F487262

General Info

Members Datasets Scaffolds Average Seq Length
976 346 968 344

Family's Representative Sequence

Representative Sequence 3300046536|Ga0495587_0040968|Ga0495587_0040968_773_1777
Length 334
Sequence MIKVGIVGGTGYTGVELLRLLAVHPEARVQAITSRSEAGVPVGTMFPSLRDQERLSELQFSDPAGAGLSRCDVVFFATPHGVAMAQARELVGAGVKIIDLAADFRLKDTAEFERWYKMPHACPDLLAESVYGLPEMYRDAIRKARIVGNPGCYPTAIQLGFLPLVEAGIVDVDHLIADAKSGVSGAGRKAELGLLFSEASDNFKAYNLGGHRHHPEVVHGLNGRSRSPVTVVFTPLYARLTDRGVDLQALFEKRYASEPFVDVMPAGSHPETRSVRASNVCRIAVHRPQGGDTAVVVAVIDNLVKGAAGQAIQNMNLMFGLAETTGLTAPPVMP

Samples

Sample ID Description Type Environment
1 2547132103 Chromobacterium sp. C-61 Isolate Rhizosphere
2 2843690924 Chromobacterium rhizoryzae JP2-74 Isolate Rhizosphere
3 2846033681 Chromobacterium sinusclupearum MWU13-2610 Isolate Rhizosphere
4 2846037992 Chromobacterium alticapitis MWU14-2602 Isolate Rhizosphere
5 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
6 2894510363 Methylomonas sp. Kb3 Isolate Unclassified
7 2989392574 Methylomonas rhizoryzae GJ1 Isolate Unclassified
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
41 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
48 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
49 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
50 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
51 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
52 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
53 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
54 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
57 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
58 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
59 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
60 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
63 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
64 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
65 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
66 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
67 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
68 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
69 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
70 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
71 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
72 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
73 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
74 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
75 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
76 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
77 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
78 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
79 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
80 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
81 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
82 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
83 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
84 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
85 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
86 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
87 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
88 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
90 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
91 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
92 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
93 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
94 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
95 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
96 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
97 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
98 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
99 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
100 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
102 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
103 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
104 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
105 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
106 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
107 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
108 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
109 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
110 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
111 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
112 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
113 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
114 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
115 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
116 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
117 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
118 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
119 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
120 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
121 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
122 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
123 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
124 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
125 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
126 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
127 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
128 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
129 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
130 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
198 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
200 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
204 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
205 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
206 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
207 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
208 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
209 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
210 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
211 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
212 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
213 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
214 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
215 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
216 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
217 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
218 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
219 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
220 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
221 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
222 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
223 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
224 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
225 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
226 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
227 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
228 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
229 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
230 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
231 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
232 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
233 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
234 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
235 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
236 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
237 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
238 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
239 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
240 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
241 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
242 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
243 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
244 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
245 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
246 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
247 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
248 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
249 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
250 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
251 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
252 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
253 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
254 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
255 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
256 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
257 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
258 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
259 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
260 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
261 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
262 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
263 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
264 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
265 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
266 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
267 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
268 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
269 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
270 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
271 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
272 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
273 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
274 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
275 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
276 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
277 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
278 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
279 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
280 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
281 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
282 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
283 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
284 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
285 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
286 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
287 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
288 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
289 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
290 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
291 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
292 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
293 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
294 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
295 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
296 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
297 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
298 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
299 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
300 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
301 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
302 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
303 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
304 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
305 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
306 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
307 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
308 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
309 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
310 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
311 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
312 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
313 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
314 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
315 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
316 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
317 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
318 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
319 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
320 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
321 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
322 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
323 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
324 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
325 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
326 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
327 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
328 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
329 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
330 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
331 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
332 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
333 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
334 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
335 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
336 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
337 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
338 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
339 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
340 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
341 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
342 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
343 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
344 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
345 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
346 8001522603 Methylomicrobium sp. RS1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.77
Metatranscriptomes 0.41
Isolates 0.82

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.84
Nodule 0
Rhizoplane 3.69
Rhizosphere 93.95
Stem 0
Stem Tuber 0
Unclassified 0.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065715_10172172 3300005293 Bacteria 1538
2 Ga0070658_10062501 3300005327 Bacteria 3035
3 Ga0070658_10244643 3300005327 Bacteria 1521
4 Ga0070676_10002569 3300005328 Bacteria 9333
5 Ga0070676_10016017 3300005328 Bacteria 4140
6 Ga0070676_10028584 3300005328 Bacteria 3167
7 Ga0070676_10051661 3300005328 Bacteria 2414
8 Ga0070683_100085505 3300005329 Bacteria 2957
9 Ga0070683_100105796 3300005329 Bacteria 2652
10 Ga0070683_100140236 3300005329 Bacteria 2290
11 Ga0070690_100000521 3300005330 Bacteria 19293
12 Ga0070670_100044437 3300005331 Bacteria 3820
13 Ga0070670_100078531 3300005331 Bacteria 2835
14 Ga0070670_100110155 3300005331 Bacteria 2372
15 Ga0070670_100192052 3300005331 Bacteria 1774
16 Ga0070670_100196571 3300005331 Bacteria 1752
17 Ga0070670_100455308 3300005331 Bacteria 1134
18 Ga0070677_10000757 3300005333 Bacteria 10776
19 Ga0070677_10010233 3300005333 Bacteria 3202
20 Ga0070677_10034506 3300005333 Bacteria 1955
21 Ga0068869_100000591 3300005334 Bacteria 20345
22 Ga0068869_100051928 3300005334 Bacteria 2976
23 Ga0068869_100097098 3300005334 Bacteria 2224
24 Ga0068869_100152584 3300005334 Bacteria 1793
25 Ga0068869_100162601 3300005334 Bacteria 1739
26 Ga0068869_100214924 3300005334 Bacteria 1522
27 Ga0070666_10000774 3300005335 Bacteria 19349
28 Ga0070666_10001704 3300005335 Bacteria 13402
29 Ga0070666_10005640 3300005335 Bacteria 7678
30 Ga0070680_100086024 3300005336 Bacteria 2598
31 Ga0070680_100170045 3300005336 Bacteria 1833
32 Ga0070682_100054343 3300005337 Bacteria 2512
33 Ga0068868_100001787 3300005338 Bacteria 14747
34 Ga0068868_100044081 3300005338 Bacteria 3487
35 Ga0068868_100081007 3300005338 Bacteria 2602
36 Ga0068868_100136300 3300005338 Bacteria 2012
37 Ga0068868_100189384 3300005338 Bacteria 1710
38 Ga0070660_100008470 3300005339 Bacteria 7194
39 Ga0070660_100010171 3300005339 Bacteria 6640
40 Ga0070660_100015683 3300005339 Bacteria 5478
41 Ga0070660_100031943 3300005339 Bacteria 3959
42 Ga0070660_100096643 3300005339 Bacteria 2336
43 Ga0070660_100219837 3300005339 Bacteria 1544
44 Ga0070660_100280309 3300005339 Bacteria 1364
45 Ga0070660_100280723 3300005339 Bacteria 1363
46 Ga0070689_100001865 3300005340 Bacteria 13584
47 Ga0070689_100064761 3300005340 Bacteria 2846
48 Ga0070689_100108700 3300005340 Bacteria 2203
49 Ga0070687_100074952 3300005343 Bacteria 1828
50 Ga0070661_100000486 3300005344 Bacteria 30405
51 Ga0070661_100002576 3300005344 Bacteria 12431
52 Ga0070661_100004760 3300005344 Bacteria 9341
53 Ga0070661_100008317 3300005344 Bacteria 7167
54 Ga0070661_100023250 3300005344 Bacteria 4441
55 Ga0070661_100064312 3300005344 Bacteria 2696
56 Ga0070661_100090669 3300005344 Bacteria 2264
57 Ga0070668_100001121 3300005347 Bacteria 18870
58 Ga0070668_100001538 3300005347 Bacteria 16641
59 Ga0070668_100001746 3300005347 Bacteria 15817
60 Ga0070668_100006569 3300005347 Bacteria 8613
61 Ga0070668_100007313 3300005347 Bacteria 8190
62 Ga0070668_100071300 3300005347 Bacteria 2706
63 Ga0070668_100196338 3300005347 Bacteria 1655
64 Ga0070669_100014524 3300005353 Bacteria 5601
65 Ga0070669_100035008 3300005353 Bacteria 3636
66 Ga0070669_100051179 3300005353 Bacteria 3018
67 Ga0070669_100147678 3300005353 Bacteria 1817
68 Ga0070669_100164569 3300005353 Bacteria 1726
69 Ga0070675_100001675 3300005354 Bacteria 16337
70 Ga0070675_100004036 3300005354 Bacteria 11141
71 Ga0070675_100202401 3300005354 Bacteria 1723
72 Ga0070671_100000564 3300005355 Bacteria 26255
73 Ga0070671_100005329 3300005355 Bacteria 10260
74 Ga0070671_100014880 3300005355 Bacteria 6287
75 Ga0070671_100022630 3300005355 Bacteria 5134
76 Ga0070671_100167950 3300005355 Bacteria 1855
77 Ga0070671_100177322 3300005355 Bacteria 1804
78 Ga0070674_100000536 3300005356 Bacteria 19089
79 Ga0070674_100006377 3300005356 Bacteria 6879
80 Ga0070674_100195196 3300005356 Bacteria 1559
81 Ga0070673_100001471 3300005364 Bacteria 13789
82 Ga0070673_100001499 3300005364 Bacteria 13706
83 Ga0070673_100004988 3300005364 Bacteria 8464
84 Ga0070673_100060747 3300005364 Bacteria 2996
85 Ga0070673_100211976 3300005364 Bacteria 1673
86 Ga0070673_100284724 3300005364 Bacteria 1451
87 Ga0070688_100001931 3300005365 Bacteria 10410
88 Ga0070688_100017316 3300005365 Bacteria 4134
89 Ga0070688_100123425 3300005365 Bacteria 1738
90 Ga0070688_100162213 3300005365 Bacteria 1536
91 Ga0070659_100002814 3300005366 Bacteria 12387
92 Ga0070659_100021771 3300005366 Bacteria 4887
93 Ga0070659_100070700 3300005366 Bacteria 2773
94 Ga0070659_100071020 3300005366 Bacteria 2767
95 Ga0070659_100146538 3300005366 Bacteria 1924
96 Ga0070659_100162190 3300005366 Bacteria 1828
97 Ga0070659_100177741 3300005366 Bacteria 1746
98 Ga0070659_100322161 3300005366 Bacteria 1292
99 Ga0070667_100000863 3300005367 Bacteria 28131
100 Ga0070667_100002948 3300005367 Bacteria 14624
101 Ga0070667_100101410 3300005367 Bacteria 2486
102 Ga0070667_100104911 3300005367 Bacteria 2445
103 Ga0070667_100106245 3300005367 Bacteria 2430
104 Ga0070667_100107754 3300005367 Bacteria 2413
105 Ga0070667_100168479 3300005367 Bacteria 1932
106 Ga0070667_100277606 3300005367 Bacteria 1504
107 Ga0070709_10037095 3300005434 Bacteria 2974
108 Ga0070714_100003499 3300005435 Bacteria 11715
109 Ga0070714_100394505 3300005435 Bacteria 1307
110 Ga0070713_100000853 3300005436 Bacteria 19545
111 Ga0070713_100006960 3300005436 Bacteria 7895
112 Ga0070713_100016724 3300005436 Bacteria 5522
113 Ga0070710_10021886 3300005437 Bacteria 3337
114 Ga0070711_100010124 3300005439 Bacteria 5826
115 Ga0070705_100027467 3300005440 Bacteria 3108
116 Ga0070700_100005754 3300005441 Bacteria 6579
117 Ga0070700_100072465 3300005441 Bacteria 2202
118 Ga0070694_100071367 3300005444 Bacteria 2393
119 Ga0070694_100116447 3300005444 Bacteria 1911
120 Ga0070708_100120336 3300005445 Bacteria 2422
121 Ga0070663_100039170 3300005455 Bacteria 3311
122 Ga0070663_100114377 3300005455 Bacteria 2032
123 Ga0070678_100000428 3300005456 Bacteria 19876
124 Ga0070678_100024746 3300005456 Bacteria 4025
125 Ga0070678_100037493 3300005456 Bacteria 3405
126 Ga0070678_100292715 3300005456 Bacteria 1381
127 Ga0070662_100012355 3300005457 Bacteria 5661
128 Ga0070662_100014943 3300005457 Bacteria 5191
129 Ga0070662_100040507 3300005457 Bacteria 3317
130 Ga0070662_100156813 3300005457 Bacteria 1778
131 Ga0070681_10003494 3300005458 Bacteria 14713
132 Ga0070681_10007813 3300005458 Bacteria 10462
133 Ga0070681_10022742 3300005458 Bacteria 6300
134 Ga0070681_10157812 3300005458 Bacteria 2193
135 Ga0070681_10270679 3300005458 Bacteria 1610
136 Ga0068867_100003381 3300005459 Bacteria 11224
137 Ga0068867_100011744 3300005459 Bacteria 6185
138 Ga0068867_100017233 3300005459 Bacteria 5131
139 Ga0068867_100139599 3300005459 Bacteria 1893
140 Ga0070685_10141158 3300005466 Bacteria 1517
141 Ga0070706_100009375 3300005467 Bacteria 9113
142 Ga0070706_100018225 3300005467 Bacteria 6478
143 Ga0070706_100022655 3300005467 Bacteria 5783
144 Ga0070706_100079995 3300005467 Bacteria 3026
145 Ga0070707_100015911 3300005468 Bacteria 7061
146 Ga0070707_100039220 3300005468 Bacteria 4526
147 Ga0070707_100044145 3300005468 Bacteria 4266
148 Ga0070707_100130285 3300005468 Bacteria 2446
149 Ga0070707_100138387 3300005468 Bacteria 2369
150 Ga0070707_100175192 3300005468 Bacteria 2091
151 Ga0070698_100043258 3300005471 Bacteria 4619
152 Ga0070699_100020295 3300005518 Bacteria 5730
153 Ga0070699_100328116 3300005518 Bacteria 1376
154 Ga0070679_100033388 3300005530 Bacteria 5096
155 Ga0070679_100049459 3300005530 Bacteria 4187
156 Ga0070679_100315167 3300005530 Bacteria 1514
157 Ga0070684_100013991 3300005535 Bacteria 6487
158 Ga0070684_100140760 3300005535 Bacteria 2182
159 Ga0070684_100166102 3300005535 Bacteria 2003
160 Ga0070697_100066453 3300005536 Bacteria 2948
161 Ga0070697_100129359 3300005536 Bacteria 2117
162 Ga0070697_100178686 3300005536 Bacteria 1798
163 Ga0068853_100031441 3300005539 Bacteria 4490
164 Ga0068853_100045026 3300005539 Bacteria 3779
165 Ga0068853_100051879 3300005539 Bacteria 3532
166 Ga0068853_100126441 3300005539 Bacteria 2284
167 Ga0070672_100004110 3300005543 Bacteria 9501
168 Ga0070672_100011327 3300005543 Bacteria 6221
169 Ga0070672_100145533 3300005543 Bacteria 1958
170 Ga0070672_100186266 3300005543 Bacteria 1731
171 Ga0070686_100089558 3300005544 Bacteria 2056
172 Ga0070686_100096000 3300005544 Bacteria 1993
173 Ga0070686_100099309 3300005544 Bacteria 1964
174 Ga0070695_100013699 3300005545 Bacteria 4874
175 Ga0070695_100030795 3300005545 Bacteria 3341
176 Ga0070696_100005910 3300005546 Bacteria 8171
177 Ga0070696_100032438 3300005546 Bacteria 3583
178 Ga0070696_100063601 3300005546 Bacteria 2585
179 Ga0070696_100160214 3300005546 Bacteria 1657
180 Ga0070696_100163669 3300005546 Bacteria 1640
181 Ga0070693_100000378 3300005547 Bacteria 20172
182 Ga0070665_100003863 3300005548 Bacteria 15852
183 Ga0070665_100005926 3300005548 Bacteria 12520
184 Ga0070665_100030720 3300005548 Bacteria 5405
185 Ga0070665_100073966 3300005548 Bacteria 3413
186 Ga0070665_100308078 3300005548 Bacteria 1587
187 Ga0070704_100015536 3300005549 Bacteria 4785
188 Ga0068855_100038385 3300005563 Bacteria 5691
189 Ga0068855_100039133 3300005563 Bacteria 5629
190 Ga0068855_100050332 3300005563 Bacteria 4910
191 Ga0068855_100059170 3300005563 Bacteria 4484
192 Ga0068855_100106814 3300005563 Bacteria 3217
193 Ga0068855_100194206 3300005563 Bacteria 2288
194 Ga0068855_100201114 3300005563 Bacteria 2242
195 Ga0068855_100438595 3300005563 Bacteria 1427
196 Ga0070664_100005958 3300005564 Bacteria 9851
197 Ga0070664_100009645 3300005564 Bacteria 7833
198 Ga0070664_100022299 3300005564 Bacteria 5221
199 Ga0070664_100032335 3300005564 Bacteria 4375
200 Ga0070664_100037072 3300005564 Bacteria 4097
201 Ga0070664_100117042 3300005564 Bacteria 2331
202 Ga0070664_100206990 3300005564 Bacteria 1752
203 Ga0070664_100323360 3300005564 Bacteria 1398
204 Ga0068857_100018143 3300005577 Bacteria 6172
205 Ga0068857_100019755 3300005577 Bacteria 5918
206 Ga0068854_100006946 3300005578 Bacteria 7220
207 Ga0068854_100015337 3300005578 Bacteria 5073
208 Ga0068854_100024845 3300005578 Bacteria 4107
209 Ga0068854_100069798 3300005578 Bacteria 2567
210 Ga0068854_100184510 3300005578 Bacteria 1631
211 Ga0068856_100002081 3300005614 Bacteria 20767
212 Ga0068856_100003025 3300005614 Bacteria 17229
213 Ga0068856_100006440 3300005614 Bacteria 11516
214 Ga0068856_100010386 3300005614 Bacteria 9043
215 Ga0068856_100050306 3300005614 Bacteria 4108
216 Ga0068856_100051117 3300005614 Bacteria 4076
217 Ga0070702_100030449 3300005615 Bacteria 2942
218 Ga0070702_100046528 3300005615 Bacteria 2459
219 Ga0070702_100098242 3300005615 Bacteria 1791
220 Ga0068852_100002732 3300005616 Bacteria 12206
221 Ga0068852_100003279 3300005616 Bacteria 11295
222 Ga0068852_100019123 3300005616 Bacteria 5414
223 Ga0068859_100000594 3300005617 Bacteria 36146
224 Ga0068859_100002773 3300005617 Bacteria 17745
225 Ga0068859_100015281 3300005617 Bacteria 7710
226 Ga0068859_100116149 3300005617 Bacteria 2740
227 Ga0068864_100001433 3300005618 Bacteria 19672
228 Ga0068864_100002465 3300005618 Bacteria 15280
229 Ga0068864_100007105 3300005618 Bacteria 9196
230 Ga0068864_100017132 3300005618 Bacteria 6043
231 Ga0068864_100018403 3300005618 Bacteria 5837
232 Ga0068864_100083623 3300005618 Bacteria 2803
233 Ga0068864_100133674 3300005618 Bacteria 2231
234 Ga0068866_10016847 3300005718 Bacteria 3275
235 Ga0068861_100000705 3300005719 Bacteria 19969
236 Ga0068861_100020915 3300005719 Bacteria 4696
237 Ga0068861_100271443 3300005719 Bacteria 1456
238 Ga0068851_10001640 3300005834 Bacteria 9817
239 Ga0068851_10037711 3300005834 Bacteria 2423
240 Ga0068851_10100016 3300005834 Bacteria 1537
241 Ga0068870_10038881 3300005840 Bacteria 2459
242 Ga0068870_10058606 3300005840 Bacteria 2062
243 Ga0068863_100002710 3300005841 Bacteria 17495
244 Ga0068863_100004302 3300005841 Bacteria 14024
245 Ga0068863_100008973 3300005841 Bacteria 9765
246 Ga0068863_100015542 3300005841 Bacteria 7312
247 Ga0068863_100212633 3300005841 Bacteria 1862
248 Ga0068863_100216006 3300005841 Bacteria 1847
249 Ga0068858_100006368 3300005842 Bacteria 11495
250 Ga0068858_100031566 3300005842 Bacteria 4921
251 Ga0068858_100042025 3300005842 Bacteria 4238
252 Ga0068858_100072444 3300005842 Bacteria 3196
253 Ga0068858_100182551 3300005842 Bacteria 1981
254 Ga0068860_100024779 3300005843 Bacteria 5795
255 Ga0068860_100036963 3300005843 Bacteria 4675
256 Ga0068860_100053257 3300005843 Bacteria 3848
257 Ga0068860_100065334 3300005843 Bacteria 3455
258 Ga0068860_100077094 3300005843 Bacteria 3169
259 Ga0068860_100093577 3300005843 Bacteria 2864
260 Ga0068860_100206852 3300005843 Bacteria 1903
261 Ga0068862_100005456 3300005844 Bacteria 10626
262 Ga0068862_100055523 3300005844 Bacteria 3392
263 Ga0068862_100183721 3300005844 Bacteria 1878
264 Ga0081539_10042797 3300005985 Bacteria 2633
265 Ga0075365_10032640 3300006038 Bacteria 3349
266 Ga0075368_10005372 3300006042 Bacteria 4404
267 Ga0070716_100032117 3300006173 Bacteria 2860
268 Ga0070716_100060768 3300006173 Bacteria 2184
269 Ga0070712_100059884 3300006175 Bacteria 2683
270 Ga0070712_100096413 3300006175 Bacteria 2178
271 Ga0075367_10002132 3300006178 Bacteria 8907
272 Ga0075369_10000546 3300006186 Bacteria 11862
273 Ga0075366_10010257 3300006195 Bacteria 5255
274 Ga0075366_10029099 3300006195 Bacteria 3244
275 Ga0097621_100013194 3300006237 Bacteria 6148
276 Ga0097621_100056010 3300006237 Bacteria 3220
277 Ga0097621_100117195 3300006237 Bacteria 2256
278 Ga0097621_100133217 3300006237 Bacteria 2117
279 Ga0097621_100138178 3300006237 Bacteria 2080
280 Ga0068871_100004698 3300006358 Bacteria 9549
281 Ga0068871_100071275 3300006358 Bacteria 2858
282 Ga0068871_100084361 3300006358 Bacteria 2636
283 Ga0068871_100142392 3300006358 Bacteria 2039
284 Ga0068871_100258476 3300006358 Bacteria 1518
285 Ga0068871_100258510 3300006358 Bacteria 1518
286 Ga0075428_100002887 3300006844 Bacteria 18709
287 Ga0075428_100267822 3300006844 Bacteria 1838
288 Ga0075430_100134415 3300006846 Bacteria 2061
289 Ga0075434_100000306 3300006871 Bacteria 34874
290 Ga0075434_100030898 3300006871 Bacteria 5278
291 Ga0075434_100088450 3300006871 Bacteria 3099
292 Ga0075434_100174691 3300006871 Bacteria 2168
293 Ga0075434_100321121 3300006871 Bacteria 1569
294 Ga0075429_100033953 3300006880 Bacteria 4433
295 Ga0068865_100061221 3300006881 Bacteria 2638
296 Ga0068865_100079218 3300006881 Bacteria 2352
297 Ga0068865_100130768 3300006881 Bacteria 1880
298 Ga0068865_100162841 3300006881 Bacteria 1703
299 Ga0075436_100152988 3300006914 Bacteria 1624
300 Ga0097620_100000594 3300006931 Bacteria 36146
301 Ga0097620_100002774 3300006931 Bacteria 17745
302 Ga0097620_100015279 3300006931 Bacteria 7710
303 Ga0097620_100116144 3300006931 Bacteria 2740
304 Ga0075435_100039517 3300007076 Bacteria 3765
305 Ga0075435_100040195 3300007076 Bacteria 3734
306 Ga0075435_100148515 3300007076 Bacteria 1970
307 Ga0099794_10122638 3300007265 Bacteria 1308
308 Ga0105240_10018384 3300009093 Bacteria 9386
309 Ga0105240_10020207 3300009093 Bacteria 8890
310 Ga0105240_10028464 3300009093 Bacteria 7299
311 Ga0111539_10000957 3300009094 Bacteria 37861
312 Ga0111539_10039536 3300009094 Bacteria 5684
313 Ga0111539_10057738 3300009094 Bacteria 4608
314 Ga0111539_10060204 3300009094 Bacteria 4500
315 Ga0105245_10010967 3300009098 Bacteria 7886
316 Ga0105245_10032337 3300009098 Bacteria 4632
317 Ga0105245_10050485 3300009098 Bacteria 3728
318 Ga0105245_10335906 3300009098 Bacteria 1493
319 Ga0105247_10007921 3300009101 Bacteria 6496
320 Ga0114129_10232513 3300009147 Bacteria 2482
321 Ga0114129_10240327 3300009147 Bacteria 2434
322 Ga0114129_10444982 3300009147 Bacteria 1700
323 Ga0114129_10726224 3300009147 Bacteria 1274
324 Ga0105241_10220027 3300009174 Bacteria 1595
325 Ga0105242_10024661 3300009176 Bacteria 4751
326 Ga0105242_10213435 3300009176 Bacteria 1721
327 Ga0105242_10309544 3300009176 Bacteria 1445
328 Ga0105248_10001225 3300009177 Bacteria 28644
329 Ga0105248_10135388 3300009177 Bacteria 2779
330 Ga0105248_10265962 3300009177 Bacteria 1930
331 Ga0105237_10105489 3300009545 Bacteria 2809
332 Ga0105237_10220558 3300009545 Bacteria 1896
333 Ga0105237_10252110 3300009545 Bacteria 1767
334 Ga0105238_10008927 3300009551 Bacteria 10033
335 Ga0105238_10039286 3300009551 Bacteria 4798
336 Ga0105238_10196799 3300009551 Bacteria 1991
337 Ga0105238_10303709 3300009551 Bacteria 1580
338 Ga0105249_10066620 3300009553 Bacteria 3316
339 Ga0105249_10092876 3300009553 Bacteria 2826
340 Ga0105249_10231855 3300009553 Bacteria 1821
341 Ga0105239_10070454 3300010375 Bacteria 3841
342 Ga0105239_10113547 3300010375 Bacteria 3004
343 Ga0105239_10152195 3300010375 Bacteria 2582
344 Ga0105239_10527065 3300010375 Bacteria 1344
345 Ga0105246_10040771 3300011119 Bacteria 3135
346 Ga0157373_10001379 3300013100 Bacteria 18633
347 Ga0157373_10015272 3300013100 Bacteria 5613
348 Ga0157373_10019295 3300013100 Bacteria 4966
349 Ga0157373_10189553 3300013100 Bacteria 1449
350 Ga0157371_10005607 3300013102 Bacteria 10554
351 Ga0157371_10106698 3300013102 Bacteria 1988
352 Ga0157371_10179597 3300013102 Bacteria 1514
353 Ga0157370_10002935 3300013104 Bacteria 20300
354 Ga0157370_10013191 3300013104 Bacteria 8522
355 Ga0157370_10014097 3300013104 Bacteria 8199
356 Ga0157370_10020764 3300013104 Bacteria 6554
357 Ga0157370_10032253 3300013104 Bacteria 5116
358 Ga0157370_10056890 3300013104 Bacteria 3721
359 Ga0157370_10143469 3300013104 Bacteria 2224
360 Ga0157370_10266230 3300013104 Bacteria 1584
361 Ga0157369_10005349 3300013105 Bacteria 14960
362 Ga0157369_10040426 3300013105 Bacteria 5091
363 Ga0157369_10213141 3300013105 Bacteria 2024
364 Ga0157369_10461971 3300013105 Bacteria 1314
365 Ga0157374_10000924 3300013296 Bacteria 25554
366 Ga0157374_10005165 3300013296 Bacteria 10949
367 Ga0157374_10021418 3300013296 Bacteria 5752
368 Ga0157374_10080988 3300013296 Bacteria 3081
369 Ga0157374_10179947 3300013296 Bacteria 2065
370 Ga0157374_10184643 3300013296 Bacteria 2038
371 Ga0157378_10004871 3300013297 Bacteria 11773
372 Ga0157378_10052080 3300013297 Bacteria 3642
373 Ga0157378_10191448 3300013297 Bacteria 1929
374 Ga0157378_10208896 3300013297 Bacteria 1850
375 Ga0157378_10379672 3300013297 Bacteria 1387
376 Ga0163162_10004885 3300013306 Bacteria 12926
377 Ga0163162_10041348 3300013306 Bacteria 4612
378 Ga0163162_10059011 3300013306 Bacteria 3868
379 Ga0163162_10115317 3300013306 Bacteria 2786
380 Ga0163162_10136132 3300013306 Bacteria 2567
381 Ga0157372_10001772 3300013307 Bacteria 23417
382 Ga0157372_10015325 3300013307 Bacteria 8214
383 Ga0157372_10018658 3300013307 Bacteria 7462
384 Ga0157372_10139004 3300013307 Bacteria 2797
385 Ga0157372_10194792 3300013307 Bacteria 2348
386 Ga0157372_10349325 3300013307 Bacteria 1723
387 Ga0157375_10004384 3300013308 Bacteria 12257
388 Ga0157375_10106761 3300013308 Bacteria 2892
389 Ga0157375_10385748 3300013308 Bacteria 1568
390 Ga0157375_10455019 3300013308 Bacteria 1445
391 Ga0163163_10229130 3300014325 Bacteria 1907
392 Ga0163163_10229622 3300014325 Bacteria 1905
393 Ga0157380_10085349 3300014326 Bacteria 2591
394 Ga0157380_10095741 3300014326 Bacteria 2460
395 Ga0157380_10399210 3300014326 Bacteria 1304
396 Ga0157377_10009541 3300014745 Bacteria 4767
397 Ga0157377_10251800 3300014745 Bacteria 1145
398 Ga0157379_10001374 3300014968 Bacteria 19913
399 Ga0157379_10011623 3300014968 Bacteria 7686
400 Ga0157379_10012130 3300014968 Bacteria 7526
401 Ga0157379_10017214 3300014968 Bacteria 6367
402 Ga0157379_10059206 3300014968 Bacteria 3425
403 Ga0157379_10093104 3300014968 Bacteria 2704
404 Ga0157379_10115348 3300014968 Bacteria 2415
405 Ga0157376_10021708 3300014969 Bacteria 4990
406 Ga0157376_10028228 3300014969 Bacteria 4458
407 Ga0157376_10047180 3300014969 Bacteria 3555
408 Ga0157376_10273364 3300014969 Bacteria 1588
409 Ga0163161_10053766 3300017792 Bacteria 2921
410 Ga0163161_10057587 3300017792 Bacteria 2823
411 Ga0163161_10091122 3300017792 Bacteria 2256
412 Ga0163161_10120716 3300017792 Bacteria 1969
413 Ga0206356_11461543 3300020070 Bacteria 2998
414 Ga0206353_10236115 3300020082 Bacteria 1445
415 Ga0213872_10000333 3300021361 Bacteria 40014
416 Ga0213872_10002733 3300021361 Bacteria 10128
417 Ga0213872_10004503 3300021361 Bacteria 7382
418 Ga0207697_10001482 3300025315 Bacteria 12807
419 Ga0207697_10007231 3300025315 Bacteria 4961
420 Ga0207697_10020055 3300025315 Bacteria 2738
421 Ga0207682_10000993 3300025893 Bacteria 13099
422 Ga0207682_10001318 3300025893 Bacteria 11412
423 Ga0207682_10007381 3300025893 Bacteria 4382
424 Ga0207692_10041356 3300025898 Bacteria 2281
425 Ga0207642_10008244 3300025899 Bacteria 3563
426 Ga0207688_10006119 3300025901 Bacteria 6549
427 Ga0207688_10041079 3300025901 Bacteria 2571
428 Ga0207680_10004681 3300025903 Bacteria 6499
429 Ga0207680_10078757 3300025903 Bacteria 2065
430 Ga0207680_10142648 3300025903 Bacteria 1589
431 Ga0207645_10000039 3300025907 Bacteria 88205
432 Ga0207645_10000331 3300025907 Bacteria 39499
433 Ga0207645_10007484 3300025907 Bacteria 7707
434 Ga0207645_10020552 3300025907 Bacteria 4321
435 Ga0207645_10059692 3300025907 Bacteria 2436
436 Ga0207643_10001108 3300025908 Bacteria 15982
437 Ga0207643_10003518 3300025908 Bacteria 8424
438 Ga0207643_10111769 3300025908 Bacteria 1610
439 Ga0207705_10114288 3300025909 Bacteria 1997
440 Ga0207705_10128151 3300025909 Bacteria 1887
441 Ga0207705_10190102 3300025909 Bacteria 1552
442 Ga0207705_10190370 3300025909 Bacteria 1551
443 Ga0207684_10046819 3300025910 Bacteria 3669
444 Ga0207684_10102396 3300025910 Bacteria 2448
445 Ga0207654_10060700 3300025911 Bacteria 2210
446 Ga0207654_10145140 3300025911 Bacteria 1518
447 Ga0207707_10008263 3300025912 Bacteria 9037
448 Ga0207707_10046343 3300025912 Bacteria 3786
449 Ga0207707_10058381 3300025912 Bacteria 3358
450 Ga0207707_10069403 3300025912 Bacteria 3071
451 Ga0207707_10139098 3300025912 Bacteria 2123
452 Ga0207707_10144033 3300025912 Bacteria 2083
453 Ga0207695_10074196 3300025913 Bacteria 3464
454 Ga0207695_10167310 3300025913 Bacteria 2126
455 Ga0207693_10000397 3300025915 Bacteria 40037
456 Ga0207693_10027063 3300025915 Bacteria 4535
457 Ga0207693_10091135 3300025915 Bacteria 2390
458 Ga0207663_10028987 3300025916 Bacteria 3246
459 Ga0207660_10022105 3300025917 Bacteria 4283
460 Ga0207660_10095518 3300025917 Bacteria 2212
461 Ga0207660_10176845 3300025917 Bacteria 1655
462 Ga0207662_10065329 3300025918 Bacteria 2191
463 Ga0207662_10096349 3300025918 Bacteria 1828
464 Ga0207657_10000394 3300025919 Bacteria 46090
465 Ga0207657_10001000 3300025919 Bacteria 30068
466 Ga0207657_10014530 3300025919 Bacteria 7677
467 Ga0207657_10032471 3300025919 Bacteria 4716
468 Ga0207657_10119234 3300025919 Bacteria 2171
469 Ga0207657_10125730 3300025919 Bacteria 2106
470 Ga0207649_10006345 3300025920 Bacteria 6427
471 Ga0207652_10009287 3300025921 Bacteria 7905
472 Ga0207652_10018041 3300025921 Bacteria 5785
473 Ga0207646_10018213 3300025922 Bacteria 6555
474 Ga0207646_10037198 3300025922 Bacteria 4389
475 Ga0207681_10002345 3300025923 Bacteria 12049
476 Ga0207681_10011778 3300025923 Bacteria 5379
477 Ga0207681_10049092 3300025923 Bacteria 2851
478 Ga0207694_10014534 3300025924 Bacteria 5936
479 Ga0207694_10021564 3300025924 Bacteria 4881
480 Ga0207650_10001745 3300025925 Bacteria 15450
481 Ga0207650_10026853 3300025925 Bacteria 4114
482 Ga0207650_10034273 3300025925 Bacteria 3681
483 Ga0207650_10044835 3300025925 Bacteria 3251
484 Ga0207650_10056570 3300025925 Bacteria 2915
485 Ga0207650_10057719 3300025925 Bacteria 2888
486 Ga0207650_10061300 3300025925 Bacteria 2808
487 Ga0207650_10274402 3300025925 Bacteria 1371
488 Ga0207659_10014770 3300025926 Bacteria 5046
489 Ga0207659_10026217 3300025926 Bacteria 3930
490 Ga0207659_10084411 3300025926 Bacteria 2356
491 Ga0207659_10161435 3300025926 Bacteria 1760
492 Ga0207687_10000188 3300025927 Bacteria 41329
493 Ga0207687_10007739 3300025927 Bacteria 7050
494 Ga0207700_10000074 3300025928 Bacteria 61772
495 Ga0207700_10010760 3300025928 Bacteria 5796
496 Ga0207700_10029252 3300025928 Bacteria 3885
497 Ga0207700_10037722 3300025928 Bacteria 3502
498 Ga0207664_10001185 3300025929 Bacteria 17338
499 Ga0207664_10049607 3300025929 Bacteria 3306
500 Ga0207664_10072300 3300025929 Bacteria 2780
501 Ga0207644_10003932 3300025931 Bacteria 9638
502 Ga0207644_10008387 3300025931 Bacteria 6762
503 Ga0207644_10011828 3300025931 Bacteria 5780
504 Ga0207644_10038706 3300025931 Bacteria 3361
505 Ga0207644_10143201 3300025931 Bacteria 1843
506 Ga0207690_10017644 3300025932 Bacteria 4364
507 Ga0207690_10158258 3300025932 Bacteria 1686
508 Ga0207690_10265407 3300025932 Bacteria 1332
509 Ga0207706_10000854 3300025933 Bacteria 31369
510 Ga0207706_10002859 3300025933 Bacteria 16752
511 Ga0207706_10007248 3300025933 Bacteria 10252
512 Ga0207706_10015396 3300025933 Bacteria 6909
513 Ga0207706_10048226 3300025933 Bacteria 3767
514 Ga0207706_10184716 3300025933 Bacteria 1831
515 Ga0207706_10294380 3300025933 Bacteria 1415
516 Ga0207706_10332238 3300025933 Bacteria 1322
517 Ga0207686_10000211 3300025934 Bacteria 44316
518 Ga0207686_10149671 3300025934 Bacteria 1623
519 Ga0207709_10031657 3300025935 Bacteria 3092
520 Ga0207670_10129669 3300025936 Bacteria 1845
521 Ga0207670_10136754 3300025936 Bacteria 1802
522 Ga0207669_10002807 3300025937 Bacteria 7460
523 Ga0207669_10055040 3300025937 Bacteria 2407
524 Ga0207669_10111983 3300025937 Bacteria 1831
525 Ga0207669_10186463 3300025937 Bacteria 1492
526 Ga0207704_10019141 3300025938 Bacteria 3590
527 Ga0207704_10064358 3300025938 Bacteria 2291
528 Ga0207665_10054762 3300025939 Bacteria 2691
529 Ga0207665_10126862 3300025939 Bacteria 1808
530 Ga0207691_10000027 3300025940 Bacteria 126502
531 Ga0207691_10000122 3300025940 Bacteria 70474
532 Ga0207691_10000772 3300025940 Bacteria 31685
533 Ga0207691_10100924 3300025940 Bacteria 2575
534 Ga0207711_10000116 3300025941 Bacteria 83390
535 Ga0207711_10036322 3300025941 Bacteria 4181
536 Ga0207711_10138857 3300025941 Bacteria 2185
537 Ga0207689_10000548 3300025942 Bacteria 35796
538 Ga0207689_10001927 3300025942 Bacteria 19632
539 Ga0207689_10006355 3300025942 Bacteria 10463
540 Ga0207689_10008896 3300025942 Bacteria 8710
541 Ga0207689_10040830 3300025942 Bacteria 3839
542 Ga0207689_10085284 3300025942 Bacteria 2596
543 Ga0207661_10010299 3300025944 Bacteria 6725
544 Ga0207661_10178940 3300025944 Bacteria 1851
545 Ga0207679_10015734 3300025945 Bacteria 5009
546 Ga0207679_10078160 3300025945 Bacteria 2520
547 Ga0207679_10251969 3300025945 Bacteria 1501
548 Ga0207679_10268270 3300025945 Bacteria 1459
549 Ga0207679_10279485 3300025945 Bacteria 1431
550 Ga0207679_10324702 3300025945 Bacteria 1334
551 Ga0207667_10002343 3300025949 Bacteria 23727
552 Ga0207667_10094773 3300025949 Bacteria 3082
553 Ga0207667_10204862 3300025949 Bacteria 2023
554 Ga0207667_10214468 3300025949 Bacteria 1973
555 Ga0207651_10044425 3300025960 Bacteria 2973
556 Ga0207651_10161962 3300025960 Bacteria 1755
557 Ga0207651_10329329 3300025960 Bacteria 1279
558 Ga0207712_10085235 3300025961 Bacteria 2311
559 Ga0207712_10192494 3300025961 Bacteria 1611
560 Ga0207668_10002876 3300025972 Bacteria 10102
561 Ga0207668_10005221 3300025972 Bacteria 7644
562 Ga0207668_10018007 3300025972 Bacteria 4436
563 Ga0207640_10008758 3300025981 Bacteria 5631
564 Ga0207640_10049870 3300025981 Bacteria 2713
565 Ga0207640_10072147 3300025981 Bacteria 2328
566 Ga0207640_10182049 3300025981 Bacteria 1576
567 Ga0207658_10012633 3300025986 Bacteria 5766
568 Ga0207658_10013907 3300025986 Bacteria 5507
569 Ga0207658_10013937 3300025986 Bacteria 5501
570 Ga0207658_10019542 3300025986 Bacteria 4686
571 Ga0207658_10071368 3300025986 Bacteria 2629
572 Ga0207658_10181302 3300025986 Bacteria 1743
573 Ga0207658_10437021 3300025986 Bacteria 1156
574 Ga0207677_10000598 3300026023 Bacteria 22232
575 Ga0207677_10018321 3300026023 Bacteria 4199
576 Ga0207677_10036280 3300026023 Bacteria 3212
577 Ga0207677_10058229 3300026023 Bacteria 2659
578 Ga0207677_10065700 3300026023 Bacteria 2532
579 Ga0207677_10072764 3300026023 Bacteria 2431
580 Ga0207677_10231064 3300026023 Bacteria 1490
581 Ga0207703_10000357 3300026035 Bacteria 49166
582 Ga0207703_10000746 3300026035 Bacteria 32065
583 Ga0207703_10024218 3300026035 Bacteria 4776
584 Ga0207703_10043079 3300026035 Bacteria 3621
585 Ga0207703_10128218 3300026035 Bacteria 2187
586 Ga0207639_10009491 3300026041 Bacteria 6716
587 Ga0207639_10029203 3300026041 Bacteria 4035
588 Ga0207678_10007312 3300026067 Bacteria 9785
589 Ga0207678_10011189 3300026067 Bacteria 7881
590 Ga0207678_10015432 3300026067 Bacteria 6716
591 Ga0207678_10082708 3300026067 Bacteria 2747
592 Ga0207678_10207134 3300026067 Bacteria 1678
593 Ga0207678_10208163 3300026067 Bacteria 1673
594 Ga0207708_10004145 3300026075 Bacteria 10665
595 Ga0207708_10007951 3300026075 Bacteria 7859
596 Ga0207708_10234001 3300026075 Bacteria 1476
597 Ga0207702_10003836 3300026078 Bacteria 13562
598 Ga0207702_10014082 3300026078 Bacteria 6641
599 Ga0207702_10029159 3300026078 Bacteria 4590
600 Ga0207702_10045737 3300026078 Bacteria 3682
601 Ga0207702_10049161 3300026078 Bacteria 3558
602 Ga0207702_10088947 3300026078 Bacteria 2700
603 Ga0207702_10146000 3300026078 Bacteria 2147
604 Ga0207641_10007190 3300026088 Bacteria 9281
605 Ga0207641_10009017 3300026088 Bacteria 8237
606 Ga0207641_10072505 3300026088 Bacteria 2966
607 Ga0207641_10125576 3300026088 Bacteria 2296
608 Ga0207641_10304927 3300026088 Bacteria 1505
609 Ga0207648_10000149 3300026089 Bacteria 70199
610 Ga0207648_10007044 3300026089 Bacteria 11113
611 Ga0207648_10014327 3300026089 Bacteria 7329
612 Ga0207648_10014574 3300026089 Bacteria 7260
613 Ga0207648_10017253 3300026089 Bacteria 6578
614 Ga0207648_10019771 3300026089 Bacteria 6077
615 Ga0207648_10023267 3300026089 Bacteria 5556
616 Ga0207648_10048131 3300026089 Bacteria 3734
617 Ga0207676_10000236 3300026095 Bacteria 48498
618 Ga0207676_10006704 3300026095 Bacteria 8145
619 Ga0207676_10012337 3300026095 Bacteria 6120
620 Ga0207674_10000694 3300026116 Bacteria 43838
621 Ga0207674_10001128 3300026116 Bacteria 34654
622 Ga0207674_10006144 3300026116 Bacteria 14184
623 Ga0207674_10022289 3300026116 Bacteria 6803
624 Ga0207674_10022536 3300026116 Bacteria 6761
625 Ga0207674_10026234 3300026116 Bacteria 6194
626 Ga0207674_10210919 3300026116 Bacteria 1891
627 Ga0207675_100000230 3300026118 Bacteria 52816
628 Ga0207675_100000871 3300026118 Bacteria 30087
629 Ga0207675_100002944 3300026118 Bacteria 16745
630 Ga0207675_100004627 3300026118 Bacteria 13261
631 Ga0207675_100030831 3300026118 Bacteria 4994
632 Ga0207683_10000005 3300026121 Bacteria 187889
633 Ga0207683_10000285 3300026121 Bacteria 45347
634 Ga0207683_10000364 3300026121 Bacteria 41505
635 Ga0207683_10004773 3300026121 Bacteria 11668
636 Ga0207683_10006165 3300026121 Bacteria 10276
637 Ga0207683_10015805 3300026121 Bacteria 6425
638 Ga0207683_10084179 3300026121 Bacteria 2827
639 Ga0207683_10321686 3300026121 Bacteria 1417
640 Ga0207698_10001960 3300026142 Bacteria 12097
641 Ga0207698_10021781 3300026142 Bacteria 4440
642 Ga0207698_10025539 3300026142 Bacteria 4164
643 Ga0207698_10341426 3300026142 Bacteria 1411
644 Ga0209969_1000136 3300027360 Bacteria 9537
645 Ga0209996_1002378 3300027395 Bacteria 2330
646 Ga0210000_1000292 3300027462 Bacteria 7188
647 Ga0209995_1011156 3300027471 Bacteria 1461
648 Ga0209983_1002782 3300027665 Bacteria 3788
649 Ga0209971_1007936 3300027682 Bacteria 2519
650 Ga0209813_10001571 3300027866 Bacteria 5126
651 Ga0209974_10000335 3300027876 Bacteria 15422
652 Ga0209974_10002039 3300027876 Bacteria 7374
653 Ga0209974_10007387 3300027876 Bacteria 3788
654 Ga0209974_10040668 3300027876 Bacteria 1548
655 Ga0207428_10011849 3300027907 Bacteria 7683
656 Ga0207428_10098368 3300027907 Bacteria 2264
657 Ga0268266_10008117 3300028379 Bacteria 9374
658 Ga0268266_10034562 3300028379 Bacteria 4299
659 Ga0268266_10213272 3300028379 Bacteria 1771
660 Ga0268266_10402793 3300028379 Bacteria 1294
661 Ga0268265_10005441 3300028380 Bacteria 8703
662 Ga0268265_10018470 3300028380 Bacteria 4833
663 Ga0268265_10047984 3300028380 Bacteria 3203
664 Ga0268264_10002371 3300028381 Bacteria 16625
665 Ga0268264_10013772 3300028381 Bacteria 6653
666 Ga0268264_10039446 3300028381 Bacteria 3902
667 Ga0268264_10044953 3300028381 Bacteria 3666
668 Ga0265324_10000001 3300029957 Bacteria 562975
669 Ga0265324_10004084 3300029957 Bacteria 6703
670 Ga0265330_10011554 3300031235 Bacteria 4138
671 Ga0265332_10083577 3300031238 Bacteria 1353
672 Ga0265328_10000020 3300031239 Bacteria 125715
673 Ga0265328_10003722 3300031239 Bacteria 6724
674 Ga0265328_10009523 3300031239 Bacteria 3951
675 Ga0265325_10000542 3300031241 Bacteria 27351
676 Ga0265325_10039496 3300031241 Bacteria 2485
677 Ga0265331_10000144 3300031250 Bacteria 92791
678 Ga0265331_10004577 3300031250 Bacteria 8610
679 Ga0265331_10012989 3300031250 Bacteria 4489
680 Ga0265331_10021602 3300031250 Bacteria 3291
681 Ga0265331_10028015 3300031250 Bacteria 2819
682 Ga0265331_10038261 3300031250 Bacteria 2346
683 Ga0265331_10062312 3300031250 Bacteria 1759
684 Ga0265331_10065006 3300031250 Bacteria 1716
685 Ga0265327_10000044 3300031251 Bacteria 284808
686 Ga0265327_10000136 3300031251 Bacteria 160868
687 Ga0265327_10000314 3300031251 Bacteria 92783
688 Ga0265327_10000475 3300031251 Bacteria 70831
689 Ga0265327_10000730 3300031251 Bacteria 51310
690 Ga0265327_10001767 3300031251 Bacteria 25537
691 Ga0265327_10006826 3300031251 Bacteria 8995
692 Ga0265327_10008949 3300031251 Bacteria 7339
693 Ga0265327_10013003 3300031251 Bacteria 5564
694 Ga0265327_10015340 3300031251 Bacteria 4953
695 Ga0265327_10071561 3300031251 Bacteria 1734
696 Ga0265316_10016572 3300031344 Bacteria 6388
697 Ga0265316_10224637 3300031344 Bacteria 1384
698 Ga0307408_100002911 3300031548 Bacteria 11869
699 Ga0307408_100057101 3300031548 Bacteria 2832
700 Ga0307408_100106422 3300031548 Bacteria 2146
701 Ga0316575_10000042 3300031665 Bacteria 31213
702 Ga0316579_10003975 3300031691 Bacteria 5828
703 Ga0316579_10010044 3300031691 Bacteria 3992
704 Ga0265314_10007067 3300031711 Bacteria 9799
705 Ga0265314_10111146 3300031711 Bacteria 1741
706 Ga0265314_10157317 3300031711 Bacteria 1386
707 Ga0316576_10048257 3300031727 Bacteria 3087
708 Ga0316578_10010133 3300031728 Bacteria 4878
709 Ga0307405_10003878 3300031731 Bacteria 6974
710 Ga0307405_10017485 3300031731 Bacteria 3935
711 Ga0316577_10003010 3300031733 Bacteria 8441
712 Ga0307413_10001237 3300031824 Bacteria 9496
713 Ga0307410_10009907 3300031852 Bacteria 5373
714 Ga0307410_10014406 3300031852 Bacteria 4651
715 Ga0307410_10137685 3300031852 Bacteria 1802
716 Ga0307406_10004415 3300031901 Bacteria 7650
717 Ga0307406_10034187 3300031901 Bacteria 3116
718 Ga0307407_10064001 3300031903 Bacteria 2159
719 Ga0307407_10112942 3300031903 Bacteria 1709
720 Ga0307412_10028767 3300031911 Bacteria 3481
721 Ga0307409_100029836 3300031995 Bacteria 3909
722 Ga0307409_100117877 3300031995 Bacteria 2241
723 Ga0307416_100035373 3300032002 Bacteria 3813
724 Ga0307414_10261984 3300032004 Bacteria 1443
725 Ga0307411_10000127 3300032005 Bacteria 23867
726 Ga0307411_10042097 3300032005 Bacteria 2911
727 Ga0307411_10358727 3300032005 Bacteria 1191
728 Ga0307415_100003315 3300032126 Bacteria 8174
729 Ga0316583_10008955 3300032133 Bacteria 3608
730 Ga0316583_10030946 3300032133 Bacteria 1905
731 Ga0316583_10048555 3300032133 Bacteria 1494
732 Ga0316585_10016146 3300032137 Bacteria 2246
733 Ga0316580_10018726 3300032139 Bacteria 2131
734 Ga0316593_10030950 3300032168 Bacteria 1740
735 Ga0316596_1002051 3300033541 Bacteria 4243
736 Ga0373928_0014325 3300035084 Bacteria 1602
737 Ga0373928_0052041 3300035084 Bacteria 970
738 Ga0373934_0000450 3300035086 Bacteria 14370
739 Ga0373952_0002096 3300035092 Bacteria 3588
740 Ga0373945_0042501 3300035116 Bacteria 1647
741 Ga0373953_0004449 3300035117 Bacteria 4470
742 Ga0373954_0000090 3300035118 Bacteria 31033
743 Ga0373956_0004386 3300035119 Bacteria 5651
744 Ga0373957_0004734 3300035120 Bacteria 4164
745 Ga0373943_0009829 3300035170 Bacteria 4283
746 Ga0373943_0038768 3300035170 Bacteria 2292
747 Ga0373946_0113841 3300035171 Bacteria 1227
748 Ga0316574_0001261 3300035398 Bacteria 11807
749 Ga0316574_0004450 3300035398 Bacteria 7347
750 Ga0316574_0033809 3300035398 Bacteria 3113
751 Ga0373935_0023065 3300035692 Bacteria 3822
752 Ga0373935_0256356 3300035692 Bacteria 1225
753 Ga0373927_0019318 3300035695 Bacteria 4469
754 Ga0373927_0030999 3300035695 Bacteria 3487
755 Ga0373927_0117713 3300035695 Bacteria 1733
756 Ga0373947_0038846 3300035725 Bacteria 2830
757 Ga0373947_0312313 3300035725 Bacteria 1050
758 Ga0373937_0031264 3300036401 Bacteria 4822
759 Ga0373937_0040788 3300036401 Bacteria 4232
760 Ga0373937_0125613 3300036401 Bacteria 2393
761 Ga0373937_0132013 3300036401 Bacteria 2333
762 Ga0373937_0168682 3300036401 Bacteria 2053
763 Ga0316582_0009509 3300036647 Bacteria 5279
764 Ga0316582_0055880 3300036647 Bacteria 2517
765 Ga0316584_0002039 3300036712 Bacteria 12637
766 Ga0316584_0004127 3300036712 Bacteria 9583
767 Ga0373925_0216161 3300037068 Bacteria 1529
768 Ga0373925_0395196 3300037068 Bacteria 1127
769 Ga0395899_0214769 3300037312 Bacteria 1335
770 Ga0395900_0099978 3300037418 Bacteria 2979
771 Ga0395900_0395256 3300037418 Bacteria 1348
772 Ga0395901_0040793 3300038443 Bacteria 4808
773 Ga0400483_128908 3300039062 Bacteria 1812
774 Ga0436361_0060436 3300039447 Bacteria 2382
775 Ga0436361_0235627 3300039447 Bacteria 11028
776 Ga0436361_0891393 3300039447 Bacteria 99242
777 Ga0451807_0812292 3300041486 Bacteria 4489
778 Ga0451853_2089945 3300041512 Bacteria 2193
779 Ga0439441_001329 3300042001 Bacteria 3190
780 Ga0439455_0050163 3300042012 Bacteria 1089
781 Ga0451577_0000002 3300042876 Bacteria 1731375
782 Ga0451577_0000395 3300042876 Bacteria 80169
783 Ga0451577_0001764 3300042876 Bacteria 27851
784 Ga0451577_0137433 3300042876 Bacteria 2195
785 Ga0451577_0178970 3300042876 Bacteria 1911
786 Ga0451577_0192340 3300042876 Bacteria 1841
787 Ga0451577_0369281 3300042876 Bacteria 1301
788 Ga0453683_0000011 3300044673 Bacteria 412765
789 Ga0453683_0003829 3300044673 Bacteria 10922
790 Ga0453684_0000002 3300044712 Bacteria 1731375
791 Ga0453684_0000694 3300044712 Bacteria 119688
792 Ga0453684_0001529 3300044712 Bacteria 64683
793 Ga0453684_0002108 3300044712 Bacteria 50205
794 Ga0453684_0013161 3300044712 Bacteria 13491
795 Ga0453684_0034047 3300044712 Bacteria 7083
796 Ga0453684_0303582 3300044712 Bacteria 1814
797 Ga0451576_0000004 3300045051 Bacteria 1312238
798 Ga0451576_0000006 3300045051 Bacteria 949698
799 Ga0451576_0001977 3300045051 Bacteria 32557
800 Ga0451576_0002214 3300045051 Bacteria 29931
801 Ga0451576_0002633 3300045051 Bacteria 26264
802 Ga0451576_0006277 3300045051 Bacteria 14626
803 Ga0451576_0018556 3300045051 Bacteria 7621
804 Ga0451576_0069900 3300045051 Bacteria 3654
805 Ga0451576_0082691 3300045051 Bacteria 3340
806 Ga0451576_0138914 3300045051 Bacteria 2535
807 Ga0466967_0480879 3300045976 Bacteria 1217
808 Ga0495629_0072973 3300046459 Bacteria 2396
809 Ga0495629_0122088 3300046459 Bacteria 1815
810 Ga0495629_0373400 3300046459 Bacteria 971
811 Ga0495580_0046345 3300046472 Bacteria 3085
812 Ga0495580_0142954 3300046472 Bacteria 1658
813 Ga0495582_0018395 3300046473 Bacteria 3821
814 Ga0495639_0029001 3300046475 Bacteria 2454
815 Ga0495665_0031115 3300046531 Bacteria 2856
816 Ga0495587_0040968 3300046536 Bacteria 2765
817 Ga0495621_0004496 3300046539 Bacteria 3930
818 Ga0495621_0029257 3300046539 Bacteria 1877
819 Ga0495645_0179809 3300046543 Bacteria 1450
820 Ga0495635_0003129 3300046663 Bacteria 11389
821 Ga0495659_0008400 3300046664 Bacteria 3286
822 Ga0495658_0227644 3300046683 Bacteria 1168
823 Ga0495600_0013499 3300046809 Bacteria 5135
824 Ga0495581_0009908 3300047315 Bacteria 5512
825 Ga0495604_0086299 3300047317 Bacteria 2340
826 Ga0495674_0121424 3300047319 Bacteria 2207
827 Ga0495680_0027794 3300047322 Bacteria 4642
828 Ga0495675_0145128 3300047444 Bacteria 1469
829 Ga0495684_0052242 3300047471 Bacteria 3118
830 Ga0496100_0049877 3300048903 Bacteria 2709
831 Ga0496101_0009759 3300048904 Bacteria 6320
832 Ga0496101_0156327 3300048904 Bacteria 1747
833 Ga0496102_0013642 3300048905 Bacteria 7042
834 Ga0496102_0095561 3300048905 Bacteria 2755
835 Ga0496103_0037694 3300048906 Bacteria 2963
836 Ga0496103_0122994 3300048906 Bacteria 1654
837 Ga0496104_0035404 3300048907 Bacteria 4661
838 Ga0496104_0266122 3300048907 Bacteria 1627
839 Ga0496105_0010312 3300048908 Bacteria 7345
840 Ga0496105_0020268 3300048908 Bacteria 5373
841 Ga0496106_0037450 3300048909 Bacteria 3629
842 Ga0496106_0044631 3300048909 Bacteria 3327
843 Ga0496106_0100662 3300048909 Bacteria 2241
844 Ga0496106_0197689 3300048909 Bacteria 1600
845 Ga0496107_0037001 3300048910 Bacteria 3502
846 Ga0496107_0059285 3300048910 Bacteria 2770
847 Ga0496108_0001943 3300048911 Bacteria 16553
848 Ga0496108_0028099 3300048911 Bacteria 4653
849 Ga0496108_0061510 3300048911 Bacteria 3160
850 Ga0496109_0007082 3300048912 Bacteria 9465
851 Ga0496109_0021461 3300048912 Bacteria 5710
852 Ga0496109_0087616 3300048912 Bacteria 2876
853 Ga0496109_0116251 3300048912 Bacteria 2489
854 Ga0496110_0041351 3300048913 Bacteria 4022
855 Ga0496110_0110755 3300048913 Bacteria 2467
856 Ga0496112_0000540 3300048915 Bacteria 25909
857 Ga0496112_0019957 3300048915 Bacteria 6342
858 Ga0496112_0130501 3300048915 Bacteria 2484
859 Ga0496114_0065630 3300048917 Bacteria 3041
860 Ga0496114_0081151 3300048917 Bacteria 2740
861 Ga0496114_0086431 3300048917 Bacteria 2658
862 Ga0496114_0100347 3300048917 Bacteria 2470
863 Ga0496114_0341069 3300048917 Bacteria 1325
864 Ga0496114_0363031 3300048917 Bacteria 1281
865 Ga0501031_0006233 3300049568 Bacteria 7778
866 Ga0501031_0009246 3300049568 Bacteria 6405
867 Ga0501031_0066973 3300049568 Bacteria 2340
868 Ga0501032_0000403 3300049569 Bacteria 35638
869 Ga0501032_0007680 3300049569 Bacteria 7860
870 Ga0501032_0051359 3300049569 Bacteria 2780
871 Ga0501032_0072552 3300049569 Bacteria 2295
872 Ga0501033_0000709 3300049570 Bacteria 30657
873 Ga0501033_0001808 3300049570 Bacteria 18685
874 Ga0501033_0016892 3300049570 Bacteria 5517
875 Ga0501034_0000759 3300049571 Bacteria 48520
876 Ga0501034_0008103 3300049571 Bacteria 11145
877 Ga0501034_0077421 3300049571 Bacteria 3331
878 Ga0501034_0080850 3300049571 Bacteria 3253
879 Ga0501036_0000268 3300049572 Bacteria 35567
880 Ga0501036_0001606 3300049572 Bacteria 17453
881 Ga0501036_0219371 3300049572 Bacteria 1597
882 Ga0501037_0023208 3300049573 Bacteria 4587
883 Ga0501037_0102228 3300049573 Bacteria 2067
884 Ga0501037_0142279 3300049573 Bacteria 1716
885 Ga0501038_0000280 3300049574 Bacteria 43290
886 Ga0501038_0001255 3300049574 Bacteria 23022
887 Ga0501038_0004118 3300049574 Bacteria 13528
888 Ga0501038_0019910 3300049574 Bacteria 6039
889 Ga0501038_0047069 3300049574 Bacteria 3737
890 Ga0501038_0076106 3300049574 Bacteria 2835
891 Ga0501038_0279571 3300049574 Bacteria 1314
892 Ga0501039_0030324 3300049575 Bacteria 4170
893 Ga0501039_0084871 3300049575 Unclassified 2467
894 Ga0501039_0167569 3300049575 Bacteria 1727
895 Ga0501039_0272400 3300049575 Bacteria 1330
896 Ga0501040_0001121 3300049576 Bacteria 16964
897 Ga0501040_0050934 3300049576 Bacteria 2833
898 Ga0501042_0125352 3300049578 Bacteria 1849
899 Ga0501043_0001507 3300049579 Bacteria 20331
900 Ga0501043_0003838 3300049579 Bacteria 12355
901 Ga0501043_0020315 3300049579 Bacteria 5210
902 Ga0501046_0008472 3300049580 Bacteria 8958
903 Ga0501046_0141840 3300049580 Bacteria 1818
904 Ga0501047_0002525 3300049581 Bacteria 17435
905 Ga0501047_0017182 3300049581 Bacteria 6925
906 Ga0501048_0006099 3300049582 Bacteria 9181
907 Ga0501067_0005678 3300049583 Bacteria 6928
908 Ga0501068_0013549 3300049584 Bacteria 4641
909 Ga0501069_0087657 3300049585 Bacteria 1758
910 Ga0501069_0105584 3300049585 Bacteria 1601
911 Ga0501072_0007494 3300049588 Bacteria 8281
912 Ga0501072_0105355 3300049588 Bacteria 2242
913 Ga0501073_0006424 3300049589 Bacteria 8751
914 Ga0501073_0061438 3300049589 Bacteria 2622
915 Ga0501073_0113961 3300049589 Bacteria 1875
916 Ga0501074_0039704 3300049590 Bacteria 3409
917 Ga0501074_0128000 3300049590 Bacteria 1817
918 Ga0501075_0042183 3300049591 Bacteria 3420
919 Ga0501076_0014178 3300049592 Bacteria 5997
920 Ga0501077_0027329 3300049593 Bacteria 3624
921 Ga0501079_0001860 3300049741 Bacteria 15133
922 Ga0501080_0003681 3300049742 Bacteria 13520
923 Ga0501080_0019259 3300049742 Bacteria 6321
924 Ga0501081_0016868 3300049743 Bacteria 4826
925 Ga0501083_0068897 3300049744 Bacteria 2354
926 Ga0501035_0000270 3300049822 Bacteria 61516
927 Ga0501035_0004552 3300049822 Bacteria 13160
928 Ga0501035_0007685 3300049822 Bacteria 10073
929 Ga0501035_0068178 3300049822 Bacteria 3155
930 Ga0501035_0111503 3300049822 Bacteria 2397
931 Ga0501044_0000261 3300049823 Bacteria 66869
932 Ga0501044_0000482 3300049823 Bacteria 48412
933 Ga0501044_0004065 3300049823 Bacteria 16403
934 Ga0501045_0000564 3300049824 Bacteria 23265
935 Ga0501045_0030960 3300049824 Bacteria 3874
936 nmdc:mga03683_10226_c1 3300050489 Bacteria 3361
937 nmdc:mga03n38_981_c1 3300050490 Bacteria 7780
938 nmdc:mga00v17_5571_c1 3300050491 Bacteria 6638
939 nmdc:mga0yw44_172_c1 3300050492 Bacteria 22648
940 nmdc:mga0k408_12910_c1 3300050493 Bacteria 4574
941 nmdc:mga0k408_35783_c1 3300050493 Bacteria 2848
942 nmdc:mga06z11_1401_c1 3300050494 Bacteria 8957
943 nmdc:mga04h51_1093_c1 3300050495 Bacteria 6254
944 nmdc:mga05p37_240457_c1 3300050507 Bacteria 2177
945 nmdc:mga05p37_300622_c1 3300050507 Bacteria 1907
946 nmdc:mga09592_30954_c1 3300050508 Bacteria 4456
947 nmdc:mga08y16_128607_c1 3300050511 Bacteria 2635
948 nmdc:mga08y16_27570_c1 3300050511 Bacteria 5985
949 nmdc:mga08y16_71407_c1 3300050511 Bacteria 3618
950 nmdc:mga08y16_84834_c1 3300050511 Bacteria 3301
951 nmdc:mga0n895_111670_c1 3300050512 Bacteria 2750
952 nmdc:mga0n895_17716_c1 3300050512 Bacteria 6571
953 nmdc:mga0n895_185344_c1 3300050512 Bacteria 2112
954 nmdc:mga0n895_255694_c1 3300050512 Bacteria 1777
955 nmdc:mga0n895_432_c1 3300050512 Bacteria 28136
956 nmdc:mga0rr50_1318_c1 3300050513 Bacteria 13536
957 nmdc:mga0rr50_49968_c1 3300050513 Bacteria 3097
958 nmdc:mga0rr50_5859_c1 3300050513 Bacteria 7390
959 nmdc:mga0rr50_72129_c1 3300050513 Bacteria 2636
960 nmdc:mga0rr50_97216_c1 3300050513 Bacteria 2305
961 nmdc:mga08x19_60696_c1 3300050514 Bacteria 2449
962 nmdc:mga0sz30_9987_c1 3300050516 Bacteria 3629
963 Ga0495619_0010282 3300053085 Bacteria 5892
964 Ga0500594_0004257 3300053118 Bacteria 3156
965 Ga0500622_0000019 3300053156 Bacteria 275028
966 Ga0501082_0034997 3300060353 Bacteria 4328
967 Ga0501082_0045730 3300060353 Bacteria 3775
968 Ga0530510_0080048 3300061734 Bacteria 2377

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025927 Ga0207687_10000188 Ga0207687_1000018838 295
2 3300026023 Ga0207677_10065700 Ga0207677_100657003 299
3 3300046459 Ga0495629_0373400 Ga0495629_0373400_14_925 299
4 3300035084 Ga0373928_0052041 Ga0373928_0052041_32_940 300
5 3300037068 Ga0373925_0395196 Ga0373925_0395196_193_1101 300
6 3300046539 Ga0495621_0029257 Ga0495621_0029257_940_1848 300
7 3300047319 Ga0495674_0121424 Ga0495674_0121424_1280_2188 300
8 3300047444 Ga0495675_0145128 Ga0495675_0145128_502_1410 300
9 3300014745 Ga0157377_10251800 Ga0157377_102518001 302
10 3300011119 Ga0105246_10040771 Ga0105246_100407713 318
11 3300035725 Ga0373947_0312313 Ga0373947_0312313_14_1006 318
12 3300025933 Ga0207706_10294380 Ga0207706_102943802 321
13 3300046536 Ga0495587_0040968 Ga0495587_0040968_773_1777 322
14 3300014968 Ga0157379_10115348 Ga0157379_101153483 327
15 iso_pu_bacteria 2894510363 2894514810 327
16 iso_pu_bacteria 2989392574 2989396658 327
17 3300005340 Ga0070689_100108700 Ga0070689_1001087002 328
18 3300005615 Ga0070702_100098242 Ga0070702_1000982421 328
19 3300025931 Ga0207644_10143201 Ga0207644_101432012 328
20 iso_pu_bacteria 2547132103 2547372644 328
21 iso_pu_bacteria 2843690924 2843691647 328
22 iso_pu_bacteria 2846033681 2846037063 328
23 iso_pu_bacteria 2846037992 2846040145 328
24 iso_pu_bacteria 2891633521 2891637714 328
25 iso_pu_bacteria 8001522603 8001524634 328
26 3300039062 Ga0400483_128908 Ga0400483_128908_26_1054 330
27 3300006038 Ga0075365_10032640 Ga0075365_100326403 331
28 3300006042 Ga0075368_10005372 Ga0075368_100053726 331
29 3300006178 Ga0075367_10002132 Ga0075367_100021329 331
30 3300006186 Ga0075369_10000546 Ga0075369_100005469 331
31 3300006195 Ga0075366_10010257 Ga0075366_100102573 331
32 3300027866 Ga0209813_10001571 Ga0209813_100015713 331
33 3300031251 Ga0265327_10015340 Ga0265327_100153403 331
34 3300042876 Ga0451577_0000395 Ga0451577_0000395_19310_20338 331
35 3300044712 Ga0453684_0002108 Ga0453684_0002108_40396_41424 331
36 3300044712 Ga0453684_0034047 Ga0453684_0034047_2208_3236 331
37 3300045051 Ga0451576_0082691 Ga0451576_0082691_1876_2904 331
38 3300050489 nmdc:mga03683_10226_c1 nmdc:mga03683_10226_c1_2245_3276 331
39 3300050490 nmdc:mga03n38_981_c1 nmdc:mga03n38_981_c1_3280_4311 331
40 3300050491 nmdc:mga00v17_5571_c1 nmdc:mga00v17_5571_c1_282_1313 331
41 3300050492 nmdc:mga0yw44_172_c1 nmdc:mga0yw44_172_c1_10590_11621 331
42 3300050493 nmdc:mga0k408_35783_c1 nmdc:mga0k408_35783_c1_227_1258 331
43 3300050494 nmdc:mga06z11_1401_c1 nmdc:mga06z11_1401_c1_3470_4501 331
44 3300050495 nmdc:mga04h51_1093_c1 nmdc:mga04h51_1093_c1_226_1257 331
45 3300050516 nmdc:mga0sz30_9987_c1 nmdc:mga0sz30_9987_c1_783_1814 331
46 3300053118 Ga0500594_0004257 Ga0500594_0004257_2001_3032 331
47 3300005333 Ga0070677_10010233 Ga0070677_100102334 332
48 3300005336 Ga0070680_100170045 Ga0070680_1001700452 332
49 3300005339 Ga0070660_100031943 Ga0070660_1000319436 332
50 3300005340 Ga0070689_100064761 Ga0070689_1000647613 332
51 3300005343 Ga0070687_100074952 Ga0070687_1000749522 332
52 3300005344 Ga0070661_100002576 Ga0070661_10000257612 332
53 3300005344 Ga0070661_100090669 Ga0070661_1000906693 332
54 3300005347 Ga0070668_100001538 Ga0070668_1000015387 332
55 3300005347 Ga0070668_100071300 Ga0070668_1000713003 332
56 3300005355 Ga0070671_100022630 Ga0070671_1000226306 332
57 3300005366 Ga0070659_100177741 Ga0070659_1001777413 332
58 3300005366 Ga0070659_100322161 Ga0070659_1003221611 332
59 3300005367 Ga0070667_100104911 Ga0070667_1001049114 332
60 3300005441 Ga0070700_100005754 Ga0070700_1000057542 332
61 3300005441 Ga0070700_100072465 Ga0070700_1000724651 332
62 3300005444 Ga0070694_100071367 Ga0070694_1000713673 332
63 3300005456 Ga0070678_100037493 Ga0070678_1000374934 332
64 3300005457 Ga0070662_100040507 Ga0070662_1000405072 332
65 3300005458 Ga0070681_10007813 Ga0070681_1000781310 332
66 3300005458 Ga0070681_10022742 Ga0070681_100227429 332
67 3300005467 Ga0070706_100022655 Ga0070706_1000226558 332
68 3300005468 Ga0070707_100015911 Ga0070707_1000159112 332
69 3300005468 Ga0070707_100175192 Ga0070707_1001751921 332
70 3300005518 Ga0070699_100328116 Ga0070699_1003281161 332
71 3300005530 Ga0070679_100033388 Ga0070679_1000333886 332
72 3300005539 Ga0068853_100045026 Ga0068853_1000450262 332
73 3300005543 Ga0070672_100186266 Ga0070672_1001862662 332
74 3300005544 Ga0070686_100096000 Ga0070686_1000960002 332
75 3300005545 Ga0070695_100030795 Ga0070695_1000307952 332
76 3300005546 Ga0070696_100032438 Ga0070696_1000324384 332
77 3300005546 Ga0070696_100063601 Ga0070696_1000636013 332
78 3300005548 Ga0070665_100030720 Ga0070665_1000307202 332
79 3300005563 Ga0068855_100106814 Ga0068855_1001068144 332
80 3300005564 Ga0070664_100206990 Ga0070664_1002069902 332
81 3300005615 Ga0070702_100046528 Ga0070702_1000465281 332
82 3300005617 Ga0068859_100116149 Ga0068859_1001161493 332
83 3300005842 Ga0068858_100031566 Ga0068858_1000315666 332
84 3300005843 Ga0068860_100206852 Ga0068860_1002068522 332
85 3300005844 Ga0068862_100183721 Ga0068862_1001837212 332
86 3300006195 Ga0075366_10029099 Ga0075366_100290993 332
87 3300006237 Ga0097621_100138178 Ga0097621_1001381783 332
88 3300006844 Ga0075428_100002887 Ga0075428_1000028875 332
89 3300006846 Ga0075430_100134415 Ga0075430_1001344153 332
90 3300006871 Ga0075434_100000306 Ga0075434_1000003063 332
91 3300006871 Ga0075434_100174691 Ga0075434_1001746912 332
92 3300006880 Ga0075429_100033953 Ga0075429_1000339534 332
93 3300006881 Ga0068865_100162841 Ga0068865_1001628411 332
94 3300006914 Ga0075436_100152988 Ga0075436_1001529882 332
95 3300006931 Ga0097620_100116144 Ga0097620_1001161443 332
96 3300007076 Ga0075435_100040195 Ga0075435_1000401955 332
97 3300007265 Ga0099794_10122638 Ga0099794_101226382 332
98 3300009094 Ga0111539_10000957 Ga0111539_1000095713 332
99 3300009094 Ga0111539_10039536 Ga0111539_100395365 332
100 3300009094 Ga0111539_10057738 Ga0111539_100577383 332
101 3300009094 Ga0111539_10060204 Ga0111539_100602044 332
102 3300009147 Ga0114129_10444982 Ga0114129_104449822 332
103 3300009176 Ga0105242_10024661 Ga0105242_100246612 332
104 3300009176 Ga0105242_10213435 Ga0105242_102134353 332
105 3300009553 Ga0105249_10066620 Ga0105249_100666202 332
106 3300013104 Ga0157370_10014097 Ga0157370_100140974 332
107 3300013296 Ga0157374_10000924 Ga0157374_100009247 332
108 3300013297 Ga0157378_10052080 Ga0157378_100520805 332
109 3300013297 Ga0157378_10208896 Ga0157378_102088962 332
110 3300013307 Ga0157372_10015325 Ga0157372_100153253 332
111 3300013308 Ga0157375_10385748 Ga0157375_103857482 332
112 3300014326 Ga0157380_10085349 Ga0157380_100853494 332
113 3300014745 Ga0157377_10009541 Ga0157377_100095416 332
114 3300014968 Ga0157379_10059206 Ga0157379_100592063 332
115 3300014969 Ga0157376_10273364 Ga0157376_102733641 332
116 3300021361 Ga0213872_10000333 Ga0213872_100003339 332
117 3300021361 Ga0213872_10002733 Ga0213872_100027332 332
118 3300021361 Ga0213872_10004503 Ga0213872_100045035 332
119 3300025315 Ga0207697_10007231 Ga0207697_100072313 332
120 3300025893 Ga0207682_10000993 Ga0207682_1000099312 332
121 3300025901 Ga0207688_10006119 Ga0207688_100061197 332
122 3300025901 Ga0207688_10041079 Ga0207688_100410793 332
123 3300025907 Ga0207645_10007484 Ga0207645_100074847 332
124 3300025908 Ga0207643_10003518 Ga0207643_100035189 332
125 3300025910 Ga0207684_10046819 Ga0207684_100468196 332
126 3300025912 Ga0207707_10046343 Ga0207707_100463433 332
127 3300025912 Ga0207707_10139098 Ga0207707_101390983 332
128 3300025912 Ga0207707_10144033 Ga0207707_101440333 332
129 3300025917 Ga0207660_10095518 Ga0207660_100955183 332
130 3300025918 Ga0207662_10096349 Ga0207662_100963492 332
131 3300025922 Ga0207646_10018213 Ga0207646_100182132 332
132 3300025925 Ga0207650_10274402 Ga0207650_102744022 332
133 3300025932 Ga0207690_10265407 Ga0207690_102654072 332
134 3300025933 Ga0207706_10048226 Ga0207706_100482264 332
135 3300025934 Ga0207686_10149671 Ga0207686_101496712 332
136 3300025935 Ga0207709_10031657 Ga0207709_100316575 332
137 3300025937 Ga0207669_10055040 Ga0207669_100550403 332
138 3300025942 Ga0207689_10008896 Ga0207689_100088968 332
139 3300025945 Ga0207679_10324702 Ga0207679_103247022 332
140 3300025961 Ga0207712_10085235 Ga0207712_100852353 332
141 3300025972 Ga0207668_10005221 Ga0207668_100052216 332
142 3300025981 Ga0207640_10182049 Ga0207640_101820492 332
143 3300025986 Ga0207658_10437021 Ga0207658_104370211 332
144 3300026067 Ga0207678_10207134 Ga0207678_102071341 332
145 3300026075 Ga0207708_10004145 Ga0207708_100041459 332
146 3300026075 Ga0207708_10007951 Ga0207708_100079518 332
147 3300026078 Ga0207702_10029159 Ga0207702_100291593 332
148 3300026089 Ga0207648_10023267 Ga0207648_100232676 332
149 3300026116 Ga0207674_10022289 Ga0207674_100222897 332
150 3300026118 Ga0207675_100002944 Ga0207675_1000029445 332
151 3300026121 Ga0207683_10006165 Ga0207683_100061654 332
152 3300027360 Ga0209969_1000136 Ga0209969_10001367 332
153 3300027395 Ga0209996_1002378 Ga0209996_10023782 332
154 3300027462 Ga0210000_1000292 Ga0210000_10002927 332
155 3300027665 Ga0209983_1002782 Ga0209983_10027825 332
156 3300027682 Ga0209971_1007936 Ga0209971_10079362 332
157 3300027876 Ga0209974_10000335 Ga0209974_100003358 332
158 3300027876 Ga0209974_10007387 Ga0209974_100073871 332
159 3300027907 Ga0207428_10011849 Ga0207428_1001184910 332
160 3300027907 Ga0207428_10098368 Ga0207428_100983682 332
161 3300028380 Ga0268265_10047984 Ga0268265_100479845 332
162 3300029957 Ga0265324_10004084 Ga0265324_100040844 332
163 3300031235 Ga0265330_10011554 Ga0265330_100115545 332
164 3300031238 Ga0265332_10083577 Ga0265332_100835771 332
165 3300031239 Ga0265328_10000020 Ga0265328_10000020119 332
166 3300031239 Ga0265328_10003722 Ga0265328_100037227 332
167 3300031239 Ga0265328_10009523 Ga0265328_100095234 332
168 3300031241 Ga0265325_10039496 Ga0265325_100394963 332
169 3300031250 Ga0265331_10000144 Ga0265331_1000014489 332
170 3300031250 Ga0265331_10004577 Ga0265331_100045777 332
171 3300031250 Ga0265331_10012989 Ga0265331_100129893 332
172 3300031250 Ga0265331_10021602 Ga0265331_100216024 332
173 3300031250 Ga0265331_10028015 Ga0265331_100280153 332
174 3300031250 Ga0265331_10038261 Ga0265331_100382612 332
175 3300031250 Ga0265331_10062312 Ga0265331_100623122 332
176 3300031250 Ga0265331_10065006 Ga0265331_100650062 332
177 3300031251 Ga0265327_10000044 Ga0265327_100000448 332
178 3300031251 Ga0265327_10000136 Ga0265327_10000136122 332
179 3300031251 Ga0265327_10000314 Ga0265327_1000031489 332
180 3300031251 Ga0265327_10000475 Ga0265327_1000047571 332
181 3300031251 Ga0265327_10000730 Ga0265327_1000073048 332
182 3300031251 Ga0265327_10001767 Ga0265327_100017679 332
183 3300031251 Ga0265327_10006826 Ga0265327_100068266 332
184 3300031251 Ga0265327_10008949 Ga0265327_100089492 332
185 3300031251 Ga0265327_10013003 Ga0265327_100130033 332
186 3300031251 Ga0265327_10071561 Ga0265327_100715612 332
187 3300031344 Ga0265316_10016572 Ga0265316_100165724 332
188 3300031665 Ga0316575_10000042 Ga0316575_1000004211 332
189 3300031711 Ga0265314_10007067 Ga0265314_100070677 332
190 3300031711 Ga0265314_10111146 Ga0265314_101111462 332
191 3300032133 Ga0316583_10008955 Ga0316583_100089553 332
192 3300032168 Ga0316593_10030950 Ga0316593_100309503 332
193 3300035084 Ga0373928_0014325 Ga0373928_0014325_187_1215 332
194 3300035092 Ga0373952_0002096 Ga0373952_0002096_840_1868 332
195 3300036401 Ga0373937_0132013 Ga0373937_0132013_118_1155 332
196 3300037418 Ga0395900_0099978 Ga0395900_0099978_1499_2527 332
197 3300039447 Ga0436361_0060436 Ga0436361_0060436_103_1131 332
198 3300039447 Ga0436361_0235627 Ga0436361_0235627_6500_7528 332
199 3300039447 Ga0436361_0891393 Ga0436361_0891393_64986_66014 332
200 3300042001 Ga0439441_001329 Ga0439441_001329_74_1138 332
201 3300042876 Ga0451577_0000002 Ga0451577_0000002_1206917_1207945 332
202 3300042876 Ga0451577_0001764 Ga0451577_0001764_908_1948 332
203 3300042876 Ga0451577_0137433 Ga0451577_0137433_678_1706 332
204 3300042876 Ga0451577_0178970 Ga0451577_0178970_732_1790 332
205 3300042876 Ga0451577_0369281 Ga0451577_0369281_41_1069 332
206 3300044673 Ga0453683_0000011 Ga0453683_0000011_261436_262464 332
207 3300044673 Ga0453683_0003829 Ga0453683_0003829_1789_2817 332
208 3300044712 Ga0453684_0000002 Ga0453684_0000002_523431_524459 332
209 3300044712 Ga0453684_0000694 Ga0453684_0000694_41616_42644 332
210 3300044712 Ga0453684_0001529 Ga0453684_0001529_60467_61495 332
211 3300044712 Ga0453684_0013161 Ga0453684_0013161_3955_4983 332
212 3300044712 Ga0453684_0303582 Ga0453684_0303582_602_1630 332
213 3300045051 Ga0451576_0000004 Ga0451576_0000004_150071_151099 332
214 3300045051 Ga0451576_0000006 Ga0451576_0000006_56959_57987 332
215 3300045051 Ga0451576_0001977 Ga0451576_0001977_16706_17734 332
216 3300045051 Ga0451576_0002214 Ga0451576_0002214_17056_18096 332
217 3300045051 Ga0451576_0002633 Ga0451576_0002633_7026_8066 332
218 3300045051 Ga0451576_0006277 Ga0451576_0006277_13544_14572 332
219 3300045051 Ga0451576_0018556 Ga0451576_0018556_3886_4914 332
220 3300045051 Ga0451576_0069900 Ga0451576_0069900_2295_3323 332
221 3300045051 Ga0451576_0138914 Ga0451576_0138914_1461_2492 332
222 3300046459 Ga0495629_0122088 Ga0495629_0122088_141_1181 332
223 3300046539 Ga0495621_0004496 Ga0495621_0004496_424_1464 332
224 3300048907 Ga0496104_0266122 Ga0496104_0266122_450_1490 332
225 3300048911 Ga0496108_0028099 Ga0496108_0028099_832_1860 332
226 3300048913 Ga0496110_0041351 Ga0496110_0041351_2110_3138 332
227 3300048917 Ga0496114_0081151 Ga0496114_0081151_1261_2301 332
228 3300048917 Ga0496114_0341069 Ga0496114_0341069_165_1205 332
229 3300049568 Ga0501031_0006233 Ga0501031_0006233_3325_4353 332
230 3300049568 Ga0501031_0009246 Ga0501031_0009246_229_1257 332
231 3300049568 Ga0501031_0066973 Ga0501031_0066973_1241_2269 332
232 3300049569 Ga0501032_0000403 Ga0501032_0000403_33739_34767 332
233 3300049569 Ga0501032_0007680 Ga0501032_0007680_864_1892 332
234 3300049569 Ga0501032_0051359 Ga0501032_0051359_558_1586 332
235 3300049569 Ga0501032_0072552 Ga0501032_0072552_394_1434 332
236 3300049570 Ga0501033_0000709 Ga0501033_0000709_4416_5444 332
237 3300049570 Ga0501033_0001808 Ga0501033_0001808_4388_5416 332
238 3300049570 Ga0501033_0016892 Ga0501033_0016892_1481_2509 332
239 3300049571 Ga0501034_0000759 Ga0501034_0000759_41792_42820 332
240 3300049571 Ga0501034_0008103 Ga0501034_0008103_3453_4481 332
241 3300049571 Ga0501034_0077421 Ga0501034_0077421_1897_2925 332
242 3300049571 Ga0501034_0080850 Ga0501034_0080850_1065_2108 332
243 3300049572 Ga0501036_0000268 Ga0501036_0000268_13687_14928 332
244 3300049572 Ga0501036_0001606 Ga0501036_0001606_3774_4802 332
245 3300049572 Ga0501036_0219371 Ga0501036_0219371_49_1077 332
246 3300049573 Ga0501037_0023208 Ga0501037_0023208_441_1469 332
247 3300049573 Ga0501037_0102228 Ga0501037_0102228_248_1276 332
248 3300049573 Ga0501037_0142279 Ga0501037_0142279_497_1525 332
249 3300049574 Ga0501038_0000280 Ga0501038_0000280_3463_4491 332
250 3300049574 Ga0501038_0001255 Ga0501038_0001255_4646_5674 332
251 3300049574 Ga0501038_0004118 Ga0501038_0004118_10695_11723 332
252 3300049574 Ga0501038_0019910 Ga0501038_0019910_3910_4938 332
253 3300049574 Ga0501038_0047069 Ga0501038_0047069_1696_2937 332
254 3300049574 Ga0501038_0076106 Ga0501038_0076106_682_1710 332
255 3300049574 Ga0501038_0279571 Ga0501038_0279571_129_1169 332
256 3300049575 Ga0501039_0030324 Ga0501039_0030324_248_1288 332
257 3300049575 Ga0501039_0084871 Ga0501039_0084871_10_1038 332
258 3300049575 Ga0501039_0167569 Ga0501039_0167569_55_1083 332
259 3300049575 Ga0501039_0272400 Ga0501039_0272400_286_1314 332
260 3300049576 Ga0501040_0001121 Ga0501040_0001121_12640_13668 332
261 3300049576 Ga0501040_0050934 Ga0501040_0050934_935_1975 332
262 3300049579 Ga0501043_0001507 Ga0501043_0001507_14645_15886 332
263 3300049579 Ga0501043_0003838 Ga0501043_0003838_3414_4442 332
264 3300049579 Ga0501043_0020315 Ga0501043_0020315_893_1921 332
265 3300049580 Ga0501046_0008472 Ga0501046_0008472_7914_8942 332
266 3300049580 Ga0501046_0141840 Ga0501046_0141840_154_1182 332
267 3300049581 Ga0501047_0002525 Ga0501047_0002525_7914_8942 332
268 3300049581 Ga0501047_0017182 Ga0501047_0017182_881_1924 332
269 3300049582 Ga0501048_0006099 Ga0501048_0006099_240_1268 332
270 3300049583 Ga0501067_0005678 Ga0501067_0005678_4826_5869 332
271 3300049584 Ga0501068_0013549 Ga0501068_0013549_1479_2507 332
272 3300049588 Ga0501072_0007494 Ga0501072_0007494_1575_2603 332
273 3300049588 Ga0501072_0105355 Ga0501072_0105355_260_1303 332
274 3300049589 Ga0501073_0006424 Ga0501073_0006424_2337_3380 332
275 3300049589 Ga0501073_0061438 Ga0501073_0061438_860_1900 332
276 3300049589 Ga0501073_0113961 Ga0501073_0113961_434_1471 332
277 3300049590 Ga0501074_0128000 Ga0501074_0128000_552_1595 332
278 3300049591 Ga0501075_0042183 Ga0501075_0042183_948_1988 332
279 3300049592 Ga0501076_0014178 Ga0501076_0014178_4748_5788 332
280 3300049593 Ga0501077_0027329 Ga0501077_0027329_1962_3002 332
281 3300049741 Ga0501079_0001860 Ga0501079_0001860_11492_12532 332
282 3300049742 Ga0501080_0003681 Ga0501080_0003681_10105_11148 332
283 3300049742 Ga0501080_0019259 Ga0501080_0019259_603_1643 332
284 3300049743 Ga0501081_0016868 Ga0501081_0016868_2607_3647 332
285 3300049744 Ga0501083_0068897 Ga0501083_0068897_490_1533 332
286 3300049822 Ga0501035_0000270 Ga0501035_0000270_25499_26527 332
287 3300049822 Ga0501035_0004552 Ga0501035_0004552_1078_2319 332
288 3300049822 Ga0501035_0007685 Ga0501035_0007685_144_1172 332
289 3300049822 Ga0501035_0068178 Ga0501035_0068178_1118_2161 332
290 3300049822 Ga0501035_0111503 Ga0501035_0111503_265_1293 332
291 3300049823 Ga0501044_0000261 Ga0501044_0000261_31809_33050 332
292 3300049823 Ga0501044_0000482 Ga0501044_0000482_37757_38785 332
293 3300049823 Ga0501044_0004065 Ga0501044_0004065_10364_11392 332
294 3300049824 Ga0501045_0000564 Ga0501045_0000564_8313_9341 332
295 3300049824 Ga0501045_0030960 Ga0501045_0030960_314_1354 332
296 3300050493 nmdc:mga0k408_12910_c1 nmdc:mga0k408_12910_c1_355_1383 332
297 3300050507 nmdc:mga05p37_300622_c1 nmdc:mga05p37_300622_c1_610_1653 332
298 3300050508 nmdc:mga09592_30954_c1 nmdc:mga09592_30954_c1_1637_2680 332
299 3300050511 nmdc:mga08y16_128607_c1 nmdc:mga08y16_128607_c1_789_1952 332
300 3300050511 nmdc:mga08y16_27570_c1 nmdc:mga08y16_27570_c1_1528_2571 332
301 3300050511 nmdc:mga08y16_71407_c1 nmdc:mga08y16_71407_c1_1688_2728 332
302 3300050512 nmdc:mga0n895_17716_c1 nmdc:mga0n895_17716_c1_4931_5986 332
303 3300050512 nmdc:mga0n895_432_c1 nmdc:mga0n895_432_c1_25732_26775 332
304 3300050513 nmdc:mga0rr50_1318_c1 nmdc:mga0rr50_1318_c1_1949_2992 332
305 3300053156 Ga0500622_0000019 Ga0500622_0000019_7139_8185 332
306 3300060353 Ga0501082_0034997 Ga0501082_0034997_2650_3690 332
307 3300060353 Ga0501082_0045730 Ga0501082_0045730_1126_2169 332
308 3300061734 Ga0530510_0080048 Ga0530510_0080048_358_1398 332
309 3300005327 Ga0070658_10062501 Ga0070658_100625015 333
310 3300005327 Ga0070658_10244643 Ga0070658_102446432 333
311 3300005328 Ga0070676_10002569 Ga0070676_100025692 333
312 3300005328 Ga0070676_10016017 Ga0070676_100160175 333
313 3300005328 Ga0070676_10051661 Ga0070676_100516612 333
314 3300005329 Ga0070683_100085505 Ga0070683_1000855053 333
315 3300005329 Ga0070683_100105796 Ga0070683_1001057963 333
316 3300005329 Ga0070683_100140236 Ga0070683_1001402363 333
317 3300005331 Ga0070670_100044437 Ga0070670_1000444374 333
318 3300005331 Ga0070670_100192052 Ga0070670_1001920522 333
319 3300005331 Ga0070670_100196571 Ga0070670_1001965712 333
320 3300005331 Ga0070670_100455308 Ga0070670_1004553081 333
321 3300005333 Ga0070677_10000757 Ga0070677_100007579 333
322 3300005333 Ga0070677_10034506 Ga0070677_100345062 333
323 3300005334 Ga0068869_100051928 Ga0068869_1000519281 333
324 3300005334 Ga0068869_100097098 Ga0068869_1000970981 333
325 3300005334 Ga0068869_100162601 Ga0068869_1001626012 333
326 3300005335 Ga0070666_10005640 Ga0070666_100056405 333
327 3300005336 Ga0070680_100086024 Ga0070680_1000860242 333
328 3300005337 Ga0070682_100054343 Ga0070682_1000543434 333
329 3300005338 Ga0068868_100001787 Ga0068868_1000017876 333
330 3300005338 Ga0068868_100081007 Ga0068868_1000810072 333
331 3300005339 Ga0070660_100008470 Ga0070660_1000084703 333
332 3300005339 Ga0070660_100010171 Ga0070660_1000101715 333
333 3300005339 Ga0070660_100096643 Ga0070660_1000966432 333
334 3300005339 Ga0070660_100219837 Ga0070660_1002198372 333
335 3300005339 Ga0070660_100280309 Ga0070660_1002803091 333
336 3300005339 Ga0070660_100280723 Ga0070660_1002807231 333
337 3300005344 Ga0070661_100000486 Ga0070661_10000048630 333
338 3300005344 Ga0070661_100004760 Ga0070661_1000047606 333
339 3300005344 Ga0070661_100023250 Ga0070661_1000232504 333
340 3300005344 Ga0070661_100064312 Ga0070661_1000643123 333
341 3300005347 Ga0070668_100001746 Ga0070668_10000174618 333
342 3300005347 Ga0070668_100007313 Ga0070668_1000073139 333
343 3300005347 Ga0070668_100196338 Ga0070668_1001963382 333
344 3300005353 Ga0070669_100035008 Ga0070669_1000350085 333
345 3300005353 Ga0070669_100051179 Ga0070669_1000511793 333
346 3300005353 Ga0070669_100164569 Ga0070669_1001645692 333
347 3300005354 Ga0070675_100001675 Ga0070675_1000016759 333
348 3300005354 Ga0070675_100004036 Ga0070675_1000040362 333
349 3300005354 Ga0070675_100202401 Ga0070675_1002024011 333
350 3300005355 Ga0070671_100000564 Ga0070671_1000005646 333
351 3300005355 Ga0070671_100005329 Ga0070671_10000532910 333
352 3300005355 Ga0070671_100167950 Ga0070671_1001679502 333
353 3300005355 Ga0070671_100177322 Ga0070671_1001773223 333
354 3300005356 Ga0070674_100000536 Ga0070674_10000053619 333
355 3300005356 Ga0070674_100195196 Ga0070674_1001951961 333
356 3300005364 Ga0070673_100004988 Ga0070673_1000049886 333
357 3300005364 Ga0070673_100060747 Ga0070673_1000607473 333
358 3300005364 Ga0070673_100211976 Ga0070673_1002119762 333
359 3300005364 Ga0070673_100284724 Ga0070673_1002847242 333
360 3300005365 Ga0070688_100017316 Ga0070688_1000173165 333
361 3300005365 Ga0070688_100123425 Ga0070688_1001234251 333
362 3300005366 Ga0070659_100002814 Ga0070659_1000028145 333
363 3300005366 Ga0070659_100021771 Ga0070659_1000217713 333
364 3300005366 Ga0070659_100070700 Ga0070659_1000707001 333
365 3300005366 Ga0070659_100071020 Ga0070659_1000710202 333
366 3300005366 Ga0070659_100146538 Ga0070659_1001465382 333
367 3300005367 Ga0070667_100002948 Ga0070667_10000294815 333
368 3300005367 Ga0070667_100101410 Ga0070667_1001014103 333
369 3300005367 Ga0070667_100106245 Ga0070667_1001062453 333
370 3300005367 Ga0070667_100107754 Ga0070667_1001077543 333
371 3300005367 Ga0070667_100277606 Ga0070667_1002776062 333
372 3300005434 Ga0070709_10037095 Ga0070709_100370953 333
373 3300005435 Ga0070714_100394505 Ga0070714_1003945051 333
374 3300005455 Ga0070663_100039170 Ga0070663_1000391704 333
375 3300005455 Ga0070663_100114377 Ga0070663_1001143772 333
376 3300005456 Ga0070678_100000428 Ga0070678_1000004288 333
377 3300005456 Ga0070678_100024746 Ga0070678_1000247465 333
378 3300005456 Ga0070678_100292715 Ga0070678_1002927151 333
379 3300005457 Ga0070662_100014943 Ga0070662_1000149433 333
380 3300005458 Ga0070681_10003494 Ga0070681_100034943 333
381 3300005458 Ga0070681_10157812 Ga0070681_101578122 333
382 3300005458 Ga0070681_10270679 Ga0070681_102706791 333
383 3300005459 Ga0068867_100011744 Ga0068867_1000117442 333
384 3300005459 Ga0068867_100017233 Ga0068867_1000172337 333
385 3300005459 Ga0068867_100139599 Ga0068867_1001395991 333
386 3300005466 Ga0070685_10141158 Ga0070685_101411582 333
387 3300005530 Ga0070679_100049459 Ga0070679_1000494595 333
388 3300005530 Ga0070679_100315167 Ga0070679_1003151672 333
389 3300005535 Ga0070684_100013991 Ga0070684_1000139915 333
390 3300005535 Ga0070684_100140760 Ga0070684_1001407603 333
391 3300005535 Ga0070684_100166102 Ga0070684_1001661022 333
392 3300005539 Ga0068853_100031441 Ga0068853_1000314412 333
393 3300005539 Ga0068853_100051879 Ga0068853_1000518792 333
394 3300005539 Ga0068853_100126441 Ga0068853_1001264412 333
395 3300005543 Ga0070672_100004110 Ga0070672_1000041108 333
396 3300005543 Ga0070672_100011327 Ga0070672_1000113276 333
397 3300005543 Ga0070672_100145533 Ga0070672_1001455332 333
398 3300005544 Ga0070686_100089558 Ga0070686_1000895583 333
399 3300005546 Ga0070696_100005910 Ga0070696_10000591010 333
400 3300005548 Ga0070665_100003863 Ga0070665_10000386316 333
401 3300005548 Ga0070665_100073966 Ga0070665_1000739664 333
402 3300005548 Ga0070665_100308078 Ga0070665_1003080781 333
403 3300005563 Ga0068855_100039133 Ga0068855_1000391337 333
404 3300005563 Ga0068855_100050332 Ga0068855_1000503325 333
405 3300005563 Ga0068855_100059170 Ga0068855_1000591703 333
406 3300005563 Ga0068855_100194206 Ga0068855_1001942063 333
407 3300005563 Ga0068855_100201114 Ga0068855_1002011143 333
408 3300005563 Ga0068855_100438595 Ga0068855_1004385952 333
409 3300005564 Ga0070664_100005958 Ga0070664_1000059583 333
410 3300005564 Ga0070664_100009645 Ga0070664_1000096456 333
411 3300005564 Ga0070664_100022299 Ga0070664_1000222994 333
412 3300005564 Ga0070664_100032335 Ga0070664_1000323351 333
413 3300005564 Ga0070664_100037072 Ga0070664_1000370722 333
414 3300005564 Ga0070664_100117042 Ga0070664_1001170423 333
415 3300005564 Ga0070664_100323360 Ga0070664_1003233602 333
416 3300005577 Ga0068857_100018143 Ga0068857_1000181437 333
417 3300005578 Ga0068854_100006946 Ga0068854_1000069466 333
418 3300005578 Ga0068854_100015337 Ga0068854_1000153375 333
419 3300005578 Ga0068854_100069798 Ga0068854_1000697983 333
420 3300005578 Ga0068854_100184510 Ga0068854_1001845102 333
421 3300005614 Ga0068856_100002081 Ga0068856_10000208119 333
422 3300005614 Ga0068856_100003025 Ga0068856_10000302514 333
423 3300005614 Ga0068856_100006440 Ga0068856_1000064408 333
424 3300005614 Ga0068856_100010386 Ga0068856_1000103866 333
425 3300005614 Ga0068856_100050306 Ga0068856_1000503062 333
426 3300005616 Ga0068852_100002732 Ga0068852_1000027324 333
427 3300005616 Ga0068852_100003279 Ga0068852_1000032796 333
428 3300005616 Ga0068852_100019123 Ga0068852_1000191233 333
429 3300005617 Ga0068859_100015281 Ga0068859_1000152813 333
430 3300005618 Ga0068864_100007105 Ga0068864_1000071053 333
431 3300005618 Ga0068864_100017132 Ga0068864_1000171322 333
432 3300005618 Ga0068864_100018403 Ga0068864_1000184037 333
433 3300005618 Ga0068864_100133674 Ga0068864_1001336742 333
434 3300005719 Ga0068861_100020915 Ga0068861_1000209153 333
435 3300005719 Ga0068861_100271443 Ga0068861_1002714432 333
436 3300005834 Ga0068851_10001640 Ga0068851_100016406 333
437 3300005834 Ga0068851_10037711 Ga0068851_100377112 333
438 3300005834 Ga0068851_10100016 Ga0068851_101000162 333
439 3300005840 Ga0068870_10058606 Ga0068870_100586062 333
440 3300005841 Ga0068863_100015542 Ga0068863_1000155422 333
441 3300005841 Ga0068863_100212633 Ga0068863_1002126332 333
442 3300005841 Ga0068863_100216006 Ga0068863_1002160062 333
443 3300005842 Ga0068858_100072444 Ga0068858_1000724442 333
444 3300005842 Ga0068858_100182551 Ga0068858_1001825511 333
445 3300005843 Ga0068860_100065334 Ga0068860_1000653344 333
446 3300005843 Ga0068860_100077094 Ga0068860_1000770944 333
447 3300005844 Ga0068862_100055523 Ga0068862_1000555233 333
448 3300005985 Ga0081539_10042797 Ga0081539_100427972 333
449 3300006175 Ga0070712_100096413 Ga0070712_1000964134 333
450 3300006237 Ga0097621_100013194 Ga0097621_1000131944 333
451 3300006237 Ga0097621_100056010 Ga0097621_1000560105 333
452 3300006237 Ga0097621_100117195 Ga0097621_1001171952 333
453 3300006237 Ga0097621_100133217 Ga0097621_1001332172 333
454 3300006358 Ga0068871_100004698 Ga0068871_1000046986 333
455 3300006358 Ga0068871_100071275 Ga0068871_1000712754 333
456 3300006358 Ga0068871_100084361 Ga0068871_1000843612 333
457 3300006358 Ga0068871_100258476 Ga0068871_1002584761 333
458 3300006844 Ga0075428_100267822 Ga0075428_1002678222 333
459 3300006871 Ga0075434_100088450 Ga0075434_1000884503 333
460 3300006871 Ga0075434_100321121 Ga0075434_1003211212 333
461 3300006881 Ga0068865_100061221 Ga0068865_1000612212 333
462 3300006881 Ga0068865_100130768 Ga0068865_1001307683 333
463 3300006931 Ga0097620_100015279 Ga0097620_1000152793 333
464 3300009093 Ga0105240_10018384 Ga0105240_1001838410 333
465 3300009093 Ga0105240_10020207 Ga0105240_100202076 333
466 3300009093 Ga0105240_10028464 Ga0105240_100284644 333
467 3300009147 Ga0114129_10726224 Ga0114129_107262241 333
468 3300009176 Ga0105242_10309544 Ga0105242_103095442 333
469 3300009177 Ga0105248_10001225 Ga0105248_1000122526 333
470 3300009177 Ga0105248_10135388 Ga0105248_101353882 333
471 3300009545 Ga0105237_10220558 Ga0105237_102205582 333
472 3300009545 Ga0105237_10252110 Ga0105237_102521102 333
473 3300009551 Ga0105238_10008927 Ga0105238_100089275 333
474 3300009551 Ga0105238_10196799 Ga0105238_101967992 333
475 3300009553 Ga0105249_10092876 Ga0105249_100928763 333
476 3300009553 Ga0105249_10231855 Ga0105249_102318552 333
477 3300010375 Ga0105239_10070454 Ga0105239_100704543 333
478 3300010375 Ga0105239_10152195 Ga0105239_101521951 333
479 3300010375 Ga0105239_10527065 Ga0105239_105270651 333
480 3300013100 Ga0157373_10001379 Ga0157373_1000137913 333
481 3300013100 Ga0157373_10015272 Ga0157373_100152723 333
482 3300013100 Ga0157373_10019295 Ga0157373_100192955 333
483 3300013100 Ga0157373_10189553 Ga0157373_101895532 333
484 3300013102 Ga0157371_10005607 Ga0157371_1000560710 333
485 3300013102 Ga0157371_10106698 Ga0157371_101066982 333
486 3300013102 Ga0157371_10179597 Ga0157371_101795972 333
487 3300013104 Ga0157370_10002935 Ga0157370_1000293518 333
488 3300013104 Ga0157370_10013191 Ga0157370_100131916 333
489 3300013104 Ga0157370_10020764 Ga0157370_100207645 333
490 3300013104 Ga0157370_10056890 Ga0157370_100568903 333
491 3300013104 Ga0157370_10143469 Ga0157370_101434693 333
492 3300013104 Ga0157370_10266230 Ga0157370_102662302 333
493 3300013105 Ga0157369_10005349 Ga0157369_1000534912 333
494 3300013105 Ga0157369_10040426 Ga0157369_100404265 333
495 3300013105 Ga0157369_10213141 Ga0157369_102131412 333
496 3300013105 Ga0157369_10461971 Ga0157369_104619712 333
497 3300013296 Ga0157374_10021418 Ga0157374_100214183 333
498 3300013296 Ga0157374_10080988 Ga0157374_100809883 333
499 3300013296 Ga0157374_10179947 Ga0157374_101799472 333
500 3300013296 Ga0157374_10184643 Ga0157374_101846432 333
501 3300013297 Ga0157378_10191448 Ga0157378_101914481 333
502 3300013297 Ga0157378_10379672 Ga0157378_103796721 333
503 3300013306 Ga0163162_10059011 Ga0163162_100590113 333
504 3300013306 Ga0163162_10115317 Ga0163162_101153172 333
505 3300013306 Ga0163162_10136132 Ga0163162_101361322 333
506 3300013307 Ga0157372_10001772 Ga0157372_1000177225 333
507 3300013307 Ga0157372_10018658 Ga0157372_100186588 333
508 3300013307 Ga0157372_10139004 Ga0157372_101390044 333
509 3300013307 Ga0157372_10194792 Ga0157372_101947922 333
510 3300013307 Ga0157372_10349325 Ga0157372_103493252 333
511 3300013308 Ga0157375_10106761 Ga0157375_101067614 333
512 3300013308 Ga0157375_10455019 Ga0157375_104550192 333
513 3300014325 Ga0163163_10229130 Ga0163163_102291302 333
514 3300014325 Ga0163163_10229622 Ga0163163_102296221 333
515 3300014326 Ga0157380_10095741 Ga0157380_100957413 333
516 3300014326 Ga0157380_10399210 Ga0157380_103992101 333
517 3300014968 Ga0157379_10012130 Ga0157379_100121302 333
518 3300014968 Ga0157379_10017214 Ga0157379_100172144 333
519 3300014968 Ga0157379_10093104 Ga0157379_100931043 333
520 3300014969 Ga0157376_10047180 Ga0157376_100471804 333
521 3300017792 Ga0163161_10053766 Ga0163161_100537662 333
522 3300017792 Ga0163161_10057587 Ga0163161_100575873 333
523 3300017792 Ga0163161_10120716 Ga0163161_101207162 333
524 3300020070 Ga0206356_11461543 Ga0206356_114615434 333
525 3300020082 Ga0206353_10236115 Ga0206353_102361152 333
526 3300025315 Ga0207697_10001482 Ga0207697_1000148214 333
527 3300025893 Ga0207682_10001318 Ga0207682_100013189 333
528 3300025893 Ga0207682_10007381 Ga0207682_100073812 333
529 3300025903 Ga0207680_10142648 Ga0207680_101426482 333
530 3300025907 Ga0207645_10000331 Ga0207645_1000033122 333
531 3300025907 Ga0207645_10020552 Ga0207645_100205526 333
532 3300025907 Ga0207645_10059692 Ga0207645_100596922 333
533 3300025908 Ga0207643_10001108 Ga0207643_1000110813 333
534 3300025908 Ga0207643_10111769 Ga0207643_101117691 333
535 3300025909 Ga0207705_10114288 Ga0207705_101142882 333
536 3300025909 Ga0207705_10128151 Ga0207705_101281513 333
537 3300025909 Ga0207705_10190102 Ga0207705_101901022 333
538 3300025909 Ga0207705_10190370 Ga0207705_101903702 333
539 3300025912 Ga0207707_10008263 Ga0207707_100082632 333
540 3300025912 Ga0207707_10069403 Ga0207707_100694035 333
541 3300025913 Ga0207695_10074196 Ga0207695_100741961 333
542 3300025913 Ga0207695_10167310 Ga0207695_101673102 333
543 3300025915 Ga0207693_10091135 Ga0207693_100911354 333
544 3300025917 Ga0207660_10022105 Ga0207660_100221053 333
545 3300025917 Ga0207660_10176845 Ga0207660_101768452 333
546 3300025919 Ga0207657_10001000 Ga0207657_100010006 333
547 3300025919 Ga0207657_10014530 Ga0207657_100145306 333
548 3300025919 Ga0207657_10032471 Ga0207657_100324713 333
549 3300025919 Ga0207657_10119234 Ga0207657_101192343 333
550 3300025919 Ga0207657_10125730 Ga0207657_101257302 333
551 3300025920 Ga0207649_10006345 Ga0207649_100063456 333
552 3300025921 Ga0207652_10009287 Ga0207652_100092876 333
553 3300025921 Ga0207652_10018041 Ga0207652_100180416 333
554 3300025923 Ga0207681_10049092 Ga0207681_100490923 333
555 3300025924 Ga0207694_10014534 Ga0207694_100145346 333
556 3300025924 Ga0207694_10021564 Ga0207694_100215644 333
557 3300025925 Ga0207650_10034273 Ga0207650_100342733 333
558 3300025925 Ga0207650_10044835 Ga0207650_100448353 333
559 3300025925 Ga0207650_10056570 Ga0207650_100565703 333
560 3300025925 Ga0207650_10057719 Ga0207650_100577193 333
561 3300025925 Ga0207650_10061300 Ga0207650_100613003 333
562 3300025926 Ga0207659_10014770 Ga0207659_100147706 333
563 3300025926 Ga0207659_10026217 Ga0207659_100262174 333
564 3300025926 Ga0207659_10084411 Ga0207659_100844113 333
565 3300025928 Ga0207700_10037722 Ga0207700_100377225 333
566 3300025929 Ga0207664_10049607 Ga0207664_100496073 333
567 3300025929 Ga0207664_10072300 Ga0207664_100723004 333
568 3300025931 Ga0207644_10003932 Ga0207644_100039324 333
569 3300025931 Ga0207644_10008387 Ga0207644_100083876 333
570 3300025931 Ga0207644_10011828 Ga0207644_100118284 333
571 3300025932 Ga0207690_10017644 Ga0207690_100176444 333
572 3300025932 Ga0207690_10158258 Ga0207690_101582582 333
573 3300025933 Ga0207706_10000854 Ga0207706_1000085422 333
574 3300025933 Ga0207706_10007248 Ga0207706_1000724810 333
575 3300025933 Ga0207706_10015396 Ga0207706_100153967 333
576 3300025933 Ga0207706_10332238 Ga0207706_103322382 333
577 3300025936 Ga0207670_10129669 Ga0207670_101296692 333
578 3300025937 Ga0207669_10002807 Ga0207669_100028079 333
579 3300025937 Ga0207669_10111983 Ga0207669_101119832 333
580 3300025937 Ga0207669_10186463 Ga0207669_101864632 333
581 3300025938 Ga0207704_10019141 Ga0207704_100191413 333
582 3300025938 Ga0207704_10064358 Ga0207704_100643582 333
583 3300025940 Ga0207691_10000122 Ga0207691_1000012214 333
584 3300025940 Ga0207691_10000772 Ga0207691_1000077232 333
585 3300025940 Ga0207691_10100924 Ga0207691_101009243 333
586 3300025941 Ga0207711_10138857 Ga0207711_101388572 333
587 3300025942 Ga0207689_10001927 Ga0207689_1000192714 333
588 3300025942 Ga0207689_10040830 Ga0207689_100408305 333
589 3300025944 Ga0207661_10010299 Ga0207661_100102995 333
590 3300025944 Ga0207661_10178940 Ga0207661_101789402 333
591 3300025945 Ga0207679_10015734 Ga0207679_100157343 333
592 3300025945 Ga0207679_10078160 Ga0207679_100781603 333
593 3300025945 Ga0207679_10251969 Ga0207679_102519692 333
594 3300025945 Ga0207679_10268270 Ga0207679_102682702 333
595 3300025945 Ga0207679_10279485 Ga0207679_102794852 333
596 3300025949 Ga0207667_10002343 Ga0207667_100023438 333
597 3300025949 Ga0207667_10094773 Ga0207667_100947733 333
598 3300025949 Ga0207667_10204862 Ga0207667_102048623 333
599 3300025949 Ga0207667_10214468 Ga0207667_102144682 333
600 3300025960 Ga0207651_10044425 Ga0207651_100444254 333
601 3300025960 Ga0207651_10161962 Ga0207651_101619622 333
602 3300025961 Ga0207712_10192494 Ga0207712_101924942 333
603 3300025972 Ga0207668_10018007 Ga0207668_100180076 333
604 3300025981 Ga0207640_10008758 Ga0207640_100087583 333
605 3300025981 Ga0207640_10049870 Ga0207640_100498702 333
606 3300025986 Ga0207658_10013937 Ga0207658_100139376 333
607 3300025986 Ga0207658_10019542 Ga0207658_100195422 333
608 3300025986 Ga0207658_10071368 Ga0207658_100713683 333
609 3300025986 Ga0207658_10181302 Ga0207658_101813022 333
610 3300026023 Ga0207677_10018321 Ga0207677_100183215 333
611 3300026023 Ga0207677_10072764 Ga0207677_100727643 333
612 3300026023 Ga0207677_10231064 Ga0207677_102310642 333
613 3300026035 Ga0207703_10024218 Ga0207703_100242185 333
614 3300026035 Ga0207703_10043079 Ga0207703_100430793 333
615 3300026035 Ga0207703_10128218 Ga0207703_101282182 333
616 3300026041 Ga0207639_10009491 Ga0207639_100094913 333
617 3300026041 Ga0207639_10029203 Ga0207639_100292033 333
618 3300026067 Ga0207678_10007312 Ga0207678_100073122 333
619 3300026067 Ga0207678_10011189 Ga0207678_100111896 333
620 3300026067 Ga0207678_10015432 Ga0207678_100154323 333
621 3300026067 Ga0207678_10208163 Ga0207678_102081632 333
622 3300026075 Ga0207708_10234001 Ga0207708_102340012 333
623 3300026078 Ga0207702_10003836 Ga0207702_100038364 333
624 3300026078 Ga0207702_10014082 Ga0207702_100140824 333
625 3300026078 Ga0207702_10045737 Ga0207702_100457373 333
626 3300026078 Ga0207702_10049161 Ga0207702_100491613 333
627 3300026078 Ga0207702_10146000 Ga0207702_101460003 333
628 3300026088 Ga0207641_10072505 Ga0207641_100725055 333
629 3300026088 Ga0207641_10125576 Ga0207641_101255761 333
630 3300026088 Ga0207641_10304927 Ga0207641_103049272 333
631 3300026089 Ga0207648_10014574 Ga0207648_100145743 333
632 3300026089 Ga0207648_10017253 Ga0207648_100172537 333
633 3300026089 Ga0207648_10019771 Ga0207648_100197718 333
634 3300026089 Ga0207648_10048131 Ga0207648_100481312 333
635 3300026095 Ga0207676_10006704 Ga0207676_100067041 333
636 3300026116 Ga0207674_10000694 Ga0207674_1000069439 333
637 3300026116 Ga0207674_10001128 Ga0207674_1000112810 333
638 3300026116 Ga0207674_10006144 Ga0207674_100061448 333
639 3300026116 Ga0207674_10210919 Ga0207674_102109191 333
640 3300026118 Ga0207675_100000871 Ga0207675_1000008713 333
641 3300026118 Ga0207675_100004627 Ga0207675_1000046276 333
642 3300026118 Ga0207675_100030831 Ga0207675_1000308312 333
643 3300026121 Ga0207683_10000005 Ga0207683_1000000536 333
644 3300026121 Ga0207683_10004773 Ga0207683_100047732 333
645 3300026121 Ga0207683_10015805 Ga0207683_100158056 333
646 3300026121 Ga0207683_10084179 Ga0207683_100841793 333
647 3300026121 Ga0207683_10321686 Ga0207683_103216861 333
648 3300026142 Ga0207698_10001960 Ga0207698_100019606 333
649 3300026142 Ga0207698_10021781 Ga0207698_100217814 333
650 3300026142 Ga0207698_10025539 Ga0207698_100255395 333
651 3300026142 Ga0207698_10341426 Ga0207698_103414261 333
652 3300027471 Ga0209995_1011156 Ga0209995_10111561 333
653 3300027876 Ga0209974_10002039 Ga0209974_100020393 333
654 3300027876 Ga0209974_10040668 Ga0209974_100406682 333
655 3300028379 Ga0268266_10034562 Ga0268266_100345625 333
656 3300028379 Ga0268266_10213272 Ga0268266_102132721 333
657 3300028379 Ga0268266_10402793 Ga0268266_104027932 333
658 3300028380 Ga0268265_10018470 Ga0268265_100184703 333
659 3300028381 Ga0268264_10013772 Ga0268264_100137726 333
660 3300028381 Ga0268264_10044953 Ga0268264_100449531 333
661 3300029957 Ga0265324_10000001 Ga0265324_10000001200 333
662 3300031241 Ga0265325_10000542 Ga0265325_100005427 333
663 3300031344 Ga0265316_10224637 Ga0265316_102246372 333
664 3300031548 Ga0307408_100002911 Ga0307408_10000291111 333
665 3300031548 Ga0307408_100057101 Ga0307408_1000571012 333
666 3300031548 Ga0307408_100106422 Ga0307408_1001064223 333
667 3300031691 Ga0316579_10003975 Ga0316579_100039754 333
668 3300031691 Ga0316579_10010044 Ga0316579_100100445 333
669 3300031711 Ga0265314_10157317 Ga0265314_101573172 333
670 3300031727 Ga0316576_10048257 Ga0316576_100482574 333
671 3300031728 Ga0316578_10010133 Ga0316578_100101331 333
672 3300031731 Ga0307405_10003878 Ga0307405_100038783 333
673 3300031731 Ga0307405_10017485 Ga0307405_100174855 333
674 3300031733 Ga0316577_10003010 Ga0316577_100030101 333
675 3300031824 Ga0307413_10001237 Ga0307413_100012378 333
676 3300031852 Ga0307410_10009907 Ga0307410_100099074 333
677 3300031852 Ga0307410_10014406 Ga0307410_100144063 333
678 3300031852 Ga0307410_10137685 Ga0307410_101376851 333
679 3300031901 Ga0307406_10004415 Ga0307406_100044154 333
680 3300031901 Ga0307406_10034187 Ga0307406_100341871 333
681 3300031903 Ga0307407_10064001 Ga0307407_100640011 333
682 3300031903 Ga0307407_10112942 Ga0307407_101129422 333
683 3300031911 Ga0307412_10028767 Ga0307412_100287674 333
684 3300031995 Ga0307409_100029836 Ga0307409_1000298365 333
685 3300031995 Ga0307409_100117877 Ga0307409_1001178772 333
686 3300032002 Ga0307416_100035373 Ga0307416_1000353734 333
687 3300032004 Ga0307414_10261984 Ga0307414_102619842 333
688 3300032005 Ga0307411_10000127 Ga0307411_1000012715 333
689 3300032005 Ga0307411_10042097 Ga0307411_100420973 333
690 3300032005 Ga0307411_10358727 Ga0307411_103587271 333
691 3300032126 Ga0307415_100003315 Ga0307415_1000033152 333
692 3300032133 Ga0316583_10030946 Ga0316583_100309462 333
693 3300032133 Ga0316583_10048555 Ga0316583_100485551 333
694 3300032137 Ga0316585_10016146 Ga0316585_100161461 333
695 3300032139 Ga0316580_10018726 Ga0316580_100187262 333
696 3300033541 Ga0316596_1002051 Ga0316596_10020511 333
697 3300035398 Ga0316574_0001261 Ga0316574_0001261_5786_6826 333
698 3300035398 Ga0316574_0004450 Ga0316574_0004450_4250_5281 333
699 3300035398 Ga0316574_0033809 Ga0316574_0033809_298_1329 333
700 3300035695 Ga0373927_0117713 Ga0373927_0117713_557_1588 333
701 3300036401 Ga0373937_0040788 Ga0373937_0040788_2109_3140 333
702 3300036401 Ga0373937_0168682 Ga0373937_0168682_577_1608 333
703 3300036647 Ga0316582_0009509 Ga0316582_0009509_3745_4776 333
704 3300036647 Ga0316582_0055880 Ga0316582_0055880_719_1750 333
705 3300036712 Ga0316584_0002039 Ga0316584_0002039_1435_2466 333
706 3300036712 Ga0316584_0004127 Ga0316584_0004127_2575_3606 333
707 3300037068 Ga0373925_0216161 Ga0373925_0216161_212_1243 333
708 3300037312 Ga0395899_0214769 Ga0395899_0214769_186_1217 333
709 3300037418 Ga0395900_0395256 Ga0395900_0395256_56_1087 333
710 3300038443 Ga0395901_0040793 Ga0395901_0040793_591_1622 333
711 3300041512 Ga0451853_2089945 Ga0451853_2089945_261_1292 333
712 3300042012 Ga0439455_0050163 Ga0439455_0050163_34_1065 333
713 3300042876 Ga0451577_0192340 Ga0451577_0192340_121_1152 333
714 3300045976 Ga0466967_0480879 Ga0466967_0480879_127_1158 333
715 3300048903 Ga0496100_0049877 Ga0496100_0049877_86_1117 333
716 3300048904 Ga0496101_0156327 Ga0496101_0156327_154_1185 333
717 3300048905 Ga0496102_0013642 Ga0496102_0013642_744_1775 333
718 3300048908 Ga0496105_0020268 Ga0496105_0020268_3890_4921 333
719 3300048909 Ga0496106_0044631 Ga0496106_0044631_1883_2914 333
720 3300048909 Ga0496106_0100662 Ga0496106_0100662_42_1073 333
721 3300048909 Ga0496106_0197689 Ga0496106_0197689_366_1397 333
722 3300048910 Ga0496107_0037001 Ga0496107_0037001_2243_3274 333
723 3300048911 Ga0496108_0001943 Ga0496108_0001943_4686_5717 333
724 3300048912 Ga0496109_0007082 Ga0496109_0007082_5184_6215 333
725 3300048912 Ga0496109_0087616 Ga0496109_0087616_1101_2132 333
726 3300048913 Ga0496110_0110755 Ga0496110_0110755_24_1055 333
727 3300048915 Ga0496112_0019957 Ga0496112_0019957_1113_2144 333
728 3300048915 Ga0496112_0130501 Ga0496112_0130501_82_1161 333
729 3300048917 Ga0496114_0100347 Ga0496114_0100347_1024_2055 333
730 3300048917 Ga0496114_0363031 Ga0496114_0363031_93_1124 333
731 3300049578 Ga0501042_0125352 Ga0501042_0125352_68_1111 333
732 3300049585 Ga0501069_0087657 Ga0501069_0087657_353_1396 333
733 3300049590 Ga0501074_0039704 Ga0501074_0039704_1348_2391 333
734 3300050511 nmdc:mga08y16_84834_c1 nmdc:mga08y16_84834_c1_881_1912 333
735 3300050512 nmdc:mga0n895_185344_c1 nmdc:mga0n895_185344_c1_289_1320 333
736 3300050512 nmdc:mga0n895_255694_c1 nmdc:mga0n895_255694_c1_283_1314 333
737 3300050513 nmdc:mga0rr50_49968_c1 nmdc:mga0rr50_49968_c1_1697_2728 333
738 3300005293 Ga0065715_10172172 Ga0065715_101721721 334
739 3300005328 Ga0070676_10028584 Ga0070676_100285842 334
740 3300005330 Ga0070690_100000521 Ga0070690_1000005213 334
741 3300005331 Ga0070670_100078531 Ga0070670_1000785313 334
742 3300005331 Ga0070670_100110155 Ga0070670_1001101552 334
743 3300005334 Ga0068869_100000591 Ga0068869_10000059114 334
744 3300005334 Ga0068869_100152584 Ga0068869_1001525842 334
745 3300005334 Ga0068869_100214924 Ga0068869_1002149242 334
746 3300005335 Ga0070666_10000774 Ga0070666_1000077417 334
747 3300005335 Ga0070666_10001704 Ga0070666_1000170412 334
748 3300005338 Ga0068868_100044081 Ga0068868_1000440812 334
749 3300005338 Ga0068868_100136300 Ga0068868_1001363002 334
750 3300005338 Ga0068868_100189384 Ga0068868_1001893842 334
751 3300005339 Ga0070660_100015683 Ga0070660_1000156835 334
752 3300005340 Ga0070689_100001865 Ga0070689_10000186514 334
753 3300005344 Ga0070661_100008317 Ga0070661_1000083176 334
754 3300005347 Ga0070668_100001121 Ga0070668_1000011214 334
755 3300005347 Ga0070668_100006569 Ga0070668_1000065698 334
756 3300005353 Ga0070669_100014524 Ga0070669_1000145242 334
757 3300005353 Ga0070669_100147678 Ga0070669_1001476781 334
758 3300005355 Ga0070671_100014880 Ga0070671_1000148804 334
759 3300005356 Ga0070674_100006377 Ga0070674_1000063778 334
760 3300005364 Ga0070673_100001471 Ga0070673_10000147114 334
761 3300005364 Ga0070673_100001499 Ga0070673_10000149914 334
762 3300005365 Ga0070688_100001931 Ga0070688_1000019318 334
763 3300005365 Ga0070688_100162213 Ga0070688_1001622132 334
764 3300005366 Ga0070659_100162190 Ga0070659_1001621902 334
765 3300005367 Ga0070667_100000863 Ga0070667_1000008636 334
766 3300005367 Ga0070667_100168479 Ga0070667_1001684792 334
767 3300005435 Ga0070714_100003499 Ga0070714_1000034998 334
768 3300005436 Ga0070713_100000853 Ga0070713_10000085321 334
769 3300005436 Ga0070713_100006960 Ga0070713_1000069604 334
770 3300005436 Ga0070713_100016724 Ga0070713_1000167243 334
771 3300005437 Ga0070710_10021886 Ga0070710_100218863 334
772 3300005439 Ga0070711_100010124 Ga0070711_1000101246 334
773 3300005440 Ga0070705_100027467 Ga0070705_1000274674 334
774 3300005444 Ga0070694_100116447 Ga0070694_1001164472 334
775 3300005445 Ga0070708_100120336 Ga0070708_1001203361 334
776 3300005457 Ga0070662_100012355 Ga0070662_1000123555 334
777 3300005457 Ga0070662_100156813 Ga0070662_1001568132 334
778 3300005459 Ga0068867_100003381 Ga0068867_10000338112 334
779 3300005467 Ga0070706_100009375 Ga0070706_1000093757 334
780 3300005467 Ga0070706_100018225 Ga0070706_1000182256 334
781 3300005467 Ga0070706_100079995 Ga0070706_1000799952 334
782 3300005468 Ga0070707_100039220 Ga0070707_1000392203 334
783 3300005468 Ga0070707_100044145 Ga0070707_1000441453 334
784 3300005468 Ga0070707_100130285 Ga0070707_1001302852 334
785 3300005468 Ga0070707_100138387 Ga0070707_1001383872 334
786 3300005471 Ga0070698_100043258 Ga0070698_1000432584 334
787 3300005518 Ga0070699_100020295 Ga0070699_1000202955 334
788 3300005536 Ga0070697_100066453 Ga0070697_1000664532 334
789 3300005536 Ga0070697_100129359 Ga0070697_1001293591 334
790 3300005536 Ga0070697_100178686 Ga0070697_1001786862 334
791 3300005544 Ga0070686_100099309 Ga0070686_1000993092 334
792 3300005545 Ga0070695_100013699 Ga0070695_1000136995 334
793 3300005546 Ga0070696_100160214 Ga0070696_1001602142 334
794 3300005546 Ga0070696_100163669 Ga0070696_1001636691 334
795 3300005547 Ga0070693_100000378 Ga0070693_1000003788 334
796 3300005548 Ga0070665_100005926 Ga0070665_1000059264 334
797 3300005549 Ga0070704_100015536 Ga0070704_1000155363 334
798 3300005563 Ga0068855_100038385 Ga0068855_1000383854 334
799 3300005577 Ga0068857_100019755 Ga0068857_1000197556 334
800 3300005578 Ga0068854_100024845 Ga0068854_1000248455 334
801 3300005614 Ga0068856_100051117 Ga0068856_1000511173 334
802 3300005615 Ga0070702_100030449 Ga0070702_1000304494 334
803 3300005617 Ga0068859_100000594 Ga0068859_10000059432 334
804 3300005617 Ga0068859_100002773 Ga0068859_1000027738 334
805 3300005618 Ga0068864_100001433 Ga0068864_1000014338 334
806 3300005618 Ga0068864_100002465 Ga0068864_1000024657 334
807 3300005618 Ga0068864_100083623 Ga0068864_1000836234 334
808 3300005718 Ga0068866_10016847 Ga0068866_100168472 334
809 3300005719 Ga0068861_100000705 Ga0068861_10000070515 334
810 3300005840 Ga0068870_10038881 Ga0068870_100388813 334
811 3300005841 Ga0068863_100002710 Ga0068863_1000027102 334
812 3300005841 Ga0068863_100004302 Ga0068863_10000430215 334
813 3300005841 Ga0068863_100008973 Ga0068863_1000089733 334
814 3300005842 Ga0068858_100006368 Ga0068858_10000636813 334
815 3300005842 Ga0068858_100042025 Ga0068858_1000420253 334
816 3300005843 Ga0068860_100024779 Ga0068860_1000247796 334
817 3300005843 Ga0068860_100036963 Ga0068860_1000369636 334
818 3300005843 Ga0068860_100053257 Ga0068860_1000532572 334
819 3300005843 Ga0068860_100093577 Ga0068860_1000935773 334
820 3300005844 Ga0068862_100005456 Ga0068862_1000054568 334
821 3300006173 Ga0070716_100032117 Ga0070716_1000321172 334
822 3300006173 Ga0070716_100060768 Ga0070716_1000607683 334
823 3300006175 Ga0070712_100059884 Ga0070712_1000598842 334
824 3300006358 Ga0068871_100142392 Ga0068871_1001423922 334
825 3300006358 Ga0068871_100258510 Ga0068871_1002585102 334
826 3300006871 Ga0075434_100030898 Ga0075434_1000308984 334
827 3300006881 Ga0068865_100079218 Ga0068865_1000792183 334
828 3300006931 Ga0097620_100000594 Ga0097620_10000059432 334
829 3300006931 Ga0097620_100002774 Ga0097620_10000277413 334
830 3300007076 Ga0075435_100039517 Ga0075435_1000395175 334
831 3300007076 Ga0075435_100148515 Ga0075435_1001485153 334
832 3300009098 Ga0105245_10010967 Ga0105245_100109673 334
833 3300009098 Ga0105245_10032337 Ga0105245_100323375 334
834 3300009098 Ga0105245_10050485 Ga0105245_100504855 334
835 3300009098 Ga0105245_10335906 Ga0105245_103359062 334
836 3300009101 Ga0105247_10007921 Ga0105247_100079215 334
837 3300009147 Ga0114129_10232513 Ga0114129_102325132 334
838 3300009147 Ga0114129_10240327 Ga0114129_102403274 334
839 3300009174 Ga0105241_10220027 Ga0105241_102200272 334
840 3300009177 Ga0105248_10265962 Ga0105248_102659622 334
841 3300009545 Ga0105237_10105489 Ga0105237_101054892 334
842 3300009551 Ga0105238_10039286 Ga0105238_100392865 334
843 3300009551 Ga0105238_10303709 Ga0105238_103037091 334
844 3300010375 Ga0105239_10113547 Ga0105239_101135473 334
845 3300013104 Ga0157370_10032253 Ga0157370_100322534 334
846 3300013296 Ga0157374_10005165 Ga0157374_100051654 334
847 3300013297 Ga0157378_10004871 Ga0157378_1000487113 334
848 3300013306 Ga0163162_10004885 Ga0163162_1000488512 334
849 3300013306 Ga0163162_10041348 Ga0163162_100413485 334
850 3300013308 Ga0157375_10004384 Ga0157375_100043848 334
851 3300014968 Ga0157379_10001374 Ga0157379_100013748 334
852 3300014968 Ga0157379_10011623 Ga0157379_100116234 334
853 3300014969 Ga0157376_10021708 Ga0157376_100217084 334
854 3300014969 Ga0157376_10028228 Ga0157376_100282285 334
855 3300017792 Ga0163161_10091122 Ga0163161_100911222 334
856 3300025315 Ga0207697_10020055 Ga0207697_100200554 334
857 3300025898 Ga0207692_10041356 Ga0207692_100413562 334
858 3300025899 Ga0207642_10008244 Ga0207642_100082444 334
859 3300025903 Ga0207680_10004681 Ga0207680_100046815 334
860 3300025903 Ga0207680_10078757 Ga0207680_100787572 334
861 3300025907 Ga0207645_10000039 Ga0207645_1000003982 334
862 3300025910 Ga0207684_10102396 Ga0207684_101023961 334
863 3300025911 Ga0207654_10060700 Ga0207654_100607003 334
864 3300025911 Ga0207654_10145140 Ga0207654_101451402 334
865 3300025912 Ga0207707_10058381 Ga0207707_100583812 334
866 3300025915 Ga0207693_10000397 Ga0207693_100003973 334
867 3300025915 Ga0207693_10027063 Ga0207693_100270632 334
868 3300025916 Ga0207663_10028987 Ga0207663_100289872 334
869 3300025918 Ga0207662_10065329 Ga0207662_100653292 334
870 3300025919 Ga0207657_10000394 Ga0207657_1000039412 334
871 3300025922 Ga0207646_10037198 Ga0207646_100371983 334
872 3300025923 Ga0207681_10002345 Ga0207681_100023456 334
873 3300025923 Ga0207681_10011778 Ga0207681_100117785 334
874 3300025925 Ga0207650_10001745 Ga0207650_100017457 334
875 3300025925 Ga0207650_10026853 Ga0207650_100268533 334
876 3300025926 Ga0207659_10161435 Ga0207659_101614352 334
877 3300025927 Ga0207687_10007739 Ga0207687_100077397 334
878 3300025928 Ga0207700_10000074 Ga0207700_1000007448 334
879 3300025928 Ga0207700_10010760 Ga0207700_100107606 334
880 3300025928 Ga0207700_10029252 Ga0207700_100292524 334
881 3300025929 Ga0207664_10001185 Ga0207664_100011856 334
882 3300025931 Ga0207644_10038706 Ga0207644_100387062 334
883 3300025933 Ga0207706_10002859 Ga0207706_100028598 334
884 3300025933 Ga0207706_10184716 Ga0207706_101847161 334
885 3300025934 Ga0207686_10000211 Ga0207686_1000021133 334
886 3300025936 Ga0207670_10136754 Ga0207670_101367542 334
887 3300025939 Ga0207665_10054762 Ga0207665_100547622 334
888 3300025939 Ga0207665_10126862 Ga0207665_101268622 334
889 3300025940 Ga0207691_10000027 Ga0207691_1000002737 334
890 3300025941 Ga0207711_10000116 Ga0207711_1000011652 334
891 3300025941 Ga0207711_10036322 Ga0207711_100363223 334
892 3300025942 Ga0207689_10000548 Ga0207689_100005488 334
893 3300025942 Ga0207689_10006355 Ga0207689_100063559 334
894 3300025942 Ga0207689_10085284 Ga0207689_100852841 334
895 3300025960 Ga0207651_10329329 Ga0207651_103293291 334
896 3300025972 Ga0207668_10002876 Ga0207668_100028765 334
897 3300025981 Ga0207640_10072147 Ga0207640_100721473 334
898 3300025986 Ga0207658_10012633 Ga0207658_100126332 334
899 3300025986 Ga0207658_10013907 Ga0207658_100139073 334
900 3300026023 Ga0207677_10000598 Ga0207677_100005988 334
901 3300026023 Ga0207677_10036280 Ga0207677_100362802 334
902 3300026023 Ga0207677_10058229 Ga0207677_100582293 334
903 3300026035 Ga0207703_10000357 Ga0207703_1000035726 334
904 3300026035 Ga0207703_10000746 Ga0207703_100007468 334
905 3300026067 Ga0207678_10082708 Ga0207678_100827083 334
906 3300026078 Ga0207702_10088947 Ga0207702_100889472 334
907 3300026088 Ga0207641_10007190 Ga0207641_100071905 334
908 3300026088 Ga0207641_10009017 Ga0207641_1000901710 334
909 3300026089 Ga0207648_10000149 Ga0207648_1000014949 334
910 3300026089 Ga0207648_10007044 Ga0207648_1000704413 334
911 3300026089 Ga0207648_10014327 Ga0207648_100143272 334
912 3300026095 Ga0207676_10000236 Ga0207676_1000023618 334
913 3300026095 Ga0207676_10012337 Ga0207676_100123372 334
914 3300026116 Ga0207674_10022536 Ga0207674_100225365 334
915 3300026116 Ga0207674_10026234 Ga0207674_100262346 334
916 3300026118 Ga0207675_100000230 Ga0207675_10000023019 334
917 3300026121 Ga0207683_10000285 Ga0207683_1000028536 334
918 3300026121 Ga0207683_10000364 Ga0207683_100003642 334
919 3300028379 Ga0268266_10008117 Ga0268266_1000811710 334
920 3300028380 Ga0268265_10005441 Ga0268265_100054418 334
921 3300028381 Ga0268264_10002371 Ga0268264_100023716 334
922 3300028381 Ga0268264_10039446 Ga0268264_100394465 334
923 3300035086 Ga0373934_0000450 Ga0373934_0000450_11229_12269 334
924 3300035116 Ga0373945_0042501 Ga0373945_0042501_148_1188 334
925 3300035117 Ga0373953_0004449 Ga0373953_0004449_793_1833 334
926 3300035118 Ga0373954_0000090 Ga0373954_0000090_1826_2866 334
927 3300035119 Ga0373956_0004386 Ga0373956_0004386_643_1683 334
928 3300035120 Ga0373957_0004734 Ga0373957_0004734_637_1677 334
929 3300035170 Ga0373943_0009829 Ga0373943_0009829_579_1619 334
930 3300035170 Ga0373943_0038768 Ga0373943_0038768_809_1849 334
931 3300035171 Ga0373946_0113841 Ga0373946_0113841_15_1055 334
932 3300035692 Ga0373935_0023065 Ga0373935_0023065_1952_2992 334
933 3300035692 Ga0373935_0256356 Ga0373935_0256356_173_1213 334
934 3300035695 Ga0373927_0019318 Ga0373927_0019318_1031_2071 334
935 3300035695 Ga0373927_0030999 Ga0373927_0030999_1594_2634 334
936 3300035725 Ga0373947_0038846 Ga0373947_0038846_517_1557 334
937 3300036401 Ga0373937_0031264 Ga0373937_0031264_1372_2412 334
938 3300036401 Ga0373937_0125613 Ga0373937_0125613_1063_2106 334
939 3300041486 Ga0451807_0812292 Ga0451807_0812292_794_1828 334
940 3300046459 Ga0495629_0072973 Ga0495629_0072973_1314_2354 334
941 3300046472 Ga0495580_0046345 Ga0495580_0046345_637_1677 334
942 3300046472 Ga0495580_0142954 Ga0495580_0142954_578_1618 334
943 3300046473 Ga0495582_0018395 Ga0495582_0018395_1952_2992 334
944 3300046475 Ga0495639_0029001 Ga0495639_0029001_175_1215 334
945 3300046531 Ga0495665_0031115 Ga0495665_0031115_1747_2787 334
946 3300046543 Ga0495645_0179809 Ga0495645_0179809_227_1267 334
947 3300046663 Ga0495635_0003129 Ga0495635_0003129_4160_5200 334
948 3300046664 Ga0495659_0008400 Ga0495659_0008400_761_1801 334
949 3300046683 Ga0495658_0227644 Ga0495658_0227644_43_1083 334
950 3300046809 Ga0495600_0013499 Ga0495600_0013499_2429_3469 334
951 3300047315 Ga0495581_0009908 Ga0495581_0009908_2317_3357 334
952 3300047317 Ga0495604_0086299 Ga0495604_0086299_652_1692 334
953 3300047322 Ga0495680_0027794 Ga0495680_0027794_1668_2708 334
954 3300047471 Ga0495684_0052242 Ga0495684_0052242_375_1415 334
955 3300048904 Ga0496101_0009759 Ga0496101_0009759_1698_2738 334
956 3300048905 Ga0496102_0095561 Ga0496102_0095561_365_1399 334
957 3300048906 Ga0496103_0037694 Ga0496103_0037694_584_1618 334
958 3300048906 Ga0496103_0122994 Ga0496103_0122994_482_1522 334
959 3300048907 Ga0496104_0035404 Ga0496104_0035404_1530_2570 334
960 3300048908 Ga0496105_0010312 Ga0496105_0010312_5104_6144 334
961 3300048909 Ga0496106_0037450 Ga0496106_0037450_1753_2787 334
962 3300048910 Ga0496107_0059285 Ga0496107_0059285_252_1292 334
963 3300048911 Ga0496108_0061510 Ga0496108_0061510_880_1920 334
964 3300048912 Ga0496109_0021461 Ga0496109_0021461_1411_2445 334
965 3300048912 Ga0496109_0116251 Ga0496109_0116251_536_1576 334
966 3300048915 Ga0496112_0000540 Ga0496112_0000540_851_1891 334
967 3300048917 Ga0496114_0065630 Ga0496114_0065630_272_1312 334
968 3300048917 Ga0496114_0086431 Ga0496114_0086431_1495_2529 334
969 3300049585 Ga0501069_0105584 Ga0501069_0105584_316_1356 334
970 3300050507 nmdc:mga05p37_240457_c1 nmdc:mga05p37_240457_c1_976_2049 334
971 3300050512 nmdc:mga0n895_111670_c1 nmdc:mga0n895_111670_c1_1230_2303 334
972 3300050513 nmdc:mga0rr50_5859_c1 nmdc:mga0rr50_5859_c1_624_1697 334
973 3300050513 nmdc:mga0rr50_72129_c1 nmdc:mga0rr50_72129_c1_527_1567 334
974 3300050513 nmdc:mga0rr50_97216_c1 nmdc:mga0rr50_97216_c1_795_1838 334
975 3300050514 nmdc:mga08x19_60696_c1 nmdc:mga08x19_60696_c1_687_1730 334
976 3300053085 Ga0495619_0010282 Ga0495619_0010282_1020_2060 334

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01118

Semialdhyde_dh

Semialdehyde dehydrogenase, NAD binding domain

3

144

0.98

PF02774

Semialdhyde_dhC

Semialdehyde dehydrogenase, dimerisation domain

161

305

0.96

PF22698

Semialdhyde_dhC_1

Semialdehyde dehydrogenase, dimerisation domain

152

302

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2cvo-assembly1.cif.gz_C crystal structure of putative n-acetyl-gamma-glutamyl-phosphate reductase (ak071544) from rice (oryza sativa) 0.9234 2 334
2cvo-assembly1.cif.gz_C crystal structure of putative n-acetyl-gamma-glutamyl-phosphate reductase (ak071544) from rice (oryza sativa) 0.9181 2 334
1xyg-assembly1.cif.gz_D x-ray structure of gene product from arabidopsis thaliana at2g19940 0.9093 2 334
8afv-assembly1.cif.gz_A daargc3 - engineered formyl phosphate reductase with 3 substitutions (s178v, g182v, l233i) 0.9061 3 327
8afu-assembly2.cif.gz_A-2 daargc - n-acetyl-gamma-glutamyl-phosphate reductase of denitrovibrio acetiphilus 0.9058 1 327
ID Description Score Start End Superfamily
af_Q2G1H4_146_311_3.30.360.10 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9063 139 302 3.30.360.10
af_Q2G1H4_146_311_3.30.360.10 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.8908 139 302 3.30.360.10
2i3gB02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.8907 138 302 3.30.360.10
af_I1KL32_193_359_3.30.360.10 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.887 138 302 3.30.360.10
2i3gB02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.8857 138 302 3.30.360.10
ID Description Score Start End GO Terms
AF-A0A5E6N168-F1-model_v4 N-acetyl-gamma-glutamyl-phosphate reductase (EC) (EC 1.2.1.38) 0.9866 233 334 GO:0003942
AF-A0A455UKX9-F1-model_v4 Uncharacterized protein 0.9843 228 334
AF-A0A455UKX9-F1-model_v4 Uncharacterized protein 0.9753 228 334
AF-A0A5E6N168-F1-model_v4 N-acetyl-gamma-glutamyl-phosphate reductase (EC) (EC 1.2.1.38) 0.9678 233 334 GO:0003942
AF-A0A849TEG7-F1-model_v4 N-acetyl-gamma-glutamyl-phosphate reductase (EC 1.2.1.38) 0.9619 1 171 GO:0003942
GO:0006526
GO:0051287

Feature Viewer

pLDDT pTM Quality
87.59 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map