195 Ga0501034_0009195_47_463 136
109 3300049571 Ga0501034_0288502 Ga0501034_0288502_289_705 136
110 3300049572 Ga0501036_0231535 Ga0501036_0231535_425_841 136
111 3300049573 Ga0501037_0508608 Ga0501037_0508608_175_591 136
112 3300049574 Ga0501038_0609392 Ga0501038_0609392_32_442 136
113 3300049576 Ga0501040_0125122 Ga0501040_0125122_611_1021 136
114 3300049579 Ga0501043_0103882 Ga0501043_0103882_991_1407 136
115 3300049580 Ga0501046_0405158 Ga0501046_0405158_360_770 136
116 3300049580 Ga0501046_0834782 Ga0501046_0834782_104_514 136
117 3300049581 Ga0501047_0001174 Ga0501047_0001174_714_1130 136
118 3300049582 Ga0501048_0798599 Ga0501048_0798599_143_553 136
119 3300049582 Ga0501048_0977663 Ga0501048_0977663_90_500 136
120 3300049582 Ga0501048_1015926 Ga0501048_1015926_86_496 136
121 3300049586 Ga0501070_0596073 Ga0501070_0596073_15_431 136
122 3300049587 Ga0501071_0064966 Ga0501071_0064966_429_839 136
123 3300049589 Ga0501073_0000842 Ga0501073_0000842_20290_20700 136
124 3300049589 Ga0501073_0039381 Ga0501073_0039381_1053_1469 136
125 3300049589 Ga0501073_0165887 Ga0501073_0165887_271_687 136
126 3300049591 Ga0501075_0227424 Ga0501075_0227424_806_1216 136
127 3300049591 Ga0501075_0299797 Ga0501075_0299797_434_844 136
128 3300049591 Ga0501075_0443871 Ga0501075_0443871_285_695 136
129 3300049592 Ga0501076_0060494 Ga0501076_0060494_515_925 136
130 3300049593 Ga0501077_0112643 Ga0501077_0112643_77_493 136
131 3300049823 Ga0501044_0496191 Ga0501044_0496191_134_550 136
132 3300049823 Ga0501044_0773963 Ga0501044_0773963_13_429 136
133 3300050493 nmdc:mga0k408_631782_c1 nmdc:mga0k408_631782_c1_82_492 136
134 3300050507 nmdc:mga05p37_1659682_c1 nmdc:mga05p37_1659682_c1_44_454 136
135 3300050507 nmdc:mga05p37_503656_c1 nmdc:mga05p37_503656_c1_688_1098 136
136 3300050508 nmdc:mga09592_1520402_c1 nmdc:mga09592_1520402_c1_26_436 136
137 3300050508 nmdc:mga09592_940956_c1 nmdc:mga09592_940956_c1_128_538 136
138 3300050509 nmdc:mga0qj67_1070389_c1 nmdc:mga0qj67_1070389_c1_55_465 136
139 3300050509 nmdc:mga0qj67_225639_c1 nmdc:mga0qj67_225639_c1_1038_1448 136
140 3300050510 nmdc:mga06r32_867484_c1 nmdc:mga06r32_867484_c1_160_585 136
141 3300050511 nmdc:mga08y16_126640_c1 nmdc:mga08y16_126640_c1_1239_1652 136
142 3300050511 nmdc:mga08y16_1369_c1 nmdc:mga08y16_1369_c1_17074_17484 136
143 3300050511 nmdc:mga08y16_4286_c1 nmdc:mga08y16_4286_c1_3395_3805 136
144 3300050511 nmdc:mga08y16_761213_c1 nmdc:mga08y16_761213_c1_36_446 136
145 3300050511 nmdc:mga08y16_78703_c1 nmdc:mga08y16_78703_c1_134_544 136
146 3300050512 nmdc:mga0n895_25335_c1 nmdc:mga0n895_25335_c1_514_924 136
147 3300050513 nmdc:mga0rr50_835197_c1 nmdc:mga0rr50_835197_c1_342_752 136
148 3300053153 Ga0500616_0070674 Ga0500616_0070674_992_1408 136
149 3300054114 Ga0501084_0016296 Ga0501084_0016296_4930_5346 136
150 3300054114 Ga0501084_0735392 Ga0501084_0735392_36_446 136
151 3300054114 Ga0501084_1703246 Ga0501084_1703246_25_435 136
152 3300060353 Ga0501082_0524458 Ga0501082_0524458_298_714 136
153 iso_pu_bacteria 2511231025 2511381660 136
154 iso_pu_bacteria 2511231035 2511432739 136
155 iso_pu_bacteria 2608642108 2608670215 136
156 iso_pu_bacteria 2648501693 2650895989 136
157 iso_pu_bacteria 2684622997 2686356037 136
158 iso_pu_bacteria 2808606414 2809127340 136
159 iso_pu_bacteria 2844528606 2844529344 136
160 iso_pu_bacteria 2847797336 2847798727 136
161 iso_pu_bacteria 2865014394 2865017154 136
162 iso_pu_bacteria 2876601092 2876603061 136
163 iso_pu_bacteria 2881609920 2881610281 136
164 iso_pu_bacteria 2939602548 2939604345 136
165 iso_pu_bacteria 2945951305 2945951927 136
166 iso_pu_bacteria 2978975091 2978978475 136
167 iso_pu_bacteria 2984494565 2984497773 136
168 iso_pu_bacteria 2990261002 2990261718 136
169 iso_pu_bacteria 8016733728 8016734858 136
170 iso_pu_bacteria 8019499862 8019501656 136
171 3300005293 Ga0065715_10350156 Ga0065715_103501561 137
172 3300005328 Ga0070676_10004905 Ga0070676_100049056 137
173 3300005330 Ga0070690_100016281 Ga0070690_1000162812 137
174 3300005331 Ga0070670_100024993 Ga0070670_1000249933 137
175 3300005331 Ga0070670_100299431 Ga0070670_1002994313 137
176 3300005334 Ga0068869_101024769 Ga0068869_1010247691 137
177 3300005335 Ga0070666_10096283 Ga0070666_100962832 137
178 3300005335 Ga0070666_10389840 Ga0070666_103898402 137
179 3300005335 Ga0070666_10564455 Ga0070666_105644552 137
180 3300005336 Ga0070680_100126478 Ga0070680_1001264783 137
181 3300005336 Ga0070680_100386735 Ga0070680_1003867352 137
182 3300005337 Ga0070682_100000035 Ga0070682_1000000352 137
183 3300005338 Ga0068868_100312725 Ga0068868_1003127253 137
184 3300005338 Ga0068868_100328456 Ga0068868_1003284562 137
185 3300005340 Ga0070689_100144658 Ga0070689_1001446583 137
186 3300005340 Ga0070689_100246628 Ga0070689_1002466282 137
187 3300005340 Ga0070689_100619926 Ga0070689_1006199263 137
188 3300005343 Ga0070687_100051272 Ga0070687_1000512723 137
189 3300005347 Ga0070668_100213689 Ga0070668_1002136894 137
190 3300005347 Ga0070668_101307667 Ga0070668_1013076671 137
191 3300005353 Ga0070669_100191698 Ga0070669_1001916982 137
192 3300005353 Ga0070669_100224737 Ga0070669_1002247372 137
193 3300005353 Ga0070669_100309031 Ga0070669_1003090312 137
194 3300005353 Ga0070669_101323243 Ga0070669_1013232432 137
195 3300005354 Ga0070675_100007339 Ga0070675_1000073393 137
196 3300005354 Ga0070675_100011756 Ga0070675_1000117565 137
197 3300005354 Ga0070675_100117308 Ga0070675_1001173083 137
198 3300005354 Ga0070675_100118121 Ga0070675_1001181214 137
199 3300005354 Ga0070675_100161591 Ga0070675_1001615913 137
200 3300005355 Ga0070671_100016291 Ga0070671_1000162915 137
201 3300005355 Ga0070671_100308936 Ga0070671_1003089363 137
202 3300005356 Ga0070674_100004717 Ga0070674_1000047179 137
203 3300005356 Ga0070674_100100452 Ga0070674_1001004523 137
204 3300005356 Ga0070674_100902262 Ga0070674_1009022621 137
205 3300005356 Ga0070674_101283134 Ga0070674_1012831341 137
206 3300005364 Ga0070673_100001825 Ga0070673_1000018255 137
207 3300005364 Ga0070673_100012360 Ga0070673_1000123605 137
208 3300005364 Ga0070673_100034826 Ga0070673_1000348263 137
209 3300005366 Ga0070659_100612076 Ga0070659_1006120761 137
210 3300005436 Ga0070713_100003643 Ga0070713_1000036432 137
211 3300005436 Ga0070713_100068677 Ga0070713_1000686773 137
212 3300005436 Ga0070713_100380630 Ga0070713_1003806302 137
213 3300005438 Ga0070701_11094547 Ga0070701_110945471 137
214 3300005438 Ga0070701_11198964 Ga0070701_111989641 137
215 3300005441 Ga0070700_100027077 Ga0070700_1000270774 137
216 3300005455 Ga0070663_100005932 Ga0070663_1000059327 137
217 3300005455 Ga0070663_101229794 Ga0070663_1012297941 137
218 3300005456 Ga0070678_100232589 Ga0070678_1002325892 137
219 3300005456 Ga0070678_100251862 Ga0070678_1002518622 137
220 3300005456 Ga0070678_101319216 Ga0070678_1013192162 137
221 3300005457 Ga0070662_101367258 Ga0070662_1013672581 137
222 3300005458 Ga0070681_10386725 Ga0070681_103867252 137
223 3300005459 Ga0068867_100001976 Ga0068867_10000197610 137
224 3300005459 Ga0068867_100257001 Ga0068867_1002570014 137
225 3300005459 Ga0068867_100894192 Ga0068867_1008941922 137
226 3300005466 Ga0070685_10043106 Ga0070685_100431062 137
227 3300005466 Ga0070685_10182558 Ga0070685_101825582 137
228 3300005471 Ga0070698_100149275 Ga0070698_1001492753 137
229 3300005471 Ga0070698_101801867 Ga0070698_1018018671 137
230 3300005530 Ga0070679_100206714 Ga0070679_1002067143 137
231 3300005535 Ga0070684_100250800 Ga0070684_1002508002 137
232 3300005539 Ga0068853_100137168 Ga0068853_1001371681 137
233 3300005543 Ga0070672_100018076 Ga0070672_1000180764 137
234 3300005543 Ga0070672_100099015 Ga0070672_1000990153 137
235 3300005543 Ga0070672_100354547 Ga0070672_1003545472 137
236 3300005548 Ga0070665_100000839 Ga0070665_10000083914 137
237 3300005548 Ga0070665_100311134 Ga0070665_1003111343 137
238 3300005548 Ga0070665_100382985 Ga0070665_1003829853 137
239 3300005548 Ga0070665_101901620 Ga0070665_1019016201 137
240 3300005549 Ga0070704_100014629 Ga0070704_1000146293 137
241 3300005563 Ga0068855_100919981 Ga0068855_1009199812 137
242 3300005564 Ga0070664_100512074 Ga0070664_1005120743 137
243 3300005577 Ga0068857_100100694 Ga0068857_1001006943 137
244 3300005577 Ga0068857_101561824 Ga0068857_1015618242 137
245 3300005578 Ga0068854_100004717 Ga0068854_1000047179 137
246 3300005617 Ga0068859_100000040 Ga0068859_10000004011 137
247 3300005617 Ga0068859_100000468 Ga0068859_10000046828 137
248 3300005617 Ga0068859_100093442 Ga0068859_1000934423 137
249 3300005617 Ga0068859_101607846 Ga0068859_1016078462 137
250 3300005617 Ga0068859_102497575 Ga0068859_1024975751 137
251 3300005618 Ga0068864_100029316 Ga0068864_1000293166 137
252 3300005618 Ga0068864_100277696 Ga0068864_1002776963 137
253 3300005618 Ga0068864_100843259 Ga0068864_1008432592 137
254 3300005718 Ga0068866_10057567 Ga0068866_100575673 137
255 3300005834 Ga0068851_10415286 Ga0068851_104152862 137
256 3300005840 Ga0068870_10032208 Ga0068870_100322083 137
257 3300005841 Ga0068863_100000307 Ga0068863_10000030746 137
258 3300005841 Ga0068863_100360734 Ga0068863_1003607343 137
259 3300005841 Ga0068863_100369372 Ga0068863_1003693722 137
260 3300005841 Ga0068863_101474573 Ga0068863_1014745731 137
261 3300005841 Ga0068863_101863406 Ga0068863_1018634062 137
262 3300005842 Ga0068858_100016825 Ga0068858_1000168255 137
263 3300005842 Ga0068858_100026210 Ga0068858_1000262103 137
264 3300005843 Ga0068860_100008532 Ga0068860_10000853212 137
265 3300005843 Ga0068860_100402722 Ga0068860_1004027221 137
266 3300005983 Ga0081540_1055956 Ga0081540_10559563 137
267 3300006028 Ga0070717_10031295 Ga0070717_100312956 137
268 3300006173 Ga0070716_101082612 Ga0070716_1010826121 137
269 3300006175 Ga0070712_100489098 Ga0070712_1004890982 137
270 3300006237 Ga0097621_100097468 Ga0097621_1000974683 137
271 3300006358 Ga0068871_100338928 Ga0068871_1003389282 137
272 3300006358 Ga0068871_100362735 Ga0068871_1003627352 137
273 3300006844 Ga0075428_100017091 Ga0075428_1000170916 137
274 3300006846 Ga0075430_100010683 Ga0075430_1000106835 137
275 3300006846 Ga0075430_100069350 Ga0075430_1000693504 137
276 3300006846 Ga0075430_100244826 Ga0075430_1002448262 137
277 3300006846 Ga0075430_100433226 Ga0075430_1004332262 137
278 3300006846 Ga0075430_100465898 Ga0075430_1004658982 137
279 3300006846 Ga0075430_100768500 Ga0075430_1007685001 137
280 3300006847 Ga0075431_100040014 Ga0075431_1000400145 137
281 3300006847 Ga0075431_100472933 Ga0075431_1004729333 137
282 3300006847 Ga0075431_100752429 Ga0075431_1007524291 137
283 3300006847 Ga0075431_101234424 Ga0075431_1012344242 137
284 3300006871 Ga0075434_100229839 Ga0075434_1002298392 137
285 3300006881 Ga0068865_100144165 Ga0068865_1001441652 137
286 3300006914 Ga0075436_100026351 Ga0075436_1000263512 137
287 3300006914 Ga0075436_100354341 Ga0075436_1003543412 137
288 3300006914 Ga0075436_100776596 Ga0075436_1007765962 137
289 3300006931 Ga0097620_100000040 Ga0097620_10000004011 137
290 3300006931 Ga0097620_100000468 Ga0097620_10000046810 137
291 3300006931 Ga0097620_100093447 Ga0097620_1000934473 137
292 3300006931 Ga0097620_101607696 Ga0097620_1016076962 137
293 3300006931 Ga0097620_102496979 Ga0097620_1024969791 137
294 3300007076 Ga0075435_101896748 Ga0075435_1018967481 137
295 3300007265 Ga0099794_10081792 Ga0099794_100817924 137
296 3300007265 Ga0099794_10204433 Ga0099794_102044331 137
297 3300007788 Ga0099795_10004626 Ga0099795_100046263 137
298 3300009094 Ga0111539_10174269 Ga0111539_101742692 137
299 3300009094 Ga0111539_10384417 Ga0111539_103844173 137
300 3300009094 Ga0111539_10476842 Ga0111539_104768423 137
301 3300009098 Ga0105245_10083279 Ga0105245_100832793 137
302 3300009098 Ga0105245_10358461 Ga0105245_103584612 137
303 3300009098 Ga0105245_11198718 Ga0105245_111987183 137
304 3300009101 Ga0105247_10179215 Ga0105247_101792152 137
305 3300009101 Ga0105247_10793578 Ga0105247_107935782 137
306 3300009101 Ga0105247_10879786 Ga0105247_108797861 137
307 3300009147 Ga0114129_10053937 Ga0114129_100539372 137
308 3300009148 Ga0105243_10829076 Ga0105243_108290762 137
309 3300009176 Ga0105242_10042077 Ga0105242_100420774 137
310 3300009176 Ga0105242_11940941 Ga0105242_119409411 137
311 3300009177 Ga0105248_10000090 Ga0105248_1000009017 137
312 3300009177 Ga0105248_11291532 Ga0105248_112915323 137
313 3300009177 Ga0105248_11298006 Ga0105248_112980062 137
314 3300009551 Ga0105238_10009190 Ga0105238_100091905 137
315 3300009553 Ga0105249_10917346 Ga0105249_109173462 137
316 3300009553 Ga0105249_12221722 Ga0105249_122217221 137
317 3300010159 Ga0099796_10018181 Ga0099796_100181813 137
318 3300010159 Ga0099796_10335200 Ga0099796_103352002 137
319 3300013102 Ga0157371_10653258 Ga0157371_106532582 137
320 3300013296 Ga0157374_10000008 Ga0157374_10000008399 137
321 3300013296 Ga0157374_10480122 Ga0157374_104801221 137
322 3300013296 Ga0157374_10740794 Ga0157374_107407942 137
323 3300013297 Ga0157378_10280588 Ga0157378_102805883 137
324 3300013297 Ga0157378_10779530 Ga0157378_107795302 137
325 3300013297 Ga0157378_11024300 Ga0157378_110243002 137
326 3300013306 Ga0163162_10067408 Ga0163162_100674083 137
327 3300013306 Ga0163162_10668003 Ga0163162_106680032 137
328 3300013307 Ga0157372_11669647 Ga0157372_116696472 137
329 3300013308 Ga0157375_10000860 Ga0157375_100008602 137
330 3300014325 Ga0163163_10015978 Ga0163163_100159785 137
331 3300014325 Ga0163163_10044160 Ga0163163_100441603 137
332 3300014325 Ga0163163_10115176 Ga0163163_101151763 137
333 3300014325 Ga0163163_10655996 Ga0163163_106559962 137
334 3300014325 Ga0163163_11069072 Ga0163163_110690722 137
335 3300014326 Ga0157380_10041295 Ga0157380_100412953 137
336 3300014326 Ga0157380_10595598 Ga0157380_105955982 137
337 3300014326 Ga0157380_10598470 Ga0157380_105984703 137
338 3300014497 Ga0182008_10239927 Ga0182008_102399272 137
339 3300014745 Ga0157377_10000007 Ga0157377_10000007369 137
340 3300014968 Ga0157379_10000365 Ga0157379_1000036517 137
341 3300014968 Ga0157379_10008665 Ga0157379_100086655 137
342 3300014969 Ga0157376_11481517 Ga0157376_114815171 137
343 3300021358 Ga0213873_10132782 Ga0213873_101327822 137
344 3300021384 Ga0213876_10000008 Ga0213876_1000000853 137
345 3300021388 Ga0213875_10190403 Ga0213875_101904032 137
346 3300024227 Ga0228598_1007044 Ga0228598_10070443 137
347 3300025321 Ga0207656_10004442 Ga0207656_100044425 137
348 3300025893 Ga0207682_10033397 Ga0207682_100333973 137
349 3300025893 Ga0207682_10101100 Ga0207682_101011002 137
350 3300025893 Ga0207682_10139590 Ga0207682_101395902 137
351 3300025893 Ga0207682_10207424 Ga0207682_102074242 137
352 3300025900 Ga0207710_10312966 Ga0207710_103129662 137
353 3300025901 Ga0207688_10090086 Ga0207688_100900862 137
354 3300025903 Ga0207680_10044560 Ga0207680_100445602 137
355 3300025903 Ga0207680_10233687 Ga0207680_102336873 137
356 3300025906 Ga0207699_10192682 Ga0207699_101926823 137
357 3300025907 Ga0207645_10123074 Ga0207645_101230742 137
358 3300025908 Ga0207643_10034115 Ga0207643_100341154 137
359 3300025908 Ga0207643_10972299 Ga0207643_109722991 137
360 3300025912 Ga0207707_10326273 Ga0207707_103262732 137
361 3300025917 Ga0207660_10122482 Ga0207660_101224822 137
362 3300025917 Ga0207660_10149133 Ga0207660_101491332 137
363 3300025918 Ga0207662_10107890 Ga0207662_101078903 137
364 3300025923 Ga0207681_10051558 Ga0207681_100515583 137
365 3300025923 Ga0207681_10135222 Ga0207681_101352223 137
366 3300025923 Ga0207681_10188670 Ga0207681_101886702 137
367 3300025923 Ga0207681_10200913 Ga0207681_102009133 137
368 3300025923 Ga0207681_10238304 Ga0207681_102383042 137
369 3300025925 Ga0207650_10036593 Ga0207650_100365934 137
370 3300025925 Ga0207650_10045226 Ga0207650_100452263 137
371 3300025926 Ga0207659_10004193 Ga0207659_100041936 137
372 3300025926 Ga0207659_10033427 Ga0207659_100334274 137
373 3300025926 Ga0207659_10109367 Ga0207659_101093673 137
374 3300025926 Ga0207659_10154248 Ga0207659_101542484 137
375 3300025926 Ga0207659_10554655 Ga0207659_105546552 137
376 3300025926 Ga0207659_11376772 Ga0207659_113767722 137
377 3300025927 Ga0207687_10434616 Ga0207687_104346162 137
378 3300025928 Ga0207700_10024321 Ga0207700_100243216 137
379 3300025928 Ga0207700_10339249 Ga0207700_103392492 137
380 3300025931 Ga0207644_10017759 Ga0207644_100177594 137
381 3300025931 Ga0207644_10203721 Ga0207644_102037213 137
382 3300025931 Ga0207644_10353999 Ga0207644_103539993 137
383 3300025934 Ga0207686_10038026 Ga0207686_100380263 137
384 3300025935 Ga0207709_10252033 Ga0207709_102520332 137
385 3300025936 Ga0207670_10019893 Ga0207670_100198933 137
386 3300025936 Ga0207670_10106572 Ga0207670_101065723 137
387 3300025937 Ga0207669_10093212 Ga0207669_100932122 137
388 3300025937 Ga0207669_10633988 Ga0207669_106339882 137
389 3300025937 Ga0207669_11129724 Ga0207669_111297241 137
390 3300025940 Ga0207691_10354554 Ga0207691_103545542 137
391 3300025941 Ga0207711_10015097 Ga0207711_100150975 137
392 3300025945 Ga0207679_10264398 Ga0207679_102643982 137
393 3300025960 Ga0207651_10011976 Ga0207651_100119765 137
394 3300025960 Ga0207651_10078395 Ga0207651_100783953 137
395 3300025960 Ga0207651_10414477 Ga0207651_104144773 137
396 3300025961 Ga0207712_10310996 Ga0207712_103109962 137
397 3300025961 Ga0207712_11419553 Ga0207712_114195532 137
398 3300025972 Ga0207668_10105912 Ga0207668_101059122 137
399 3300025972 Ga0207668_11281483 Ga0207668_112814832 137
400 3300025972 Ga0207668_11634536 Ga0207668_116345362 137
401 3300025981 Ga0207640_10198484 Ga0207640_101984842 137
402 3300026023 Ga0207677_10229607 Ga0207677_102296073 137
403 3300026023 Ga0207677_11158489 Ga0207677_111584892 137
404 3300026035 Ga0207703_10007529 Ga0207703_100075296 137
405 3300026035 Ga0207703_10046911 Ga0207703_100469113 137
406 3300026041 Ga0207639_10146333 Ga0207639_101463333 137
407 3300026067 Ga0207678_10036396 Ga0207678_100363963 137
408 3300026067 Ga0207678_10039306 Ga0207678_100393066 137
409 3300026067 Ga0207678_11122327 Ga0207678_111223271 137
410 3300026067 Ga0207678_11356572 Ga0207678_113565721 137
411 3300026075 Ga0207708_10001790 Ga0207708_1000179010 137
412 3300026075 Ga0207708_10097167 Ga0207708_100971673 137
413 3300026088 Ga0207641_10032537 Ga0207641_100325375 137
414 3300026088 Ga0207641_10289199 Ga0207641_102891993 137
415 3300026089 Ga0207648_10000077 Ga0207648_100000774 137
416 3300026089 Ga0207648_10605294 Ga0207648_106052942 137
417 3300026095 Ga0207676_10050527 Ga0207676_100505274 137
418 3300026095 Ga0207676_10082496 Ga0207676_100824962 137
419 3300026095 Ga0207676_10133403 Ga0207676_101334034 137
420 3300026116 Ga0207674_10126790 Ga0207674_101267902 137
421 3300026116 Ga0207674_10167782 Ga0207674_101677821 137
422 3300026118 Ga0207675_100382424 Ga0207675_1003824243 137
423 3300026121 Ga0207683_10189771 Ga0207683_101897714 137
424 3300026121 Ga0207683_10293896 Ga0207683_102938962 137
425 3300026121 Ga0207683_11608632 Ga0207683_116086321 137
426 3300027512 Ga0209179_1020163 Ga0209179_10201633 137
427 3300027671 Ga0209588_1098108 Ga0209588_10981082 137
428 3300027695 Ga0209966_1010275 Ga0209966_10102753 137
429 3300027876 Ga0209974_10022919 Ga0209974_100229193 137
430 3300027876 Ga0209974_10050323 Ga0209974_100503232 137
431 3300027907 Ga0207428_10520266 Ga0207428_105202662 137
432 3300027907 Ga0207428_10720380 Ga0207428_107203801 137
433 3300028379 Ga0268266_10000072 Ga0268266_10000072118 137
434 3300028379 Ga0268266_10459131 Ga0268266_104591313 137
435 3300028379 Ga0268266_10562553 Ga0268266_105625532 137
436 3300028379 Ga0268266_11044778 Ga0268266_110447781 137
437 3300028379 Ga0268266_11695301 Ga0268266_116953012 137
438 3300028379 Ga0268266_11868853 Ga0268266_118688531 137
439 3300028380 Ga0268265_10344981 Ga0268265_103449812 137
440 3300028381 Ga0268264_10006064 Ga0268264_100060642 137
441 3300028800 Ga0265338_10151094 Ga0265338_101510943 137
442 3300028800 Ga0265338_10265119 Ga0265338_102651192 137
443 3300031235 Ga0265330_10004069 Ga0265330_100040698 137
444 3300031241 Ga0265325_10000124 Ga0265325_1000012419 137
445 3300031247 Ga0265340_10031662 Ga0265340_100316622 137
446 3300031249 Ga0265339_10000521 Ga0265339_1000052112 137
447 3300031344 Ga0265316_10000629 Ga0265316_1000062922 137
448 3300031344 Ga0265316_10089557 Ga0265316_100895573 137
449 3300031344 Ga0265316_10190979 Ga0265316_101909791 137
450 3300031548 Ga0307408_100003848 Ga0307408_1000038485 137
451 3300031595 Ga0265313_10000588 Ga0265313_1000058822 137
452 3300031712 Ga0265342_10010188 Ga0265342_100101883 137
453 3300031731 Ga0307405_10000655 Ga0307405_100006558 137
454 3300031731 Ga0307405_10326121 Ga0307405_103261213 137
455 3300031731 Ga0307405_10420470 Ga0307405_104204702 137
456 3300031824 Ga0307413_10096316 Ga0307413_100963163 137
457 3300031824 Ga0307413_10440517 Ga0307413_104405173 137
458 3300031852 Ga0307410_10009942 Ga0307410_100099424 137
459 3300031901 Ga0307406_11724478 Ga0307406_117244781 137
460 3300031903 Ga0307407_10005789 Ga0307407_100057897 137
461 3300031911 Ga0307412_10086408 Ga0307412_100864084 137
462 3300031911 Ga0307412_11384330 Ga0307412_113843302 137
463 3300031995 Ga0307409_100003910 Ga0307409_1000039103 137
464 3300031995 Ga0307409_100539628 Ga0307409_1005396282 137
465 3300031995 Ga0307409_101477333 Ga0307409_1014773331 137
466 3300032002 Ga0307416_100003573 Ga0307416_1000035738 137
467 3300032002 Ga0307416_100184416 Ga0307416_1001844162 137
468 3300032002 Ga0307416_100931553 Ga0307416_1009315531 137
469 3300032002 Ga0307416_103262883 Ga0307416_1032628832 137
470 3300032004 Ga0307414_10582474 Ga0307414_105824741 137
471 3300032004 Ga0307414_10676175 Ga0307414_106761752 137
472 3300032005 Ga0307411_10001781 Ga0307411_100017815 137
473 3300032005 Ga0307411_11897516 Ga0307411_118975161 137
474 3300032126 Ga0307415_100011537 Ga0307415_1000115372 137
475 3300033528 Ga0316588_1176508 Ga0316588_11765081 137
476 3300033541 Ga0316596_1114729 Ga0316596_11147292 137
477 3300035086 Ga0373934_0196307 Ga0373934_0196307_268_681 137
478 3300035089 Ga0373944_0417183 Ga0373944_0417183_85_498 137
479 3300035116 Ga0373945_0348062 Ga0373945_0348062_135_548 137
480 3300035116 Ga0373945_0455302 Ga0373945_0455302_38_451 137
481 3300035118 Ga0373954_0049694 Ga0373954_0049694_555_974 137
482 3300035172 Ga0373955_0044923 Ga0373955_0044923_138_557 137
483 3300035398 Ga0316574_0027123 Ga0316574_0027123_2350_2763 137
484 3300035398 Ga0316574_0079546 Ga0316574_0079546_1469_1894 137
485 3300035692 Ga0373935_0224909 Ga0373935_0224909_316_729 137
486 3300035724 Ga0373933_0047018 Ga0373933_0047018_323_736 137
487 3300036401 Ga0373937_0001949 Ga0373937_0001949_15357_15770 137
488 3300036401 Ga0373937_0134651 Ga0373937_0134651_1614_2033 137
489 3300036401 Ga0373937_0813751 Ga0373937_0813751_144_563 137
490 3300036712 Ga0316584_0036328 Ga0316584_0036328_75_500 137
491 3300037068 Ga0373925_0003799 Ga0373925_0003799_6713_7126 137
492 3300037068 Ga0373925_0143043 Ga0373925_0143043_1151_1570 137
493 3300037418 Ga0395900_0319329 Ga0395900_0319329_576_1010 137
494 3300037466 Ga0395898_0509743 Ga0395898_0509743_442_858 137
495 3300037466 Ga0395898_0566628 Ga0395898_0566628_369_803 137
496 3300037853 Ga0436364_0229532 Ga0436364_0229532_1299_1718 137
497 3300037853 Ga0436364_0324904 Ga0436364_0324904_1874_2293 137
498 3300037853 Ga0436364_1075915 Ga0436364_1075915_5446_5865 137
499 3300038725 Ga0400484_07775 Ga0400484_07775_1449_1862 137
500 3300038726 Ga0400490_10514 Ga0400490_10514_887_1300 137
501 3300038726 Ga0400490_50905 Ga0400490_50905_45672_46085 137
502 3300038727 Ga0400491_28577 Ga0400491_28577_1216_1629 137
503 3300038741 Ga0400488_12509 Ga0400488_12509_1327_1740 137
504 3300038741 Ga0400488_61775 Ga0400488_61775_545_958 137
505 3300039062 Ga0400483_008789 Ga0400483_008789_189_602 137
506 3300039093 Ga0400489_07561 Ga0400489_07561_39_452 137
507 3300039110 Ga0400487_00767 Ga0400487_00767_5718_6131 137
508 3300039437 Ga0436365_0546808 Ga0436365_0546808_48_467 137
509 3300039437 Ga0436365_0973417 Ga0436365_0973417_47162_47578 137
510 3300039437 Ga0436365_1380816 Ga0436365_1380816_106_525 137
511 3300039450 Ga0436363_1032628 Ga0436363_1032628_133_549 137
512 3300039453 Ga0436362_1054863 Ga0436362_1054863_6161_6577 137
513 3300041451 Ga0451791_0577217 Ga0451791_0577217_66_485 137
514 3300041460 Ga0451802_1374578 Ga0451802_1374578_77_490 137
515 3300041997 Ga0439431_0124628 Ga0439431_0124628_191_604 137
516 3300041999 Ga0439433_0044345 Ga0439433_0044345_50_463 137
517 3300041999 Ga0439433_0090420 Ga0439433_0090420_95_508 137
518 3300042014 Ga0439457_034358 Ga0439457_034358_143_556 137
519 3300042015 Ga0439462_0037247 Ga0439462_0037247_288_701 137
520 3300042015 Ga0439462_0105888 Ga0439462_0105888_309_722 137
521 3300042156 Ga0439446_0021847 Ga0439446_0021847_59_472 137
522 3300042156 Ga0439446_0059487 Ga0439446_0059487_430_843 137
523 3300042435 Ga0439434_0004722 Ga0439434_0004722_3260_3673 137
524 3300042435 Ga0439434_0106819 Ga0439434_0106819_238_651 137
525 3300042439 Ga0439464_0053692 Ga0439464_0053692_583_996 137
526 3300042461 Ga0439460_0045238 Ga0439460_0045238_262_675 137
527 3300042876 Ga0451577_0011198 Ga0451577_0011198_3604_4020 137
528 3300042876 Ga0451577_0089131 Ga0451577_0089131_1322_1735 137
529 3300042876 Ga0451577_0200088 Ga0451577_0200088_1167_1583 137
530 3300042876 Ga0451577_0475111 Ga0451577_0475111_682_1095 137
531 3300042876 Ga0451577_0495909 Ga0451577_0495909_589_1002 137
532 3300042876 Ga0451577_0502082 Ga0451577_0502082_451_876 137
533 3300042876 Ga0451577_0816842 Ga0451577_0816842_26_439 137
534 3300042993 Ga0439440_0033688 Ga0439440_0033688_666_1079 137
535 3300044712 Ga0453684_0006795 Ga0453684_0006795_9128_9541 137
536 3300044712 Ga0453684_0014729 Ga0453684_0014729_9848_10261 137
537 3300044712 Ga0453684_0025039 Ga0453684_0025039_3568_3984 137
538 3300044712 Ga0453684_0035956 Ga0453684_0035956_4454_4867 137
539 3300044712 Ga0453684_0116646 Ga0453684_0116646_2520_2933 137
540 3300044712 Ga0453684_0132428 Ga0453684_0132428_2267_2680 137
541 3300044712 Ga0453684_0605922 Ga0453684_0605922_33_452 137
542 3300044712 Ga0453684_2089324 Ga0453684_2089324_76_489 137
543 3300045051 Ga0451576_0000956 Ga0451576_0000956_34564_34989 137
544 3300045051 Ga0451576_0225806 Ga0451576_0225806_910_1326 137
545 3300045051 Ga0451576_0893860 Ga0451576_0893860_190_603 137
546 3300045051 Ga0451576_1283628 Ga0451576_1283628_193_606 137
547 3300045051 Ga0451576_2325761 Ga0451576_2325761_68_481 137
548 3300046454 Ga0495592_0628498 Ga0495592_0628498_153_566 137
549 3300046455 Ga0495603_0018770 Ga0495603_0018770_2688_3107 137
550 3300046459 Ga0495629_0022981 Ga0495629_0022981_751_1170 137
551 3300046460 Ga0495638_0007866 Ga0495638_0007866_2315_2728 137
552 3300046472 Ga0495580_0011289 Ga0495580_0011289_3091_3510 137
553 3300046475 Ga0495639_0009532 Ga0495639_0009532_1300_1719 137
554 3300046476 Ga0495662_0291902 Ga0495662_0291902_197_616 137
555 3300046477 Ga0495664_0140157 Ga0495664_0140157_87_506 137
556 3300046499 Ga0495594_0129558 Ga0495594_0129558_818_1237 137
557 3300046514 Ga0495618_0275526 Ga0495618_0275526_444_863 137
558 3300046516 Ga0495628_0062260 Ga0495628_0062260_965_1378 137
559 3300046517 Ga0495630_0559952 Ga0495630_0559952_303_722 137
560 3300046526 Ga0495666_0005554 Ga0495666_0005554_4542_4961 137
561 3300046531 Ga0495665_0005040 Ga0495665_0005040_4052_4471 137
562 3300046531 Ga0495665_0077382 Ga0495665_0077382_402_821 137
563 3300046533 Ga0495640_0043425 Ga0495640_0043425_999_1418 137
564 3300046557 Ga0495622_0277241 Ga0495622_0277241_306_719 137
565 3300046642 Ga0495634_0093925 Ga0495634_0093925_169_588 137
566 3300046681 Ga0495647_0000571 Ga0495647_0000571_2083_2502 137
567 3300046683 Ga0495658_0007179 Ga0495658_0007179_1775_2194 137
568 3300046683 Ga0495658_0050305 Ga0495658_0050305_1378_1791 137
569 3300046689 Ga0495613_0015997 Ga0495613_0015997_3968_4387 137
570 3300046689 Ga0495613_0886801 Ga0495613_0886801_35_454 137
571 3300046690 Ga0495624_0215506 Ga0495624_0215506_651_1070 137
572 3300047315 Ga0495581_0005976 Ga0495581_0005976_3961_4380 137
573 3300047318 Ga0495636_0393257 Ga0495636_0393257_37_450 137
574 3300047319 Ga0495674_0040657 Ga0495674_0040657_3672_4091 137
575 3300047319 Ga0495674_0248044 Ga0495674_0248044_391_804 137
576 3300047321 Ga0495676_0031186 Ga0495676_0031186_3194_3613 137
577 3300047673 Ga0495593_0018936 Ga0495593_0018936_3310_3729 137
578 3300048089 Ga0495614_0041847 Ga0495614_0041847_1197_1616 137
579 3300048903 Ga0496100_0473832 Ga0496100_0473832_69_482 137
580 3300048903 Ga0496100_1086932 Ga0496100_1086932_172_591 137
581 3300048907 Ga0496104_0237980 Ga0496104_0237980_1169_1582 137
582 3300048912 Ga0496109_0302128 Ga0496109_0302128_149_562 137
583 3300048912 Ga0496109_1124964 Ga0496109_1124964_29_442 137
584 3300048916 Ga0496113_0228752 Ga0496113_0228752_490_903 137
585 3300048917 Ga0496114_1201194 Ga0496114_1201194_66_485 137
586 3300049513 Ga0501290_020932 Ga0501290_020932_179_592 137
587 3300049522 Ga0501299_003607 Ga0501299_003607_106_519 137
588 3300049570 Ga0501033_0256371 Ga0501033_0256371_85_498 137
589 3300049572 Ga0501036_0920754 Ga0501036_0920754_128_541 137
590 3300049574 Ga0501038_0250362 Ga0501038_0250362_532_945 137
591 3300049574 Ga0501038_0441386 Ga0501038_0441386_571_984 137
592 3300049576 Ga0501040_0313026 Ga0501040_0313026_610_1023 137
593 3300049577 Ga0501041_0048882 Ga0501041_0048882_1956_2369 137
594 3300049577 Ga0501041_0290288 Ga0501041_0290288_452_865 137
595 3300049578 Ga0501042_0556685 Ga0501042_0556685_145_558 137
596 3300049578 Ga0501042_0659131 Ga0501042_0659131_140_553 137
597 3300049580 Ga0501046_1269744 Ga0501046_1269744_72_485 137
598 3300049582 Ga0501048_0877791 Ga0501048_0877791_174_587 137
599 3300049587 Ga0501071_0094075 Ga0501071_0094075_627_1040 137
600 3300049587 Ga0501071_0933235 Ga0501071_0933235_212_625 137
601 3300049588 Ga0501072_0013236 Ga0501072_0013236_5473_5886 137
602 3300049591 Ga0501075_0037185 Ga0501075_0037185_1050_1463 137
603 3300049591 Ga0501075_0709344 Ga0501075_0709344_274_687 137
604 3300049592 Ga0501076_0021140 Ga0501076_0021140_838_1251 137
605 3300049592 Ga0501076_0214800 Ga0501076_0214800_180_593 137
606 3300049592 Ga0501076_0360818 Ga0501076_0360818_622_1035 137
607 3300049679 Ga0501249_023517 Ga0501249_023517_79_492 137
608 3300049706 Ga0501229_063525 Ga0501229_063525_110_523 137
609 3300049707 Ga0501234_070624 Ga0501234_070624_108_521 137
610 3300049743 Ga0501081_0218636 Ga0501081_0218636_423_836 137
611 3300049743 Ga0501081_1009826 Ga0501081_1009826_11_424 137
612 3300049743 Ga0501081_1239875 Ga0501081_1239875_83_496 137
613 3300049764 Ga0501267_041421 Ga0501267_041421_120_533 137
614 3300049770 Ga0501273_006920 Ga0501273_006920_168_581 137
615 3300049779 Ga0501283_025994 Ga0501283_025994_286_699 137
616 3300049822 Ga0501035_0595293 Ga0501035_0595293_66_485 137
617 3300049822 Ga0501035_1260706 Ga0501035_1260706_12_425 137
618 3300049824 Ga0501045_0079391 Ga0501045_0079391_588_1001 137
619 3300049824 Ga0501045_0247064 Ga0501045_0247064_157_570 137
620 3300049824 Ga0501045_0664602 Ga0501045_0664602_186_599 137
621 3300050491 nmdc:mga00v17_64952_c1 nmdc:mga00v17_64952_c1_642_1055 137
622 3300050509 nmdc:mga0qj67_1504440_c1 nmdc:mga0qj67_1504440_c1_17_439 137
623 3300050509 nmdc:mga0qj67_17312_c1 nmdc:mga0qj67_17312_c1_2973_3386 137
624 3300050509 nmdc:mga0qj67_310499_c1 nmdc:mga0qj67_310499_c1_554_967 137
625 3300050509 nmdc:mga0qj67_312957_c1 nmdc:mga0qj67_312957_c1_182_595 137
626 3300050509 nmdc:mga0qj67_608058_c1 nmdc:mga0qj67_608058_c1_443_856 137
627 3300050510 nmdc:mga06r32_14950_c1 nmdc:mga06r32_14950_c1_457_879 137
628 3300050510 nmdc:mga06r32_1711606_c1 nmdc:mga06r32_1711606_c1_31_444 137
629 3300050510 nmdc:mga06r32_368653_c1 nmdc:mga06r32_368653_c1_203_616 137
630 3300050510 nmdc:mga06r32_499574_c1 nmdc:mga06r32_499574_c1_72_485 137
631 3300050510 nmdc:mga06r32_979069_c1 nmdc:mga06r32_979069_c1_272_685 137
632 3300050511 nmdc:mga08y16_215065_c1 nmdc:mga08y16_215065_c1_367_780 137
633 3300050511 nmdc:mga08y16_442795_c1 nmdc:mga08y16_442795_c1_616_1029 137
634 3300050512 nmdc:mga0n895_122840_c1 nmdc:mga0n895_122840_c1_1576_1989 137
635 3300050513 nmdc:mga0rr50_1855643_c1 nmdc:mga0rr50_1855643_c1_16_429 137
636 3300050514 nmdc:mga08x19_468248_c1 nmdc:mga08x19_468248_c1_244_657 137
637 3300050514 nmdc:mga08x19_7041_c1 nmdc:mga08x19_7041_c1_2783_3202 137
638 3300050514 nmdc:mga08x19_815279_c1 nmdc:mga08x19_815279_c1_66_482 137
639 3300053727 Ga0500611_051238 Ga0500611_051238_448_861 137
640 3300054114 Ga0501084_1173081 Ga0501084_1173081_160_573 137
641 3300054114 Ga0501084_1215078 Ga0501084_1215078_56_469 137
642 3300054114 Ga0501084_1239844 Ga0501084_1239844_101_514 137
643 3300059421 Ga0590071_000060 Ga0590071_000060_28214_28627 137
644 3300059421 Ga0590071_020967 Ga0590071_020967_660_1073 137
645 3300059423 Ga0590074_000203 Ga0590074_000203_564_977 137
646 3300059423 Ga0590074_124798 Ga0590074_124798_16_429 137
647 3300059424 Ga0590075_000338 Ga0590075_000338_5893_6306 137
648 3300059424 Ga0590075_006284 Ga0590075_006284_379_792 137
649 3300059426 Ga0590077_000202 Ga0590077_000202_16008_16421 137
650 3300059426 Ga0590077_019779 Ga0590077_019779_141_554 137
651 3300060353 Ga0501082_0333227 Ga0501082_0333227_465_878 137
652 3300060353 Ga0501082_0738902 Ga0501082_0738902_133_546 137
653 3300061734 Ga0530510_0093709 Ga0530510_0093709_734_1147 137
654 3300061734 Ga0530510_0432574 Ga0530510_0432574_87_500 137
655 3300061734 Ga0530510_1234127 Ga0530510_1234127_45_458 137
656 3300061734 Ga0530510_1300903 Ga0530510_1300903_132_545 137
657 3300003203 JGI25406J46586_10243124 JGI25406J46586_102431241 138
658 3300005295 Ga0065707_10512314 Ga0065707_105123142 138
659 3300005327 Ga0070658_10059170 Ga0070658_100591702 138
660 3300005329 Ga0070683_100171249 Ga0070683_1001712491 138
661 3300005331 Ga0070670_100652273 Ga0070670_1006522732 138
662 3300005333 Ga0070677_10210617 Ga0070677_102106172 138
663 3300005336 Ga0070680_100016205 Ga0070680_1000162052 138
664 3300005337 Ga0070682_100392110 Ga0070682_1003921101 138
665 3300005338 Ga0068868_100264100 Ga0068868_1002641002 138
666 3300005339 Ga0070660_100023622 Ga0070660_1000236222 138
667 3300005339 Ga0070660_100137008 Ga0070660_1001370085 138
668 3300005339 Ga0070660_100546524 Ga0070660_1005465241 138
669 3300005344 Ga0070661_100008889 Ga0070661_1000088894 138
670 3300005344 Ga0070661_100027663 Ga0070661_1000276632 138
671 3300005344 Ga0070661_100754952 Ga0070661_1007549522 138
672 3300005345 Ga0070692_11047784 Ga0070692_110477842 138
673 3300005355 Ga0070671_100014366 Ga0070671_1000143663 138
674 3300005356 Ga0070674_100070771 Ga0070674_1000707713 138
675 3300005364 Ga0070673_101200008 Ga0070673_1012000081 138
676 3300005365 Ga0070688_100437836 Ga0070688_1004378361 138
677 3300005367 Ga0070667_100348291 Ga0070667_1003482911 138
678 3300005455 Ga0070663_100148931 Ga0070663_1001489314 138
679 3300005456 Ga0070678_100643101 Ga0070678_1006431012 138
680 3300005456 Ga0070678_101045567 Ga0070678_1010455671 138
681 3300005458 Ga0070681_10019189 Ga0070681_100191896 138
682 3300005466 Ga0070685_10013898 Ga0070685_100138982 138
683 3300005471 Ga0070698_100780796 Ga0070698_1007807962 138
684 3300005471 Ga0070698_100939676 Ga0070698_1009396761 138
685 3300005518 Ga0070699_100198406 Ga0070699_1001984063 138
686 3300005530 Ga0070679_100302551 Ga0070679_1003025512 138
687 3300005535 Ga0070684_100081768 Ga0070684_1000817683 138
688 3300005535 Ga0070684_101517437 Ga0070684_1015174371 138
689 3300005536 Ga0070697_100049091 Ga0070697_1000490912 138
690 3300005539 Ga0068853_100005152 Ga0068853_1000051526 138
691 3300005539 Ga0068853_100028505 Ga0068853_1000285056 138
692 3300005539 Ga0068853_100102808 Ga0068853_1001028082 138
693 3300005539 Ga0068853_100246164 Ga0068853_1002461642 138
694 3300005543 Ga0070672_100031727 Ga0070672_1000317277 138
695 3300005545 Ga0070695_100062705 Ga0070695_1000627052 138
696 3300005548 Ga0070665_100595402 Ga0070665_1005954021 138
697 3300005548 Ga0070665_100741933 Ga0070665_1007419332 138
698 3300005548 Ga0070665_101180264 Ga0070665_1011802642 138
699 3300005548 Ga0070665_101398522 Ga0070665_1013985222 138
700 3300005549 Ga0070704_101341769 Ga0070704_1013417691 138
701 3300005563 Ga0068855_100025034 Ga0068855_1000250346 138
702 3300005563 Ga0068855_100118445 Ga0068855_1001184453 138
703 3300005563 Ga0068855_100450522 Ga0068855_1004505222 138
704 3300005563 Ga0068855_100542524 Ga0068855_1005425243 138
705 3300005564 Ga0070664_100016791 Ga0070664_1000167913 138
706 3300005578 Ga0068854_100015515 Ga0068854_1000155159 138
707 3300005578 Ga0068854_100028425 Ga0068854_1000284258 138
708 3300005578 Ga0068854_100271546 Ga0068854_1002715462 138
709 3300005578 Ga0068854_101020626 Ga0068854_1010206261 138
710 3300005614 Ga0068856_100077852 Ga0068856_1000778522 138
711 3300005614 Ga0068856_100205345 Ga0068856_1002053453 138
712 3300005614 Ga0068856_100301755 Ga0068856_1003017552 138
713 3300005616 Ga0068852_100005648 Ga0068852_1000056487 138
714 3300005616 Ga0068852_100034648 Ga0068852_1000346487 138
715 3300005616 Ga0068852_100154208 Ga0068852_1001542082 138
716 3300005616 Ga0068852_100586799 Ga0068852_1005867993 138
717 3300005616 Ga0068852_100599731 Ga0068852_1005997312 138
718 3300005617 Ga0068859_102559106 Ga0068859_1025591061 138
719 3300005719 Ga0068861_100103017 Ga0068861_1001030175 138
720 3300005719 Ga0068861_100193131 Ga0068861_1001931312 138
721 3300005834 Ga0068851_10005621 Ga0068851_1000562110 138
722 3300005840 Ga0068870_10237853 Ga0068870_102378532 138
723 3300005842 Ga0068858_100048034 Ga0068858_1000480343 138
724 3300005842 Ga0068858_100371418 Ga0068858_1003714183 138
725 3300005843 Ga0068860_100003051 Ga0068860_1000030512 138
726 3300005937 Ga0081455_10220993 Ga0081455_102209932 138
727 3300005985 Ga0081539_10027575 Ga0081539_100275754 138
728 3300005985 Ga0081539_10337301 Ga0081539_103373012 138
729 3300006038 Ga0075365_10080806 Ga0075365_100808064 138
730 3300006042 Ga0075368_10040666 Ga0075368_100406662 138
731 3300006042 Ga0075368_10089583 Ga0075368_100895833 138
732 3300006051 Ga0075364_10232614 Ga0075364_102326142 138
733 3300006051 Ga0075364_10558624 Ga0075364_105586242 138
734 3300006175 Ga0070712_100961073 Ga0070712_1009610731 138
735 3300006178 Ga0075367_10039305 Ga0075367_100393054 138
736 3300006178 Ga0075367_10249356 Ga0075367_102493562 138
737 3300006178 Ga0075367_10651814 Ga0075367_106518142 138
738 3300006195 Ga0075366_10008607 Ga0075366_100086073 138
739 3300006195 Ga0075366_10152577 Ga0075366_101525773 138
740 3300006237 Ga0097621_100160348 Ga0097621_1001603482 138
741 3300006353 Ga0075370_10032032 Ga0075370_100320326 138
742 3300006844 Ga0075428_100308190 Ga0075428_1003081901 138
743 3300006844 Ga0075428_100532853 Ga0075428_1005328533 138
744 3300006847 Ga0075431_100195183 Ga0075431_1001951833 138
745 3300006880 Ga0075429_100093654 Ga0075429_1000936543 138
746 3300006881 Ga0068865_100334624 Ga0068865_1003346243 138
747 3300006931 Ga0097620_102558995 Ga0097620_1025589951 138
748 3300009093 Ga0105240_10012404 Ga0105240_100124046 138
749 3300009093 Ga0105240_10028438 Ga0105240_100284382 138
750 3300009093 Ga0105240_10152968 Ga0105240_101529683 138
751 3300009098 Ga0105245_10211792 Ga0105245_102117922 138
752 3300009098 Ga0105245_10458327 Ga0105245_104583272 138
753 3300009101 Ga0105247_10051805 Ga0105247_100518054 138
754 3300009147 Ga0114129_11135531 Ga0114129_111355312 138
755 3300009148 Ga0105243_11127985 Ga0105243_111279852 138
756 3300009174 Ga0105241_10114161 Ga0105241_101141613 138
757 3300009174 Ga0105241_10552086 Ga0105241_105520862 138
758 3300009174 Ga0105241_10613271 Ga0105241_106132711 138
759 3300009174 Ga0105241_11649018 Ga0105241_116490181 138
760 3300009177 Ga0105248_10666579 Ga0105248_106665792 138
761 3300009545 Ga0105237_11749043 Ga0105237_117490431 138
762 3300009545 Ga0105237_11819665 Ga0105237_118196651 138
763 3300009551 Ga0105238_10009677 Ga0105238_100096778 138
764 3300009551 Ga0105238_10136633 Ga0105238_101366333 138
765 3300009551 Ga0105238_10403448 Ga0105238_104034482 138
766 3300009553 Ga0105249_10813068 Ga0105249_108130681 138
767 3300010375 Ga0105239_10007066 Ga0105239_100070663 138
768 3300010375 Ga0105239_10118954 Ga0105239_101189543 138
769 3300010375 Ga0105239_10962653 Ga0105239_109626532 138
770 3300010375 Ga0105239_12410490 Ga0105239_124104901 138
771 3300010375 Ga0105239_12445264 Ga0105239_124452642 138
772 3300011119 Ga0105246_10376112 Ga0105246_103761122 138
773 3300011119 Ga0105246_10872153 Ga0105246_108721531 138
774 3300013100 Ga0157373_10267520 Ga0157373_102675202 138
775 3300013100 Ga0157373_10291151 Ga0157373_102911512 138
776 3300013102 Ga0157371_10034623 Ga0157371_100346239 138
777 3300013104 Ga0157370_10070956 Ga0157370_100709566 138
778 3300013104 Ga0157370_10112532 Ga0157370_101125322 138
779 3300013104 Ga0157370_10231297 Ga0157370_102312972 138
780 3300013104 Ga0157370_10778863 Ga0157370_107788632 138
781 3300013104 Ga0157370_11012175 Ga0157370_110121752 138
782 3300013105 Ga0157369_10014955 Ga0157369_100149558 138
783 3300013296 Ga0157374_11993646 Ga0157374_119936462 138
784 3300013297 Ga0157378_10477684 Ga0157378_104776841 138
785 3300013307 Ga0157372_10219749 Ga0157372_102197494 138
786 3300013307 Ga0157372_10483777 Ga0157372_104837772 138
787 3300013307 Ga0157372_12049114 Ga0157372_120491142 138
788 3300014325 Ga0163163_10106869 Ga0163163_101068692 138
789 3300014326 Ga0157380_11701603 Ga0157380_117016032 138
790 3300014745 Ga0157377_10607175 Ga0157377_106071752 138
791 3300014968 Ga0157379_10025258 Ga0157379_100252581 138
792 3300014968 Ga0157379_10390423 Ga0157379_103904232 138
793 3300014969 Ga0157376_10397616 Ga0157376_103976162 138
794 3300014969 Ga0157376_10464511 Ga0157376_104645112 138
795 3300017792 Ga0163161_10394336 Ga0163161_103943361 138
796 3300020070 Ga0206356_11229896 Ga0206356_112298962 138
797 3300020078 Ga0206352_10061836 Ga0206352_100618361 138
798 3300020081 Ga0206354_10876749 Ga0206354_108767492 138
799 3300020610 Ga0154015_1512287 Ga0154015_15122872 138
800 3300021384 Ga0213876_10520272 Ga0213876_105202722 138
801 3300025321 Ga0207656_10001311 Ga0207656_100013112 138
802 3300025321 Ga0207656_10249660 Ga0207656_102496602 138
803 3300025893 Ga0207682_10167217 Ga0207682_101672172 138
804 3300025900 Ga0207710_10024756 Ga0207710_100247562 138
805 3300025907 Ga0207645_10022662 Ga0207645_100226622 138
806 3300025909 Ga0207705_10248703 Ga0207705_102487032 138
807 3300025912 Ga0207707_10342284 Ga0207707_103422842 138
808 3300025913 Ga0207695_10007106 Ga0207695_1000710612 138
809 3300025913 Ga0207695_10494094 Ga0207695_104940941 138
810 3300025913 Ga0207695_10932069 Ga0207695_109320691 138
811 3300025913 Ga0207695_11280134 Ga0207695_112801341 138
812 3300025914 Ga0207671_10460783 Ga0207671_104607832 138
813 3300025918 Ga0207662_10224059 Ga0207662_102240591 138
814 3300025919 Ga0207657_10044776 Ga0207657_100447762 138
815 3300025919 Ga0207657_10501061 Ga0207657_105010612 138
816 3300025920 Ga0207649_10001031 Ga0207649_100010316 138
817 3300025920 Ga0207649_10187784 Ga0207649_101877842 138
818 3300025920 Ga0207649_10541971 Ga0207649_105419711 138
819 3300025921 Ga0207652_10158236 Ga0207652_101582363 138
820 3300025924 Ga0207694_10006307 Ga0207694_100063078 138
821 3300025924 Ga0207694_10246106 Ga0207694_102461062 138
822 3300025924 Ga0207694_11294337 Ga0207694_112943371 138
823 3300025925 Ga0207650_10148131 Ga0207650_101481315 138
824 3300025926 Ga0207659_10637438 Ga0207659_106374382 138
825 3300025927 Ga0207687_10174541 Ga0207687_101745415 138
826 3300025931 Ga0207644_10025280 Ga0207644_100252807 138
827 3300025933 Ga0207706_10086949 Ga0207706_100869495 138
828 3300025936 Ga0207670_11814575 Ga0207670_118145751 138
829 3300025937 Ga0207669_10148738 Ga0207669_101487382 138
830 3300025938 Ga0207704_10128793 Ga0207704_101287932 138
831 3300025940 Ga0207691_10039249 Ga0207691_100392492 138
832 3300025941 Ga0207711_11122502 Ga0207711_111225022 138
833 3300025942 Ga0207689_10178242 Ga0207689_101782423 138
834 3300025945 Ga0207679_10370026 Ga0207679_103700261 138
835 3300025949 Ga0207667_10020673 Ga0207667_100206738 138
836 3300025949 Ga0207667_10092286 Ga0207667_100922862 138
837 3300025949 Ga0207667_10127751 Ga0207667_101277512 138
838 3300025949 Ga0207667_11075202 Ga0207667_110752021 138
839 3300025960 Ga0207651_10971831 Ga0207651_109718311 138
840 3300025960 Ga0207651_11229421 Ga0207651_112294212 138
841 3300025981 Ga0207640_10003993 Ga0207640_100039937 138
842 3300025981 Ga0207640_10014708 Ga0207640_100147089 138
843 3300025981 Ga0207640_10496838 Ga0207640_104968381 138
844 3300025981 Ga0207640_10673962 Ga0207640_106739621 138
845 3300025986 Ga0207658_10366286 Ga0207658_103662863 138
846 3300026023 Ga0207677_10079440 Ga0207677_100794404 138
847 3300026023 Ga0207677_11103982 Ga0207677_111039822 138
848 3300026035 Ga0207703_11032863 Ga0207703_110328631 138
849 3300026041 Ga0207639_10002270 Ga0207639_100022703 138
850 3300026041 Ga0207639_10058301 Ga0207639_100583012 138
851 3300026041 Ga0207639_10302296 Ga0207639_103022964 138
852 3300026041 Ga0207639_10584226 Ga0207639_105842261 138
853 3300026067 Ga0207678_10006322 Ga0207678_100063227 138
854 3300026067 Ga0207678_10049950 Ga0207678_100499502 138
855 3300026067 Ga0207678_10111317 Ga0207678_101113174 138
856 3300026067 Ga0207678_10619502 Ga0207678_106195022 138
857 3300026067 Ga0207678_11538258 Ga0207678_115382581 138
858 3300026078 Ga0207702_10044412 Ga0207702_100444122 138
859 3300026078 Ga0207702_10165396 Ga0207702_101653963 138
860 3300026078 Ga0207702_10385591 Ga0207702_103855912 138
861 3300026088 Ga0207641_11491457 Ga0207641_114914572 138
862 3300026089 Ga0207648_10211315 Ga0207648_102113152 138
863 3300026116 Ga0207674_10010061 Ga0207674_100100616 138
864 3300026116 Ga0207674_10086625 Ga0207674_100866255 138
865 3300026118 Ga0207675_100073156 Ga0207675_1000731567 138
866 3300026118 Ga0207675_101058313 Ga0207675_1010583132 138
867 3300026121 Ga0207683_10628288 Ga0207683_106282881 138
868 3300026142 Ga0207698_10009294 Ga0207698_100092948 138
869 3300026142 Ga0207698_10072672 Ga0207698_100726721 138
870 3300026142 Ga0207698_10098755 Ga0207698_100987552 138
871 3300026142 Ga0207698_12085776 Ga0207698_120857761 138
872 3300026142 Ga0207698_12252496 Ga0207698_122524961 138
873 3300028379 Ga0268266_10096295 Ga0268266_100962952 138
874 3300028379 Ga0268266_11769120 Ga0268266_117691202 138
875 3300028380 Ga0268265_11948244 Ga0268265_119482441 138
876 3300028381 Ga0268264_10002191 Ga0268264_100021911 138
877 3300028381 Ga0268264_10499926 Ga0268264_104999262 138
878 3300028800 Ga0265338_10027640 Ga0265338_100276406 138
879 3300029957 Ga0265324_10061787 Ga0265324_100617872 138
880 3300031235 Ga0265330_10052275 Ga0265330_100522752 138
881 3300031239 Ga0265328_10121476 Ga0265328_101214763 138
882 3300031241 Ga0265325_10040624 Ga0265325_100406246 138
883 3300031247 Ga0265340_10300569 Ga0265340_103005692 138
884 3300031249 Ga0265339_10000277 Ga0265339_100002778 138
885 3300031595 Ga0265313_10002031 Ga0265313_1000203118 138
886 3300031665 Ga0316575_10057546 Ga0316575_100575462 138
887 3300031711 Ga0265314_10094029 Ga0265314_100940293 138
888 3300031995 Ga0307409_100796478 Ga0307409_1007964782 138
889 3300032002 Ga0307416_100799254 Ga0307416_1007992543 138
890 3300032002 Ga0307416_100927573 Ga0307416_1009275732 138
891 3300032126 Ga0307415_101640370 Ga0307415_1016403701 138
892 3300034820 Ga0373959_0000006 Ga0373959_0000006_67663_68079 138
893 3300035091 Ga0373951_0273422 Ga0373951_0273422_40_462 138
894 3300035092 Ga0373952_0026644 Ga0373952_0026644_416_838 138
895 3300035398 Ga0316574_0091842 Ga0316574_0091842_1342_1767 138
896 3300035691 Ga0373931_0075955 Ga0373931_0075955_54_476 138
897 3300035725 Ga0373947_1114798 Ga0373947_1114798_70_486 138
898 3300036401 Ga0373937_0344060 Ga0373937_0344060_932_1348 138
899 3300037312 Ga0395899_0612193 Ga0395899_0612193_214_636 138
900 3300037418 Ga0395900_0707454 Ga0395900_0707454_53_475 138
901 3300037466 Ga0395898_0359431 Ga0395898_0359431_803_1225 138
902 3300038443 Ga0395901_0661471 Ga0395901_0661471_214_636 138
903 3300038735 Ga0400485_17143 Ga0400485_17143_11780_12196 138
904 3300038742 Ga0400486_16511 Ga0400486_16511_881_1297 138
905 3300039093 Ga0400489_35047 Ga0400489_35047_33416_33832 138
906 3300039437 Ga0436365_0324434 Ga0436365_0324434_973_1389 138
907 3300041443 Ga0451789_0527783 Ga0451789_0527783_45_461 138
908 3300041505 Ga0451849_0083480 Ga0451849_0083480_31_453 138
909 3300041512 Ga0451853_0993517 Ga0451853_0993517_52_468 138
910 3300041512 Ga0451853_1851339 Ga0451853_1851339_110_529 138
911 3300041997 Ga0439431_0278491 Ga0439431_0278491_25_441 138
912 3300042007 Ga0439449_0077694 Ga0439449_0077694_87_503 138
913 3300042015 Ga0439462_0030219 Ga0439462_0030219_663_1079 138
914 3300042876 Ga0451577_0195978 Ga0451577_0195978_738_1154 138
915 3300042876 Ga0451577_1328782 Ga0451577_1328782_167_583 138
916 3300044673 Ga0453683_0171190 Ga0453683_0171190_432_848 138
917 3300044673 Ga0453683_0196832 Ga0453683_0196832_86_502 138
918 3300044673 Ga0453683_0434910 Ga0453683_0434910_233_649 138
919 3300044673 Ga0453683_0792224 Ga0453683_0792224_37_456 138
920 3300044712 Ga0453684_0553098 Ga0453684_0553098_251_667 138
921 3300045051 Ga0451576_1812629 Ga0451576_1812629_31_456 138
922 3300046460 Ga0495638_0030256 Ga0495638_0030256_2749_3174 138
923 3300046472 Ga0495580_0291328 Ga0495580_0291328_423_851 138
924 3300046499 Ga0495594_0133768 Ga0495594_0133768_683_1108 138
925 3300046511 Ga0495608_0353175 Ga0495608_0353175_262_678 138
926 3300046524 Ga0495648_0391502 Ga0495648_0391502_91_519 138
927 3300046558 Ga0495633_0079535 Ga0495633_0079535_250_678 138
928 3300046689 Ga0495613_0135472 Ga0495613_0135472_658_1095 138
929 3300046794 Ga0495589_0245621 Ga0495589_0245621_202_630 138
930 3300047317 Ga0495604_0070562 Ga0495604_0070562_1036_1452 138
931 3300048088 Ga0495602_0083542 Ga0495602_0083542_937_1353 138
932 3300048911 Ga0496108_0460699 Ga0496108_0460699_647_1063 138
933 3300048911 Ga0496108_1003131 Ga0496108_1003131_73_495 138
934 3300048912 Ga0496109_0434127 Ga0496109_0434127_431_853 138
935 3300048912 Ga0496109_0806525 Ga0496109_0806525_421_837 138
936 3300048912 Ga0496109_0899992 Ga0496109_0899992_80_505 138
937 3300048915 Ga0496112_1414553 Ga0496112_1414553_32_451 138
938 3300049568 Ga0501031_0029982 Ga0501031_0029982_160_582 138
939 3300049569 Ga0501032_0096139 Ga0501032_0096139_126_548 138
940 3300049570 Ga0501033_0092758 Ga0501033_0092758_1617_2039 138
941 3300049572 Ga0501036_0030301 Ga0501036_0030301_1168_1590 138
942 3300049574 Ga0501038_0041127 Ga0501038_0041127_3453_3875 138
943 3300049575 Ga0501039_0127623 Ga0501039_0127623_158_580 138
944 3300049578 Ga0501042_0129327 Ga0501042_0129327_1214_1636 138
945 3300049579 Ga0501043_0216620 Ga0501043_0216620_67_489 138
946 3300049580 Ga0501046_0364830 Ga0501046_0364830_44_466 138
947 3300049581 Ga0501047_0192643 Ga0501047_0192643_1050_1472 138
948 3300049584 Ga0501068_0419141 Ga0501068_0419141_132_554 138
949 3300049586 Ga0501070_0047126 Ga0501070_0047126_3066_3488 138
950 3300049587 Ga0501071_0599595 Ga0501071_0599595_371_793 138
951 3300049588 Ga0501072_0184273 Ga0501072_0184273_987_1409 138
952 3300049589 Ga0501073_0183524 Ga0501073_0183524_602_1027 138
953 3300049589 Ga0501073_0311642 Ga0501073_0311642_234_656 138
954 3300049741 Ga0501079_0305094 Ga0501079_0305094_291_713 138
955 3300049742 Ga0501080_0049961 Ga0501080_0049961_1837_2262 138
956 3300049743 Ga0501081_0571635 Ga0501081_0571635_256_678 138
957 3300049822 Ga0501035_0138889 Ga0501035_0138889_978_1400 138
958 3300049822 Ga0501035_1522115 Ga0501035_1522115_35_457 138
959 3300049823 Ga0501044_0203071 Ga0501044_0203071_842_1264 138
960 3300050490 nmdc:mga03n38_134423_c1 nmdc:mga03n38_134423_c1_651_1070 138
961 3300050491 nmdc:mga00v17_255223_c1 nmdc:mga00v17_255223_c1_293_709 138
962 3300050491 nmdc:mga00v17_298329_c1 nmdc:mga00v17_298329_c1_336_755 138
963 3300050491 nmdc:mga00v17_53025_c1 nmdc:mga00v17_53025_c1_1853_2272 138
964 3300050492 nmdc:mga0yw44_11740_c1 nmdc:mga0yw44_11740_c1_534_950 138
965 3300050493 nmdc:mga0k408_149532_c2 nmdc:mga0k408_149532_c2_77_496 138
966 3300050493 nmdc:mga0k408_37903_c1 nmdc:mga0k408_37903_c1_1004_1423 138
967 3300050494 nmdc:mga06z11_223245_c1 nmdc:mga06z11_223245_c1_348_767 138
968 3300050494 nmdc:mga06z11_484490_c1 nmdc:mga06z11_484490_c1_131_550 138
969 3300050496 nmdc:mga07m45_36229_c1 nmdc:mga07m45_36229_c1_706_1125 138
970 3300050496 nmdc:mga07m45_86012_c1 nmdc:mga07m45_86012_c1_851_1267 138
971 3300050496 nmdc:mga07m45_89282_c1 nmdc:mga07m45_89282_c1_175_594 138
972 3300050507 nmdc:mga05p37_476857_c1 nmdc:mga05p37_476857_c1_351_773 138
973 3300050508 nmdc:mga09592_547467_c1 nmdc:mga09592_547467_c1_165_596 138
974 3300050510 nmdc:mga06r32_767296_c1 nmdc:mga06r32_767296_c1_489_911 138
975 3300050514 nmdc:mga08x19_4109_c1 nmdc:mga08x19_4109_c1_5145_5564 138
976 3300061734 Ga0530510_0691743 Ga0530510_0691743_286_702 138
977 3300061734 Ga0530510_0734462 Ga0530510_0734462_245_664 138
978 3300061734 Ga0530510_0955878 Ga0530510_0955878_33_449 138

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00334

NDK

Nucleoside diphosphate kinase

4

138

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ay1-assembly5.cif.gz_E crystal structure of a nucleoside diphosphate kinase ndk from helicobacter pylori 0.995 1 136
6ay1-assembly8.cif.gz_H crystal structure of a nucleoside diphosphate kinase ndk from helicobacter pylori 0.9905 2 136
6aes-assembly2.cif.gz_B crystal structure of nucleoside diphosphate kinase from pseudomonas aeruginosa at 3.55 a resolution. 0.9893 2 138
6ay1-assembly7.cif.gz_G crystal structure of a nucleoside diphosphate kinase ndk from helicobacter pylori 0.9889 1 136
6ay1-assembly5.cif.gz_E crystal structure of a nucleoside diphosphate kinase ndk from helicobacter pylori 0.9876 1 136
ID Description Score Start End Superfamily
6ay1G00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain 0.9889 1 136 3.30.70.141
af_I1KHD6_3_118_3.30.70.141 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain 0.9842 35 132 3.30.70.141
4w98A00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain 0.9814 2 138 3.30.70.141
6ay1G00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain 0.9813 1 136 3.30.70.141
af_O88425_6_161_3.30.70.141 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain 0.981 2 131 3.30.70.141
ID Description Score Start End GO Terms
AF-V6DH04-F1-model_v4 Nucleoside diphosphate kinase (EC 2.7.4.6) 1.003 2 131 GO:0004550
GO:0005524
GO:0005737
GO:0006183
GO:0006228
GO:0006241
GO:0046872
AF-A0A4R5P201-F1-model_v4 Nucleoside diphosphate kinase (EC 2.7.4.6) 1.003 3 131 GO:0004550
GO:0006183
GO:0006228
GO:0006241
AF-A0A2N6EU76-F1-model_v4 Nucleoside diphosphate kinase (NDK) (NDP kinase) (EC 2.7.4.6) (Nucleoside-2-P kinase) 1.001 1 136 GO:0004550
GO:0005524
GO:0005737
GO:0006183
GO:0006228
GO:0006241
GO:0046872
AF-A0A2V9HHJ3-F1-model_v4 Nucleoside diphosphate kinase (NDK) (NDP kinase) (EC 2.7.4.6) (Nucleoside-2-P kinase) 1.001 2 136 GO:0004550
GO:0005524
GO:0005737
GO:0006183
GO:0006228
GO:0006241
GO:0046872
AF-A0A523TYZ3-F1-model_v4 Nucleoside diphosphate kinase (NDK) (NDP kinase) (EC 2.7.4.6) (Nucleoside-2-P kinase) 1.001 1 133 GO:0004550
GO:0005524
GO:0005737
GO:0006183
GO:0006228
GO:0006241
GO:0046872

Feature Viewer

pLDDT pTM Quality
96.4 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map