F487299
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 978 | 400 | 960 | 138 |
Family's Representative Sequence
| Representative Sequence | 3300013104|Ga0157370_10778863|Ga0157370_107788632 |
| Length | 140 |
| Sequence | MALERTFSIIKPDATRRNITGKIIALIEANGLRVVASKRIRMTRQQAEGFYAVHKERPFYGELVEQMIGGPVVVQVLEGENAIIKYREVMGATNPEEAVPGTIRKEFALNMGENSVHGSDSPENAKTEIKFFFTDAEIVG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231025 | Pantoea sp. YR343 | Isolate | Rhizosphere |
| 2 | 2511231035 | Pantoea sp. GM01 | Isolate | Rhizosphere |
| 3 | 2608642108 | Pantoea agglomerans NFPP29 | Isolate | Rhizoplane |
| 4 | 2648501693 | Pantoea ananatis B1-9 | Isolate | Rhizosphere |
| 5 | 2684622997 | Pantoea ananatis NFIX48 | Isolate | Rhizoplane |
| 6 | 2808606414 | Pantoea sp. SJZ147 | Isolate | Rhizosphere |
| 7 | 2844528606 | Pantoea sp. R-72498 v. 2 | Isolate | Unclassified |
| 8 | 2847797336 | Pantoea ananatis NN08200 | Isolate | Unclassified |
| 9 | 2865014394 | Pantoea sp. R-71966 | Isolate | Unclassified |
| 10 | 2876601092 | Pantoea endophytica 596 | Isolate | Unclassified |
| 11 | 2881609920 | Pantoea sp. ARC607 | Isolate | Rhizosphere |
| 12 | 2939602548 | Pantoea dispersa 1175 | Isolate | Rhizosphere |
| 13 | 2945951305 | Pantoea agglomerans W2I1 | Isolate | Rhizosphere |
| 14 | 2978975091 | Pantoea anthophila SORGH_AS 797 | Isolate | Unclassified |
| 15 | 2984494565 | Pantoea ananatis SORGH_AS197 | Isolate | Aerial Root |
| 16 | 2990261002 | Pantoea ananatis SORGH_AS213 | Isolate | Aerial Root |
| 17 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 18 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 19 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 20 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 27 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 31 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 43 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 54 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 58 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 61 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 67 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 69 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 70 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 71 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 73 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 74 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 75 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 76 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 77 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 78 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 79 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 80 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 81 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 82 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 83 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 84 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 85 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 87 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 88 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 89 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 90 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 91 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 92 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 93 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 95 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 96 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 97 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 98 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 99 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 100 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 101 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 102 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 103 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 105 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 106 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 107 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 120 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 134 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 139 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 140 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 141 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 142 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 143 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 144 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 145 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 146 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 204 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 208 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 209 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 210 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 211 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 212 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 213 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 214 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 215 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 216 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 217 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 218 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 219 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 220 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 221 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 222 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 223 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 224 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 225 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 226 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 227 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 228 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 229 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 230 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 231 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 232 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 233 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 234 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 235 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 236 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 237 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 238 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 239 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 240 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 241 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 242 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 243 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 244 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 245 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 246 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 247 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 248 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 249 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 250 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 251 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 252 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 253 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 254 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 255 | 3300038725 | Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 | Metagenome | Unclassified |
| 256 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 257 | 3300038727 | Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 | Metagenome | Unclassified |
| 258 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 259 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 260 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 261 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 262 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 263 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 264 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 265 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 266 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 267 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 268 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 269 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 270 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 271 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 272 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 273 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 274 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 275 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 276 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 277 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 278 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 279 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 280 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 281 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 282 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 283 | 3300042132 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 | Metagenome | Rhizosphere |
| 284 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 285 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 286 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 287 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 288 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 289 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 290 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 291 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 292 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 293 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 294 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 295 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 331 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 332 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 333 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 334 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 335 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 336 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 337 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 338 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 339 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 340 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 341 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 342 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 343 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 344 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 345 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 346 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 352 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 353 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 356 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 358 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 359 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 360 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 361 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 362 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 363 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 364 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 365 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 366 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 367 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 368 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 369 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 370 | 3300049764 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control | Metagenome | Rhizosphere |
| 371 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 372 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 373 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 374 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 375 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 376 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 377 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 378 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 379 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 380 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 381 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 382 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 383 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 384 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 385 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 386 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 387 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 388 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 389 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 390 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 391 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 392 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 393 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 394 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 395 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 396 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 397 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 398 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 399 | 8016733728 | Pantoea sp. SORGH_AS 659 | Isolate | Unclassified |
| 400 | 8019499862 | Kluyvera sp. 1366 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.55 |
| Metatranscriptomes | 0.61 |
| Isolates | 1.84 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.2 |
| Bulb | 0 |
| Endosphere | 2.76 |
| Nodule | 0 |
| Rhizoplane | 2.45 |
| Rhizosphere | 91 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.58 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10243124 | 3300003203 | Bacteria | 528 |
| 2 | Ga0065715_10350156 | 3300005293 | Bacteria | 952 |
| 3 | Ga0065707_10005793 | 3300005295 | Bacteria | 4042 |
| 4 | Ga0065707_10512314 | 3300005295 | Bacteria | 748 |
| 5 | Ga0070658_10059170 | 3300005327 | Bacteria | 3120 |
| 6 | Ga0070676_10004905 | 3300005328 | Bacteria | 7088 |
| 7 | Ga0070683_100171249 | 3300005329 | Bacteria | 2061 |
| 8 | Ga0070690_100016281 | 3300005330 | Bacteria | 4450 |
| 9 | Ga0070670_100024993 | 3300005331 | Bacteria | 5139 |
| 10 | Ga0070670_100299431 | 3300005331 | Bacteria | 1406 |
| 11 | Ga0070670_100652273 | 3300005331 | Bacteria | 944 |
| 12 | Ga0070670_101358526 | 3300005331 | Bacteria | 651 |
| 13 | Ga0070677_10210617 | 3300005333 | Bacteria | 943 |
| 14 | Ga0068869_101024769 | 3300005334 | Bacteria | 719 |
| 15 | Ga0070666_10096283 | 3300005335 | Bacteria | 2037 |
| 16 | Ga0070666_10389840 | 3300005335 | Bacteria | 1001 |
| 17 | Ga0070666_10564455 | 3300005335 | Bacteria | 829 |
| 18 | Ga0070680_100016205 | 3300005336 | Bacteria | 5861 |
| 19 | Ga0070680_100126478 | 3300005336 | Bacteria | 2136 |
| 20 | Ga0070680_100197373 | 3300005336 | Bacteria | 1696 |
| 21 | Ga0070680_100386735 | 3300005336 | Bacteria | 1192 |
| 22 | Ga0070680_100860824 | 3300005336 | Bacteria | 781 |
| 23 | Ga0070682_100000035 | 3300005337 | Bacteria | 150016 |
| 24 | Ga0070682_100392110 | 3300005337 | Bacteria | 1048 |
| 25 | Ga0068868_100264100 | 3300005338 | Bacteria | 1453 |
| 26 | Ga0068868_100312725 | 3300005338 | Bacteria | 1337 |
| 27 | Ga0068868_100328456 | 3300005338 | Bacteria | 1305 |
| 28 | Ga0070660_100023622 | 3300005339 | Bacteria | 4556 |
| 29 | Ga0070660_100137008 | 3300005339 | Bacteria | 1961 |
| 30 | Ga0070660_100546524 | 3300005339 | Bacteria | 966 |
| 31 | Ga0070689_100144658 | 3300005340 | Bacteria | 1914 |
| 32 | Ga0070689_100246628 | 3300005340 | Bacteria | 1473 |
| 33 | Ga0070689_100619926 | 3300005340 | Bacteria | 939 |
| 34 | Ga0070687_100051272 | 3300005343 | Bacteria | 2136 |
| 35 | Ga0070687_101105960 | 3300005343 | Bacteria | 580 |
| 36 | Ga0070661_100008889 | 3300005344 | Bacteria | 6952 |
| 37 | Ga0070661_100027663 | 3300005344 | Bacteria | 4085 |
| 38 | Ga0070661_100754952 | 3300005344 | Bacteria | 796 |
| 39 | Ga0070692_11047784 | 3300005345 | Bacteria | 573 |
| 40 | Ga0070668_100213689 | 3300005347 | Bacteria | 1588 |
| 41 | Ga0070668_101307667 | 3300005347 | Bacteria | 659 |
| 42 | Ga0070669_100191698 | 3300005353 | Bacteria | 1604 |
| 43 | Ga0070669_100224737 | 3300005353 | Bacteria | 1485 |
| 44 | Ga0070669_100309031 | 3300005353 | Bacteria | 1274 |
| 45 | Ga0070669_101323243 | 3300005353 | Unclassified | 624 |
| 46 | Ga0070675_100007339 | 3300005354 | Bacteria | 8507 |
| 47 | Ga0070675_100011756 | 3300005354 | Bacteria | 6857 |
| 48 | Ga0070675_100117308 | 3300005354 | Bacteria | 2259 |
| 49 | Ga0070675_100118121 | 3300005354 | Bacteria | 2251 |
| 50 | Ga0070675_100161591 | 3300005354 | Bacteria | 1926 |
| 51 | Ga0070675_100444097 | 3300005354 | Bacteria | 1162 |
| 52 | Ga0070675_100682381 | 3300005354 | Viruses | 935 |
| 53 | Ga0070671_100014366 | 3300005355 | Bacteria | 6396 |
| 54 | Ga0070671_100016291 | 3300005355 | Bacteria | 6012 |
| 55 | Ga0070671_100308936 | 3300005355 | Bacteria | 1347 |
| 56 | Ga0070674_100004717 | 3300005356 | Bacteria | 7799 |
| 57 | Ga0070674_100070771 | 3300005356 | Bacteria | 2465 |
| 58 | Ga0070674_100089702 | 3300005356 | Bacteria | 2215 |
| 59 | Ga0070674_100100452 | 3300005356 | Bacteria | 2106 |
| 60 | Ga0070674_100902262 | 3300005356 | Bacteria | 770 |
| 61 | Ga0070674_101283134 | 3300005356 | Bacteria | 652 |
| 62 | Ga0070673_100001825 | 3300005364 | Bacteria | 12719 |
| 63 | Ga0070673_100012360 | 3300005364 | Bacteria | 5860 |
| 64 | Ga0070673_100034826 | 3300005364 | Bacteria | 3814 |
| 65 | Ga0070673_101200008 | 3300005364 | Bacteria | 711 |
| 66 | Ga0070673_101508236 | 3300005364 | Bacteria | 634 |
| 67 | Ga0070688_100437836 | 3300005365 | Bacteria | 975 |
| 68 | Ga0070659_100612076 | 3300005366 | Bacteria | 937 |
| 69 | Ga0070667_100348291 | 3300005367 | Bacteria | 1341 |
| 70 | Ga0070667_100969762 | 3300005367 | Bacteria | 793 |
| 71 | Ga0070713_100003643 | 3300005436 | Bacteria | 10193 |
| 72 | Ga0070713_100068677 | 3300005436 | Bacteria | 2987 |
| 73 | Ga0070713_100380630 | 3300005436 | Bacteria | 1315 |
| 74 | Ga0070701_10212838 | 3300005438 | Bacteria | 1148 |
| 75 | Ga0070701_11094547 | 3300005438 | Bacteria | 560 |
| 76 | Ga0070701_11198964 | 3300005438 | Unclassified | 538 |
| 77 | Ga0070705_100672958 | 3300005440 | Bacteria | 810 |
| 78 | Ga0070700_100027077 | 3300005441 | Bacteria | 3395 |
| 79 | Ga0070700_100059804 | 3300005441 | Bacteria | 2400 |
| 80 | Ga0070700_100391884 | 3300005441 | Bacteria | 1042 |
| 81 | Ga0070663_100005932 | 3300005455 | Bacteria | 7309 |
| 82 | Ga0070663_100148931 | 3300005455 | Bacteria | 1793 |
| 83 | Ga0070663_101229794 | 3300005455 | Bacteria | 659 |
| 84 | Ga0070678_100232589 | 3300005456 | Bacteria | 1537 |
| 85 | Ga0070678_100251862 | 3300005456 | Bacteria | 1481 |
| 86 | Ga0070678_100267319 | 3300005456 | Bacteria | 1441 |
| 87 | Ga0070678_100643101 | 3300005456 | Bacteria | 951 |
| 88 | Ga0070678_101045567 | 3300005456 | Bacteria | 752 |
| 89 | Ga0070678_101319216 | 3300005456 | Bacteria | 672 |
| 90 | Ga0070662_101367258 | 3300005457 | Unclassified | 610 |
| 91 | Ga0070681_10019189 | 3300005458 | Bacteria | 6843 |
| 92 | Ga0070681_10386725 | 3300005458 | Bacteria | 1310 |
| 93 | Ga0068867_100001976 | 3300005459 | Bacteria | 14295 |
| 94 | Ga0068867_100257001 | 3300005459 | Bacteria | 1423 |
| 95 | Ga0068867_100894192 | 3300005459 | Bacteria | 799 |
| 96 | Ga0070685_10013898 | 3300005466 | Bacteria | 4259 |
| 97 | Ga0070685_10043106 | 3300005466 | Bacteria | 2579 |
| 98 | Ga0070685_10182558 | 3300005466 | Bacteria | 1352 |
| 99 | Ga0070698_100149275 | 3300005471 | Bacteria | 2286 |
| 100 | Ga0070698_100780796 | 3300005471 | Bacteria | 899 |
| 101 | Ga0070698_100939676 | 3300005471 | Bacteria | 811 |
| 102 | Ga0070698_101801867 | 3300005471 | Bacteria | 565 |
| 103 | Ga0070699_100198406 | 3300005518 | Bacteria | 1784 |
| 104 | Ga0070679_100206714 | 3300005530 | Bacteria | 1928 |
| 105 | Ga0070679_100302551 | 3300005530 | Bacteria | 1550 |
| 106 | Ga0070684_100081768 | 3300005535 | Bacteria | 2859 |
| 107 | Ga0070684_100250800 | 3300005535 | Bacteria | 1618 |
| 108 | Ga0070684_101475018 | 3300005535 | Bacteria | 641 |
| 109 | Ga0070684_101517437 | 3300005535 | Bacteria | 632 |
| 110 | Ga0070697_100049091 | 3300005536 | Bacteria | 3424 |
| 111 | Ga0068853_100005152 | 3300005539 | Bacteria | 10215 |
| 112 | Ga0068853_100028505 | 3300005539 | Bacteria | 4698 |
| 113 | Ga0068853_100102808 | 3300005539 | Bacteria | 2529 |
| 114 | Ga0068853_100137168 | 3300005539 | Bacteria | 2194 |
| 115 | Ga0068853_100246164 | 3300005539 | Bacteria | 1640 |
| 116 | Ga0070672_100018076 | 3300005543 | Bacteria | 5089 |
| 117 | Ga0070672_100031727 | 3300005543 | Bacteria | 3980 |
| 118 | Ga0070672_100099015 | 3300005543 | Bacteria | 2362 |
| 119 | Ga0070672_100354547 | 3300005543 | Bacteria | 1251 |
| 120 | Ga0070672_101993736 | 3300005543 | Bacteria | 523 |
| 121 | Ga0070695_100062705 | 3300005545 | Bacteria | 2414 |
| 122 | Ga0070696_100777012 | 3300005546 | Bacteria | 787 |
| 123 | Ga0070665_100000839 | 3300005548 | Bacteria | 40097 |
| 124 | Ga0070665_100311134 | 3300005548 | Bacteria | 1579 |
| 125 | Ga0070665_100382985 | 3300005548 | Bacteria | 1414 |
| 126 | Ga0070665_100595402 | 3300005548 | Bacteria | 1119 |
| 127 | Ga0070665_100741933 | 3300005548 | Bacteria | 995 |
| 128 | Ga0070665_101180264 | 3300005548 | Bacteria | 776 |
| 129 | Ga0070665_101398522 | 3300005548 | Bacteria | 709 |
| 130 | Ga0070665_101901620 | 3300005548 | Bacteria | 601 |
| 131 | Ga0070704_100014629 | 3300005549 | Bacteria | 4906 |
| 132 | Ga0070704_101341769 | 3300005549 | Bacteria | 655 |
| 133 | Ga0068855_100025034 | 3300005563 | Bacteria | 7143 |
| 134 | Ga0068855_100118445 | 3300005563 | Bacteria | 3033 |
| 135 | Ga0068855_100450522 | 3300005563 | Bacteria | 1404 |
| 136 | Ga0068855_100542524 | 3300005563 | Bacteria | 1260 |
| 137 | Ga0068855_100919981 | 3300005563 | Bacteria | 923 |
| 138 | Ga0070664_100016791 | 3300005564 | Bacteria | 6008 |
| 139 | Ga0070664_100512074 | 3300005564 | Bacteria | 1107 |
| 140 | Ga0068857_100100694 | 3300005577 | Bacteria | 2592 |
| 141 | Ga0068857_101561824 | 3300005577 | Bacteria | 644 |
| 142 | Ga0068854_100004717 | 3300005578 | Bacteria | 8590 |
| 143 | Ga0068854_100015515 | 3300005578 | Bacteria | 5049 |
| 144 | Ga0068854_100028425 | 3300005578 | Bacteria | 3864 |
| 145 | Ga0068854_100271546 | 3300005578 | Bacteria | 1362 |
| 146 | Ga0068854_101020626 | 3300005578 | Unclassified | 733 |
| 147 | Ga0068856_100077852 | 3300005614 | Bacteria | 3286 |
| 148 | Ga0068856_100205345 | 3300005614 | Bacteria | 1985 |
| 149 | Ga0068856_100301755 | 3300005614 | Bacteria | 1619 |
| 150 | Ga0070702_100927566 | 3300005615 | Bacteria | 684 |
| 151 | Ga0068852_100005648 | 3300005616 | Bacteria | 8972 |
| 152 | Ga0068852_100034648 | 3300005616 | Bacteria | 4203 |
| 153 | Ga0068852_100154208 | 3300005616 | Bacteria | 2138 |
| 154 | Ga0068852_100586799 | 3300005616 | Bacteria | 1118 |
| 155 | Ga0068852_100599731 | 3300005616 | Bacteria | 1105 |
| 156 | Ga0068859_100000040 | 3300005617 | Bacteria | 162782 |
| 157 | Ga0068859_100000468 | 3300005617 | Bacteria | 39887 |
| 158 | Ga0068859_100093442 | 3300005617 | Bacteria | 3059 |
| 159 | Ga0068859_101607846 | 3300005617 | Bacteria | 718 |
| 160 | Ga0068859_102497575 | 3300005617 | Bacteria | 569 |
| 161 | Ga0068859_102559106 | 3300005617 | Bacteria | 562 |
| 162 | Ga0068864_100029316 | 3300005618 | Bacteria | 4659 |
| 163 | Ga0068864_100277696 | 3300005618 | Bacteria | 1563 |
| 164 | Ga0068864_100843259 | 3300005618 | Bacteria | 903 |
| 165 | Ga0068866_10057567 | 3300005718 | Bacteria | 2004 |
| 166 | Ga0068861_100103017 | 3300005719 | Bacteria | 2274 |
| 167 | Ga0068861_100193131 | 3300005719 | Bacteria | 1703 |
| 168 | Ga0068851_10005621 | 3300005834 | Bacteria | 5693 |
| 169 | Ga0068851_10415286 | 3300005834 | Bacteria | 794 |
| 170 | Ga0068870_10032208 | 3300005840 | Bacteria | 2663 |
| 171 | Ga0068870_10237853 | 3300005840 | Bacteria | 1123 |
| 172 | Ga0068863_100000307 | 3300005841 | Bacteria | 50304 |
| 173 | Ga0068863_100360734 | 3300005841 | Bacteria | 1417 |
| 174 | Ga0068863_100369372 | 3300005841 | Bacteria | 1400 |
| 175 | Ga0068863_100622559 | 3300005841 | Bacteria | 1069 |
| 176 | Ga0068863_101474573 | 3300005841 | Unclassified | 689 |
| 177 | Ga0068863_101863406 | 3300005841 | Bacteria | 611 |
| 178 | Ga0068858_100016825 | 3300005842 | Bacteria | 6868 |
| 179 | Ga0068858_100026210 | 3300005842 | Bacteria | 5419 |
| 180 | Ga0068858_100048034 | 3300005842 | Bacteria | 3956 |
| 181 | Ga0068858_100371418 | 3300005842 | Bacteria | 1372 |
| 182 | Ga0068858_100689252 | 3300005842 | Bacteria | 994 |
| 183 | Ga0068860_100003051 | 3300005843 | Bacteria | 17296 |
| 184 | Ga0068860_100008532 | 3300005843 | Bacteria | 10210 |
| 185 | Ga0068860_100402722 | 3300005843 | Bacteria | 1354 |
| 186 | Ga0068860_101355042 | 3300005843 | Bacteria | 732 |
| 187 | Ga0081455_10220993 | 3300005937 | Bacteria | 1404 |
| 188 | Ga0081540_1055956 | 3300005983 | Bacteria | 1918 |
| 189 | Ga0081539_10027575 | 3300005985 | Bacteria | 3593 |
| 190 | Ga0081539_10337301 | 3300005985 | Unclassified | 637 |
| 191 | Ga0070717_10031295 | 3300006028 | Bacteria | 4279 |
| 192 | Ga0075365_10080806 | 3300006038 | Bacteria | 2201 |
| 193 | Ga0075368_10040666 | 3300006042 | Bacteria | 1825 |
| 194 | Ga0075368_10089583 | 3300006042 | Bacteria | 1258 |
| 195 | Ga0075364_10232614 | 3300006051 | Bacteria | 1251 |
| 196 | Ga0075364_10558624 | 3300006051 | Bacteria | 782 |
| 197 | Ga0070716_101082612 | 3300006173 | Bacteria | 638 |
| 198 | Ga0070712_100489098 | 3300006175 | Bacteria | 1030 |
| 199 | Ga0070712_100961073 | 3300006175 | Bacteria | 738 |
| 200 | Ga0075367_10039305 | 3300006178 | Bacteria | 2758 |
| 201 | Ga0075367_10249356 | 3300006178 | Bacteria | 1113 |
| 202 | Ga0075367_10651814 | 3300006178 | Bacteria | 669 |
| 203 | Ga0075366_10008607 | 3300006195 | Bacteria | 5682 |
| 204 | Ga0075366_10152577 | 3300006195 | Bacteria | 1399 |
| 205 | Ga0097621_100097468 | 3300006237 | Bacteria | 2469 |
| 206 | Ga0097621_100160348 | 3300006237 | Bacteria | 1933 |
| 207 | Ga0097621_100329929 | 3300006237 | Bacteria | 1353 |
| 208 | Ga0097621_100898233 | 3300006237 | Bacteria | 825 |
| 209 | Ga0075370_10032032 | 3300006353 | Bacteria | 2936 |
| 210 | Ga0068871_100338928 | 3300006358 | Bacteria | 1327 |
| 211 | Ga0068871_100362735 | 3300006358 | Bacteria | 1284 |
| 212 | Ga0075428_100017091 | 3300006844 | Bacteria | 8015 |
| 213 | Ga0075428_100308190 | 3300006844 | Bacteria | 1702 |
| 214 | Ga0075428_100379392 | 3300006844 | Bacteria | 1516 |
| 215 | Ga0075428_100532853 | 3300006844 | Bacteria | 1256 |
| 216 | Ga0075430_100010683 | 3300006846 | Bacteria | 7779 |
| 217 | Ga0075430_100069350 | 3300006846 | Bacteria | 2958 |
| 218 | Ga0075430_100148983 | 3300006846 | Bacteria | 1949 |
| 219 | Ga0075430_100160396 | 3300006846 | Bacteria | 1872 |
| 220 | Ga0075430_100244826 | 3300006846 | Bacteria | 1486 |
| 221 | Ga0075430_100433226 | 3300006846 | Bacteria | 1085 |
| 222 | Ga0075430_100465898 | 3300006846 | Bacteria | 1043 |
| 223 | Ga0075430_100768500 | 3300006846 | Bacteria | 794 |
| 224 | Ga0075431_100040014 | 3300006847 | Bacteria | 4830 |
| 225 | Ga0075431_100195183 | 3300006847 | Bacteria | 2073 |
| 226 | Ga0075431_100472410 | 3300006847 | Bacteria | 1248 |
| 227 | Ga0075431_100472933 | 3300006847 | Bacteria | 1247 |
| 228 | Ga0075431_100752429 | 3300006847 | Bacteria | 950 |
| 229 | Ga0075431_101234424 | 3300006847 | Bacteria | 710 |
| 230 | Ga0075434_100068600 | 3300006871 | Bacteria | 3533 |
| 231 | Ga0075434_100229839 | 3300006871 | Bacteria | 1874 |
| 232 | Ga0075429_100093654 | 3300006880 | Bacteria | 2620 |
| 233 | Ga0075429_100720730 | 3300006880 | Bacteria | 874 |
| 234 | Ga0068865_100144165 | 3300006881 | Bacteria | 1799 |
| 235 | Ga0068865_100334624 | 3300006881 | Bacteria | 1222 |
| 236 | Ga0068865_100547007 | 3300006881 | Bacteria | 972 |
| 237 | Ga0075436_100026351 | 3300006914 | Bacteria | 4003 |
| 238 | Ga0075436_100354341 | 3300006914 | Bacteria | 1058 |
| 239 | Ga0075436_100776596 | 3300006914 | Bacteria | 712 |
| 240 | Ga0097620_100000040 | 3300006931 | Bacteria | 162782 |
| 241 | Ga0097620_100000468 | 3300006931 | Bacteria | 39887 |
| 242 | Ga0097620_100093447 | 3300006931 | Bacteria | 3059 |
| 243 | Ga0097620_101607696 | 3300006931 | Bacteria | 718 |
| 244 | Ga0097620_102496979 | 3300006931 | Bacteria | 569 |
| 245 | Ga0097620_102558995 | 3300006931 | Bacteria | 562 |
| 246 | Ga0075435_101896748 | 3300007076 | Bacteria | 523 |
| 247 | Ga0099794_10081792 | 3300007265 | Bacteria | 1594 |
| 248 | Ga0099794_10204433 | 3300007265 | Bacteria | 1012 |
| 249 | Ga0099795_10004626 | 3300007788 | Bacteria | 3573 |
| 250 | Ga0105240_10012404 | 3300009093 | Bacteria | 11765 |
| 251 | Ga0105240_10028438 | 3300009093 | Bacteria | 7303 |
| 252 | Ga0105240_10152968 | 3300009093 | Bacteria | 2746 |
| 253 | Ga0111539_10012966 | 3300009094 | Bacteria | 10430 |
| 254 | Ga0111539_10087032 | 3300009094 | Bacteria | 3671 |
| 255 | Ga0111539_10129573 | 3300009094 | Bacteria | 2954 |
| 256 | Ga0111539_10174269 | 3300009094 | Bacteria | 2513 |
| 257 | Ga0111539_10184332 | 3300009094 | Bacteria | 2438 |
| 258 | Ga0111539_10235811 | 3300009094 | Bacteria | 2130 |
| 259 | Ga0111539_10384417 | 3300009094 | Bacteria | 1634 |
| 260 | Ga0111539_10476842 | 3300009094 | Bacteria | 1453 |
| 261 | Ga0111539_10497423 | 3300009094 | Bacteria | 1420 |
| 262 | Ga0111539_11709641 | 3300009094 | Bacteria | 730 |
| 263 | Ga0111539_13455072 | 3300009094 | Bacteria | 507 |
| 264 | Ga0105245_10083279 | 3300009098 | Bacteria | 2928 |
| 265 | Ga0105245_10211792 | 3300009098 | Bacteria | 1865 |
| 266 | Ga0105245_10358461 | 3300009098 | Bacteria | 1447 |
| 267 | Ga0105245_10458327 | 3300009098 | Bacteria | 1285 |
| 268 | Ga0105245_11198718 | 3300009098 | Bacteria | 807 |
| 269 | Ga0105247_10051805 | 3300009101 | Bacteria | 2529 |
| 270 | Ga0105247_10179215 | 3300009101 | Bacteria | 1413 |
| 271 | Ga0105247_10793578 | 3300009101 | Bacteria | 722 |
| 272 | Ga0105247_10879786 | 3300009101 | Bacteria | 690 |
| 273 | Ga0114129_10053937 | 3300009147 | Bacteria | 5638 |
| 274 | Ga0114129_10069113 | 3300009147 | Bacteria | 4923 |
| 275 | Ga0114129_11135531 | 3300009147 | Bacteria | 976 |
| 276 | Ga0105243_10829076 | 3300009148 | Bacteria | 914 |
| 277 | Ga0105243_11127985 | 3300009148 | Bacteria | 794 |
| 278 | Ga0105243_12777543 | 3300009148 | Bacteria | 530 |
| 279 | Ga0105241_10114161 | 3300009174 | Bacteria | 2166 |
| 280 | Ga0105241_10552086 | 3300009174 | Unclassified | 1034 |
| 281 | Ga0105241_10613271 | 3300009174 | Bacteria | 984 |
| 282 | Ga0105241_11649018 | 3300009174 | Bacteria | 622 |
| 283 | Ga0105242_10042077 | 3300009176 | Bacteria | 3687 |
| 284 | Ga0105242_11940941 | 3300009176 | Bacteria | 630 |
| 285 | Ga0105248_10000090 | 3300009177 | Bacteria | 101891 |
| 286 | Ga0105248_10157617 | 3300009177 | Bacteria | 2561 |
| 287 | Ga0105248_10666579 | 3300009177 | Bacteria | 1174 |
| 288 | Ga0105248_11291532 | 3300009177 | Bacteria | 825 |
| 289 | Ga0105248_11298006 | 3300009177 | Bacteria | 823 |
| 290 | Ga0105237_11749043 | 3300009545 | Bacteria | 629 |
| 291 | Ga0105237_11819665 | 3300009545 | Bacteria | 617 |
| 292 | Ga0105238_10009190 | 3300009551 | Bacteria | 9895 |
| 293 | Ga0105238_10009677 | 3300009551 | Bacteria | 9648 |
| 294 | Ga0105238_10136633 | 3300009551 | Bacteria | 2429 |
| 295 | Ga0105238_10403448 | 3300009551 | Bacteria | 1360 |
| 296 | Ga0105249_10813068 | 3300009553 | Bacteria | 999 |
| 297 | Ga0105249_10877083 | 3300009553 | Bacteria | 964 |
| 298 | Ga0105249_10917346 | 3300009553 | Bacteria | 943 |
| 299 | Ga0105249_12221722 | 3300009553 | Bacteria | 621 |
| 300 | Ga0099796_10018181 | 3300010159 | Bacteria | 2106 |
| 301 | Ga0099796_10335200 | 3300010159 | Bacteria | 649 |
| 302 | Ga0105239_10007066 | 3300010375 | Bacteria | 12922 |
| 303 | Ga0105239_10118954 | 3300010375 | Bacteria | 2932 |
| 304 | Ga0105239_10962653 | 3300010375 | Bacteria | 981 |
| 305 | Ga0105239_12410490 | 3300010375 | Bacteria | 613 |
| 306 | Ga0105239_12445264 | 3300010375 | Bacteria | 608 |
| 307 | Ga0105246_10376112 | 3300011119 | Bacteria | 1172 |
| 308 | Ga0105246_10872153 | 3300011119 | Bacteria | 805 |
| 309 | Ga0157373_10267520 | 3300013100 | Bacteria | 1210 |
| 310 | Ga0157373_10291151 | 3300013100 | Bacteria | 1158 |
| 311 | Ga0157371_10034623 | 3300013102 | Bacteria | 3621 |
| 312 | Ga0157371_10653258 | 3300013102 | Bacteria | 785 |
| 313 | Ga0157370_10070956 | 3300013104 | Bacteria | 3287 |
| 314 | Ga0157370_10112532 | 3300013104 | Bacteria | 2544 |
| 315 | Ga0157370_10231297 | 3300013104 | Bacteria | 1711 |
| 316 | Ga0157370_10778863 | 3300013104 | Bacteria | 871 |
| 317 | Ga0157370_11012175 | 3300013104 | Bacteria | 752 |
| 318 | Ga0157369_10014955 | 3300013105 | Bacteria | 8759 |
| 319 | Ga0157374_10000008 | 3300013296 | Bacteria | 588863 |
| 320 | Ga0157374_10480122 | 3300013296 | Bacteria | 1246 |
| 321 | Ga0157374_10740794 | 3300013296 | Bacteria | 997 |
| 322 | Ga0157374_11993646 | 3300013296 | Bacteria | 607 |
| 323 | Ga0157378_10280588 | 3300013297 | Bacteria | 1606 |
| 324 | Ga0157378_10463408 | 3300013297 | Bacteria | 1260 |
| 325 | Ga0157378_10477684 | 3300013297 | Bacteria | 1241 |
| 326 | Ga0157378_10779530 | 3300013297 | Bacteria | 981 |
| 327 | Ga0157378_11024300 | 3300013297 | Unclassified | 861 |
| 328 | Ga0163162_10067408 | 3300013306 | Bacteria | 3629 |
| 329 | Ga0163162_10668003 | 3300013306 | Bacteria | 1162 |
| 330 | Ga0157372_10219749 | 3300013307 | Bacteria | 2202 |
| 331 | Ga0157372_10483777 | 3300013307 | Bacteria | 1443 |
| 332 | Ga0157372_11669647 | 3300013307 | Bacteria | 733 |
| 333 | Ga0157372_12049114 | 3300013307 | Bacteria | 657 |
| 334 | Ga0157375_10000860 | 3300013308 | Bacteria | 26402 |
| 335 | Ga0157375_10598570 | 3300013308 | Bacteria | 1262 |
| 336 | Ga0163163_10000017 | 3300014325 | Bacteria | 208781 |
| 337 | Ga0163163_10015978 | 3300014325 | Bacteria | 6957 |
| 338 | Ga0163163_10044160 | 3300014325 | Bacteria | 4371 |
| 339 | Ga0163163_10106869 | 3300014325 | Bacteria | 2825 |
| 340 | Ga0163163_10115176 | 3300014325 | Bacteria | 2720 |
| 341 | Ga0163163_10655996 | 3300014325 | Bacteria | 1113 |
| 342 | Ga0163163_11069072 | 3300014325 | Bacteria | 870 |
| 343 | Ga0163163_12769509 | 3300014325 | Bacteria | 547 |
| 344 | Ga0157380_10000592 | 3300014326 | Bacteria | 22301 |
| 345 | Ga0157380_10027828 | 3300014326 | Bacteria | 4303 |
| 346 | Ga0157380_10041295 | 3300014326 | Bacteria | 3599 |
| 347 | Ga0157380_10070065 | 3300014326 | Bacteria | 2832 |
| 348 | Ga0157380_10595598 | 3300014326 | Bacteria | 1093 |
| 349 | Ga0157380_10598470 | 3300014326 | Bacteria | 1090 |
| 350 | Ga0157380_11552319 | 3300014326 | Bacteria | 716 |
| 351 | Ga0157380_11701603 | 3300014326 | Bacteria | 688 |
| 352 | Ga0182008_10239927 | 3300014497 | Bacteria | 932 |
| 353 | Ga0157377_10000007 | 3300014745 | Bacteria | 402005 |
| 354 | Ga0157377_10118117 | 3300014745 | Bacteria | 1603 |
| 355 | Ga0157377_10607175 | 3300014745 | Bacteria | 781 |
| 356 | Ga0157379_10000365 | 3300014968 | Bacteria | 36359 |
| 357 | Ga0157379_10008665 | 3300014968 | Bacteria | 8857 |
| 358 | Ga0157379_10025258 | 3300014968 | Bacteria | 5276 |
| 359 | Ga0157379_10390423 | 3300014968 | Bacteria | 1278 |
| 360 | Ga0157376_10036646 | 3300014969 | Bacteria | 3975 |
| 361 | Ga0157376_10397616 | 3300014969 | Bacteria | 1331 |
| 362 | Ga0157376_10464511 | 3300014969 | Bacteria | 1237 |
| 363 | Ga0157376_11481517 | 3300014969 | Bacteria | 711 |
| 364 | Ga0163161_10394336 | 3300017792 | Bacteria | 1109 |
| 365 | Ga0206356_11229896 | 3300020070 | Bacteria | 1577 |
| 366 | Ga0206352_10061836 | 3300020078 | Bacteria | 816 |
| 367 | Ga0206354_10876749 | 3300020081 | Bacteria | 869 |
| 368 | Ga0154015_1512287 | 3300020610 | Bacteria | 1325 |
| 369 | Ga0213873_10132782 | 3300021358 | Unclassified | 738 |
| 370 | Ga0213876_10000008 | 3300021384 | Bacteria | 506740 |
| 371 | Ga0213876_10520272 | 3300021384 | Bacteria | 633 |
| 372 | Ga0213875_10190403 | 3300021388 | Bacteria | 964 |
| 373 | Ga0228598_1007044 | 3300024227 | Bacteria | 2306 |
| 374 | Ga0207656_10001311 | 3300025321 | Bacteria | 8183 |
| 375 | Ga0207656_10004442 | 3300025321 | Bacteria | 4900 |
| 376 | Ga0207656_10249660 | 3300025321 | Bacteria | 869 |
| 377 | Ga0207682_10033397 | 3300025893 | Bacteria | 2071 |
| 378 | Ga0207682_10101100 | 3300025893 | Bacteria | 1260 |
| 379 | Ga0207682_10139590 | 3300025893 | Bacteria | 1087 |
| 380 | Ga0207682_10167217 | 3300025893 | Bacteria | 999 |
| 381 | Ga0207682_10207424 | 3300025893 | Bacteria | 903 |
| 382 | Ga0207710_10024756 | 3300025900 | Bacteria | 2587 |
| 383 | Ga0207710_10312966 | 3300025900 | Bacteria | 795 |
| 384 | Ga0207688_10090086 | 3300025901 | Bacteria | 1760 |
| 385 | Ga0207680_10044560 | 3300025903 | Bacteria | 2610 |
| 386 | Ga0207680_10233687 | 3300025903 | Bacteria | 1264 |
| 387 | Ga0207699_10192682 | 3300025906 | Bacteria | 1376 |
| 388 | Ga0207645_10022662 | 3300025907 | Bacteria | 4083 |
| 389 | Ga0207645_10123074 | 3300025907 | Bacteria | 1685 |
| 390 | Ga0207645_10629284 | 3300025907 | Bacteria | 729 |
| 391 | Ga0207643_10034115 | 3300025908 | Bacteria | 2850 |
| 392 | Ga0207643_10972299 | 3300025908 | Bacteria | 549 |
| 393 | Ga0207705_10248703 | 3300025909 | Bacteria | 1356 |
| 394 | Ga0207707_10326273 | 3300025912 | Bacteria | 1325 |
| 395 | Ga0207707_10342284 | 3300025912 | Bacteria | 1289 |
| 396 | Ga0207695_10007106 | 3300025913 | Bacteria | 14343 |
| 397 | Ga0207695_10494094 | 3300025913 | Bacteria | 1106 |
| 398 | Ga0207695_10932069 | 3300025913 | Bacteria | 748 |
| 399 | Ga0207695_11280134 | 3300025913 | Bacteria | 614 |
| 400 | Ga0207671_10460783 | 3300025914 | Bacteria | 1013 |
| 401 | Ga0207660_10122482 | 3300025917 | Bacteria | 1971 |
| 402 | Ga0207660_10149133 | 3300025917 | Bacteria | 1795 |
| 403 | Ga0207660_10382759 | 3300025917 | Bacteria | 1131 |
| 404 | Ga0207662_10107890 | 3300025918 | Bacteria | 1733 |
| 405 | Ga0207662_10224059 | 3300025918 | Bacteria | 1226 |
| 406 | Ga0207662_10408934 | 3300025918 | Bacteria | 921 |
| 407 | Ga0207662_10910704 | 3300025918 | Bacteria | 623 |
| 408 | Ga0207657_10044776 | 3300025919 | Bacteria | 3888 |
| 409 | Ga0207657_10501061 | 3300025919 | Bacteria | 951 |
| 410 | Ga0207649_10001031 | 3300025920 | Bacteria | 17152 |
| 411 | Ga0207649_10187784 | 3300025920 | Bacteria | 1451 |
| 412 | Ga0207649_10541971 | 3300025920 | Bacteria | 889 |
| 413 | Ga0207652_10158236 | 3300025921 | Bacteria | 2030 |
| 414 | Ga0207681_10051558 | 3300025923 | Bacteria | 2788 |
| 415 | Ga0207681_10135222 | 3300025923 | Bacteria | 1828 |
| 416 | Ga0207681_10188670 | 3300025923 | Bacteria | 1575 |
| 417 | Ga0207681_10200913 | 3300025923 | Bacteria | 1531 |
| 418 | Ga0207681_10238304 | 3300025923 | Bacteria | 1415 |
| 419 | Ga0207694_10006307 | 3300025924 | Bacteria | 9055 |
| 420 | Ga0207694_10246106 | 3300025924 | Bacteria | 1462 |
| 421 | Ga0207694_11294337 | 3300025924 | Bacteria | 616 |
| 422 | Ga0207650_10036593 | 3300025925 | Bacteria | 3572 |
| 423 | Ga0207650_10045226 | 3300025925 | Bacteria | 3239 |
| 424 | Ga0207650_10148131 | 3300025925 | Bacteria | 1850 |
| 425 | Ga0207659_10004193 | 3300025926 | Bacteria | 8709 |
| 426 | Ga0207659_10033427 | 3300025926 | Bacteria | 3540 |
| 427 | Ga0207659_10083746 | 3300025926 | Bacteria | 2365 |
| 428 | Ga0207659_10109367 | 3300025926 | Bacteria | 2098 |
| 429 | Ga0207659_10154248 | 3300025926 | Bacteria | 1796 |
| 430 | Ga0207659_10155706 | 3300025926 | Bacteria | 1789 |
| 431 | Ga0207659_10554655 | 3300025926 | Bacteria | 977 |
| 432 | Ga0207659_10637438 | 3300025926 | Bacteria | 910 |
| 433 | Ga0207659_11376772 | 3300025926 | Bacteria | 605 |
| 434 | Ga0207687_10174541 | 3300025927 | Bacteria | 1660 |
| 435 | Ga0207687_10434616 | 3300025927 | Bacteria | 1086 |
| 436 | Ga0207700_10024321 | 3300025928 | Bacteria | 4191 |
| 437 | Ga0207700_10339249 | 3300025928 | Bacteria | 1306 |
| 438 | Ga0207644_10017759 | 3300025931 | Bacteria | 4810 |
| 439 | Ga0207644_10025280 | 3300025931 | Bacteria | 4083 |
| 440 | Ga0207644_10203721 | 3300025931 | Bacteria | 1561 |
| 441 | Ga0207644_10353999 | 3300025931 | Bacteria | 1193 |
| 442 | Ga0207706_10086949 | 3300025933 | Bacteria | 2748 |
| 443 | Ga0207686_10038026 | 3300025934 | Bacteria | 2909 |
| 444 | Ga0207709_10252033 | 3300025935 | Bacteria | 1290 |
| 445 | Ga0207670_10019893 | 3300025936 | Bacteria | 4111 |
| 446 | Ga0207670_10057836 | 3300025936 | Bacteria | 2631 |
| 447 | Ga0207670_10106572 | 3300025936 | Bacteria | 2011 |
| 448 | Ga0207670_11814575 | 3300025936 | Bacteria | 519 |
| 449 | Ga0207669_10093212 | 3300025937 | Bacteria | 1967 |
| 450 | Ga0207669_10148738 | 3300025937 | Bacteria | 1637 |
| 451 | Ga0207669_10633988 | 3300025937 | Bacteria | 872 |
| 452 | Ga0207669_11129724 | 3300025937 | Bacteria | 662 |
| 453 | Ga0207704_10128793 | 3300025938 | Bacteria | 1748 |
| 454 | Ga0207691_10039249 | 3300025940 | Bacteria | 4380 |
| 455 | Ga0207691_10354554 | 3300025940 | Bacteria | 1255 |
| 456 | Ga0207691_10853150 | 3300025940 | Bacteria | 764 |
| 457 | Ga0207711_10015097 | 3300025941 | Bacteria | 6414 |
| 458 | Ga0207711_11122502 | 3300025941 | Bacteria | 727 |
| 459 | Ga0207689_10178242 | 3300025942 | Bacteria | 1753 |
| 460 | Ga0207679_10264398 | 3300025945 | Bacteria | 1469 |
| 461 | Ga0207679_10370026 | 3300025945 | Bacteria | 1254 |
| 462 | Ga0207667_10020673 | 3300025949 | Bacteria | 7314 |
| 463 | Ga0207667_10092286 | 3300025949 | Bacteria | 3128 |
| 464 | Ga0207667_10127751 | 3300025949 | Bacteria | 2619 |
| 465 | Ga0207667_11075202 | 3300025949 | Bacteria | 789 |
| 466 | Ga0207651_10011976 | 3300025960 | Bacteria | 4882 |
| 467 | Ga0207651_10078395 | 3300025960 | Bacteria | 2369 |
| 468 | Ga0207651_10414477 | 3300025960 | Bacteria | 1148 |
| 469 | Ga0207651_10971831 | 3300025960 | Bacteria | 758 |
| 470 | Ga0207651_11229421 | 3300025960 | Bacteria | 673 |
| 471 | Ga0207712_10310996 | 3300025961 | Bacteria | 1296 |
| 472 | Ga0207712_11419553 | 3300025961 | Bacteria | 621 |
| 473 | Ga0207668_10105912 | 3300025972 | Bacteria | 2100 |
| 474 | Ga0207668_11281483 | 3300025972 | Bacteria | 659 |
| 475 | Ga0207668_11634536 | 3300025972 | Unclassified | 582 |
| 476 | Ga0207640_10003993 | 3300025981 | Bacteria | 7968 |
| 477 | Ga0207640_10014708 | 3300025981 | Bacteria | 4511 |
| 478 | Ga0207640_10198484 | 3300025981 | Bacteria | 1518 |
| 479 | Ga0207640_10496838 | 3300025981 | Bacteria | 1015 |
| 480 | Ga0207640_10673962 | 3300025981 | Bacteria | 884 |
| 481 | Ga0207658_10366286 | 3300025986 | Bacteria | 1259 |
| 482 | Ga0207658_11470553 | 3300025986 | Bacteria | 623 |
| 483 | Ga0207677_10079440 | 3300026023 | Bacteria | 2346 |
| 484 | Ga0207677_10229607 | 3300026023 | Bacteria | 1494 |
| 485 | Ga0207677_11103982 | 3300026023 | Bacteria | 723 |
| 486 | Ga0207677_11158489 | 3300026023 | Bacteria | 707 |
| 487 | Ga0207677_11437837 | 3300026023 | Bacteria | 636 |
| 488 | Ga0207703_10007529 | 3300026035 | Bacteria | 8639 |
| 489 | Ga0207703_10046911 | 3300026035 | Bacteria | 3482 |
| 490 | Ga0207703_11032863 | 3300026035 | Bacteria | 789 |
| 491 | Ga0207639_10002270 | 3300026041 | Bacteria | 12928 |
| 492 | Ga0207639_10058301 | 3300026041 | Bacteria | 2969 |
| 493 | Ga0207639_10146333 | 3300026041 | Bacteria | 1974 |
| 494 | Ga0207639_10302296 | 3300026041 | Bacteria | 1415 |
| 495 | Ga0207639_10584226 | 3300026041 | Bacteria | 1029 |
| 496 | Ga0207639_11256340 | 3300026041 | Bacteria | 695 |
| 497 | Ga0207678_10006322 | 3300026067 | Bacteria | 10518 |
| 498 | Ga0207678_10036396 | 3300026067 | Bacteria | 4284 |
| 499 | Ga0207678_10039306 | 3300026067 | Bacteria | 4107 |
| 500 | Ga0207678_10049950 | 3300026067 | Bacteria | 3614 |
| 501 | Ga0207678_10111317 | 3300026067 | Bacteria | 2335 |
| 502 | Ga0207678_10619502 | 3300026067 | Bacteria | 949 |
| 503 | Ga0207678_11122327 | 3300026067 | Bacteria | 696 |
| 504 | Ga0207678_11356572 | 3300026067 | Unclassified | 629 |
| 505 | Ga0207678_11538258 | 3300026067 | Unclassified | 587 |
| 506 | Ga0207708_10001790 | 3300026075 | Bacteria | 15846 |
| 507 | Ga0207708_10053891 | 3300026075 | Bacteria | 3065 |
| 508 | Ga0207708_10064508 | 3300026075 | Bacteria | 2798 |
| 509 | Ga0207708_10097167 | 3300026075 | Bacteria | 2276 |
| 510 | Ga0207702_10044412 | 3300026078 | Bacteria | 3735 |
| 511 | Ga0207702_10165396 | 3300026078 | Bacteria | 2023 |
| 512 | Ga0207702_10385591 | 3300026078 | Bacteria | 1348 |
| 513 | Ga0207641_10032537 | 3300026088 | Bacteria | 4329 |
| 514 | Ga0207641_10289199 | 3300026088 | Bacteria | 1544 |
| 515 | Ga0207641_11491457 | 3300026088 | Bacteria | 678 |
| 516 | Ga0207648_10000077 | 3300026089 | Bacteria | 93009 |
| 517 | Ga0207648_10211315 | 3300026089 | Bacteria | 1723 |
| 518 | Ga0207648_10605294 | 3300026089 | Bacteria | 1010 |
| 519 | Ga0207648_11890251 | 3300026089 | Bacteria | 558 |
| 520 | Ga0207676_10050527 | 3300026095 | Bacteria | 3242 |
| 521 | Ga0207676_10082496 | 3300026095 | Bacteria | 2615 |
| 522 | Ga0207676_10133403 | 3300026095 | Bacteria | 2115 |
| 523 | Ga0207674_10010061 | 3300026116 | Bacteria | 10758 |
| 524 | Ga0207674_10086625 | 3300026116 | Bacteria | 3127 |
| 525 | Ga0207674_10126790 | 3300026116 | Bacteria | 2518 |
| 526 | Ga0207674_10167782 | 3300026116 | Bacteria | 2149 |
| 527 | Ga0207675_100073156 | 3300026118 | Bacteria | 3207 |
| 528 | Ga0207675_100382424 | 3300026118 | Bacteria | 1384 |
| 529 | Ga0207675_101058313 | 3300026118 | Bacteria | 830 |
| 530 | Ga0207683_10157463 | 3300026121 | Bacteria | 2052 |
| 531 | Ga0207683_10189771 | 3300026121 | Bacteria | 1865 |
| 532 | Ga0207683_10293896 | 3300026121 | Bacteria | 1486 |
| 533 | Ga0207683_10628288 | 3300026121 | Bacteria | 995 |
| 534 | Ga0207683_10715479 | 3300026121 | Bacteria | 929 |
| 535 | Ga0207683_10869864 | 3300026121 | Bacteria | 837 |
| 536 | Ga0207683_11608632 | 3300026121 | Bacteria | 599 |
| 537 | Ga0207698_10009294 | 3300026142 | Bacteria | 6259 |
| 538 | Ga0207698_10072672 | 3300026142 | Bacteria | 2735 |
| 539 | Ga0207698_10098755 | 3300026142 | Bacteria | 2413 |
| 540 | Ga0207698_10852266 | 3300026142 | Bacteria | 916 |
| 541 | Ga0207698_12085776 | 3300026142 | Bacteria | 581 |
| 542 | Ga0207698_12252496 | 3300026142 | Bacteria | 557 |
| 543 | Ga0209179_1020163 | 3300027512 | Bacteria | 1291 |
| 544 | Ga0209588_1098108 | 3300027671 | Bacteria | 943 |
| 545 | Ga0209966_1010275 | 3300027695 | Bacteria | 1684 |
| 546 | Ga0209974_10022919 | 3300027876 | Bacteria | 2067 |
| 547 | Ga0209974_10050323 | 3300027876 | Bacteria | 1399 |
| 548 | Ga0207428_10002456 | 3300027907 | Bacteria | 18510 |
| 549 | Ga0207428_10024210 | 3300027907 | Bacteria | 5100 |
| 550 | Ga0207428_10520266 | 3300027907 | Bacteria | 862 |
| 551 | Ga0207428_10720380 | 3300027907 | Bacteria | 712 |
| 552 | Ga0268266_10000072 | 3300028379 | Bacteria | 232245 |
| 553 | Ga0268266_10096295 | 3300028379 | Bacteria | 2601 |
| 554 | Ga0268266_10459131 | 3300028379 | Unclassified | 1212 |
| 555 | Ga0268266_10562553 | 3300028379 | Bacteria | 1093 |
| 556 | Ga0268266_11044778 | 3300028379 | Bacteria | 790 |
| 557 | Ga0268266_11695301 | 3300028379 | Bacteria | 607 |
| 558 | Ga0268266_11769120 | 3300028379 | Bacteria | 593 |
| 559 | Ga0268266_11868853 | 3300028379 | Bacteria | 575 |
| 560 | Ga0268265_10344981 | 3300028380 | Bacteria | 1357 |
| 561 | Ga0268265_11948244 | 3300028380 | Bacteria | 595 |
| 562 | Ga0268264_10002191 | 3300028381 | Bacteria | 17369 |
| 563 | Ga0268264_10006064 | 3300028381 | Bacteria | 10213 |
| 564 | Ga0268264_10499926 | 3300028381 | Bacteria | 1186 |
| 565 | Ga0265338_10027640 | 3300028800 | Bacteria | 5686 |
| 566 | Ga0265338_10151094 | 3300028800 | Bacteria | 1804 |
| 567 | Ga0265338_10265119 | 3300028800 | Bacteria | 1261 |
| 568 | Ga0265324_10061787 | 3300029957 | Bacteria | 1280 |
| 569 | Ga0265330_10004069 | 3300031235 | Bacteria | 7500 |
| 570 | Ga0265330_10052275 | 3300031235 | Bacteria | 1790 |
| 571 | Ga0265328_10121476 | 3300031239 | Bacteria | 974 |
| 572 | Ga0265325_10000124 | 3300031241 | Bacteria | 53002 |
| 573 | Ga0265325_10040624 | 3300031241 | Bacteria | 2442 |
| 574 | Ga0265340_10031662 | 3300031247 | Bacteria | 2644 |
| 575 | Ga0265340_10300569 | 3300031247 | Bacteria | 712 |
| 576 | Ga0265339_10000277 | 3300031249 | Bacteria | 41496 |
| 577 | Ga0265339_10000521 | 3300031249 | Bacteria | 30036 |
| 578 | Ga0265316_10000629 | 3300031344 | Bacteria | 39308 |
| 579 | Ga0265316_10089557 | 3300031344 | Bacteria | 2348 |
| 580 | Ga0265316_10190979 | 3300031344 | Bacteria | 1521 |
| 581 | Ga0307408_100003848 | 3300031548 | Bacteria | 10213 |
| 582 | Ga0265313_10000588 | 3300031595 | Bacteria | 37769 |
| 583 | Ga0265313_10002031 | 3300031595 | Bacteria | 18150 |
| 584 | Ga0316575_10057546 | 3300031665 | Bacteria | 1550 |
| 585 | Ga0265314_10094029 | 3300031711 | Bacteria | 1944 |
| 586 | Ga0265342_10010188 | 3300031712 | Bacteria | 6545 |
| 587 | Ga0307405_10000655 | 3300031731 | Bacteria | 13337 |
| 588 | Ga0307405_10326121 | 3300031731 | Bacteria | 1175 |
| 589 | Ga0307405_10420470 | 3300031731 | Bacteria | 1052 |
| 590 | Ga0307405_10812331 | 3300031731 | Bacteria | 784 |
| 591 | Ga0307413_10096316 | 3300031824 | Bacteria | 1942 |
| 592 | Ga0307413_10440517 | 3300031824 | Bacteria | 1031 |
| 593 | Ga0307410_10009942 | 3300031852 | Bacteria | 5364 |
| 594 | Ga0307406_11724478 | 3300031901 | Unclassified | 555 |
| 595 | Ga0307407_10005789 | 3300031903 | Bacteria | 5408 |
| 596 | Ga0307407_10293894 | 3300031903 | Bacteria | 1130 |
| 597 | Ga0307412_10070651 | 3300031911 | Bacteria | 2381 |
| 598 | Ga0307412_10086408 | 3300031911 | Bacteria | 2182 |
| 599 | Ga0307412_11384330 | 3300031911 | Bacteria | 636 |
| 600 | Ga0307412_11617794 | 3300031911 | Bacteria | 592 |
| 601 | Ga0307409_100003910 | 3300031995 | Bacteria | 8245 |
| 602 | Ga0307409_100539628 | 3300031995 | Bacteria | 1143 |
| 603 | Ga0307409_100796478 | 3300031995 | Bacteria | 952 |
| 604 | Ga0307409_101477333 | 3300031995 | Bacteria | 707 |
| 605 | Ga0307416_100003573 | 3300032002 | Bacteria | 9171 |
| 606 | Ga0307416_100184416 | 3300032002 | Bacteria | 1960 |
| 607 | Ga0307416_100224917 | 3300032002 | Bacteria | 1803 |
| 608 | Ga0307416_100799254 | 3300032002 | Bacteria | 1039 |
| 609 | Ga0307416_100927573 | 3300032002 | Bacteria | 972 |
| 610 | Ga0307416_100931553 | 3300032002 | Bacteria | 970 |
| 611 | Ga0307416_100996683 | 3300032002 | Bacteria | 941 |
| 612 | Ga0307416_101010352 | 3300032002 | Bacteria | 935 |
| 613 | Ga0307416_103214251 | 3300032002 | Bacteria | 547 |
| 614 | Ga0307416_103262883 | 3300032002 | Bacteria | 543 |
| 615 | Ga0307414_10582474 | 3300032004 | Unclassified | 1001 |
| 616 | Ga0307414_10676175 | 3300032004 | Bacteria | 933 |
| 617 | Ga0307411_10001781 | 3300032005 | Bacteria | 9096 |
| 618 | Ga0307411_10257847 | 3300032005 | Bacteria | 1375 |
| 619 | Ga0307411_11897516 | 3300032005 | Bacteria | 554 |
| 620 | Ga0307415_100011537 | 3300032126 | Bacteria | 5063 |
| 621 | Ga0307415_101640370 | 3300032126 | Bacteria | 619 |
| 622 | Ga0316588_1176508 | 3300033528 | Unclassified | 553 |
| 623 | Ga0316596_1114729 | 3300033541 | Unclassified | 732 |
| 624 | Ga0373959_0000006 | 3300034820 | Bacteria | 73733 |
| 625 | Ga0373934_0196307 | 3300035086 | Bacteria | 830 |
| 626 | Ga0373944_0417183 | 3300035089 | Bacteria | 519 |
| 627 | Ga0373951_0273422 | 3300035091 | Bacteria | 514 |
| 628 | Ga0373952_0026644 | 3300035092 | Bacteria | 1257 |
| 629 | Ga0373945_0348062 | 3300035116 | Bacteria | 642 |
| 630 | Ga0373945_0455302 | 3300035116 | Bacteria | 566 |
| 631 | Ga0373954_0049694 | 3300035118 | Bacteria | 1967 |
| 632 | Ga0373955_0044923 | 3300035172 | Bacteria | 2382 |
| 633 | Ga0316574_0027123 | 3300035398 | Bacteria | 3449 |
| 634 | Ga0316574_0079546 | 3300035398 | Unclassified | 2079 |
| 635 | Ga0316574_0091842 | 3300035398 | Bacteria | 1936 |
| 636 | Ga0373931_0075955 | 3300035691 | Bacteria | 1844 |
| 637 | Ga0373935_0224909 | 3300035692 | Bacteria | 1305 |
| 638 | Ga0373927_1121750 | 3300035695 | Bacteria | 519 |
| 639 | Ga0373933_0047018 | 3300035724 | Bacteria | 2565 |
| 640 | Ga0373947_1114798 | 3300035725 | Unclassified | 538 |
| 641 | Ga0373937_0001949 | 3300036401 | Bacteria | 17281 |
| 642 | Ga0373937_0134651 | 3300036401 | Bacteria | 2309 |
| 643 | Ga0373937_0344060 | 3300036401 | Bacteria | 1412 |
| 644 | Ga0373937_0813751 | 3300036401 | Bacteria | 882 |
| 645 | Ga0316584_0036328 | 3300036712 | Unclassified | 3656 |
| 646 | Ga0373925_0003799 | 3300037068 | Bacteria | 11608 |
| 647 | Ga0373925_0143043 | 3300037068 | Bacteria | 1873 |
| 648 | Ga0395899_0612193 | 3300037312 | Bacteria | 692 |
| 649 | Ga0395900_0319329 | 3300037418 | Bacteria | 1534 |
| 650 | Ga0395900_0707454 | 3300037418 | Bacteria | 940 |
| 651 | Ga0395898_0359431 | 3300037466 | Bacteria | 1388 |
| 652 | Ga0395898_0509743 | 3300037466 | Bacteria | 1144 |
| 653 | Ga0395898_0566628 | 3300037466 | Bacteria | 1078 |
| 654 | Ga0436364_0229532 | 3300037853 | Bacteria | 1873 |
| 655 | Ga0436364_0324904 | 3300037853 | Bacteria | 5220 |
| 656 | Ga0436364_1075915 | 3300037853 | Bacteria | 9351 |
| 657 | Ga0395901_0661471 | 3300038443 | Bacteria | 1046 |
| 658 | Ga0400484_07775 | 3300038725 | Bacteria | 5999 |
| 659 | Ga0400490_10514 | 3300038726 | Bacteria | 1629 |
| 660 | Ga0400490_50905 | 3300038726 | Bacteria | 65742 |
| 661 | Ga0400491_28577 | 3300038727 | Bacteria | 8184 |
| 662 | Ga0400485_17143 | 3300038735 | Bacteria | 18739 |
| 663 | Ga0400488_12509 | 3300038741 | Bacteria | 1958 |
| 664 | Ga0400488_61775 | 3300038741 | Bacteria | 1209 |
| 665 | Ga0400486_16511 | 3300038742 | Bacteria | 11583 |
| 666 | Ga0400483_008789 | 3300039062 | Unclassified | 1339 |
| 667 | Ga0400489_07561 | 3300039093 | Bacteria | 1221 |
| 668 | Ga0400489_35047 | 3300039093 | Bacteria | 73845 |
| 669 | Ga0400487_00767 | 3300039110 | Bacteria | 7422 |
| 670 | Ga0436365_0324434 | 3300039437 | Bacteria | 2803 |
| 671 | Ga0436365_0546808 | 3300039437 | Bacteria | 630 |
| 672 | Ga0436365_0973417 | 3300039437 | Bacteria | 57549 |
| 673 | Ga0436365_1380816 | 3300039437 | Bacteria | 816 |
| 674 | Ga0436363_1032628 | 3300039450 | Bacteria | 1573 |
| 675 | Ga0436362_1054863 | 3300039453 | Bacteria | 6750 |
| 676 | Ga0451789_0527783 | 3300041443 | Bacteria | 677 |
| 677 | Ga0451791_0577217 | 3300041451 | Bacteria | 932 |
| 678 | Ga0451798_1001455 | 3300041458 | Bacteria | 660 |
| 679 | Ga0451798_1010594 | 3300041458 | Unclassified | 612 |
| 680 | Ga0451802_1374578 | 3300041460 | Bacteria | 754 |
| 681 | Ga0451804_1178722 | 3300041463 | Bacteria | 722 |
| 682 | Ga0451807_0101166 | 3300041486 | Bacteria | 732 |
| 683 | Ga0451839_1101301 | 3300041496 | Bacteria | 707 |
| 684 | Ga0451849_0083480 | 3300041505 | Bacteria | 636 |
| 685 | Ga0451853_0993517 | 3300041512 | Bacteria | 572 |
| 686 | Ga0451853_1851339 | 3300041512 | Bacteria | 994 |
| 687 | Ga0451853_3591999 | 3300041512 | Bacteria | 589 |
| 688 | Ga0439431_0124628 | 3300041997 | Bacteria | 720 |
| 689 | Ga0439431_0278491 | 3300041997 | Unclassified | 501 |
| 690 | Ga0439433_0044345 | 3300041999 | Bacteria | 1040 |
| 691 | Ga0439433_0090420 | 3300041999 | Bacteria | 752 |
| 692 | Ga0439433_0182863 | 3300041999 | Bacteria | 549 |
| 693 | Ga0439443_041728 | 3300042003 | Bacteria | 785 |
| 694 | Ga0439449_0077694 | 3300042007 | Bacteria | 1224 |
| 695 | Ga0439457_034358 | 3300042014 | Bacteria | 1127 |
| 696 | Ga0439462_0030219 | 3300042015 | Bacteria | 1433 |
| 697 | Ga0439462_0037247 | 3300042015 | Bacteria | 1295 |
| 698 | Ga0439462_0105888 | 3300042015 | Bacteria | 777 |
| 699 | Ga0450922_045110 | 3300042124 | Bacteria | 505 |
| 700 | Ga0450895_034085 | 3300042132 | Bacteria | 504 |
| 701 | Ga0450896_078439 | 3300042133 | Bacteria | 554 |
| 702 | Ga0439446_0021847 | 3300042156 | Bacteria | 1810 |
| 703 | Ga0439446_0059487 | 3300042156 | Bacteria | 1153 |
| 704 | Ga0439446_0144531 | 3300042156 | Bacteria | 779 |
| 705 | Ga0439434_0004722 | 3300042435 | Bacteria | 3992 |
| 706 | Ga0439434_0106819 | 3300042435 | Bacteria | 905 |
| 707 | Ga0439435_0013044 | 3300042436 | Bacteria | 2025 |
| 708 | Ga0439464_0053692 | 3300042439 | Bacteria | 1170 |
| 709 | Ga0439460_0045238 | 3300042461 | Bacteria | 1305 |
| 710 | Ga0451577_0011198 | 3300042876 | Bacteria | 8505 |
| 711 | Ga0451577_0089131 | 3300042876 | Unclassified | 2753 |
| 712 | Ga0451577_0195978 | 3300042876 | Bacteria | 1823 |
| 713 | Ga0451577_0200088 | 3300042876 | Bacteria | 1803 |
| 714 | Ga0451577_0475111 | 3300042876 | Bacteria | 1135 |
| 715 | Ga0451577_0495909 | 3300042876 | Bacteria | 1109 |
| 716 | Ga0451577_0502082 | 3300042876 | Bacteria | 1101 |
| 717 | Ga0451577_0816842 | 3300042876 | Bacteria | 842 |
| 718 | Ga0451577_1328782 | 3300042876 | Bacteria | 639 |
| 719 | Ga0439440_0033688 | 3300042993 | Bacteria | 1222 |
| 720 | Ga0453683_0171190 | 3300044673 | Bacteria | 1376 |
| 721 | Ga0453683_0196832 | 3300044673 | Bacteria | 1280 |
| 722 | Ga0453683_0434910 | 3300044673 | Bacteria | 848 |
| 723 | Ga0453683_0792224 | 3300044673 | Bacteria | 624 |
| 724 | Ga0453684_0006795 | 3300044712 | Bacteria | 21521 |
| 725 | Ga0453684_0014729 | 3300044712 | Bacteria | 12466 |
| 726 | Ga0453684_0025039 | 3300044712 | Bacteria | 8684 |
| 727 | Ga0453684_0035956 | 3300044712 | Bacteria | 6834 |
| 728 | Ga0453684_0116646 | 3300044712 | Bacteria | 3233 |
| 729 | Ga0453684_0132428 | 3300044712 | Bacteria | 2990 |
| 730 | Ga0453684_0553098 | 3300044712 | Unclassified | 1267 |
| 731 | Ga0453684_0605922 | 3300044712 | Bacteria | 1200 |
| 732 | Ga0453684_2089324 | 3300044712 | Bacteria | 568 |
| 733 | Ga0451576_0000956 | 3300045051 | Bacteria | 54199 |
| 734 | Ga0451576_0225806 | 3300045051 | Bacteria | 1955 |
| 735 | Ga0451576_0893860 | 3300045051 | Bacteria | 932 |
| 736 | Ga0451576_1283628 | 3300045051 | Unclassified | 763 |
| 737 | Ga0451576_1812629 | 3300045051 | Bacteria | 631 |
| 738 | Ga0451576_2325761 | 3300045051 | Unclassified | 549 |
| 739 | Ga0495592_0628498 | 3300046454 | Bacteria | 652 |
| 740 | Ga0495603_0018770 | 3300046455 | Bacteria | 4186 |
| 741 | Ga0495629_0022981 | 3300046459 | Bacteria | 4444 |
| 742 | Ga0495638_0007866 | 3300046460 | Bacteria | 7605 |
| 743 | Ga0495638_0030256 | 3300046460 | Bacteria | 3487 |
| 744 | Ga0495580_0011289 | 3300046472 | Bacteria | 6913 |
| 745 | Ga0495580_0291328 | 3300046472 | Bacteria | 1113 |
| 746 | Ga0495639_0009532 | 3300046475 | Bacteria | 4167 |
| 747 | Ga0495662_0291902 | 3300046476 | Bacteria | 802 |
| 748 | Ga0495664_0140157 | 3300046477 | Bacteria | 1466 |
| 749 | Ga0495594_0129558 | 3300046499 | Bacteria | 1428 |
| 750 | Ga0495594_0133768 | 3300046499 | Bacteria | 1405 |
| 751 | Ga0495608_0353175 | 3300046511 | Bacteria | 905 |
| 752 | Ga0495618_0275526 | 3300046514 | Bacteria | 1050 |
| 753 | Ga0495628_0062260 | 3300046516 | Bacteria | 2925 |
| 754 | Ga0495630_0559952 | 3300046517 | Bacteria | 876 |
| 755 | Ga0495648_0391502 | 3300046524 | Bacteria | 624 |
| 756 | Ga0495663_0172998 | 3300046525 | Bacteria | 745 |
| 757 | Ga0495666_0005554 | 3300046526 | Bacteria | 6354 |
| 758 | Ga0495665_0005040 | 3300046531 | Bacteria | 7123 |
| 759 | Ga0495665_0077382 | 3300046531 | Bacteria | 1751 |
| 760 | Ga0495640_0043425 | 3300046533 | Bacteria | 3131 |
| 761 | Ga0495622_0277241 | 3300046557 | Bacteria | 734 |
| 762 | Ga0495633_0079535 | 3300046558 | Bacteria | 1526 |
| 763 | Ga0495634_0093925 | 3300046642 | Bacteria | 1944 |
| 764 | Ga0495647_0000571 | 3300046681 | Bacteria | 10870 |
| 765 | Ga0495658_0007179 | 3300046683 | Bacteria | 5502 |
| 766 | Ga0495658_0050305 | 3300046683 | Bacteria | 2357 |
| 767 | Ga0495613_0015997 | 3300046689 | Bacteria | 5584 |
| 768 | Ga0495613_0135472 | 3300046689 | Bacteria | 1762 |
| 769 | Ga0495613_0886801 | 3300046689 | Unclassified | 578 |
| 770 | Ga0495624_0215506 | 3300046690 | Bacteria | 1164 |
| 771 | Ga0495670_0560480 | 3300046691 | Bacteria | 622 |
| 772 | Ga0495589_0245621 | 3300046794 | Bacteria | 837 |
| 773 | Ga0495581_0005976 | 3300047315 | Bacteria | 7050 |
| 774 | Ga0495604_0070562 | 3300047317 | Bacteria | 2645 |
| 775 | Ga0495636_0393257 | 3300047318 | Bacteria | 659 |
| 776 | Ga0495674_0040657 | 3300047319 | Bacteria | 4157 |
| 777 | Ga0495674_0248044 | 3300047319 | Bacteria | 1466 |
| 778 | Ga0495676_0031186 | 3300047321 | Bacteria | 4511 |
| 779 | Ga0495593_0018936 | 3300047673 | Bacteria | 3863 |
| 780 | Ga0495602_0083542 | 3300048088 | Bacteria | 2675 |
| 781 | Ga0495614_0041847 | 3300048089 | Bacteria | 1965 |
| 782 | Ga0496100_0473832 | 3300048903 | Bacteria | 962 |
| 783 | Ga0496100_1086932 | 3300048903 | Bacteria | 630 |
| 784 | Ga0496104_0237980 | 3300048907 | Bacteria | 1733 |
| 785 | Ga0496105_0458009 | 3300048908 | Bacteria | 1006 |
| 786 | Ga0496108_0460699 | 3300048911 | Bacteria | 1111 |
| 787 | Ga0496108_1003131 | 3300048911 | Bacteria | 713 |
| 788 | Ga0496109_0302128 | 3300048912 | Bacteria | 1509 |
| 789 | Ga0496109_0434127 | 3300048912 | Bacteria | 1241 |
| 790 | Ga0496109_0806525 | 3300048912 | Bacteria | 877 |
| 791 | Ga0496109_0899992 | 3300048912 | Bacteria | 823 |
| 792 | Ga0496109_1124964 | 3300048912 | Bacteria | 722 |
| 793 | Ga0496112_1414553 | 3300048915 | Bacteria | 610 |
| 794 | Ga0496113_0228752 | 3300048916 | Bacteria | 1483 |
| 795 | Ga0496114_0129125 | 3300048917 | Bacteria | 2181 |
| 796 | Ga0496114_1201194 | 3300048917 | Bacteria | 644 |
| 797 | Ga0496125_0187350 | 3300048928 | Bacteria | 1370 |
| 798 | Ga0501290_020932 | 3300049513 | Unclassified | 895 |
| 799 | Ga0501299_003607 | 3300049522 | Bacteria | 2255 |
| 800 | Ga0501031_0029982 | 3300049568 | Bacteria | 3548 |
| 801 | Ga0501032_0096139 | 3300049569 | Bacteria | 1963 |
| 802 | Ga0501032_0346337 | 3300049569 | Bacteria | 957 |
| 803 | Ga0501033_0092758 | 3300049570 | Bacteria | 2208 |
| 804 | Ga0501033_0256371 | 3300049570 | Bacteria | 1239 |
| 805 | Ga0501034_0009195 | 3300049571 | Bacteria | 10366 |
| 806 | Ga0501034_0288502 | 3300049571 | Bacteria | 1579 |
| 807 | Ga0501036_0030301 | 3300049572 | Bacteria | 4572 |
| 808 | Ga0501036_0231535 | 3300049572 | Bacteria | 1550 |
| 809 | Ga0501036_0920754 | 3300049572 | Bacteria | 717 |
| 810 | Ga0501037_0508608 | 3300049573 | Unclassified | 816 |
| 811 | Ga0501038_0041127 | 3300049574 | Bacteria | 4032 |
| 812 | Ga0501038_0250362 | 3300049574 | Bacteria | 1404 |
| 813 | Ga0501038_0441386 | 3300049574 | Bacteria | 1002 |
| 814 | Ga0501038_0609392 | 3300049574 | Bacteria | 825 |
| 815 | Ga0501039_0127623 | 3300049575 | Bacteria | 1995 |
| 816 | Ga0501040_0125122 | 3300049576 | Bacteria | 1806 |
| 817 | Ga0501040_0313026 | 3300049576 | Unclassified | 1123 |
| 818 | Ga0501041_0048882 | 3300049577 | Bacteria | 2576 |
| 819 | Ga0501041_0290288 | 3300049577 | Bacteria | 1030 |
| 820 | Ga0501042_0129327 | 3300049578 | Bacteria | 1820 |
| 821 | Ga0501042_0556685 | 3300049578 | Bacteria | 833 |
| 822 | Ga0501042_0659131 | 3300049578 | Bacteria | 761 |
| 823 | Ga0501043_0103882 | 3300049579 | Bacteria | 2232 |
| 824 | Ga0501043_0216620 | 3300049579 | Bacteria | 1482 |
| 825 | Ga0501046_0246999 | 3300049580 | Bacteria | 1315 |
| 826 | Ga0501046_0364830 | 3300049580 | Bacteria | 1047 |
| 827 | Ga0501046_0405158 | 3300049580 | Bacteria | 985 |
| 828 | Ga0501046_0834782 | 3300049580 | Bacteria | 645 |
| 829 | Ga0501046_0878687 | 3300049580 | Bacteria | 626 |
| 830 | Ga0501046_1269744 | 3300049580 | Bacteria | 504 |
| 831 | Ga0501047_0001174 | 3300049581 | Bacteria | 25954 |
| 832 | Ga0501047_0192643 | 3300049581 | Bacteria | 1901 |
| 833 | Ga0501048_0798599 | 3300049582 | Bacteria | 678 |
| 834 | Ga0501048_0877791 | 3300049582 | Bacteria | 645 |
| 835 | Ga0501048_0977663 | 3300049582 | Bacteria | 609 |
| 836 | Ga0501048_1015926 | 3300049582 | Bacteria | 596 |
| 837 | Ga0501068_0419141 | 3300049584 | Bacteria | 864 |
| 838 | Ga0501070_0047126 | 3300049586 | Bacteria | 3583 |
| 839 | Ga0501070_0596073 | 3300049586 | Bacteria | 881 |
| 840 | Ga0501071_0064966 | 3300049587 | Bacteria | 2649 |
| 841 | Ga0501071_0094075 | 3300049587 | Bacteria | 2204 |
| 842 | Ga0501071_0599595 | 3300049587 | Bacteria | 847 |
| 843 | Ga0501071_0933235 | 3300049587 | Bacteria | 670 |
| 844 | Ga0501072_0013236 | 3300049588 | Bacteria | 6319 |
| 845 | Ga0501072_0184273 | 3300049588 | Bacteria | 1666 |
| 846 | Ga0501073_0000842 | 3300049589 | Bacteria | 21848 |
| 847 | Ga0501073_0039381 | 3300049589 | Bacteria | 3349 |
| 848 | Ga0501073_0165887 | 3300049589 | Bacteria | 1529 |
| 849 | Ga0501073_0183524 | 3300049589 | Bacteria | 1448 |
| 850 | Ga0501073_0311642 | 3300049589 | Bacteria | 1086 |
| 851 | Ga0501075_0037185 | 3300049591 | Bacteria | 3636 |
| 852 | Ga0501075_0227424 | 3300049591 | Bacteria | 1423 |
| 853 | Ga0501075_0299797 | 3300049591 | Bacteria | 1225 |
| 854 | Ga0501075_0443871 | 3300049591 | Bacteria | 989 |
| 855 | Ga0501075_0709344 | 3300049591 | Bacteria | 766 |
| 856 | Ga0501076_0021140 | 3300049592 | Bacteria | 4987 |
| 857 | Ga0501076_0060494 | 3300049592 | Bacteria | 3014 |
| 858 | Ga0501076_0214800 | 3300049592 | Bacteria | 1572 |
| 859 | Ga0501076_0360818 | 3300049592 | Bacteria | 1194 |
| 860 | Ga0501077_0112643 | 3300049593 | Bacteria | 1725 |
| 861 | Ga0501249_023517 | 3300049679 | Bacteria | 1353 |
| 862 | Ga0501229_063525 | 3300049706 | Unclassified | 567 |
| 863 | Ga0501234_070624 | 3300049707 | Unclassified | 603 |
| 864 | Ga0501079_0305094 | 3300049741 | Bacteria | 1246 |
| 865 | Ga0501080_0049961 | 3300049742 | Bacteria | 3893 |
| 866 | Ga0501080_0146765 | 3300049742 | Bacteria | 2181 |
| 867 | Ga0501081_0119802 | 3300049743 | Bacteria | 1873 |
| 868 | Ga0501081_0218636 | 3300049743 | Bacteria | 1385 |
| 869 | Ga0501081_0571635 | 3300049743 | Bacteria | 845 |
| 870 | Ga0501081_1009826 | 3300049743 | Unclassified | 629 |
| 871 | Ga0501081_1239875 | 3300049743 | Bacteria | 565 |
| 872 | Ga0501267_041421 | 3300049764 | Unclassified | 575 |
| 873 | Ga0501273_006920 | 3300049770 | Bacteria | 1325 |
| 874 | Ga0501283_025994 | 3300049779 | Unclassified | 961 |
| 875 | Ga0501035_0138889 | 3300049822 | Bacteria | 2113 |
| 876 | Ga0501035_0595293 | 3300049822 | Bacteria | 902 |
| 877 | Ga0501035_1260706 | 3300049822 | Bacteria | 571 |
| 878 | Ga0501035_1522115 | 3300049822 | Bacteria | 510 |
| 879 | Ga0501044_0203071 | 3300049823 | Bacteria | 1939 |
| 880 | Ga0501044_0496191 | 3300049823 | Bacteria | 1122 |
| 881 | Ga0501044_0773963 | 3300049823 | Bacteria | 840 |
| 882 | Ga0501045_0079391 | 3300049824 | Bacteria | 2419 |
| 883 | Ga0501045_0247064 | 3300049824 | Bacteria | 1328 |
| 884 | Ga0501045_0664602 | 3300049824 | Unclassified | 770 |
| 885 | nmdc:mga03n38_134423_c1 | 3300050490 | Bacteria | 1229 |
| 886 | nmdc:mga00v17_255223_c1 | 3300050491 | Bacteria | 1137 |
| 887 | nmdc:mga00v17_298329_c1 | 3300050491 | Bacteria | 1047 |
| 888 | nmdc:mga00v17_53025_c1 | 3300050491 | Bacteria | 2471 |
| 889 | nmdc:mga00v17_64952_c1 | 3300050491 | Bacteria | 2250 |
| 890 | nmdc:mga0yw44_11740_c1 | 3300050492 | Bacteria | 4538 |
| 891 | nmdc:mga0k408_149532_c2 | 3300050493 | Bacteria | 1002 |
| 892 | nmdc:mga0k408_37903_c1 | 3300050493 | Bacteria | 1884 |
| 893 | nmdc:mga0k408_631782_c1 | 3300050493 | Bacteria | 630 |
| 894 | nmdc:mga06z11_223245_c1 | 3300050494 | Bacteria | 1102 |
| 895 | nmdc:mga06z11_484490_c1 | 3300050494 | Bacteria | 749 |
| 896 | nmdc:mga07m45_36229_c1 | 3300050496 | Bacteria | 2747 |
| 897 | nmdc:mga07m45_86012_c1 | 3300050496 | Bacteria | 1798 |
| 898 | nmdc:mga07m45_89282_c1 | 3300050496 | Bacteria | 1765 |
| 899 | nmdc:mga05p37_1659682_c1 | 3300050507 | Bacteria | 626 |
| 900 | nmdc:mga05p37_476857_c1 | 3300050507 | Bacteria | 1438 |
| 901 | nmdc:mga05p37_503656_c1 | 3300050507 | Bacteria | 1389 |
| 902 | nmdc:mga09592_1520402_c1 | 3300050508 | Bacteria | 544 |
| 903 | nmdc:mga09592_547467_c1 | 3300050508 | Bacteria | 994 |
| 904 | nmdc:mga09592_940956_c1 | 3300050508 | Bacteria | 725 |
| 905 | nmdc:mga0qj67_1070389_c1 | 3300050509 | Bacteria | 631 |
| 906 | nmdc:mga0qj67_1504440_c1 | 3300050509 | Bacteria | 518 |
| 907 | nmdc:mga0qj67_17312_c1 | 3300050509 | Bacteria | 5478 |
| 908 | nmdc:mga0qj67_225639_c1 | 3300050509 | Unclassified | 1520 |
| 909 | nmdc:mga0qj67_310499_c1 | 3300050509 | Bacteria | 1277 |
| 910 | nmdc:mga0qj67_312957_c1 | 3300050509 | Bacteria | 1271 |
| 911 | nmdc:mga0qj67_608058_c1 | 3300050509 | Bacteria | 874 |
| 912 | nmdc:mga06r32_14950_c1 | 3300050510 | Bacteria | 7044 |
| 913 | nmdc:mga06r32_1711606_c1 | 3300050510 | Bacteria | 566 |
| 914 | nmdc:mga06r32_368653_c1 | 3300050510 | Bacteria | 1419 |
| 915 | nmdc:mga06r32_499574_c1 | 3300050510 | Bacteria | 1193 |
| 916 | nmdc:mga06r32_767296_c1 | 3300050510 | Bacteria | 926 |
| 917 | nmdc:mga06r32_867484_c1 | 3300050510 | Bacteria | 860 |
| 918 | nmdc:mga06r32_979069_c1 | 3300050510 | Bacteria | 799 |
| 919 | nmdc:mga08y16_126640_c1 | 3300050511 | Bacteria | 2656 |
| 920 | nmdc:mga08y16_1369_c1 | 3300050511 | Bacteria | 24366 |
| 921 | nmdc:mga08y16_215065_c1 | 3300050511 | Bacteria | 1990 |
| 922 | nmdc:mga08y16_4286_c1 | 3300050511 | Bacteria | 14889 |
| 923 | nmdc:mga08y16_442795_c1 | 3300050511 | Bacteria | 1326 |
| 924 | nmdc:mga08y16_761213_c1 | 3300050511 | Bacteria | 964 |
| 925 | nmdc:mga08y16_78703_c1 | 3300050511 | Bacteria | 3437 |
| 926 | nmdc:mga0n895_122840_c1 | 3300050512 | Bacteria | 2618 |
| 927 | nmdc:mga0n895_25335_c1 | 3300050512 | Bacteria | 5603 |
| 928 | nmdc:mga0rr50_1855643_c1 | 3300050513 | Bacteria | 507 |
| 929 | nmdc:mga0rr50_835197_c1 | 3300050513 | Bacteria | 786 |
| 930 | nmdc:mga08x19_4109_c1 | 3300050514 | Bacteria | 8637 |
| 931 | nmdc:mga08x19_468248_c1 | 3300050514 | Bacteria | 888 |
| 932 | nmdc:mga08x19_7041_c1 | 3300050514 | Bacteria | 6676 |
| 933 | nmdc:mga08x19_815279_c1 | 3300050514 | Unclassified | 663 |
| 934 | Ga0500616_0070674 | 3300053153 | Bacteria | 1781 |
| 935 | Ga0500611_051238 | 3300053727 | Bacteria | 946 |
| 936 | Ga0501084_0016296 | 3300054114 | Bacteria | 6171 |
| 937 | Ga0501084_0735392 | 3300054114 | Bacteria | 831 |
| 938 | Ga0501084_1173081 | 3300054114 | Bacteria | 644 |
| 939 | Ga0501084_1215078 | 3300054114 | Bacteria | 632 |
| 940 | Ga0501084_1239844 | 3300054114 | Bacteria | 625 |
| 941 | Ga0501084_1703246 | 3300054114 | Bacteria | 527 |
| 942 | Ga0590071_000060 | 3300059421 | Bacteria | 29173 |
| 943 | Ga0590071_020967 | 3300059421 | Bacteria | 1539 |
| 944 | Ga0590074_000203 | 3300059423 | Bacteria | 7654 |
| 945 | Ga0590074_124798 | 3300059423 | Unclassified | 514 |
| 946 | Ga0590075_000338 | 3300059424 | Bacteria | 13058 |
| 947 | Ga0590075_006284 | 3300059424 | Bacteria | 2818 |
| 948 | Ga0590077_000202 | 3300059426 | Bacteria | 17335 |
| 949 | Ga0590077_019779 | 3300059426 | Bacteria | 1427 |
| 950 | Ga0501082_0140198 | 3300060353 | Bacteria | 2099 |
| 951 | Ga0501082_0333227 | 3300060353 | Bacteria | 1322 |
| 952 | Ga0501082_0524458 | 3300060353 | Bacteria | 1035 |
| 953 | Ga0501082_0738902 | 3300060353 | Unclassified | 861 |
| 954 | Ga0530510_0093709 | 3300061734 | Bacteria | 2193 |
| 955 | Ga0530510_0432574 | 3300061734 | Bacteria | 994 |
| 956 | Ga0530510_0691743 | 3300061734 | Bacteria | 777 |
| 957 | Ga0530510_0734462 | 3300061734 | Bacteria | 753 |
| 958 | Ga0530510_0955878 | 3300061734 | Bacteria | 655 |
| 959 | Ga0530510_1234127 | 3300061734 | Bacteria | 573 |
| 960 | Ga0530510_1300903 | 3300061734 | Bacteria | 558 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025907 | Ga0207645_10629284 | Ga0207645_106292842 | 131 |
| 2 | 3300049580 | Ga0501046_0878687 | Ga0501046_0878687_87_491 | 132 |
| 3 | 3300048928 | Ga0496125_0187350 | Ga0496125_0187350_236_640 | 134 |
| 4 | 3300049580 | Ga0501046_0246999 | Ga0501046_0246999_73_483 | 135 |
| 5 | 3300049742 | Ga0501080_0146765 | Ga0501080_0146765_1477_1887 | 135 |
| 6 | 3300049743 | Ga0501081_0119802 | Ga0501081_0119802_1273_1683 | 135 |
| 7 | 3300060353 | Ga0501082_0140198 | Ga0501082_0140198_1487_1894 | 135 |
| 8 | 3300005295 | Ga0065707_10005793 | Ga0065707_100057932 | 136 |
| 9 | 3300005331 | Ga0070670_101358526 | Ga0070670_1013585261 | 136 |
| 10 | 3300005336 | Ga0070680_100197373 | Ga0070680_1001973731 | 136 |
| 11 | 3300005336 | Ga0070680_100860824 | Ga0070680_1008608242 | 136 |
| 12 | 3300005343 | Ga0070687_101105960 | Ga0070687_1011059601 | 136 |
| 13 | 3300005354 | Ga0070675_100444097 | Ga0070675_1004440972 | 136 |
| 14 | 3300005354 | Ga0070675_100682381 | Ga0070675_1006823812 | 136 |
| 15 | 3300005356 | Ga0070674_100089702 | Ga0070674_1000897023 | 136 |
| 16 | 3300005364 | Ga0070673_101508236 | Ga0070673_1015082361 | 136 |
| 17 | 3300005367 | Ga0070667_100969762 | Ga0070667_1009697622 | 136 |
| 18 | 3300005438 | Ga0070701_10212838 | Ga0070701_102128382 | 136 |
| 19 | 3300005440 | Ga0070705_100672958 | Ga0070705_1006729581 | 136 |
| 20 | 3300005441 | Ga0070700_100059804 | Ga0070700_1000598042 | 136 |
| 21 | 3300005441 | Ga0070700_100391884 | Ga0070700_1003918842 | 136 |
| 22 | 3300005456 | Ga0070678_100267319 | Ga0070678_1002673192 | 136 |
| 23 | 3300005535 | Ga0070684_101475018 | Ga0070684_1014750182 | 136 |
| 24 | 3300005543 | Ga0070672_101993736 | Ga0070672_1019937361 | 136 |
| 25 | 3300005546 | Ga0070696_100777012 | Ga0070696_1007770122 | 136 |
| 26 | 3300005615 | Ga0070702_100927566 | Ga0070702_1009275661 | 136 |
| 27 | 3300005841 | Ga0068863_100622559 | Ga0068863_1006225592 | 136 |
| 28 | 3300005842 | Ga0068858_100689252 | Ga0068858_1006892522 | 136 |
| 29 | 3300005843 | Ga0068860_101355042 | Ga0068860_1013550422 | 136 |
| 30 | 3300006237 | Ga0097621_100329929 | Ga0097621_1003299292 | 136 |
| 31 | 3300006237 | Ga0097621_100898233 | Ga0097621_1008982332 | 136 |
| 32 | 3300006844 | Ga0075428_100379392 | Ga0075428_1003793922 | 136 |
| 33 | 3300006846 | Ga0075430_100148983 | Ga0075430_1001489833 | 136 |
| 34 | 3300006846 | Ga0075430_100160396 | Ga0075430_1001603962 | 136 |
| 35 | 3300006847 | Ga0075431_100472410 | Ga0075431_1004724102 | 136 |
| 36 | 3300006871 | Ga0075434_100068600 | Ga0075434_1000686004 | 136 |
| 37 | 3300006880 | Ga0075429_100720730 | Ga0075429_1007207302 | 136 |
| 38 | 3300006881 | Ga0068865_100547007 | Ga0068865_1005470072 | 136 |
| 39 | 3300009094 | Ga0111539_10012966 | Ga0111539_100129665 | 136 |
| 40 | 3300009094 | Ga0111539_10087032 | Ga0111539_100870325 | 136 |
| 41 | 3300009094 | Ga0111539_10129573 | Ga0111539_101295732 | 136 |
| 42 | 3300009094 | Ga0111539_10184332 | Ga0111539_101843324 | 136 |
| 43 | 3300009094 | Ga0111539_10235811 | Ga0111539_102358113 | 136 |
| 44 | 3300009094 | Ga0111539_10497423 | Ga0111539_104974233 | 136 |
| 45 | 3300009094 | Ga0111539_11709641 | Ga0111539_117096412 | 136 |
| 46 | 3300009094 | Ga0111539_13455072 | Ga0111539_134550721 | 136 |
| 47 | 3300009147 | Ga0114129_10069113 | Ga0114129_100691135 | 136 |
| 48 | 3300009148 | Ga0105243_12777543 | Ga0105243_127775431 | 136 |
| 49 | 3300009177 | Ga0105248_10157617 | Ga0105248_101576173 | 136 |
| 50 | 3300009553 | Ga0105249_10877083 | Ga0105249_108770833 | 136 |
| 51 | 3300013297 | Ga0157378_10463408 | Ga0157378_104634082 | 136 |
| 52 | 3300013308 | Ga0157375_10598570 | Ga0157375_105985702 | 136 |
| 53 | 3300014325 | Ga0163163_10000017 | Ga0163163_1000001773 | 136 |
| 54 | 3300014325 | Ga0163163_12769509 | Ga0163163_127695091 | 136 |
| 55 | 3300014326 | Ga0157380_10000592 | Ga0157380_100005927 | 136 |
| 56 | 3300014326 | Ga0157380_10027828 | Ga0157380_100278285 | 136 |
| 57 | 3300014326 | Ga0157380_10070065 | Ga0157380_100700652 | 136 |
| 58 | 3300014326 | Ga0157380_11552319 | Ga0157380_115523191 | 136 |
| 59 | 3300014745 | Ga0157377_10118117 | Ga0157377_101181172 | 136 |
| 60 | 3300014969 | Ga0157376_10036646 | Ga0157376_100366465 | 136 |
| 61 | 3300025917 | Ga0207660_10382759 | Ga0207660_103827592 | 136 |
| 62 | 3300025918 | Ga0207662_10408934 | Ga0207662_104089342 | 136 |
| 63 | 3300025918 | Ga0207662_10910704 | Ga0207662_109107042 | 136 |
| 64 | 3300025926 | Ga0207659_10083746 | Ga0207659_100837462 | 136 |
| 65 | 3300025926 | Ga0207659_10155706 | Ga0207659_101557062 | 136 |
| 66 | 3300025936 | Ga0207670_10057836 | Ga0207670_100578362 | 136 |
| 67 | 3300025940 | Ga0207691_10853150 | Ga0207691_108531501 | 136 |
| 68 | 3300025986 | Ga0207658_11470553 | Ga0207658_114705532 | 136 |
| 69 | 3300026023 | Ga0207677_11437837 | Ga0207677_114378372 | 136 |
| 70 | 3300026041 | Ga0207639_11256340 | Ga0207639_112563402 | 136 |
| 71 | 3300026075 | Ga0207708_10053891 | Ga0207708_100538914 | 136 |
| 72 | 3300026075 | Ga0207708_10064508 | Ga0207708_100645084 | 136 |
| 73 | 3300026089 | Ga0207648_11890251 | Ga0207648_118902511 | 136 |
| 74 | 3300026121 | Ga0207683_10157463 | Ga0207683_101574632 | 136 |
| 75 | 3300026121 | Ga0207683_10715479 | Ga0207683_107154792 | 136 |
| 76 | 3300026121 | Ga0207683_10869864 | Ga0207683_108698642 | 136 |
| 77 | 3300026142 | Ga0207698_10852266 | Ga0207698_108522662 | 136 |
| 78 | 3300027907 | Ga0207428_10002456 | Ga0207428_100024567 | 136 |
| 79 | 3300027907 | Ga0207428_10024210 | Ga0207428_100242104 | 136 |
| 80 | 3300031731 | Ga0307405_10812331 | Ga0307405_108123312 | 136 |
| 81 | 3300031903 | Ga0307407_10293894 | Ga0307407_102938942 | 136 |
| 82 | 3300031911 | Ga0307412_10070651 | Ga0307412_100706513 | 136 |
| 83 | 3300031911 | Ga0307412_11617794 | Ga0307412_116177942 | 136 |
| 84 | 3300032002 | Ga0307416_100224917 | Ga0307416_1002249172 | 136 |
| 85 | 3300032002 | Ga0307416_100996683 | Ga0307416_1009966832 | 136 |
| 86 | 3300032002 | Ga0307416_101010352 | Ga0307416_1010103522 | 136 |
| 87 | 3300032002 | Ga0307416_103214251 | Ga0307416_1032142512 | 136 |
| 88 | 3300032005 | Ga0307411_10257847 | Ga0307411_102578471 | 136 |
| 89 | 3300035695 | Ga0373927_1121750 | Ga0373927_1121750_87_503 | 136 |
| 90 | 3300041458 | Ga0451798_1001455 | Ga0451798_1001455_75_485 | 136 |
| 91 | 3300041458 | Ga0451798_1010594 | Ga0451798_1010594_53_469 | 136 |
| 92 | 3300041463 | Ga0451804_1178722 | Ga0451804_1178722_236_646 | 136 |
| 93 | 3300041486 | Ga0451807_0101166 | Ga0451807_0101166_132_542 | 136 |
| 94 | 3300041496 | Ga0451839_1101301 | Ga0451839_1101301_168_578 | 136 |
| 95 | 3300041512 | Ga0451853_3591999 | Ga0451853_3591999_86_496 | 136 |
| 96 | 3300041999 | Ga0439433_0182863 | Ga0439433_0182863_128_538 | 136 |
| 97 | 3300042003 | Ga0439443_041728 | Ga0439443_041728_112_522 | 136 |
| 98 | 3300042124 | Ga0450922_045110 | Ga0450922_045110_81_491 | 136 |
| 99 | 3300042132 | Ga0450895_034085 | Ga0450895_034085_36_446 | 136 |
| 100 | 3300042133 | Ga0450896_078439 | Ga0450896_078439_64_474 | 136 |
| 101 | 3300042156 | Ga0439446_0144531 | Ga0439446_0144531_109_519 | 136 |
| 102 | 3300042436 | Ga0439435_0013044 | Ga0439435_0013044_701_1111 | 136 |
| 103 | 3300046525 | Ga0495663_0172998 | Ga0495663_0172998_168_578 | 136 |
| 104 | 3300046691 | Ga0495670_0560480 | Ga0495670_0560480_147_557 | 136 |
| 105 | 3300048908 | Ga0496105_0458009 | Ga0496105_0458009_244_657 | 136 |
| 106 | 3300048917 | Ga0496114_0129125 | Ga0496114_0129125_1455_1868 | 136 |
| 107 | 3300049569 | Ga0501032_0346337 | Ga0501032_0346337_308_724 | 136 |
| 108 | 3300049571 | Ga0501034_0009195 | Ga0501034_0009195_47_463 | 136 |
| 109 | 3300049571 | Ga0501034_0288502 | Ga0501034_0288502_289_705 | 136 |
| 110 | 3300049572 | Ga0501036_0231535 | Ga0501036_0231535_425_841 | 136 |
| 111 | 3300049573 | Ga0501037_0508608 | Ga0501037_0508608_175_591 | 136 |
| 112 | 3300049574 | Ga0501038_0609392 | Ga0501038_0609392_32_442 | 136 |
| 113 | 3300049576 | Ga0501040_0125122 | Ga0501040_0125122_611_1021 | 136 |
| 114 | 3300049579 | Ga0501043_0103882 | Ga0501043_0103882_991_1407 | 136 |
| 115 | 3300049580 | Ga0501046_0405158 | Ga0501046_0405158_360_770 | 136 |
| 116 | 3300049580 | Ga0501046_0834782 | Ga0501046_0834782_104_514 | 136 |
| 117 | 3300049581 | Ga0501047_0001174 | Ga0501047_0001174_714_1130 | 136 |
| 118 | 3300049582 | Ga0501048_0798599 | Ga0501048_0798599_143_553 | 136 |
| 119 | 3300049582 | Ga0501048_0977663 | Ga0501048_0977663_90_500 | 136 |
| 120 | 3300049582 | Ga0501048_1015926 | Ga0501048_1015926_86_496 | 136 |
| 121 | 3300049586 | Ga0501070_0596073 | Ga0501070_0596073_15_431 | 136 |
| 122 | 3300049587 | Ga0501071_0064966 | Ga0501071_0064966_429_839 | 136 |
| 123 | 3300049589 | Ga0501073_0000842 | Ga0501073_0000842_20290_20700 | 136 |
| 124 | 3300049589 | Ga0501073_0039381 | Ga0501073_0039381_1053_1469 | 136 |
| 125 | 3300049589 | Ga0501073_0165887 | Ga0501073_0165887_271_687 | 136 |
| 126 | 3300049591 | Ga0501075_0227424 | Ga0501075_0227424_806_1216 | 136 |
| 127 | 3300049591 | Ga0501075_0299797 | Ga0501075_0299797_434_844 | 136 |
| 128 | 3300049591 | Ga0501075_0443871 | Ga0501075_0443871_285_695 | 136 |
| 129 | 3300049592 | Ga0501076_0060494 | Ga0501076_0060494_515_925 | 136 |
| 130 | 3300049593 | Ga0501077_0112643 | Ga0501077_0112643_77_493 | 136 |
| 131 | 3300049823 | Ga0501044_0496191 | Ga0501044_0496191_134_550 | 136 |
| 132 | 3300049823 | Ga0501044_0773963 | Ga0501044_0773963_13_429 | 136 |
| 133 | 3300050493 | nmdc:mga0k408_631782_c1 | nmdc:mga0k408_631782_c1_82_492 | 136 |
| 134 | 3300050507 | nmdc:mga05p37_1659682_c1 | nmdc:mga05p37_1659682_c1_44_454 | 136 |
| 135 | 3300050507 | nmdc:mga05p37_503656_c1 | nmdc:mga05p37_503656_c1_688_1098 | 136 |
| 136 | 3300050508 | nmdc:mga09592_1520402_c1 | nmdc:mga09592_1520402_c1_26_436 | 136 |
| 137 | 3300050508 | nmdc:mga09592_940956_c1 | nmdc:mga09592_940956_c1_128_538 | 136 |
| 138 | 3300050509 | nmdc:mga0qj67_1070389_c1 | nmdc:mga0qj67_1070389_c1_55_465 | 136 |
| 139 | 3300050509 | nmdc:mga0qj67_225639_c1 | nmdc:mga0qj67_225639_c1_1038_1448 | 136 |
| 140 | 3300050510 | nmdc:mga06r32_867484_c1 | nmdc:mga06r32_867484_c1_160_585 | 136 |
| 141 | 3300050511 | nmdc:mga08y16_126640_c1 | nmdc:mga08y16_126640_c1_1239_1652 | 136 |
| 142 | 3300050511 | nmdc:mga08y16_1369_c1 | nmdc:mga08y16_1369_c1_17074_17484 | 136 |
| 143 | 3300050511 | nmdc:mga08y16_4286_c1 | nmdc:mga08y16_4286_c1_3395_3805 | 136 |
| 144 | 3300050511 | nmdc:mga08y16_761213_c1 | nmdc:mga08y16_761213_c1_36_446 | 136 |
| 145 | 3300050511 | nmdc:mga08y16_78703_c1 | nmdc:mga08y16_78703_c1_134_544 | 136 |
| 146 | 3300050512 | nmdc:mga0n895_25335_c1 | nmdc:mga0n895_25335_c1_514_924 | 136 |
| 147 | 3300050513 | nmdc:mga0rr50_835197_c1 | nmdc:mga0rr50_835197_c1_342_752 | 136 |
| 148 | 3300053153 | Ga0500616_0070674 | Ga0500616_0070674_992_1408 | 136 |
| 149 | 3300054114 | Ga0501084_0016296 | Ga0501084_0016296_4930_5346 | 136 |
| 150 | 3300054114 | Ga0501084_0735392 | Ga0501084_0735392_36_446 | 136 |
| 151 | 3300054114 | Ga0501084_1703246 | Ga0501084_1703246_25_435 | 136 |
| 152 | 3300060353 | Ga0501082_0524458 | Ga0501082_0524458_298_714 | 136 |
| 153 | iso_pu_bacteria | 2511231025 | 2511381660 | 136 |
| 154 | iso_pu_bacteria | 2511231035 | 2511432739 | 136 |
| 155 | iso_pu_bacteria | 2608642108 | 2608670215 | 136 |
| 156 | iso_pu_bacteria | 2648501693 | 2650895989 | 136 |
| 157 | iso_pu_bacteria | 2684622997 | 2686356037 | 136 |
| 158 | iso_pu_bacteria | 2808606414 | 2809127340 | 136 |
| 159 | iso_pu_bacteria | 2844528606 | 2844529344 | 136 |
| 160 | iso_pu_bacteria | 2847797336 | 2847798727 | 136 |
| 161 | iso_pu_bacteria | 2865014394 | 2865017154 | 136 |
| 162 | iso_pu_bacteria | 2876601092 | 2876603061 | 136 |
| 163 | iso_pu_bacteria | 2881609920 | 2881610281 | 136 |
| 164 | iso_pu_bacteria | 2939602548 | 2939604345 | 136 |
| 165 | iso_pu_bacteria | 2945951305 | 2945951927 | 136 |
| 166 | iso_pu_bacteria | 2978975091 | 2978978475 | 136 |
| 167 | iso_pu_bacteria | 2984494565 | 2984497773 | 136 |
| 168 | iso_pu_bacteria | 2990261002 | 2990261718 | 136 |
| 169 | iso_pu_bacteria | 8016733728 | 8016734858 | 136 |
| 170 | iso_pu_bacteria | 8019499862 | 8019501656 | 136 |
| 171 | 3300005293 | Ga0065715_10350156 | Ga0065715_103501561 | 137 |
| 172 | 3300005328 | Ga0070676_10004905 | Ga0070676_100049056 | 137 |
| 173 | 3300005330 | Ga0070690_100016281 | Ga0070690_1000162812 | 137 |
| 174 | 3300005331 | Ga0070670_100024993 | Ga0070670_1000249933 | 137 |
| 175 | 3300005331 | Ga0070670_100299431 | Ga0070670_1002994313 | 137 |
| 176 | 3300005334 | Ga0068869_101024769 | Ga0068869_1010247691 | 137 |
| 177 | 3300005335 | Ga0070666_10096283 | Ga0070666_100962832 | 137 |
| 178 | 3300005335 | Ga0070666_10389840 | Ga0070666_103898402 | 137 |
| 179 | 3300005335 | Ga0070666_10564455 | Ga0070666_105644552 | 137 |
| 180 | 3300005336 | Ga0070680_100126478 | Ga0070680_1001264783 | 137 |
| 181 | 3300005336 | Ga0070680_100386735 | Ga0070680_1003867352 | 137 |
| 182 | 3300005337 | Ga0070682_100000035 | Ga0070682_1000000352 | 137 |
| 183 | 3300005338 | Ga0068868_100312725 | Ga0068868_1003127253 | 137 |
| 184 | 3300005338 | Ga0068868_100328456 | Ga0068868_1003284562 | 137 |
| 185 | 3300005340 | Ga0070689_100144658 | Ga0070689_1001446583 | 137 |
| 186 | 3300005340 | Ga0070689_100246628 | Ga0070689_1002466282 | 137 |
| 187 | 3300005340 | Ga0070689_100619926 | Ga0070689_1006199263 | 137 |
| 188 | 3300005343 | Ga0070687_100051272 | Ga0070687_1000512723 | 137 |
| 189 | 3300005347 | Ga0070668_100213689 | Ga0070668_1002136894 | 137 |
| 190 | 3300005347 | Ga0070668_101307667 | Ga0070668_1013076671 | 137 |
| 191 | 3300005353 | Ga0070669_100191698 | Ga0070669_1001916982 | 137 |
| 192 | 3300005353 | Ga0070669_100224737 | Ga0070669_1002247372 | 137 |
| 193 | 3300005353 | Ga0070669_100309031 | Ga0070669_1003090312 | 137 |
| 194 | 3300005353 | Ga0070669_101323243 | Ga0070669_1013232432 | 137 |
| 195 | 3300005354 | Ga0070675_100007339 | Ga0070675_1000073393 | 137 |
| 196 | 3300005354 | Ga0070675_100011756 | Ga0070675_1000117565 | 137 |
| 197 | 3300005354 | Ga0070675_100117308 | Ga0070675_1001173083 | 137 |
| 198 | 3300005354 | Ga0070675_100118121 | Ga0070675_1001181214 | 137 |
| 199 | 3300005354 | Ga0070675_100161591 | Ga0070675_1001615913 | 137 |
| 200 | 3300005355 | Ga0070671_100016291 | Ga0070671_1000162915 | 137 |
| 201 | 3300005355 | Ga0070671_100308936 | Ga0070671_1003089363 | 137 |
| 202 | 3300005356 | Ga0070674_100004717 | Ga0070674_1000047179 | 137 |
| 203 | 3300005356 | Ga0070674_100100452 | Ga0070674_1001004523 | 137 |
| 204 | 3300005356 | Ga0070674_100902262 | Ga0070674_1009022621 | 137 |
| 205 | 3300005356 | Ga0070674_101283134 | Ga0070674_1012831341 | 137 |
| 206 | 3300005364 | Ga0070673_100001825 | Ga0070673_1000018255 | 137 |
| 207 | 3300005364 | Ga0070673_100012360 | Ga0070673_1000123605 | 137 |
| 208 | 3300005364 | Ga0070673_100034826 | Ga0070673_1000348263 | 137 |
| 209 | 3300005366 | Ga0070659_100612076 | Ga0070659_1006120761 | 137 |
| 210 | 3300005436 | Ga0070713_100003643 | Ga0070713_1000036432 | 137 |
| 211 | 3300005436 | Ga0070713_100068677 | Ga0070713_1000686773 | 137 |
| 212 | 3300005436 | Ga0070713_100380630 | Ga0070713_1003806302 | 137 |
| 213 | 3300005438 | Ga0070701_11094547 | Ga0070701_110945471 | 137 |
| 214 | 3300005438 | Ga0070701_11198964 | Ga0070701_111989641 | 137 |
| 215 | 3300005441 | Ga0070700_100027077 | Ga0070700_1000270774 | 137 |
| 216 | 3300005455 | Ga0070663_100005932 | Ga0070663_1000059327 | 137 |
| 217 | 3300005455 | Ga0070663_101229794 | Ga0070663_1012297941 | 137 |
| 218 | 3300005456 | Ga0070678_100232589 | Ga0070678_1002325892 | 137 |
| 219 | 3300005456 | Ga0070678_100251862 | Ga0070678_1002518622 | 137 |
| 220 | 3300005456 | Ga0070678_101319216 | Ga0070678_1013192162 | 137 |
| 221 | 3300005457 | Ga0070662_101367258 | Ga0070662_1013672581 | 137 |
| 222 | 3300005458 | Ga0070681_10386725 | Ga0070681_103867252 | 137 |
| 223 | 3300005459 | Ga0068867_100001976 | Ga0068867_10000197610 | 137 |
| 224 | 3300005459 | Ga0068867_100257001 | Ga0068867_1002570014 | 137 |
| 225 | 3300005459 | Ga0068867_100894192 | Ga0068867_1008941922 | 137 |
| 226 | 3300005466 | Ga0070685_10043106 | Ga0070685_100431062 | 137 |
| 227 | 3300005466 | Ga0070685_10182558 | Ga0070685_101825582 | 137 |
| 228 | 3300005471 | Ga0070698_100149275 | Ga0070698_1001492753 | 137 |
| 229 | 3300005471 | Ga0070698_101801867 | Ga0070698_1018018671 | 137 |
| 230 | 3300005530 | Ga0070679_100206714 | Ga0070679_1002067143 | 137 |
| 231 | 3300005535 | Ga0070684_100250800 | Ga0070684_1002508002 | 137 |
| 232 | 3300005539 | Ga0068853_100137168 | Ga0068853_1001371681 | 137 |
| 233 | 3300005543 | Ga0070672_100018076 | Ga0070672_1000180764 | 137 |
| 234 | 3300005543 | Ga0070672_100099015 | Ga0070672_1000990153 | 137 |
| 235 | 3300005543 | Ga0070672_100354547 | Ga0070672_1003545472 | 137 |
| 236 | 3300005548 | Ga0070665_100000839 | Ga0070665_10000083914 | 137 |
| 237 | 3300005548 | Ga0070665_100311134 | Ga0070665_1003111343 | 137 |
| 238 | 3300005548 | Ga0070665_100382985 | Ga0070665_1003829853 | 137 |
| 239 | 3300005548 | Ga0070665_101901620 | Ga0070665_1019016201 | 137 |
| 240 | 3300005549 | Ga0070704_100014629 | Ga0070704_1000146293 | 137 |
| 241 | 3300005563 | Ga0068855_100919981 | Ga0068855_1009199812 | 137 |
| 242 | 3300005564 | Ga0070664_100512074 | Ga0070664_1005120743 | 137 |
| 243 | 3300005577 | Ga0068857_100100694 | Ga0068857_1001006943 | 137 |
| 244 | 3300005577 | Ga0068857_101561824 | Ga0068857_1015618242 | 137 |
| 245 | 3300005578 | Ga0068854_100004717 | Ga0068854_1000047179 | 137 |
| 246 | 3300005617 | Ga0068859_100000040 | Ga0068859_10000004011 | 137 |
| 247 | 3300005617 | Ga0068859_100000468 | Ga0068859_10000046828 | 137 |
| 248 | 3300005617 | Ga0068859_100093442 | Ga0068859_1000934423 | 137 |
| 249 | 3300005617 | Ga0068859_101607846 | Ga0068859_1016078462 | 137 |
| 250 | 3300005617 | Ga0068859_102497575 | Ga0068859_1024975751 | 137 |
| 251 | 3300005618 | Ga0068864_100029316 | Ga0068864_1000293166 | 137 |
| 252 | 3300005618 | Ga0068864_100277696 | Ga0068864_1002776963 | 137 |
| 253 | 3300005618 | Ga0068864_100843259 | Ga0068864_1008432592 | 137 |
| 254 | 3300005718 | Ga0068866_10057567 | Ga0068866_100575673 | 137 |
| 255 | 3300005834 | Ga0068851_10415286 | Ga0068851_104152862 | 137 |
| 256 | 3300005840 | Ga0068870_10032208 | Ga0068870_100322083 | 137 |
| 257 | 3300005841 | Ga0068863_100000307 | Ga0068863_10000030746 | 137 |
| 258 | 3300005841 | Ga0068863_100360734 | Ga0068863_1003607343 | 137 |
| 259 | 3300005841 | Ga0068863_100369372 | Ga0068863_1003693722 | 137 |
| 260 | 3300005841 | Ga0068863_101474573 | Ga0068863_1014745731 | 137 |
| 261 | 3300005841 | Ga0068863_101863406 | Ga0068863_1018634062 | 137 |
| 262 | 3300005842 | Ga0068858_100016825 | Ga0068858_1000168255 | 137 |
| 263 | 3300005842 | Ga0068858_100026210 | Ga0068858_1000262103 | 137 |
| 264 | 3300005843 | Ga0068860_100008532 | Ga0068860_10000853212 | 137 |
| 265 | 3300005843 | Ga0068860_100402722 | Ga0068860_1004027221 | 137 |
| 266 | 3300005983 | Ga0081540_1055956 | Ga0081540_10559563 | 137 |
| 267 | 3300006028 | Ga0070717_10031295 | Ga0070717_100312956 | 137 |
| 268 | 3300006173 | Ga0070716_101082612 | Ga0070716_1010826121 | 137 |
| 269 | 3300006175 | Ga0070712_100489098 | Ga0070712_1004890982 | 137 |
| 270 | 3300006237 | Ga0097621_100097468 | Ga0097621_1000974683 | 137 |
| 271 | 3300006358 | Ga0068871_100338928 | Ga0068871_1003389282 | 137 |
| 272 | 3300006358 | Ga0068871_100362735 | Ga0068871_1003627352 | 137 |
| 273 | 3300006844 | Ga0075428_100017091 | Ga0075428_1000170916 | 137 |
| 274 | 3300006846 | Ga0075430_100010683 | Ga0075430_1000106835 | 137 |
| 275 | 3300006846 | Ga0075430_100069350 | Ga0075430_1000693504 | 137 |
| 276 | 3300006846 | Ga0075430_100244826 | Ga0075430_1002448262 | 137 |
| 277 | 3300006846 | Ga0075430_100433226 | Ga0075430_1004332262 | 137 |
| 278 | 3300006846 | Ga0075430_100465898 | Ga0075430_1004658982 | 137 |
| 279 | 3300006846 | Ga0075430_100768500 | Ga0075430_1007685001 | 137 |
| 280 | 3300006847 | Ga0075431_100040014 | Ga0075431_1000400145 | 137 |
| 281 | 3300006847 | Ga0075431_100472933 | Ga0075431_1004729333 | 137 |
| 282 | 3300006847 | Ga0075431_100752429 | Ga0075431_1007524291 | 137 |
| 283 | 3300006847 | Ga0075431_101234424 | Ga0075431_1012344242 | 137 |
| 284 | 3300006871 | Ga0075434_100229839 | Ga0075434_1002298392 | 137 |
| 285 | 3300006881 | Ga0068865_100144165 | Ga0068865_1001441652 | 137 |
| 286 | 3300006914 | Ga0075436_100026351 | Ga0075436_1000263512 | 137 |
| 287 | 3300006914 | Ga0075436_100354341 | Ga0075436_1003543412 | 137 |
| 288 | 3300006914 | Ga0075436_100776596 | Ga0075436_1007765962 | 137 |
| 289 | 3300006931 | Ga0097620_100000040 | Ga0097620_10000004011 | 137 |
| 290 | 3300006931 | Ga0097620_100000468 | Ga0097620_10000046810 | 137 |
| 291 | 3300006931 | Ga0097620_100093447 | Ga0097620_1000934473 | 137 |
| 292 | 3300006931 | Ga0097620_101607696 | Ga0097620_1016076962 | 137 |
| 293 | 3300006931 | Ga0097620_102496979 | Ga0097620_1024969791 | 137 |
| 294 | 3300007076 | Ga0075435_101896748 | Ga0075435_1018967481 | 137 |
| 295 | 3300007265 | Ga0099794_10081792 | Ga0099794_100817924 | 137 |
| 296 | 3300007265 | Ga0099794_10204433 | Ga0099794_102044331 | 137 |
| 297 | 3300007788 | Ga0099795_10004626 | Ga0099795_100046263 | 137 |
| 298 | 3300009094 | Ga0111539_10174269 | Ga0111539_101742692 | 137 |
| 299 | 3300009094 | Ga0111539_10384417 | Ga0111539_103844173 | 137 |
| 300 | 3300009094 | Ga0111539_10476842 | Ga0111539_104768423 | 137 |
| 301 | 3300009098 | Ga0105245_10083279 | Ga0105245_100832793 | 137 |
| 302 | 3300009098 | Ga0105245_10358461 | Ga0105245_103584612 | 137 |
| 303 | 3300009098 | Ga0105245_11198718 | Ga0105245_111987183 | 137 |
| 304 | 3300009101 | Ga0105247_10179215 | Ga0105247_101792152 | 137 |
| 305 | 3300009101 | Ga0105247_10793578 | Ga0105247_107935782 | 137 |
| 306 | 3300009101 | Ga0105247_10879786 | Ga0105247_108797861 | 137 |
| 307 | 3300009147 | Ga0114129_10053937 | Ga0114129_100539372 | 137 |
| 308 | 3300009148 | Ga0105243_10829076 | Ga0105243_108290762 | 137 |
| 309 | 3300009176 | Ga0105242_10042077 | Ga0105242_100420774 | 137 |
| 310 | 3300009176 | Ga0105242_11940941 | Ga0105242_119409411 | 137 |
| 311 | 3300009177 | Ga0105248_10000090 | Ga0105248_1000009017 | 137 |
| 312 | 3300009177 | Ga0105248_11291532 | Ga0105248_112915323 | 137 |
| 313 | 3300009177 | Ga0105248_11298006 | Ga0105248_112980062 | 137 |
| 314 | 3300009551 | Ga0105238_10009190 | Ga0105238_100091905 | 137 |
| 315 | 3300009553 | Ga0105249_10917346 | Ga0105249_109173462 | 137 |
| 316 | 3300009553 | Ga0105249_12221722 | Ga0105249_122217221 | 137 |
| 317 | 3300010159 | Ga0099796_10018181 | Ga0099796_100181813 | 137 |
| 318 | 3300010159 | Ga0099796_10335200 | Ga0099796_103352002 | 137 |
| 319 | 3300013102 | Ga0157371_10653258 | Ga0157371_106532582 | 137 |
| 320 | 3300013296 | Ga0157374_10000008 | Ga0157374_10000008399 | 137 |
| 321 | 3300013296 | Ga0157374_10480122 | Ga0157374_104801221 | 137 |
| 322 | 3300013296 | Ga0157374_10740794 | Ga0157374_107407942 | 137 |
| 323 | 3300013297 | Ga0157378_10280588 | Ga0157378_102805883 | 137 |
| 324 | 3300013297 | Ga0157378_10779530 | Ga0157378_107795302 | 137 |
| 325 | 3300013297 | Ga0157378_11024300 | Ga0157378_110243002 | 137 |
| 326 | 3300013306 | Ga0163162_10067408 | Ga0163162_100674083 | 137 |
| 327 | 3300013306 | Ga0163162_10668003 | Ga0163162_106680032 | 137 |
| 328 | 3300013307 | Ga0157372_11669647 | Ga0157372_116696472 | 137 |
| 329 | 3300013308 | Ga0157375_10000860 | Ga0157375_100008602 | 137 |
| 330 | 3300014325 | Ga0163163_10015978 | Ga0163163_100159785 | 137 |
| 331 | 3300014325 | Ga0163163_10044160 | Ga0163163_100441603 | 137 |
| 332 | 3300014325 | Ga0163163_10115176 | Ga0163163_101151763 | 137 |
| 333 | 3300014325 | Ga0163163_10655996 | Ga0163163_106559962 | 137 |
| 334 | 3300014325 | Ga0163163_11069072 | Ga0163163_110690722 | 137 |
| 335 | 3300014326 | Ga0157380_10041295 | Ga0157380_100412953 | 137 |
| 336 | 3300014326 | Ga0157380_10595598 | Ga0157380_105955982 | 137 |
| 337 | 3300014326 | Ga0157380_10598470 | Ga0157380_105984703 | 137 |
| 338 | 3300014497 | Ga0182008_10239927 | Ga0182008_102399272 | 137 |
| 339 | 3300014745 | Ga0157377_10000007 | Ga0157377_10000007369 | 137 |
| 340 | 3300014968 | Ga0157379_10000365 | Ga0157379_1000036517 | 137 |
| 341 | 3300014968 | Ga0157379_10008665 | Ga0157379_100086655 | 137 |
| 342 | 3300014969 | Ga0157376_11481517 | Ga0157376_114815171 | 137 |
| 343 | 3300021358 | Ga0213873_10132782 | Ga0213873_101327822 | 137 |
| 344 | 3300021384 | Ga0213876_10000008 | Ga0213876_1000000853 | 137 |
| 345 | 3300021388 | Ga0213875_10190403 | Ga0213875_101904032 | 137 |
| 346 | 3300024227 | Ga0228598_1007044 | Ga0228598_10070443 | 137 |
| 347 | 3300025321 | Ga0207656_10004442 | Ga0207656_100044425 | 137 |
| 348 | 3300025893 | Ga0207682_10033397 | Ga0207682_100333973 | 137 |
| 349 | 3300025893 | Ga0207682_10101100 | Ga0207682_101011002 | 137 |
| 350 | 3300025893 | Ga0207682_10139590 | Ga0207682_101395902 | 137 |
| 351 | 3300025893 | Ga0207682_10207424 | Ga0207682_102074242 | 137 |
| 352 | 3300025900 | Ga0207710_10312966 | Ga0207710_103129662 | 137 |
| 353 | 3300025901 | Ga0207688_10090086 | Ga0207688_100900862 | 137 |
| 354 | 3300025903 | Ga0207680_10044560 | Ga0207680_100445602 | 137 |
| 355 | 3300025903 | Ga0207680_10233687 | Ga0207680_102336873 | 137 |
| 356 | 3300025906 | Ga0207699_10192682 | Ga0207699_101926823 | 137 |
| 357 | 3300025907 | Ga0207645_10123074 | Ga0207645_101230742 | 137 |
| 358 | 3300025908 | Ga0207643_10034115 | Ga0207643_100341154 | 137 |
| 359 | 3300025908 | Ga0207643_10972299 | Ga0207643_109722991 | 137 |
| 360 | 3300025912 | Ga0207707_10326273 | Ga0207707_103262732 | 137 |
| 361 | 3300025917 | Ga0207660_10122482 | Ga0207660_101224822 | 137 |
| 362 | 3300025917 | Ga0207660_10149133 | Ga0207660_101491332 | 137 |
| 363 | 3300025918 | Ga0207662_10107890 | Ga0207662_101078903 | 137 |
| 364 | 3300025923 | Ga0207681_10051558 | Ga0207681_100515583 | 137 |
| 365 | 3300025923 | Ga0207681_10135222 | Ga0207681_101352223 | 137 |
| 366 | 3300025923 | Ga0207681_10188670 | Ga0207681_101886702 | 137 |
| 367 | 3300025923 | Ga0207681_10200913 | Ga0207681_102009133 | 137 |
| 368 | 3300025923 | Ga0207681_10238304 | Ga0207681_102383042 | 137 |
| 369 | 3300025925 | Ga0207650_10036593 | Ga0207650_100365934 | 137 |
| 370 | 3300025925 | Ga0207650_10045226 | Ga0207650_100452263 | 137 |
| 371 | 3300025926 | Ga0207659_10004193 | Ga0207659_100041936 | 137 |
| 372 | 3300025926 | Ga0207659_10033427 | Ga0207659_100334274 | 137 |
| 373 | 3300025926 | Ga0207659_10109367 | Ga0207659_101093673 | 137 |
| 374 | 3300025926 | Ga0207659_10154248 | Ga0207659_101542484 | 137 |
| 375 | 3300025926 | Ga0207659_10554655 | Ga0207659_105546552 | 137 |
| 376 | 3300025926 | Ga0207659_11376772 | Ga0207659_113767722 | 137 |
| 377 | 3300025927 | Ga0207687_10434616 | Ga0207687_104346162 | 137 |
| 378 | 3300025928 | Ga0207700_10024321 | Ga0207700_100243216 | 137 |
| 379 | 3300025928 | Ga0207700_10339249 | Ga0207700_103392492 | 137 |
| 380 | 3300025931 | Ga0207644_10017759 | Ga0207644_100177594 | 137 |
| 381 | 3300025931 | Ga0207644_10203721 | Ga0207644_102037213 | 137 |
| 382 | 3300025931 | Ga0207644_10353999 | Ga0207644_103539993 | 137 |
| 383 | 3300025934 | Ga0207686_10038026 | Ga0207686_100380263 | 137 |
| 384 | 3300025935 | Ga0207709_10252033 | Ga0207709_102520332 | 137 |
| 385 | 3300025936 | Ga0207670_10019893 | Ga0207670_100198933 | 137 |
| 386 | 3300025936 | Ga0207670_10106572 | Ga0207670_101065723 | 137 |
| 387 | 3300025937 | Ga0207669_10093212 | Ga0207669_100932122 | 137 |
| 388 | 3300025937 | Ga0207669_10633988 | Ga0207669_106339882 | 137 |
| 389 | 3300025937 | Ga0207669_11129724 | Ga0207669_111297241 | 137 |
| 390 | 3300025940 | Ga0207691_10354554 | Ga0207691_103545542 | 137 |
| 391 | 3300025941 | Ga0207711_10015097 | Ga0207711_100150975 | 137 |
| 392 | 3300025945 | Ga0207679_10264398 | Ga0207679_102643982 | 137 |
| 393 | 3300025960 | Ga0207651_10011976 | Ga0207651_100119765 | 137 |
| 394 | 3300025960 | Ga0207651_10078395 | Ga0207651_100783953 | 137 |
| 395 | 3300025960 | Ga0207651_10414477 | Ga0207651_104144773 | 137 |
| 396 | 3300025961 | Ga0207712_10310996 | Ga0207712_103109962 | 137 |
| 397 | 3300025961 | Ga0207712_11419553 | Ga0207712_114195532 | 137 |
| 398 | 3300025972 | Ga0207668_10105912 | Ga0207668_101059122 | 137 |
| 399 | 3300025972 | Ga0207668_11281483 | Ga0207668_112814832 | 137 |
| 400 | 3300025972 | Ga0207668_11634536 | Ga0207668_116345362 | 137 |
| 401 | 3300025981 | Ga0207640_10198484 | Ga0207640_101984842 | 137 |
| 402 | 3300026023 | Ga0207677_10229607 | Ga0207677_102296073 | 137 |
| 403 | 3300026023 | Ga0207677_11158489 | Ga0207677_111584892 | 137 |
| 404 | 3300026035 | Ga0207703_10007529 | Ga0207703_100075296 | 137 |
| 405 | 3300026035 | Ga0207703_10046911 | Ga0207703_100469113 | 137 |
| 406 | 3300026041 | Ga0207639_10146333 | Ga0207639_101463333 | 137 |
| 407 | 3300026067 | Ga0207678_10036396 | Ga0207678_100363963 | 137 |
| 408 | 3300026067 | Ga0207678_10039306 | Ga0207678_100393066 | 137 |
| 409 | 3300026067 | Ga0207678_11122327 | Ga0207678_111223271 | 137 |
| 410 | 3300026067 | Ga0207678_11356572 | Ga0207678_113565721 | 137 |
| 411 | 3300026075 | Ga0207708_10001790 | Ga0207708_1000179010 | 137 |
| 412 | 3300026075 | Ga0207708_10097167 | Ga0207708_100971673 | 137 |
| 413 | 3300026088 | Ga0207641_10032537 | Ga0207641_100325375 | 137 |
| 414 | 3300026088 | Ga0207641_10289199 | Ga0207641_102891993 | 137 |
| 415 | 3300026089 | Ga0207648_10000077 | Ga0207648_100000774 | 137 |
| 416 | 3300026089 | Ga0207648_10605294 | Ga0207648_106052942 | 137 |
| 417 | 3300026095 | Ga0207676_10050527 | Ga0207676_100505274 | 137 |
| 418 | 3300026095 | Ga0207676_10082496 | Ga0207676_100824962 | 137 |
| 419 | 3300026095 | Ga0207676_10133403 | Ga0207676_101334034 | 137 |
| 420 | 3300026116 | Ga0207674_10126790 | Ga0207674_101267902 | 137 |
| 421 | 3300026116 | Ga0207674_10167782 | Ga0207674_101677821 | 137 |
| 422 | 3300026118 | Ga0207675_100382424 | Ga0207675_1003824243 | 137 |
| 423 | 3300026121 | Ga0207683_10189771 | Ga0207683_101897714 | 137 |
| 424 | 3300026121 | Ga0207683_10293896 | Ga0207683_102938962 | 137 |
| 425 | 3300026121 | Ga0207683_11608632 | Ga0207683_116086321 | 137 |
| 426 | 3300027512 | Ga0209179_1020163 | Ga0209179_10201633 | 137 |
| 427 | 3300027671 | Ga0209588_1098108 | Ga0209588_10981082 | 137 |
| 428 | 3300027695 | Ga0209966_1010275 | Ga0209966_10102753 | 137 |
| 429 | 3300027876 | Ga0209974_10022919 | Ga0209974_100229193 | 137 |
| 430 | 3300027876 | Ga0209974_10050323 | Ga0209974_100503232 | 137 |
| 431 | 3300027907 | Ga0207428_10520266 | Ga0207428_105202662 | 137 |
| 432 | 3300027907 | Ga0207428_10720380 | Ga0207428_107203801 | 137 |
| 433 | 3300028379 | Ga0268266_10000072 | Ga0268266_10000072118 | 137 |
| 434 | 3300028379 | Ga0268266_10459131 | Ga0268266_104591313 | 137 |
| 435 | 3300028379 | Ga0268266_10562553 | Ga0268266_105625532 | 137 |
| 436 | 3300028379 | Ga0268266_11044778 | Ga0268266_110447781 | 137 |
| 437 | 3300028379 | Ga0268266_11695301 | Ga0268266_116953012 | 137 |
| 438 | 3300028379 | Ga0268266_11868853 | Ga0268266_118688531 | 137 |
| 439 | 3300028380 | Ga0268265_10344981 | Ga0268265_103449812 | 137 |
| 440 | 3300028381 | Ga0268264_10006064 | Ga0268264_100060642 | 137 |
| 441 | 3300028800 | Ga0265338_10151094 | Ga0265338_101510943 | 137 |
| 442 | 3300028800 | Ga0265338_10265119 | Ga0265338_102651192 | 137 |
| 443 | 3300031235 | Ga0265330_10004069 | Ga0265330_100040698 | 137 |
| 444 | 3300031241 | Ga0265325_10000124 | Ga0265325_1000012419 | 137 |
| 445 | 3300031247 | Ga0265340_10031662 | Ga0265340_100316622 | 137 |
| 446 | 3300031249 | Ga0265339_10000521 | Ga0265339_1000052112 | 137 |
| 447 | 3300031344 | Ga0265316_10000629 | Ga0265316_1000062922 | 137 |
| 448 | 3300031344 | Ga0265316_10089557 | Ga0265316_100895573 | 137 |
| 449 | 3300031344 | Ga0265316_10190979 | Ga0265316_101909791 | 137 |
| 450 | 3300031548 | Ga0307408_100003848 | Ga0307408_1000038485 | 137 |
| 451 | 3300031595 | Ga0265313_10000588 | Ga0265313_1000058822 | 137 |
| 452 | 3300031712 | Ga0265342_10010188 | Ga0265342_100101883 | 137 |
| 453 | 3300031731 | Ga0307405_10000655 | Ga0307405_100006558 | 137 |
| 454 | 3300031731 | Ga0307405_10326121 | Ga0307405_103261213 | 137 |
| 455 | 3300031731 | Ga0307405_10420470 | Ga0307405_104204702 | 137 |
| 456 | 3300031824 | Ga0307413_10096316 | Ga0307413_100963163 | 137 |
| 457 | 3300031824 | Ga0307413_10440517 | Ga0307413_104405173 | 137 |
| 458 | 3300031852 | Ga0307410_10009942 | Ga0307410_100099424 | 137 |
| 459 | 3300031901 | Ga0307406_11724478 | Ga0307406_117244781 | 137 |
| 460 | 3300031903 | Ga0307407_10005789 | Ga0307407_100057897 | 137 |
| 461 | 3300031911 | Ga0307412_10086408 | Ga0307412_100864084 | 137 |
| 462 | 3300031911 | Ga0307412_11384330 | Ga0307412_113843302 | 137 |
| 463 | 3300031995 | Ga0307409_100003910 | Ga0307409_1000039103 | 137 |
| 464 | 3300031995 | Ga0307409_100539628 | Ga0307409_1005396282 | 137 |
| 465 | 3300031995 | Ga0307409_101477333 | Ga0307409_1014773331 | 137 |
| 466 | 3300032002 | Ga0307416_100003573 | Ga0307416_1000035738 | 137 |
| 467 | 3300032002 | Ga0307416_100184416 | Ga0307416_1001844162 | 137 |
| 468 | 3300032002 | Ga0307416_100931553 | Ga0307416_1009315531 | 137 |
| 469 | 3300032002 | Ga0307416_103262883 | Ga0307416_1032628832 | 137 |
| 470 | 3300032004 | Ga0307414_10582474 | Ga0307414_105824741 | 137 |
| 471 | 3300032004 | Ga0307414_10676175 | Ga0307414_106761752 | 137 |
| 472 | 3300032005 | Ga0307411_10001781 | Ga0307411_100017815 | 137 |
| 473 | 3300032005 | Ga0307411_11897516 | Ga0307411_118975161 | 137 |
| 474 | 3300032126 | Ga0307415_100011537 | Ga0307415_1000115372 | 137 |
| 475 | 3300033528 | Ga0316588_1176508 | Ga0316588_11765081 | 137 |
| 476 | 3300033541 | Ga0316596_1114729 | Ga0316596_11147292 | 137 |
| 477 | 3300035086 | Ga0373934_0196307 | Ga0373934_0196307_268_681 | 137 |
| 478 | 3300035089 | Ga0373944_0417183 | Ga0373944_0417183_85_498 | 137 |
| 479 | 3300035116 | Ga0373945_0348062 | Ga0373945_0348062_135_548 | 137 |
| 480 | 3300035116 | Ga0373945_0455302 | Ga0373945_0455302_38_451 | 137 |
| 481 | 3300035118 | Ga0373954_0049694 | Ga0373954_0049694_555_974 | 137 |
| 482 | 3300035172 | Ga0373955_0044923 | Ga0373955_0044923_138_557 | 137 |
| 483 | 3300035398 | Ga0316574_0027123 | Ga0316574_0027123_2350_2763 | 137 |
| 484 | 3300035398 | Ga0316574_0079546 | Ga0316574_0079546_1469_1894 | 137 |
| 485 | 3300035692 | Ga0373935_0224909 | Ga0373935_0224909_316_729 | 137 |
| 486 | 3300035724 | Ga0373933_0047018 | Ga0373933_0047018_323_736 | 137 |
| 487 | 3300036401 | Ga0373937_0001949 | Ga0373937_0001949_15357_15770 | 137 |
| 488 | 3300036401 | Ga0373937_0134651 | Ga0373937_0134651_1614_2033 | 137 |
| 489 | 3300036401 | Ga0373937_0813751 | Ga0373937_0813751_144_563 | 137 |
| 490 | 3300036712 | Ga0316584_0036328 | Ga0316584_0036328_75_500 | 137 |
| 491 | 3300037068 | Ga0373925_0003799 | Ga0373925_0003799_6713_7126 | 137 |
| 492 | 3300037068 | Ga0373925_0143043 | Ga0373925_0143043_1151_1570 | 137 |
| 493 | 3300037418 | Ga0395900_0319329 | Ga0395900_0319329_576_1010 | 137 |
| 494 | 3300037466 | Ga0395898_0509743 | Ga0395898_0509743_442_858 | 137 |
| 495 | 3300037466 | Ga0395898_0566628 | Ga0395898_0566628_369_803 | 137 |
| 496 | 3300037853 | Ga0436364_0229532 | Ga0436364_0229532_1299_1718 | 137 |
| 497 | 3300037853 | Ga0436364_0324904 | Ga0436364_0324904_1874_2293 | 137 |
| 498 | 3300037853 | Ga0436364_1075915 | Ga0436364_1075915_5446_5865 | 137 |
| 499 | 3300038725 | Ga0400484_07775 | Ga0400484_07775_1449_1862 | 137 |
| 500 | 3300038726 | Ga0400490_10514 | Ga0400490_10514_887_1300 | 137 |
| 501 | 3300038726 | Ga0400490_50905 | Ga0400490_50905_45672_46085 | 137 |
| 502 | 3300038727 | Ga0400491_28577 | Ga0400491_28577_1216_1629 | 137 |
| 503 | 3300038741 | Ga0400488_12509 | Ga0400488_12509_1327_1740 | 137 |
| 504 | 3300038741 | Ga0400488_61775 | Ga0400488_61775_545_958 | 137 |
| 505 | 3300039062 | Ga0400483_008789 | Ga0400483_008789_189_602 | 137 |
| 506 | 3300039093 | Ga0400489_07561 | Ga0400489_07561_39_452 | 137 |
| 507 | 3300039110 | Ga0400487_00767 | Ga0400487_00767_5718_6131 | 137 |
| 508 | 3300039437 | Ga0436365_0546808 | Ga0436365_0546808_48_467 | 137 |
| 509 | 3300039437 | Ga0436365_0973417 | Ga0436365_0973417_47162_47578 | 137 |
| 510 | 3300039437 | Ga0436365_1380816 | Ga0436365_1380816_106_525 | 137 |
| 511 | 3300039450 | Ga0436363_1032628 | Ga0436363_1032628_133_549 | 137 |
| 512 | 3300039453 | Ga0436362_1054863 | Ga0436362_1054863_6161_6577 | 137 |
| 513 | 3300041451 | Ga0451791_0577217 | Ga0451791_0577217_66_485 | 137 |
| 514 | 3300041460 | Ga0451802_1374578 | Ga0451802_1374578_77_490 | 137 |
| 515 | 3300041997 | Ga0439431_0124628 | Ga0439431_0124628_191_604 | 137 |
| 516 | 3300041999 | Ga0439433_0044345 | Ga0439433_0044345_50_463 | 137 |
| 517 | 3300041999 | Ga0439433_0090420 | Ga0439433_0090420_95_508 | 137 |
| 518 | 3300042014 | Ga0439457_034358 | Ga0439457_034358_143_556 | 137 |
| 519 | 3300042015 | Ga0439462_0037247 | Ga0439462_0037247_288_701 | 137 |
| 520 | 3300042015 | Ga0439462_0105888 | Ga0439462_0105888_309_722 | 137 |
| 521 | 3300042156 | Ga0439446_0021847 | Ga0439446_0021847_59_472 | 137 |
| 522 | 3300042156 | Ga0439446_0059487 | Ga0439446_0059487_430_843 | 137 |
| 523 | 3300042435 | Ga0439434_0004722 | Ga0439434_0004722_3260_3673 | 137 |
| 524 | 3300042435 | Ga0439434_0106819 | Ga0439434_0106819_238_651 | 137 |
| 525 | 3300042439 | Ga0439464_0053692 | Ga0439464_0053692_583_996 | 137 |
| 526 | 3300042461 | Ga0439460_0045238 | Ga0439460_0045238_262_675 | 137 |
| 527 | 3300042876 | Ga0451577_0011198 | Ga0451577_0011198_3604_4020 | 137 |
| 528 | 3300042876 | Ga0451577_0089131 | Ga0451577_0089131_1322_1735 | 137 |
| 529 | 3300042876 | Ga0451577_0200088 | Ga0451577_0200088_1167_1583 | 137 |
| 530 | 3300042876 | Ga0451577_0475111 | Ga0451577_0475111_682_1095 | 137 |
| 531 | 3300042876 | Ga0451577_0495909 | Ga0451577_0495909_589_1002 | 137 |
| 532 | 3300042876 | Ga0451577_0502082 | Ga0451577_0502082_451_876 | 137 |
| 533 | 3300042876 | Ga0451577_0816842 | Ga0451577_0816842_26_439 | 137 |
| 534 | 3300042993 | Ga0439440_0033688 | Ga0439440_0033688_666_1079 | 137 |
| 535 | 3300044712 | Ga0453684_0006795 | Ga0453684_0006795_9128_9541 | 137 |
| 536 | 3300044712 | Ga0453684_0014729 | Ga0453684_0014729_9848_10261 | 137 |
| 537 | 3300044712 | Ga0453684_0025039 | Ga0453684_0025039_3568_3984 | 137 |
| 538 | 3300044712 | Ga0453684_0035956 | Ga0453684_0035956_4454_4867 | 137 |
| 539 | 3300044712 | Ga0453684_0116646 | Ga0453684_0116646_2520_2933 | 137 |
| 540 | 3300044712 | Ga0453684_0132428 | Ga0453684_0132428_2267_2680 | 137 |
| 541 | 3300044712 | Ga0453684_0605922 | Ga0453684_0605922_33_452 | 137 |
| 542 | 3300044712 | Ga0453684_2089324 | Ga0453684_2089324_76_489 | 137 |
| 543 | 3300045051 | Ga0451576_0000956 | Ga0451576_0000956_34564_34989 | 137 |
| 544 | 3300045051 | Ga0451576_0225806 | Ga0451576_0225806_910_1326 | 137 |
| 545 | 3300045051 | Ga0451576_0893860 | Ga0451576_0893860_190_603 | 137 |
| 546 | 3300045051 | Ga0451576_1283628 | Ga0451576_1283628_193_606 | 137 |
| 547 | 3300045051 | Ga0451576_2325761 | Ga0451576_2325761_68_481 | 137 |
| 548 | 3300046454 | Ga0495592_0628498 | Ga0495592_0628498_153_566 | 137 |
| 549 | 3300046455 | Ga0495603_0018770 | Ga0495603_0018770_2688_3107 | 137 |
| 550 | 3300046459 | Ga0495629_0022981 | Ga0495629_0022981_751_1170 | 137 |
| 551 | 3300046460 | Ga0495638_0007866 | Ga0495638_0007866_2315_2728 | 137 |
| 552 | 3300046472 | Ga0495580_0011289 | Ga0495580_0011289_3091_3510 | 137 |
| 553 | 3300046475 | Ga0495639_0009532 | Ga0495639_0009532_1300_1719 | 137 |
| 554 | 3300046476 | Ga0495662_0291902 | Ga0495662_0291902_197_616 | 137 |
| 555 | 3300046477 | Ga0495664_0140157 | Ga0495664_0140157_87_506 | 137 |
| 556 | 3300046499 | Ga0495594_0129558 | Ga0495594_0129558_818_1237 | 137 |
| 557 | 3300046514 | Ga0495618_0275526 | Ga0495618_0275526_444_863 | 137 |
| 558 | 3300046516 | Ga0495628_0062260 | Ga0495628_0062260_965_1378 | 137 |
| 559 | 3300046517 | Ga0495630_0559952 | Ga0495630_0559952_303_722 | 137 |
| 560 | 3300046526 | Ga0495666_0005554 | Ga0495666_0005554_4542_4961 | 137 |
| 561 | 3300046531 | Ga0495665_0005040 | Ga0495665_0005040_4052_4471 | 137 |
| 562 | 3300046531 | Ga0495665_0077382 | Ga0495665_0077382_402_821 | 137 |
| 563 | 3300046533 | Ga0495640_0043425 | Ga0495640_0043425_999_1418 | 137 |
| 564 | 3300046557 | Ga0495622_0277241 | Ga0495622_0277241_306_719 | 137 |
| 565 | 3300046642 | Ga0495634_0093925 | Ga0495634_0093925_169_588 | 137 |
| 566 | 3300046681 | Ga0495647_0000571 | Ga0495647_0000571_2083_2502 | 137 |
| 567 | 3300046683 | Ga0495658_0007179 | Ga0495658_0007179_1775_2194 | 137 |
| 568 | 3300046683 | Ga0495658_0050305 | Ga0495658_0050305_1378_1791 | 137 |
| 569 | 3300046689 | Ga0495613_0015997 | Ga0495613_0015997_3968_4387 | 137 |
| 570 | 3300046689 | Ga0495613_0886801 | Ga0495613_0886801_35_454 | 137 |
| 571 | 3300046690 | Ga0495624_0215506 | Ga0495624_0215506_651_1070 | 137 |
| 572 | 3300047315 | Ga0495581_0005976 | Ga0495581_0005976_3961_4380 | 137 |
| 573 | 3300047318 | Ga0495636_0393257 | Ga0495636_0393257_37_450 | 137 |
| 574 | 3300047319 | Ga0495674_0040657 | Ga0495674_0040657_3672_4091 | 137 |
| 575 | 3300047319 | Ga0495674_0248044 | Ga0495674_0248044_391_804 | 137 |
| 576 | 3300047321 | Ga0495676_0031186 | Ga0495676_0031186_3194_3613 | 137 |
| 577 | 3300047673 | Ga0495593_0018936 | Ga0495593_0018936_3310_3729 | 137 |
| 578 | 3300048089 | Ga0495614_0041847 | Ga0495614_0041847_1197_1616 | 137 |
| 579 | 3300048903 | Ga0496100_0473832 | Ga0496100_0473832_69_482 | 137 |
| 580 | 3300048903 | Ga0496100_1086932 | Ga0496100_1086932_172_591 | 137 |
| 581 | 3300048907 | Ga0496104_0237980 | Ga0496104_0237980_1169_1582 | 137 |
| 582 | 3300048912 | Ga0496109_0302128 | Ga0496109_0302128_149_562 | 137 |
| 583 | 3300048912 | Ga0496109_1124964 | Ga0496109_1124964_29_442 | 137 |
| 584 | 3300048916 | Ga0496113_0228752 | Ga0496113_0228752_490_903 | 137 |
| 585 | 3300048917 | Ga0496114_1201194 | Ga0496114_1201194_66_485 | 137 |
| 586 | 3300049513 | Ga0501290_020932 | Ga0501290_020932_179_592 | 137 |
| 587 | 3300049522 | Ga0501299_003607 | Ga0501299_003607_106_519 | 137 |
| 588 | 3300049570 | Ga0501033_0256371 | Ga0501033_0256371_85_498 | 137 |
| 589 | 3300049572 | Ga0501036_0920754 | Ga0501036_0920754_128_541 | 137 |
| 590 | 3300049574 | Ga0501038_0250362 | Ga0501038_0250362_532_945 | 137 |
| 591 | 3300049574 | Ga0501038_0441386 | Ga0501038_0441386_571_984 | 137 |
| 592 | 3300049576 | Ga0501040_0313026 | Ga0501040_0313026_610_1023 | 137 |
| 593 | 3300049577 | Ga0501041_0048882 | Ga0501041_0048882_1956_2369 | 137 |
| 594 | 3300049577 | Ga0501041_0290288 | Ga0501041_0290288_452_865 | 137 |
| 595 | 3300049578 | Ga0501042_0556685 | Ga0501042_0556685_145_558 | 137 |
| 596 | 3300049578 | Ga0501042_0659131 | Ga0501042_0659131_140_553 | 137 |
| 597 | 3300049580 | Ga0501046_1269744 | Ga0501046_1269744_72_485 | 137 |
| 598 | 3300049582 | Ga0501048_0877791 | Ga0501048_0877791_174_587 | 137 |
| 599 | 3300049587 | Ga0501071_0094075 | Ga0501071_0094075_627_1040 | 137 |
| 600 | 3300049587 | Ga0501071_0933235 | Ga0501071_0933235_212_625 | 137 |
| 601 | 3300049588 | Ga0501072_0013236 | Ga0501072_0013236_5473_5886 | 137 |
| 602 | 3300049591 | Ga0501075_0037185 | Ga0501075_0037185_1050_1463 | 137 |
| 603 | 3300049591 | Ga0501075_0709344 | Ga0501075_0709344_274_687 | 137 |
| 604 | 3300049592 | Ga0501076_0021140 | Ga0501076_0021140_838_1251 | 137 |
| 605 | 3300049592 | Ga0501076_0214800 | Ga0501076_0214800_180_593 | 137 |
| 606 | 3300049592 | Ga0501076_0360818 | Ga0501076_0360818_622_1035 | 137 |
| 607 | 3300049679 | Ga0501249_023517 | Ga0501249_023517_79_492 | 137 |
| 608 | 3300049706 | Ga0501229_063525 | Ga0501229_063525_110_523 | 137 |
| 609 | 3300049707 | Ga0501234_070624 | Ga0501234_070624_108_521 | 137 |
| 610 | 3300049743 | Ga0501081_0218636 | Ga0501081_0218636_423_836 | 137 |
| 611 | 3300049743 | Ga0501081_1009826 | Ga0501081_1009826_11_424 | 137 |
| 612 | 3300049743 | Ga0501081_1239875 | Ga0501081_1239875_83_496 | 137 |
| 613 | 3300049764 | Ga0501267_041421 | Ga0501267_041421_120_533 | 137 |
| 614 | 3300049770 | Ga0501273_006920 | Ga0501273_006920_168_581 | 137 |
| 615 | 3300049779 | Ga0501283_025994 | Ga0501283_025994_286_699 | 137 |
| 616 | 3300049822 | Ga0501035_0595293 | Ga0501035_0595293_66_485 | 137 |
| 617 | 3300049822 | Ga0501035_1260706 | Ga0501035_1260706_12_425 | 137 |
| 618 | 3300049824 | Ga0501045_0079391 | Ga0501045_0079391_588_1001 | 137 |
| 619 | 3300049824 | Ga0501045_0247064 | Ga0501045_0247064_157_570 | 137 |
| 620 | 3300049824 | Ga0501045_0664602 | Ga0501045_0664602_186_599 | 137 |
| 621 | 3300050491 | nmdc:mga00v17_64952_c1 | nmdc:mga00v17_64952_c1_642_1055 | 137 |
| 622 | 3300050509 | nmdc:mga0qj67_1504440_c1 | nmdc:mga0qj67_1504440_c1_17_439 | 137 |
| 623 | 3300050509 | nmdc:mga0qj67_17312_c1 | nmdc:mga0qj67_17312_c1_2973_3386 | 137 |
| 624 | 3300050509 | nmdc:mga0qj67_310499_c1 | nmdc:mga0qj67_310499_c1_554_967 | 137 |
| 625 | 3300050509 | nmdc:mga0qj67_312957_c1 | nmdc:mga0qj67_312957_c1_182_595 | 137 |
| 626 | 3300050509 | nmdc:mga0qj67_608058_c1 | nmdc:mga0qj67_608058_c1_443_856 | 137 |
| 627 | 3300050510 | nmdc:mga06r32_14950_c1 | nmdc:mga06r32_14950_c1_457_879 | 137 |
| 628 | 3300050510 | nmdc:mga06r32_1711606_c1 | nmdc:mga06r32_1711606_c1_31_444 | 137 |
| 629 | 3300050510 | nmdc:mga06r32_368653_c1 | nmdc:mga06r32_368653_c1_203_616 | 137 |
| 630 | 3300050510 | nmdc:mga06r32_499574_c1 | nmdc:mga06r32_499574_c1_72_485 | 137 |
| 631 | 3300050510 | nmdc:mga06r32_979069_c1 | nmdc:mga06r32_979069_c1_272_685 | 137 |
| 632 | 3300050511 | nmdc:mga08y16_215065_c1 | nmdc:mga08y16_215065_c1_367_780 | 137 |
| 633 | 3300050511 | nmdc:mga08y16_442795_c1 | nmdc:mga08y16_442795_c1_616_1029 | 137 |
| 634 | 3300050512 | nmdc:mga0n895_122840_c1 | nmdc:mga0n895_122840_c1_1576_1989 | 137 |
| 635 | 3300050513 | nmdc:mga0rr50_1855643_c1 | nmdc:mga0rr50_1855643_c1_16_429 | 137 |
| 636 | 3300050514 | nmdc:mga08x19_468248_c1 | nmdc:mga08x19_468248_c1_244_657 | 137 |
| 637 | 3300050514 | nmdc:mga08x19_7041_c1 | nmdc:mga08x19_7041_c1_2783_3202 | 137 |
| 638 | 3300050514 | nmdc:mga08x19_815279_c1 | nmdc:mga08x19_815279_c1_66_482 | 137 |
| 639 | 3300053727 | Ga0500611_051238 | Ga0500611_051238_448_861 | 137 |
| 640 | 3300054114 | Ga0501084_1173081 | Ga0501084_1173081_160_573 | 137 |
| 641 | 3300054114 | Ga0501084_1215078 | Ga0501084_1215078_56_469 | 137 |
| 642 | 3300054114 | Ga0501084_1239844 | Ga0501084_1239844_101_514 | 137 |
| 643 | 3300059421 | Ga0590071_000060 | Ga0590071_000060_28214_28627 | 137 |
| 644 | 3300059421 | Ga0590071_020967 | Ga0590071_020967_660_1073 | 137 |
| 645 | 3300059423 | Ga0590074_000203 | Ga0590074_000203_564_977 | 137 |
| 646 | 3300059423 | Ga0590074_124798 | Ga0590074_124798_16_429 | 137 |
| 647 | 3300059424 | Ga0590075_000338 | Ga0590075_000338_5893_6306 | 137 |
| 648 | 3300059424 | Ga0590075_006284 | Ga0590075_006284_379_792 | 137 |
| 649 | 3300059426 | Ga0590077_000202 | Ga0590077_000202_16008_16421 | 137 |
| 650 | 3300059426 | Ga0590077_019779 | Ga0590077_019779_141_554 | 137 |
| 651 | 3300060353 | Ga0501082_0333227 | Ga0501082_0333227_465_878 | 137 |
| 652 | 3300060353 | Ga0501082_0738902 | Ga0501082_0738902_133_546 | 137 |
| 653 | 3300061734 | Ga0530510_0093709 | Ga0530510_0093709_734_1147 | 137 |
| 654 | 3300061734 | Ga0530510_0432574 | Ga0530510_0432574_87_500 | 137 |
| 655 | 3300061734 | Ga0530510_1234127 | Ga0530510_1234127_45_458 | 137 |
| 656 | 3300061734 | Ga0530510_1300903 | Ga0530510_1300903_132_545 | 137 |
| 657 | 3300003203 | JGI25406J46586_10243124 | JGI25406J46586_102431241 | 138 |
| 658 | 3300005295 | Ga0065707_10512314 | Ga0065707_105123142 | 138 |
| 659 | 3300005327 | Ga0070658_10059170 | Ga0070658_100591702 | 138 |
| 660 | 3300005329 | Ga0070683_100171249 | Ga0070683_1001712491 | 138 |
| 661 | 3300005331 | Ga0070670_100652273 | Ga0070670_1006522732 | 138 |
| 662 | 3300005333 | Ga0070677_10210617 | Ga0070677_102106172 | 138 |
| 663 | 3300005336 | Ga0070680_100016205 | Ga0070680_1000162052 | 138 |
| 664 | 3300005337 | Ga0070682_100392110 | Ga0070682_1003921101 | 138 |
| 665 | 3300005338 | Ga0068868_100264100 | Ga0068868_1002641002 | 138 |
| 666 | 3300005339 | Ga0070660_100023622 | Ga0070660_1000236222 | 138 |
| 667 | 3300005339 | Ga0070660_100137008 | Ga0070660_1001370085 | 138 |
| 668 | 3300005339 | Ga0070660_100546524 | Ga0070660_1005465241 | 138 |
| 669 | 3300005344 | Ga0070661_100008889 | Ga0070661_1000088894 | 138 |
| 670 | 3300005344 | Ga0070661_100027663 | Ga0070661_1000276632 | 138 |
| 671 | 3300005344 | Ga0070661_100754952 | Ga0070661_1007549522 | 138 |
| 672 | 3300005345 | Ga0070692_11047784 | Ga0070692_110477842 | 138 |
| 673 | 3300005355 | Ga0070671_100014366 | Ga0070671_1000143663 | 138 |
| 674 | 3300005356 | Ga0070674_100070771 | Ga0070674_1000707713 | 138 |
| 675 | 3300005364 | Ga0070673_101200008 | Ga0070673_1012000081 | 138 |
| 676 | 3300005365 | Ga0070688_100437836 | Ga0070688_1004378361 | 138 |
| 677 | 3300005367 | Ga0070667_100348291 | Ga0070667_1003482911 | 138 |
| 678 | 3300005455 | Ga0070663_100148931 | Ga0070663_1001489314 | 138 |
| 679 | 3300005456 | Ga0070678_100643101 | Ga0070678_1006431012 | 138 |
| 680 | 3300005456 | Ga0070678_101045567 | Ga0070678_1010455671 | 138 |
| 681 | 3300005458 | Ga0070681_10019189 | Ga0070681_100191896 | 138 |
| 682 | 3300005466 | Ga0070685_10013898 | Ga0070685_100138982 | 138 |
| 683 | 3300005471 | Ga0070698_100780796 | Ga0070698_1007807962 | 138 |
| 684 | 3300005471 | Ga0070698_100939676 | Ga0070698_1009396761 | 138 |
| 685 | 3300005518 | Ga0070699_100198406 | Ga0070699_1001984063 | 138 |
| 686 | 3300005530 | Ga0070679_100302551 | Ga0070679_1003025512 | 138 |
| 687 | 3300005535 | Ga0070684_100081768 | Ga0070684_1000817683 | 138 |
| 688 | 3300005535 | Ga0070684_101517437 | Ga0070684_1015174371 | 138 |
| 689 | 3300005536 | Ga0070697_100049091 | Ga0070697_1000490912 | 138 |
| 690 | 3300005539 | Ga0068853_100005152 | Ga0068853_1000051526 | 138 |
| 691 | 3300005539 | Ga0068853_100028505 | Ga0068853_1000285056 | 138 |
| 692 | 3300005539 | Ga0068853_100102808 | Ga0068853_1001028082 | 138 |
| 693 | 3300005539 | Ga0068853_100246164 | Ga0068853_1002461642 | 138 |
| 694 | 3300005543 | Ga0070672_100031727 | Ga0070672_1000317277 | 138 |
| 695 | 3300005545 | Ga0070695_100062705 | Ga0070695_1000627052 | 138 |
| 696 | 3300005548 | Ga0070665_100595402 | Ga0070665_1005954021 | 138 |
| 697 | 3300005548 | Ga0070665_100741933 | Ga0070665_1007419332 | 138 |
| 698 | 3300005548 | Ga0070665_101180264 | Ga0070665_1011802642 | 138 |
| 699 | 3300005548 | Ga0070665_101398522 | Ga0070665_1013985222 | 138 |
| 700 | 3300005549 | Ga0070704_101341769 | Ga0070704_1013417691 | 138 |
| 701 | 3300005563 | Ga0068855_100025034 | Ga0068855_1000250346 | 138 |
| 702 | 3300005563 | Ga0068855_100118445 | Ga0068855_1001184453 | 138 |
| 703 | 3300005563 | Ga0068855_100450522 | Ga0068855_1004505222 | 138 |
| 704 | 3300005563 | Ga0068855_100542524 | Ga0068855_1005425243 | 138 |
| 705 | 3300005564 | Ga0070664_100016791 | Ga0070664_1000167913 | 138 |
| 706 | 3300005578 | Ga0068854_100015515 | Ga0068854_1000155159 | 138 |
| 707 | 3300005578 | Ga0068854_100028425 | Ga0068854_1000284258 | 138 |
| 708 | 3300005578 | Ga0068854_100271546 | Ga0068854_1002715462 | 138 |
| 709 | 3300005578 | Ga0068854_101020626 | Ga0068854_1010206261 | 138 |
| 710 | 3300005614 | Ga0068856_100077852 | Ga0068856_1000778522 | 138 |
| 711 | 3300005614 | Ga0068856_100205345 | Ga0068856_1002053453 | 138 |
| 712 | 3300005614 | Ga0068856_100301755 | Ga0068856_1003017552 | 138 |
| 713 | 3300005616 | Ga0068852_100005648 | Ga0068852_1000056487 | 138 |
| 714 | 3300005616 | Ga0068852_100034648 | Ga0068852_1000346487 | 138 |
| 715 | 3300005616 | Ga0068852_100154208 | Ga0068852_1001542082 | 138 |
| 716 | 3300005616 | Ga0068852_100586799 | Ga0068852_1005867993 | 138 |
| 717 | 3300005616 | Ga0068852_100599731 | Ga0068852_1005997312 | 138 |
| 718 | 3300005617 | Ga0068859_102559106 | Ga0068859_1025591061 | 138 |
| 719 | 3300005719 | Ga0068861_100103017 | Ga0068861_1001030175 | 138 |
| 720 | 3300005719 | Ga0068861_100193131 | Ga0068861_1001931312 | 138 |
| 721 | 3300005834 | Ga0068851_10005621 | Ga0068851_1000562110 | 138 |
| 722 | 3300005840 | Ga0068870_10237853 | Ga0068870_102378532 | 138 |
| 723 | 3300005842 | Ga0068858_100048034 | Ga0068858_1000480343 | 138 |
| 724 | 3300005842 | Ga0068858_100371418 | Ga0068858_1003714183 | 138 |
| 725 | 3300005843 | Ga0068860_100003051 | Ga0068860_1000030512 | 138 |
| 726 | 3300005937 | Ga0081455_10220993 | Ga0081455_102209932 | 138 |
| 727 | 3300005985 | Ga0081539_10027575 | Ga0081539_100275754 | 138 |
| 728 | 3300005985 | Ga0081539_10337301 | Ga0081539_103373012 | 138 |
| 729 | 3300006038 | Ga0075365_10080806 | Ga0075365_100808064 | 138 |
| 730 | 3300006042 | Ga0075368_10040666 | Ga0075368_100406662 | 138 |
| 731 | 3300006042 | Ga0075368_10089583 | Ga0075368_100895833 | 138 |
| 732 | 3300006051 | Ga0075364_10232614 | Ga0075364_102326142 | 138 |
| 733 | 3300006051 | Ga0075364_10558624 | Ga0075364_105586242 | 138 |
| 734 | 3300006175 | Ga0070712_100961073 | Ga0070712_1009610731 | 138 |
| 735 | 3300006178 | Ga0075367_10039305 | Ga0075367_100393054 | 138 |
| 736 | 3300006178 | Ga0075367_10249356 | Ga0075367_102493562 | 138 |
| 737 | 3300006178 | Ga0075367_10651814 | Ga0075367_106518142 | 138 |
| 738 | 3300006195 | Ga0075366_10008607 | Ga0075366_100086073 | 138 |
| 739 | 3300006195 | Ga0075366_10152577 | Ga0075366_101525773 | 138 |
| 740 | 3300006237 | Ga0097621_100160348 | Ga0097621_1001603482 | 138 |
| 741 | 3300006353 | Ga0075370_10032032 | Ga0075370_100320326 | 138 |
| 742 | 3300006844 | Ga0075428_100308190 | Ga0075428_1003081901 | 138 |
| 743 | 3300006844 | Ga0075428_100532853 | Ga0075428_1005328533 | 138 |
| 744 | 3300006847 | Ga0075431_100195183 | Ga0075431_1001951833 | 138 |
| 745 | 3300006880 | Ga0075429_100093654 | Ga0075429_1000936543 | 138 |
| 746 | 3300006881 | Ga0068865_100334624 | Ga0068865_1003346243 | 138 |
| 747 | 3300006931 | Ga0097620_102558995 | Ga0097620_1025589951 | 138 |
| 748 | 3300009093 | Ga0105240_10012404 | Ga0105240_100124046 | 138 |
| 749 | 3300009093 | Ga0105240_10028438 | Ga0105240_100284382 | 138 |
| 750 | 3300009093 | Ga0105240_10152968 | Ga0105240_101529683 | 138 |
| 751 | 3300009098 | Ga0105245_10211792 | Ga0105245_102117922 | 138 |
| 752 | 3300009098 | Ga0105245_10458327 | Ga0105245_104583272 | 138 |
| 753 | 3300009101 | Ga0105247_10051805 | Ga0105247_100518054 | 138 |
| 754 | 3300009147 | Ga0114129_11135531 | Ga0114129_111355312 | 138 |
| 755 | 3300009148 | Ga0105243_11127985 | Ga0105243_111279852 | 138 |
| 756 | 3300009174 | Ga0105241_10114161 | Ga0105241_101141613 | 138 |
| 757 | 3300009174 | Ga0105241_10552086 | Ga0105241_105520862 | 138 |
| 758 | 3300009174 | Ga0105241_10613271 | Ga0105241_106132711 | 138 |
| 759 | 3300009174 | Ga0105241_11649018 | Ga0105241_116490181 | 138 |
| 760 | 3300009177 | Ga0105248_10666579 | Ga0105248_106665792 | 138 |
| 761 | 3300009545 | Ga0105237_11749043 | Ga0105237_117490431 | 138 |
| 762 | 3300009545 | Ga0105237_11819665 | Ga0105237_118196651 | 138 |
| 763 | 3300009551 | Ga0105238_10009677 | Ga0105238_100096778 | 138 |
| 764 | 3300009551 | Ga0105238_10136633 | Ga0105238_101366333 | 138 |
| 765 | 3300009551 | Ga0105238_10403448 | Ga0105238_104034482 | 138 |
| 766 | 3300009553 | Ga0105249_10813068 | Ga0105249_108130681 | 138 |
| 767 | 3300010375 | Ga0105239_10007066 | Ga0105239_100070663 | 138 |
| 768 | 3300010375 | Ga0105239_10118954 | Ga0105239_101189543 | 138 |
| 769 | 3300010375 | Ga0105239_10962653 | Ga0105239_109626532 | 138 |
| 770 | 3300010375 | Ga0105239_12410490 | Ga0105239_124104901 | 138 |
| 771 | 3300010375 | Ga0105239_12445264 | Ga0105239_124452642 | 138 |
| 772 | 3300011119 | Ga0105246_10376112 | Ga0105246_103761122 | 138 |
| 773 | 3300011119 | Ga0105246_10872153 | Ga0105246_108721531 | 138 |
| 774 | 3300013100 | Ga0157373_10267520 | Ga0157373_102675202 | 138 |
| 775 | 3300013100 | Ga0157373_10291151 | Ga0157373_102911512 | 138 |
| 776 | 3300013102 | Ga0157371_10034623 | Ga0157371_100346239 | 138 |
| 777 | 3300013104 | Ga0157370_10070956 | Ga0157370_100709566 | 138 |
| 778 | 3300013104 | Ga0157370_10112532 | Ga0157370_101125322 | 138 |
| 779 | 3300013104 | Ga0157370_10231297 | Ga0157370_102312972 | 138 |
| 780 | 3300013104 | Ga0157370_10778863 | Ga0157370_107788632 | 138 |
| 781 | 3300013104 | Ga0157370_11012175 | Ga0157370_110121752 | 138 |
| 782 | 3300013105 | Ga0157369_10014955 | Ga0157369_100149558 | 138 |
| 783 | 3300013296 | Ga0157374_11993646 | Ga0157374_119936462 | 138 |
| 784 | 3300013297 | Ga0157378_10477684 | Ga0157378_104776841 | 138 |
| 785 | 3300013307 | Ga0157372_10219749 | Ga0157372_102197494 | 138 |
| 786 | 3300013307 | Ga0157372_10483777 | Ga0157372_104837772 | 138 |
| 787 | 3300013307 | Ga0157372_12049114 | Ga0157372_120491142 | 138 |
| 788 | 3300014325 | Ga0163163_10106869 | Ga0163163_101068692 | 138 |
| 789 | 3300014326 | Ga0157380_11701603 | Ga0157380_117016032 | 138 |
| 790 | 3300014745 | Ga0157377_10607175 | Ga0157377_106071752 | 138 |
| 791 | 3300014968 | Ga0157379_10025258 | Ga0157379_100252581 | 138 |
| 792 | 3300014968 | Ga0157379_10390423 | Ga0157379_103904232 | 138 |
| 793 | 3300014969 | Ga0157376_10397616 | Ga0157376_103976162 | 138 |
| 794 | 3300014969 | Ga0157376_10464511 | Ga0157376_104645112 | 138 |
| 795 | 3300017792 | Ga0163161_10394336 | Ga0163161_103943361 | 138 |
| 796 | 3300020070 | Ga0206356_11229896 | Ga0206356_112298962 | 138 |
| 797 | 3300020078 | Ga0206352_10061836 | Ga0206352_100618361 | 138 |
| 798 | 3300020081 | Ga0206354_10876749 | Ga0206354_108767492 | 138 |
| 799 | 3300020610 | Ga0154015_1512287 | Ga0154015_15122872 | 138 |
| 800 | 3300021384 | Ga0213876_10520272 | Ga0213876_105202722 | 138 |
| 801 | 3300025321 | Ga0207656_10001311 | Ga0207656_100013112 | 138 |
| 802 | 3300025321 | Ga0207656_10249660 | Ga0207656_102496602 | 138 |
| 803 | 3300025893 | Ga0207682_10167217 | Ga0207682_101672172 | 138 |
| 804 | 3300025900 | Ga0207710_10024756 | Ga0207710_100247562 | 138 |
| 805 | 3300025907 | Ga0207645_10022662 | Ga0207645_100226622 | 138 |
| 806 | 3300025909 | Ga0207705_10248703 | Ga0207705_102487032 | 138 |
| 807 | 3300025912 | Ga0207707_10342284 | Ga0207707_103422842 | 138 |
| 808 | 3300025913 | Ga0207695_10007106 | Ga0207695_1000710612 | 138 |
| 809 | 3300025913 | Ga0207695_10494094 | Ga0207695_104940941 | 138 |
| 810 | 3300025913 | Ga0207695_10932069 | Ga0207695_109320691 | 138 |
| 811 | 3300025913 | Ga0207695_11280134 | Ga0207695_112801341 | 138 |
| 812 | 3300025914 | Ga0207671_10460783 | Ga0207671_104607832 | 138 |
| 813 | 3300025918 | Ga0207662_10224059 | Ga0207662_102240591 | 138 |
| 814 | 3300025919 | Ga0207657_10044776 | Ga0207657_100447762 | 138 |
| 815 | 3300025919 | Ga0207657_10501061 | Ga0207657_105010612 | 138 |
| 816 | 3300025920 | Ga0207649_10001031 | Ga0207649_100010316 | 138 |
| 817 | 3300025920 | Ga0207649_10187784 | Ga0207649_101877842 | 138 |
| 818 | 3300025920 | Ga0207649_10541971 | Ga0207649_105419711 | 138 |
| 819 | 3300025921 | Ga0207652_10158236 | Ga0207652_101582363 | 138 |
| 820 | 3300025924 | Ga0207694_10006307 | Ga0207694_100063078 | 138 |
| 821 | 3300025924 | Ga0207694_10246106 | Ga0207694_102461062 | 138 |
| 822 | 3300025924 | Ga0207694_11294337 | Ga0207694_112943371 | 138 |
| 823 | 3300025925 | Ga0207650_10148131 | Ga0207650_101481315 | 138 |
| 824 | 3300025926 | Ga0207659_10637438 | Ga0207659_106374382 | 138 |
| 825 | 3300025927 | Ga0207687_10174541 | Ga0207687_101745415 | 138 |
| 826 | 3300025931 | Ga0207644_10025280 | Ga0207644_100252807 | 138 |
| 827 | 3300025933 | Ga0207706_10086949 | Ga0207706_100869495 | 138 |
| 828 | 3300025936 | Ga0207670_11814575 | Ga0207670_118145751 | 138 |
| 829 | 3300025937 | Ga0207669_10148738 | Ga0207669_101487382 | 138 |
| 830 | 3300025938 | Ga0207704_10128793 | Ga0207704_101287932 | 138 |
| 831 | 3300025940 | Ga0207691_10039249 | Ga0207691_100392492 | 138 |
| 832 | 3300025941 | Ga0207711_11122502 | Ga0207711_111225022 | 138 |
| 833 | 3300025942 | Ga0207689_10178242 | Ga0207689_101782423 | 138 |
| 834 | 3300025945 | Ga0207679_10370026 | Ga0207679_103700261 | 138 |
| 835 | 3300025949 | Ga0207667_10020673 | Ga0207667_100206738 | 138 |
| 836 | 3300025949 | Ga0207667_10092286 | Ga0207667_100922862 | 138 |
| 837 | 3300025949 | Ga0207667_10127751 | Ga0207667_101277512 | 138 |
| 838 | 3300025949 | Ga0207667_11075202 | Ga0207667_110752021 | 138 |
| 839 | 3300025960 | Ga0207651_10971831 | Ga0207651_109718311 | 138 |
| 840 | 3300025960 | Ga0207651_11229421 | Ga0207651_112294212 | 138 |
| 841 | 3300025981 | Ga0207640_10003993 | Ga0207640_100039937 | 138 |
| 842 | 3300025981 | Ga0207640_10014708 | Ga0207640_100147089 | 138 |
| 843 | 3300025981 | Ga0207640_10496838 | Ga0207640_104968381 | 138 |
| 844 | 3300025981 | Ga0207640_10673962 | Ga0207640_106739621 | 138 |
| 845 | 3300025986 | Ga0207658_10366286 | Ga0207658_103662863 | 138 |
| 846 | 3300026023 | Ga0207677_10079440 | Ga0207677_100794404 | 138 |
| 847 | 3300026023 | Ga0207677_11103982 | Ga0207677_111039822 | 138 |
| 848 | 3300026035 | Ga0207703_11032863 | Ga0207703_110328631 | 138 |
| 849 | 3300026041 | Ga0207639_10002270 | Ga0207639_100022703 | 138 |
| 850 | 3300026041 | Ga0207639_10058301 | Ga0207639_100583012 | 138 |
| 851 | 3300026041 | Ga0207639_10302296 | Ga0207639_103022964 | 138 |
| 852 | 3300026041 | Ga0207639_10584226 | Ga0207639_105842261 | 138 |
| 853 | 3300026067 | Ga0207678_10006322 | Ga0207678_100063227 | 138 |
| 854 | 3300026067 | Ga0207678_10049950 | Ga0207678_100499502 | 138 |
| 855 | 3300026067 | Ga0207678_10111317 | Ga0207678_101113174 | 138 |
| 856 | 3300026067 | Ga0207678_10619502 | Ga0207678_106195022 | 138 |
| 857 | 3300026067 | Ga0207678_11538258 | Ga0207678_115382581 | 138 |
| 858 | 3300026078 | Ga0207702_10044412 | Ga0207702_100444122 | 138 |
| 859 | 3300026078 | Ga0207702_10165396 | Ga0207702_101653963 | 138 |
| 860 | 3300026078 | Ga0207702_10385591 | Ga0207702_103855912 | 138 |
| 861 | 3300026088 | Ga0207641_11491457 | Ga0207641_114914572 | 138 |
| 862 | 3300026089 | Ga0207648_10211315 | Ga0207648_102113152 | 138 |
| 863 | 3300026116 | Ga0207674_10010061 | Ga0207674_100100616 | 138 |
| 864 | 3300026116 | Ga0207674_10086625 | Ga0207674_100866255 | 138 |
| 865 | 3300026118 | Ga0207675_100073156 | Ga0207675_1000731567 | 138 |
| 866 | 3300026118 | Ga0207675_101058313 | Ga0207675_1010583132 | 138 |
| 867 | 3300026121 | Ga0207683_10628288 | Ga0207683_106282881 | 138 |
| 868 | 3300026142 | Ga0207698_10009294 | Ga0207698_100092948 | 138 |
| 869 | 3300026142 | Ga0207698_10072672 | Ga0207698_100726721 | 138 |
| 870 | 3300026142 | Ga0207698_10098755 | Ga0207698_100987552 | 138 |
| 871 | 3300026142 | Ga0207698_12085776 | Ga0207698_120857761 | 138 |
| 872 | 3300026142 | Ga0207698_12252496 | Ga0207698_122524961 | 138 |
| 873 | 3300028379 | Ga0268266_10096295 | Ga0268266_100962952 | 138 |
| 874 | 3300028379 | Ga0268266_11769120 | Ga0268266_117691202 | 138 |
| 875 | 3300028380 | Ga0268265_11948244 | Ga0268265_119482441 | 138 |
| 876 | 3300028381 | Ga0268264_10002191 | Ga0268264_100021911 | 138 |
| 877 | 3300028381 | Ga0268264_10499926 | Ga0268264_104999262 | 138 |
| 878 | 3300028800 | Ga0265338_10027640 | Ga0265338_100276406 | 138 |
| 879 | 3300029957 | Ga0265324_10061787 | Ga0265324_100617872 | 138 |
| 880 | 3300031235 | Ga0265330_10052275 | Ga0265330_100522752 | 138 |
| 881 | 3300031239 | Ga0265328_10121476 | Ga0265328_101214763 | 138 |
| 882 | 3300031241 | Ga0265325_10040624 | Ga0265325_100406246 | 138 |
| 883 | 3300031247 | Ga0265340_10300569 | Ga0265340_103005692 | 138 |
| 884 | 3300031249 | Ga0265339_10000277 | Ga0265339_100002778 | 138 |
| 885 | 3300031595 | Ga0265313_10002031 | Ga0265313_1000203118 | 138 |
| 886 | 3300031665 | Ga0316575_10057546 | Ga0316575_100575462 | 138 |
| 887 | 3300031711 | Ga0265314_10094029 | Ga0265314_100940293 | 138 |
| 888 | 3300031995 | Ga0307409_100796478 | Ga0307409_1007964782 | 138 |
| 889 | 3300032002 | Ga0307416_100799254 | Ga0307416_1007992543 | 138 |
| 890 | 3300032002 | Ga0307416_100927573 | Ga0307416_1009275732 | 138 |
| 891 | 3300032126 | Ga0307415_101640370 | Ga0307415_1016403701 | 138 |
| 892 | 3300034820 | Ga0373959_0000006 | Ga0373959_0000006_67663_68079 | 138 |
| 893 | 3300035091 | Ga0373951_0273422 | Ga0373951_0273422_40_462 | 138 |
| 894 | 3300035092 | Ga0373952_0026644 | Ga0373952_0026644_416_838 | 138 |
| 895 | 3300035398 | Ga0316574_0091842 | Ga0316574_0091842_1342_1767 | 138 |
| 896 | 3300035691 | Ga0373931_0075955 | Ga0373931_0075955_54_476 | 138 |
| 897 | 3300035725 | Ga0373947_1114798 | Ga0373947_1114798_70_486 | 138 |
| 898 | 3300036401 | Ga0373937_0344060 | Ga0373937_0344060_932_1348 | 138 |
| 899 | 3300037312 | Ga0395899_0612193 | Ga0395899_0612193_214_636 | 138 |
| 900 | 3300037418 | Ga0395900_0707454 | Ga0395900_0707454_53_475 | 138 |
| 901 | 3300037466 | Ga0395898_0359431 | Ga0395898_0359431_803_1225 | 138 |
| 902 | 3300038443 | Ga0395901_0661471 | Ga0395901_0661471_214_636 | 138 |
| 903 | 3300038735 | Ga0400485_17143 | Ga0400485_17143_11780_12196 | 138 |
| 904 | 3300038742 | Ga0400486_16511 | Ga0400486_16511_881_1297 | 138 |
| 905 | 3300039093 | Ga0400489_35047 | Ga0400489_35047_33416_33832 | 138 |
| 906 | 3300039437 | Ga0436365_0324434 | Ga0436365_0324434_973_1389 | 138 |
| 907 | 3300041443 | Ga0451789_0527783 | Ga0451789_0527783_45_461 | 138 |
| 908 | 3300041505 | Ga0451849_0083480 | Ga0451849_0083480_31_453 | 138 |
| 909 | 3300041512 | Ga0451853_0993517 | Ga0451853_0993517_52_468 | 138 |
| 910 | 3300041512 | Ga0451853_1851339 | Ga0451853_1851339_110_529 | 138 |
| 911 | 3300041997 | Ga0439431_0278491 | Ga0439431_0278491_25_441 | 138 |
| 912 | 3300042007 | Ga0439449_0077694 | Ga0439449_0077694_87_503 | 138 |
| 913 | 3300042015 | Ga0439462_0030219 | Ga0439462_0030219_663_1079 | 138 |
| 914 | 3300042876 | Ga0451577_0195978 | Ga0451577_0195978_738_1154 | 138 |
| 915 | 3300042876 | Ga0451577_1328782 | Ga0451577_1328782_167_583 | 138 |
| 916 | 3300044673 | Ga0453683_0171190 | Ga0453683_0171190_432_848 | 138 |
| 917 | 3300044673 | Ga0453683_0196832 | Ga0453683_0196832_86_502 | 138 |
| 918 | 3300044673 | Ga0453683_0434910 | Ga0453683_0434910_233_649 | 138 |
| 919 | 3300044673 | Ga0453683_0792224 | Ga0453683_0792224_37_456 | 138 |
| 920 | 3300044712 | Ga0453684_0553098 | Ga0453684_0553098_251_667 | 138 |
| 921 | 3300045051 | Ga0451576_1812629 | Ga0451576_1812629_31_456 | 138 |
| 922 | 3300046460 | Ga0495638_0030256 | Ga0495638_0030256_2749_3174 | 138 |
| 923 | 3300046472 | Ga0495580_0291328 | Ga0495580_0291328_423_851 | 138 |
| 924 | 3300046499 | Ga0495594_0133768 | Ga0495594_0133768_683_1108 | 138 |
| 925 | 3300046511 | Ga0495608_0353175 | Ga0495608_0353175_262_678 | 138 |
| 926 | 3300046524 | Ga0495648_0391502 | Ga0495648_0391502_91_519 | 138 |
| 927 | 3300046558 | Ga0495633_0079535 | Ga0495633_0079535_250_678 | 138 |
| 928 | 3300046689 | Ga0495613_0135472 | Ga0495613_0135472_658_1095 | 138 |
| 929 | 3300046794 | Ga0495589_0245621 | Ga0495589_0245621_202_630 | 138 |
| 930 | 3300047317 | Ga0495604_0070562 | Ga0495604_0070562_1036_1452 | 138 |
| 931 | 3300048088 | Ga0495602_0083542 | Ga0495602_0083542_937_1353 | 138 |
| 932 | 3300048911 | Ga0496108_0460699 | Ga0496108_0460699_647_1063 | 138 |
| 933 | 3300048911 | Ga0496108_1003131 | Ga0496108_1003131_73_495 | 138 |
| 934 | 3300048912 | Ga0496109_0434127 | Ga0496109_0434127_431_853 | 138 |
| 935 | 3300048912 | Ga0496109_0806525 | Ga0496109_0806525_421_837 | 138 |
| 936 | 3300048912 | Ga0496109_0899992 | Ga0496109_0899992_80_505 | 138 |
| 937 | 3300048915 | Ga0496112_1414553 | Ga0496112_1414553_32_451 | 138 |
| 938 | 3300049568 | Ga0501031_0029982 | Ga0501031_0029982_160_582 | 138 |
| 939 | 3300049569 | Ga0501032_0096139 | Ga0501032_0096139_126_548 | 138 |
| 940 | 3300049570 | Ga0501033_0092758 | Ga0501033_0092758_1617_2039 | 138 |
| 941 | 3300049572 | Ga0501036_0030301 | Ga0501036_0030301_1168_1590 | 138 |
| 942 | 3300049574 | Ga0501038_0041127 | Ga0501038_0041127_3453_3875 | 138 |
| 943 | 3300049575 | Ga0501039_0127623 | Ga0501039_0127623_158_580 | 138 |
| 944 | 3300049578 | Ga0501042_0129327 | Ga0501042_0129327_1214_1636 | 138 |
| 945 | 3300049579 | Ga0501043_0216620 | Ga0501043_0216620_67_489 | 138 |
| 946 | 3300049580 | Ga0501046_0364830 | Ga0501046_0364830_44_466 | 138 |
| 947 | 3300049581 | Ga0501047_0192643 | Ga0501047_0192643_1050_1472 | 138 |
| 948 | 3300049584 | Ga0501068_0419141 | Ga0501068_0419141_132_554 | 138 |
| 949 | 3300049586 | Ga0501070_0047126 | Ga0501070_0047126_3066_3488 | 138 |
| 950 | 3300049587 | Ga0501071_0599595 | Ga0501071_0599595_371_793 | 138 |
| 951 | 3300049588 | Ga0501072_0184273 | Ga0501072_0184273_987_1409 | 138 |
| 952 | 3300049589 | Ga0501073_0183524 | Ga0501073_0183524_602_1027 | 138 |
| 953 | 3300049589 | Ga0501073_0311642 | Ga0501073_0311642_234_656 | 138 |
| 954 | 3300049741 | Ga0501079_0305094 | Ga0501079_0305094_291_713 | 138 |
| 955 | 3300049742 | Ga0501080_0049961 | Ga0501080_0049961_1837_2262 | 138 |
| 956 | 3300049743 | Ga0501081_0571635 | Ga0501081_0571635_256_678 | 138 |
| 957 | 3300049822 | Ga0501035_0138889 | Ga0501035_0138889_978_1400 | 138 |
| 958 | 3300049822 | Ga0501035_1522115 | Ga0501035_1522115_35_457 | 138 |
| 959 | 3300049823 | Ga0501044_0203071 | Ga0501044_0203071_842_1264 | 138 |
| 960 | 3300050490 | nmdc:mga03n38_134423_c1 | nmdc:mga03n38_134423_c1_651_1070 | 138 |
| 961 | 3300050491 | nmdc:mga00v17_255223_c1 | nmdc:mga00v17_255223_c1_293_709 | 138 |
| 962 | 3300050491 | nmdc:mga00v17_298329_c1 | nmdc:mga00v17_298329_c1_336_755 | 138 |
| 963 | 3300050491 | nmdc:mga00v17_53025_c1 | nmdc:mga00v17_53025_c1_1853_2272 | 138 |
| 964 | 3300050492 | nmdc:mga0yw44_11740_c1 | nmdc:mga0yw44_11740_c1_534_950 | 138 |
| 965 | 3300050493 | nmdc:mga0k408_149532_c2 | nmdc:mga0k408_149532_c2_77_496 | 138 |
| 966 | 3300050493 | nmdc:mga0k408_37903_c1 | nmdc:mga0k408_37903_c1_1004_1423 | 138 |
| 967 | 3300050494 | nmdc:mga06z11_223245_c1 | nmdc:mga06z11_223245_c1_348_767 | 138 |
| 968 | 3300050494 | nmdc:mga06z11_484490_c1 | nmdc:mga06z11_484490_c1_131_550 | 138 |
| 969 | 3300050496 | nmdc:mga07m45_36229_c1 | nmdc:mga07m45_36229_c1_706_1125 | 138 |
| 970 | 3300050496 | nmdc:mga07m45_86012_c1 | nmdc:mga07m45_86012_c1_851_1267 | 138 |
| 971 | 3300050496 | nmdc:mga07m45_89282_c1 | nmdc:mga07m45_89282_c1_175_594 | 138 |
| 972 | 3300050507 | nmdc:mga05p37_476857_c1 | nmdc:mga05p37_476857_c1_351_773 | 138 |
| 973 | 3300050508 | nmdc:mga09592_547467_c1 | nmdc:mga09592_547467_c1_165_596 | 138 |
| 974 | 3300050510 | nmdc:mga06r32_767296_c1 | nmdc:mga06r32_767296_c1_489_911 | 138 |
| 975 | 3300050514 | nmdc:mga08x19_4109_c1 | nmdc:mga08x19_4109_c1_5145_5564 | 138 |
| 976 | 3300061734 | Ga0530510_0691743 | Ga0530510_0691743_286_702 | 138 |
| 977 | 3300061734 | Ga0530510_0734462 | Ga0530510_0734462_245_664 | 138 |
| 978 | 3300061734 | Ga0530510_0955878 | Ga0530510_0955878_33_449 | 138 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6ay1-assembly5.cif.gz_E | crystal structure of a nucleoside diphosphate kinase ndk from helicobacter pylori | 0.995 | 1 | 136 |
| 6ay1-assembly8.cif.gz_H | crystal structure of a nucleoside diphosphate kinase ndk from helicobacter pylori | 0.9905 | 2 | 136 |
| 6aes-assembly2.cif.gz_B | crystal structure of nucleoside diphosphate kinase from pseudomonas aeruginosa at 3.55 a resolution. | 0.9893 | 2 | 138 |
| 6ay1-assembly7.cif.gz_G | crystal structure of a nucleoside diphosphate kinase ndk from helicobacter pylori | 0.9889 | 1 | 136 |
| 6ay1-assembly5.cif.gz_E | crystal structure of a nucleoside diphosphate kinase ndk from helicobacter pylori | 0.9876 | 1 | 136 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 6ay1G00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain | 0.9889 | 1 | 136 | 3.30.70.141 |
| af_I1KHD6_3_118_3.30.70.141 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain | 0.9842 | 35 | 132 | 3.30.70.141 |
| 4w98A00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain | 0.9814 | 2 | 138 | 3.30.70.141 |
| 6ay1G00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain | 0.9813 | 1 | 136 | 3.30.70.141 |
| af_O88425_6_161_3.30.70.141 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain | 0.981 | 2 | 131 | 3.30.70.141 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-V6DH04-F1-model_v4 | Nucleoside diphosphate kinase (EC 2.7.4.6) | 1.003 | 2 | 131 |
GO:0004550
GO:0005524 GO:0005737 GO:0006183 GO:0006228 GO:0006241 GO:0046872 |
| AF-A0A4R5P201-F1-model_v4 | Nucleoside diphosphate kinase (EC 2.7.4.6) | 1.003 | 3 | 131 |
GO:0004550
GO:0006183 GO:0006228 GO:0006241 |
| AF-A0A2N6EU76-F1-model_v4 | Nucleoside diphosphate kinase (NDK) (NDP kinase) (EC 2.7.4.6) (Nucleoside-2-P kinase) | 1.001 | 1 | 136 |
GO:0004550
GO:0005524 GO:0005737 GO:0006183 GO:0006228 GO:0006241 GO:0046872 |
| AF-A0A2V9HHJ3-F1-model_v4 | Nucleoside diphosphate kinase (NDK) (NDP kinase) (EC 2.7.4.6) (Nucleoside-2-P kinase) | 1.001 | 2 | 136 |
GO:0004550
GO:0005524 GO:0005737 GO:0006183 GO:0006228 GO:0006241 GO:0046872 |
| AF-A0A523TYZ3-F1-model_v4 | Nucleoside diphosphate kinase (NDK) (NDP kinase) (EC 2.7.4.6) (Nucleoside-2-P kinase) | 1.001 | 1 | 133 |
GO:0004550
GO:0005524 GO:0005737 GO:0006183 GO:0006228 GO:0006241 GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar