F487262
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 976 | 346 | 968 | 344 |
Family's Representative Sequence
| Representative Sequence | 3300046536|Ga0495587_0040968|Ga0495587_0040968_773_1777 |
| Length | 334 |
| Sequence | MIKVGIVGGTGYTGVELLRLLAVHPEARVQAITSRSEAGVPVGTMFPSLRDQERLSELQFSDPAGAGLSRCDVVFFATPHGVAMAQARELVGAGVKIIDLAADFRLKDTAEFERWYKMPHACPDLLAESVYGLPEMYRDAIRKARIVGNPGCYPTAIQLGFLPLVEAGIVDVDHLIADAKSGVSGAGRKAELGLLFSEASDNFKAYNLGGHRHHPEVVHGLNGRSRSPVTVVFTPLYARLTDRGVDLQALFEKRYASEPFVDVMPAGSHPETRSVRASNVCRIAVHRPQGGDTAVVVAVIDNLVKGAAGQAIQNMNLMFGLAETTGLTAPPVMP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2547132103 | Chromobacterium sp. C-61 | Isolate | Rhizosphere |
| 2 | 2843690924 | Chromobacterium rhizoryzae JP2-74 | Isolate | Rhizosphere |
| 3 | 2846033681 | Chromobacterium sinusclupearum MWU13-2610 | Isolate | Rhizosphere |
| 4 | 2846037992 | Chromobacterium alticapitis MWU14-2602 | Isolate | Rhizosphere |
| 5 | 2891633521 | Azoarcus rhizosphaerae CC-YHH848 | Isolate | Rhizosphere |
| 6 | 2894510363 | Methylomonas sp. Kb3 | Isolate | Unclassified |
| 7 | 2989392574 | Methylomonas rhizoryzae GJ1 | Isolate | Unclassified |
| 8 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 16 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 47 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 56 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 64 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 66 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 67 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 68 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 70 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 71 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 72 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 73 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 74 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 75 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 76 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 77 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 78 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 79 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 80 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 81 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 82 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 83 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 84 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 85 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 86 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 87 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 88 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 90 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 91 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 92 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 93 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 94 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 95 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 96 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 98 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 99 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 128 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 129 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 130 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 198 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 200 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 204 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 205 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 206 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 207 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 208 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 209 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 210 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 211 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 212 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 213 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 214 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 215 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 216 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 217 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 218 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 219 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 220 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 221 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 222 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 223 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 224 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 225 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 226 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 227 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 228 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 229 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 230 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 231 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 232 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 233 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 234 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 235 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 236 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 237 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 238 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 239 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 240 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 241 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 242 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 243 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 244 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 245 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 246 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 247 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 248 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 249 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 250 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 251 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 252 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 253 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 254 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 255 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 256 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 257 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 258 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 259 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 260 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 261 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 262 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 263 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 264 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 265 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 266 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 285 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 286 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 287 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 288 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 289 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 290 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 291 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 292 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 293 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 294 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 295 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 296 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 297 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 300 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 302 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 305 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 309 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 311 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 314 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 318 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 321 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 323 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 327 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 328 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 329 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 330 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 331 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 332 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 333 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 334 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 335 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 336 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 337 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 338 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 339 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 340 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 341 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 343 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 344 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 345 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 346 | 8001522603 | Methylomicrobium sp. RS1 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.77 |
| Metatranscriptomes | 0.41 |
| Isolates | 0.82 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.84 |
| Nodule | 0 |
| Rhizoplane | 3.69 |
| Rhizosphere | 93.95 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.51 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065715_10172172 | 3300005293 | Bacteria | 1538 |
| 2 | Ga0070658_10062501 | 3300005327 | Bacteria | 3035 |
| 3 | Ga0070658_10244643 | 3300005327 | Bacteria | 1521 |
| 4 | Ga0070676_10002569 | 3300005328 | Bacteria | 9333 |
| 5 | Ga0070676_10016017 | 3300005328 | Bacteria | 4140 |
| 6 | Ga0070676_10028584 | 3300005328 | Bacteria | 3167 |
| 7 | Ga0070676_10051661 | 3300005328 | Bacteria | 2414 |
| 8 | Ga0070683_100085505 | 3300005329 | Bacteria | 2957 |
| 9 | Ga0070683_100105796 | 3300005329 | Bacteria | 2652 |
| 10 | Ga0070683_100140236 | 3300005329 | Bacteria | 2290 |
| 11 | Ga0070690_100000521 | 3300005330 | Bacteria | 19293 |
| 12 | Ga0070670_100044437 | 3300005331 | Bacteria | 3820 |
| 13 | Ga0070670_100078531 | 3300005331 | Bacteria | 2835 |
| 14 | Ga0070670_100110155 | 3300005331 | Bacteria | 2372 |
| 15 | Ga0070670_100192052 | 3300005331 | Bacteria | 1774 |
| 16 | Ga0070670_100196571 | 3300005331 | Bacteria | 1752 |
| 17 | Ga0070670_100455308 | 3300005331 | Bacteria | 1134 |
| 18 | Ga0070677_10000757 | 3300005333 | Bacteria | 10776 |
| 19 | Ga0070677_10010233 | 3300005333 | Bacteria | 3202 |
| 20 | Ga0070677_10034506 | 3300005333 | Bacteria | 1955 |
| 21 | Ga0068869_100000591 | 3300005334 | Bacteria | 20345 |
| 22 | Ga0068869_100051928 | 3300005334 | Bacteria | 2976 |
| 23 | Ga0068869_100097098 | 3300005334 | Bacteria | 2224 |
| 24 | Ga0068869_100152584 | 3300005334 | Bacteria | 1793 |
| 25 | Ga0068869_100162601 | 3300005334 | Bacteria | 1739 |
| 26 | Ga0068869_100214924 | 3300005334 | Bacteria | 1522 |
| 27 | Ga0070666_10000774 | 3300005335 | Bacteria | 19349 |
| 28 | Ga0070666_10001704 | 3300005335 | Bacteria | 13402 |
| 29 | Ga0070666_10005640 | 3300005335 | Bacteria | 7678 |
| 30 | Ga0070680_100086024 | 3300005336 | Bacteria | 2598 |
| 31 | Ga0070680_100170045 | 3300005336 | Bacteria | 1833 |
| 32 | Ga0070682_100054343 | 3300005337 | Bacteria | 2512 |
| 33 | Ga0068868_100001787 | 3300005338 | Bacteria | 14747 |
| 34 | Ga0068868_100044081 | 3300005338 | Bacteria | 3487 |
| 35 | Ga0068868_100081007 | 3300005338 | Bacteria | 2602 |
| 36 | Ga0068868_100136300 | 3300005338 | Bacteria | 2012 |
| 37 | Ga0068868_100189384 | 3300005338 | Bacteria | 1710 |
| 38 | Ga0070660_100008470 | 3300005339 | Bacteria | 7194 |
| 39 | Ga0070660_100010171 | 3300005339 | Bacteria | 6640 |
| 40 | Ga0070660_100015683 | 3300005339 | Bacteria | 5478 |
| 41 | Ga0070660_100031943 | 3300005339 | Bacteria | 3959 |
| 42 | Ga0070660_100096643 | 3300005339 | Bacteria | 2336 |
| 43 | Ga0070660_100219837 | 3300005339 | Bacteria | 1544 |
| 44 | Ga0070660_100280309 | 3300005339 | Bacteria | 1364 |
| 45 | Ga0070660_100280723 | 3300005339 | Bacteria | 1363 |
| 46 | Ga0070689_100001865 | 3300005340 | Bacteria | 13584 |
| 47 | Ga0070689_100064761 | 3300005340 | Bacteria | 2846 |
| 48 | Ga0070689_100108700 | 3300005340 | Bacteria | 2203 |
| 49 | Ga0070687_100074952 | 3300005343 | Bacteria | 1828 |
| 50 | Ga0070661_100000486 | 3300005344 | Bacteria | 30405 |
| 51 | Ga0070661_100002576 | 3300005344 | Bacteria | 12431 |
| 52 | Ga0070661_100004760 | 3300005344 | Bacteria | 9341 |
| 53 | Ga0070661_100008317 | 3300005344 | Bacteria | 7167 |
| 54 | Ga0070661_100023250 | 3300005344 | Bacteria | 4441 |
| 55 | Ga0070661_100064312 | 3300005344 | Bacteria | 2696 |
| 56 | Ga0070661_100090669 | 3300005344 | Bacteria | 2264 |
| 57 | Ga0070668_100001121 | 3300005347 | Bacteria | 18870 |
| 58 | Ga0070668_100001538 | 3300005347 | Bacteria | 16641 |
| 59 | Ga0070668_100001746 | 3300005347 | Bacteria | 15817 |
| 60 | Ga0070668_100006569 | 3300005347 | Bacteria | 8613 |
| 61 | Ga0070668_100007313 | 3300005347 | Bacteria | 8190 |
| 62 | Ga0070668_100071300 | 3300005347 | Bacteria | 2706 |
| 63 | Ga0070668_100196338 | 3300005347 | Bacteria | 1655 |
| 64 | Ga0070669_100014524 | 3300005353 | Bacteria | 5601 |
| 65 | Ga0070669_100035008 | 3300005353 | Bacteria | 3636 |
| 66 | Ga0070669_100051179 | 3300005353 | Bacteria | 3018 |
| 67 | Ga0070669_100147678 | 3300005353 | Bacteria | 1817 |
| 68 | Ga0070669_100164569 | 3300005353 | Bacteria | 1726 |
| 69 | Ga0070675_100001675 | 3300005354 | Bacteria | 16337 |
| 70 | Ga0070675_100004036 | 3300005354 | Bacteria | 11141 |
| 71 | Ga0070675_100202401 | 3300005354 | Bacteria | 1723 |
| 72 | Ga0070671_100000564 | 3300005355 | Bacteria | 26255 |
| 73 | Ga0070671_100005329 | 3300005355 | Bacteria | 10260 |
| 74 | Ga0070671_100014880 | 3300005355 | Bacteria | 6287 |
| 75 | Ga0070671_100022630 | 3300005355 | Bacteria | 5134 |
| 76 | Ga0070671_100167950 | 3300005355 | Bacteria | 1855 |
| 77 | Ga0070671_100177322 | 3300005355 | Bacteria | 1804 |
| 78 | Ga0070674_100000536 | 3300005356 | Bacteria | 19089 |
| 79 | Ga0070674_100006377 | 3300005356 | Bacteria | 6879 |
| 80 | Ga0070674_100195196 | 3300005356 | Bacteria | 1559 |
| 81 | Ga0070673_100001471 | 3300005364 | Bacteria | 13789 |
| 82 | Ga0070673_100001499 | 3300005364 | Bacteria | 13706 |
| 83 | Ga0070673_100004988 | 3300005364 | Bacteria | 8464 |
| 84 | Ga0070673_100060747 | 3300005364 | Bacteria | 2996 |
| 85 | Ga0070673_100211976 | 3300005364 | Bacteria | 1673 |
| 86 | Ga0070673_100284724 | 3300005364 | Bacteria | 1451 |
| 87 | Ga0070688_100001931 | 3300005365 | Bacteria | 10410 |
| 88 | Ga0070688_100017316 | 3300005365 | Bacteria | 4134 |
| 89 | Ga0070688_100123425 | 3300005365 | Bacteria | 1738 |
| 90 | Ga0070688_100162213 | 3300005365 | Bacteria | 1536 |
| 91 | Ga0070659_100002814 | 3300005366 | Bacteria | 12387 |
| 92 | Ga0070659_100021771 | 3300005366 | Bacteria | 4887 |
| 93 | Ga0070659_100070700 | 3300005366 | Bacteria | 2773 |
| 94 | Ga0070659_100071020 | 3300005366 | Bacteria | 2767 |
| 95 | Ga0070659_100146538 | 3300005366 | Bacteria | 1924 |
| 96 | Ga0070659_100162190 | 3300005366 | Bacteria | 1828 |
| 97 | Ga0070659_100177741 | 3300005366 | Bacteria | 1746 |
| 98 | Ga0070659_100322161 | 3300005366 | Bacteria | 1292 |
| 99 | Ga0070667_100000863 | 3300005367 | Bacteria | 28131 |
| 100 | Ga0070667_100002948 | 3300005367 | Bacteria | 14624 |
| 101 | Ga0070667_100101410 | 3300005367 | Bacteria | 2486 |
| 102 | Ga0070667_100104911 | 3300005367 | Bacteria | 2445 |
| 103 | Ga0070667_100106245 | 3300005367 | Bacteria | 2430 |
| 104 | Ga0070667_100107754 | 3300005367 | Bacteria | 2413 |
| 105 | Ga0070667_100168479 | 3300005367 | Bacteria | 1932 |
| 106 | Ga0070667_100277606 | 3300005367 | Bacteria | 1504 |
| 107 | Ga0070709_10037095 | 3300005434 | Bacteria | 2974 |
| 108 | Ga0070714_100003499 | 3300005435 | Bacteria | 11715 |
| 109 | Ga0070714_100394505 | 3300005435 | Bacteria | 1307 |
| 110 | Ga0070713_100000853 | 3300005436 | Bacteria | 19545 |
| 111 | Ga0070713_100006960 | 3300005436 | Bacteria | 7895 |
| 112 | Ga0070713_100016724 | 3300005436 | Bacteria | 5522 |
| 113 | Ga0070710_10021886 | 3300005437 | Bacteria | 3337 |
| 114 | Ga0070711_100010124 | 3300005439 | Bacteria | 5826 |
| 115 | Ga0070705_100027467 | 3300005440 | Bacteria | 3108 |
| 116 | Ga0070700_100005754 | 3300005441 | Bacteria | 6579 |
| 117 | Ga0070700_100072465 | 3300005441 | Bacteria | 2202 |
| 118 | Ga0070694_100071367 | 3300005444 | Bacteria | 2393 |
| 119 | Ga0070694_100116447 | 3300005444 | Bacteria | 1911 |
| 120 | Ga0070708_100120336 | 3300005445 | Bacteria | 2422 |
| 121 | Ga0070663_100039170 | 3300005455 | Bacteria | 3311 |
| 122 | Ga0070663_100114377 | 3300005455 | Bacteria | 2032 |
| 123 | Ga0070678_100000428 | 3300005456 | Bacteria | 19876 |
| 124 | Ga0070678_100024746 | 3300005456 | Bacteria | 4025 |
| 125 | Ga0070678_100037493 | 3300005456 | Bacteria | 3405 |
| 126 | Ga0070678_100292715 | 3300005456 | Bacteria | 1381 |
| 127 | Ga0070662_100012355 | 3300005457 | Bacteria | 5661 |
| 128 | Ga0070662_100014943 | 3300005457 | Bacteria | 5191 |
| 129 | Ga0070662_100040507 | 3300005457 | Bacteria | 3317 |
| 130 | Ga0070662_100156813 | 3300005457 | Bacteria | 1778 |
| 131 | Ga0070681_10003494 | 3300005458 | Bacteria | 14713 |
| 132 | Ga0070681_10007813 | 3300005458 | Bacteria | 10462 |
| 133 | Ga0070681_10022742 | 3300005458 | Bacteria | 6300 |
| 134 | Ga0070681_10157812 | 3300005458 | Bacteria | 2193 |
| 135 | Ga0070681_10270679 | 3300005458 | Bacteria | 1610 |
| 136 | Ga0068867_100003381 | 3300005459 | Bacteria | 11224 |
| 137 | Ga0068867_100011744 | 3300005459 | Bacteria | 6185 |
| 138 | Ga0068867_100017233 | 3300005459 | Bacteria | 5131 |
| 139 | Ga0068867_100139599 | 3300005459 | Bacteria | 1893 |
| 140 | Ga0070685_10141158 | 3300005466 | Bacteria | 1517 |
| 141 | Ga0070706_100009375 | 3300005467 | Bacteria | 9113 |
| 142 | Ga0070706_100018225 | 3300005467 | Bacteria | 6478 |
| 143 | Ga0070706_100022655 | 3300005467 | Bacteria | 5783 |
| 144 | Ga0070706_100079995 | 3300005467 | Bacteria | 3026 |
| 145 | Ga0070707_100015911 | 3300005468 | Bacteria | 7061 |
| 146 | Ga0070707_100039220 | 3300005468 | Bacteria | 4526 |
| 147 | Ga0070707_100044145 | 3300005468 | Bacteria | 4266 |
| 148 | Ga0070707_100130285 | 3300005468 | Bacteria | 2446 |
| 149 | Ga0070707_100138387 | 3300005468 | Bacteria | 2369 |
| 150 | Ga0070707_100175192 | 3300005468 | Bacteria | 2091 |
| 151 | Ga0070698_100043258 | 3300005471 | Bacteria | 4619 |
| 152 | Ga0070699_100020295 | 3300005518 | Bacteria | 5730 |
| 153 | Ga0070699_100328116 | 3300005518 | Bacteria | 1376 |
| 154 | Ga0070679_100033388 | 3300005530 | Bacteria | 5096 |
| 155 | Ga0070679_100049459 | 3300005530 | Bacteria | 4187 |
| 156 | Ga0070679_100315167 | 3300005530 | Bacteria | 1514 |
| 157 | Ga0070684_100013991 | 3300005535 | Bacteria | 6487 |
| 158 | Ga0070684_100140760 | 3300005535 | Bacteria | 2182 |
| 159 | Ga0070684_100166102 | 3300005535 | Bacteria | 2003 |
| 160 | Ga0070697_100066453 | 3300005536 | Bacteria | 2948 |
| 161 | Ga0070697_100129359 | 3300005536 | Bacteria | 2117 |
| 162 | Ga0070697_100178686 | 3300005536 | Bacteria | 1798 |
| 163 | Ga0068853_100031441 | 3300005539 | Bacteria | 4490 |
| 164 | Ga0068853_100045026 | 3300005539 | Bacteria | 3779 |
| 165 | Ga0068853_100051879 | 3300005539 | Bacteria | 3532 |
| 166 | Ga0068853_100126441 | 3300005539 | Bacteria | 2284 |
| 167 | Ga0070672_100004110 | 3300005543 | Bacteria | 9501 |
| 168 | Ga0070672_100011327 | 3300005543 | Bacteria | 6221 |
| 169 | Ga0070672_100145533 | 3300005543 | Bacteria | 1958 |
| 170 | Ga0070672_100186266 | 3300005543 | Bacteria | 1731 |
| 171 | Ga0070686_100089558 | 3300005544 | Bacteria | 2056 |
| 172 | Ga0070686_100096000 | 3300005544 | Bacteria | 1993 |
| 173 | Ga0070686_100099309 | 3300005544 | Bacteria | 1964 |
| 174 | Ga0070695_100013699 | 3300005545 | Bacteria | 4874 |
| 175 | Ga0070695_100030795 | 3300005545 | Bacteria | 3341 |
| 176 | Ga0070696_100005910 | 3300005546 | Bacteria | 8171 |
| 177 | Ga0070696_100032438 | 3300005546 | Bacteria | 3583 |
| 178 | Ga0070696_100063601 | 3300005546 | Bacteria | 2585 |
| 179 | Ga0070696_100160214 | 3300005546 | Bacteria | 1657 |
| 180 | Ga0070696_100163669 | 3300005546 | Bacteria | 1640 |
| 181 | Ga0070693_100000378 | 3300005547 | Bacteria | 20172 |
| 182 | Ga0070665_100003863 | 3300005548 | Bacteria | 15852 |
| 183 | Ga0070665_100005926 | 3300005548 | Bacteria | 12520 |
| 184 | Ga0070665_100030720 | 3300005548 | Bacteria | 5405 |
| 185 | Ga0070665_100073966 | 3300005548 | Bacteria | 3413 |
| 186 | Ga0070665_100308078 | 3300005548 | Bacteria | 1587 |
| 187 | Ga0070704_100015536 | 3300005549 | Bacteria | 4785 |
| 188 | Ga0068855_100038385 | 3300005563 | Bacteria | 5691 |
| 189 | Ga0068855_100039133 | 3300005563 | Bacteria | 5629 |
| 190 | Ga0068855_100050332 | 3300005563 | Bacteria | 4910 |
| 191 | Ga0068855_100059170 | 3300005563 | Bacteria | 4484 |
| 192 | Ga0068855_100106814 | 3300005563 | Bacteria | 3217 |
| 193 | Ga0068855_100194206 | 3300005563 | Bacteria | 2288 |
| 194 | Ga0068855_100201114 | 3300005563 | Bacteria | 2242 |
| 195 | Ga0068855_100438595 | 3300005563 | Bacteria | 1427 |
| 196 | Ga0070664_100005958 | 3300005564 | Bacteria | 9851 |
| 197 | Ga0070664_100009645 | 3300005564 | Bacteria | 7833 |
| 198 | Ga0070664_100022299 | 3300005564 | Bacteria | 5221 |
| 199 | Ga0070664_100032335 | 3300005564 | Bacteria | 4375 |
| 200 | Ga0070664_100037072 | 3300005564 | Bacteria | 4097 |
| 201 | Ga0070664_100117042 | 3300005564 | Bacteria | 2331 |
| 202 | Ga0070664_100206990 | 3300005564 | Bacteria | 1752 |
| 203 | Ga0070664_100323360 | 3300005564 | Bacteria | 1398 |
| 204 | Ga0068857_100018143 | 3300005577 | Bacteria | 6172 |
| 205 | Ga0068857_100019755 | 3300005577 | Bacteria | 5918 |
| 206 | Ga0068854_100006946 | 3300005578 | Bacteria | 7220 |
| 207 | Ga0068854_100015337 | 3300005578 | Bacteria | 5073 |
| 208 | Ga0068854_100024845 | 3300005578 | Bacteria | 4107 |
| 209 | Ga0068854_100069798 | 3300005578 | Bacteria | 2567 |
| 210 | Ga0068854_100184510 | 3300005578 | Bacteria | 1631 |
| 211 | Ga0068856_100002081 | 3300005614 | Bacteria | 20767 |
| 212 | Ga0068856_100003025 | 3300005614 | Bacteria | 17229 |
| 213 | Ga0068856_100006440 | 3300005614 | Bacteria | 11516 |
| 214 | Ga0068856_100010386 | 3300005614 | Bacteria | 9043 |
| 215 | Ga0068856_100050306 | 3300005614 | Bacteria | 4108 |
| 216 | Ga0068856_100051117 | 3300005614 | Bacteria | 4076 |
| 217 | Ga0070702_100030449 | 3300005615 | Bacteria | 2942 |
| 218 | Ga0070702_100046528 | 3300005615 | Bacteria | 2459 |
| 219 | Ga0070702_100098242 | 3300005615 | Bacteria | 1791 |
| 220 | Ga0068852_100002732 | 3300005616 | Bacteria | 12206 |
| 221 | Ga0068852_100003279 | 3300005616 | Bacteria | 11295 |
| 222 | Ga0068852_100019123 | 3300005616 | Bacteria | 5414 |
| 223 | Ga0068859_100000594 | 3300005617 | Bacteria | 36146 |
| 224 | Ga0068859_100002773 | 3300005617 | Bacteria | 17745 |
| 225 | Ga0068859_100015281 | 3300005617 | Bacteria | 7710 |
| 226 | Ga0068859_100116149 | 3300005617 | Bacteria | 2740 |
| 227 | Ga0068864_100001433 | 3300005618 | Bacteria | 19672 |
| 228 | Ga0068864_100002465 | 3300005618 | Bacteria | 15280 |
| 229 | Ga0068864_100007105 | 3300005618 | Bacteria | 9196 |
| 230 | Ga0068864_100017132 | 3300005618 | Bacteria | 6043 |
| 231 | Ga0068864_100018403 | 3300005618 | Bacteria | 5837 |
| 232 | Ga0068864_100083623 | 3300005618 | Bacteria | 2803 |
| 233 | Ga0068864_100133674 | 3300005618 | Bacteria | 2231 |
| 234 | Ga0068866_10016847 | 3300005718 | Bacteria | 3275 |
| 235 | Ga0068861_100000705 | 3300005719 | Bacteria | 19969 |
| 236 | Ga0068861_100020915 | 3300005719 | Bacteria | 4696 |
| 237 | Ga0068861_100271443 | 3300005719 | Bacteria | 1456 |
| 238 | Ga0068851_10001640 | 3300005834 | Bacteria | 9817 |
| 239 | Ga0068851_10037711 | 3300005834 | Bacteria | 2423 |
| 240 | Ga0068851_10100016 | 3300005834 | Bacteria | 1537 |
| 241 | Ga0068870_10038881 | 3300005840 | Bacteria | 2459 |
| 242 | Ga0068870_10058606 | 3300005840 | Bacteria | 2062 |
| 243 | Ga0068863_100002710 | 3300005841 | Bacteria | 17495 |
| 244 | Ga0068863_100004302 | 3300005841 | Bacteria | 14024 |
| 245 | Ga0068863_100008973 | 3300005841 | Bacteria | 9765 |
| 246 | Ga0068863_100015542 | 3300005841 | Bacteria | 7312 |
| 247 | Ga0068863_100212633 | 3300005841 | Bacteria | 1862 |
| 248 | Ga0068863_100216006 | 3300005841 | Bacteria | 1847 |
| 249 | Ga0068858_100006368 | 3300005842 | Bacteria | 11495 |
| 250 | Ga0068858_100031566 | 3300005842 | Bacteria | 4921 |
| 251 | Ga0068858_100042025 | 3300005842 | Bacteria | 4238 |
| 252 | Ga0068858_100072444 | 3300005842 | Bacteria | 3196 |
| 253 | Ga0068858_100182551 | 3300005842 | Bacteria | 1981 |
| 254 | Ga0068860_100024779 | 3300005843 | Bacteria | 5795 |
| 255 | Ga0068860_100036963 | 3300005843 | Bacteria | 4675 |
| 256 | Ga0068860_100053257 | 3300005843 | Bacteria | 3848 |
| 257 | Ga0068860_100065334 | 3300005843 | Bacteria | 3455 |
| 258 | Ga0068860_100077094 | 3300005843 | Bacteria | 3169 |
| 259 | Ga0068860_100093577 | 3300005843 | Bacteria | 2864 |
| 260 | Ga0068860_100206852 | 3300005843 | Bacteria | 1903 |
| 261 | Ga0068862_100005456 | 3300005844 | Bacteria | 10626 |
| 262 | Ga0068862_100055523 | 3300005844 | Bacteria | 3392 |
| 263 | Ga0068862_100183721 | 3300005844 | Bacteria | 1878 |
| 264 | Ga0081539_10042797 | 3300005985 | Bacteria | 2633 |
| 265 | Ga0075365_10032640 | 3300006038 | Bacteria | 3349 |
| 266 | Ga0075368_10005372 | 3300006042 | Bacteria | 4404 |
| 267 | Ga0070716_100032117 | 3300006173 | Bacteria | 2860 |
| 268 | Ga0070716_100060768 | 3300006173 | Bacteria | 2184 |
| 269 | Ga0070712_100059884 | 3300006175 | Bacteria | 2683 |
| 270 | Ga0070712_100096413 | 3300006175 | Bacteria | 2178 |
| 271 | Ga0075367_10002132 | 3300006178 | Bacteria | 8907 |
| 272 | Ga0075369_10000546 | 3300006186 | Bacteria | 11862 |
| 273 | Ga0075366_10010257 | 3300006195 | Bacteria | 5255 |
| 274 | Ga0075366_10029099 | 3300006195 | Bacteria | 3244 |
| 275 | Ga0097621_100013194 | 3300006237 | Bacteria | 6148 |
| 276 | Ga0097621_100056010 | 3300006237 | Bacteria | 3220 |
| 277 | Ga0097621_100117195 | 3300006237 | Bacteria | 2256 |
| 278 | Ga0097621_100133217 | 3300006237 | Bacteria | 2117 |
| 279 | Ga0097621_100138178 | 3300006237 | Bacteria | 2080 |
| 280 | Ga0068871_100004698 | 3300006358 | Bacteria | 9549 |
| 281 | Ga0068871_100071275 | 3300006358 | Bacteria | 2858 |
| 282 | Ga0068871_100084361 | 3300006358 | Bacteria | 2636 |
| 283 | Ga0068871_100142392 | 3300006358 | Bacteria | 2039 |
| 284 | Ga0068871_100258476 | 3300006358 | Bacteria | 1518 |
| 285 | Ga0068871_100258510 | 3300006358 | Bacteria | 1518 |
| 286 | Ga0075428_100002887 | 3300006844 | Bacteria | 18709 |
| 287 | Ga0075428_100267822 | 3300006844 | Bacteria | 1838 |
| 288 | Ga0075430_100134415 | 3300006846 | Bacteria | 2061 |
| 289 | Ga0075434_100000306 | 3300006871 | Bacteria | 34874 |
| 290 | Ga0075434_100030898 | 3300006871 | Bacteria | 5278 |
| 291 | Ga0075434_100088450 | 3300006871 | Bacteria | 3099 |
| 292 | Ga0075434_100174691 | 3300006871 | Bacteria | 2168 |
| 293 | Ga0075434_100321121 | 3300006871 | Bacteria | 1569 |
| 294 | Ga0075429_100033953 | 3300006880 | Bacteria | 4433 |
| 295 | Ga0068865_100061221 | 3300006881 | Bacteria | 2638 |
| 296 | Ga0068865_100079218 | 3300006881 | Bacteria | 2352 |
| 297 | Ga0068865_100130768 | 3300006881 | Bacteria | 1880 |
| 298 | Ga0068865_100162841 | 3300006881 | Bacteria | 1703 |
| 299 | Ga0075436_100152988 | 3300006914 | Bacteria | 1624 |
| 300 | Ga0097620_100000594 | 3300006931 | Bacteria | 36146 |
| 301 | Ga0097620_100002774 | 3300006931 | Bacteria | 17745 |
| 302 | Ga0097620_100015279 | 3300006931 | Bacteria | 7710 |
| 303 | Ga0097620_100116144 | 3300006931 | Bacteria | 2740 |
| 304 | Ga0075435_100039517 | 3300007076 | Bacteria | 3765 |
| 305 | Ga0075435_100040195 | 3300007076 | Bacteria | 3734 |
| 306 | Ga0075435_100148515 | 3300007076 | Bacteria | 1970 |
| 307 | Ga0099794_10122638 | 3300007265 | Bacteria | 1308 |
| 308 | Ga0105240_10018384 | 3300009093 | Bacteria | 9386 |
| 309 | Ga0105240_10020207 | 3300009093 | Bacteria | 8890 |
| 310 | Ga0105240_10028464 | 3300009093 | Bacteria | 7299 |
| 311 | Ga0111539_10000957 | 3300009094 | Bacteria | 37861 |
| 312 | Ga0111539_10039536 | 3300009094 | Bacteria | 5684 |
| 313 | Ga0111539_10057738 | 3300009094 | Bacteria | 4608 |
| 314 | Ga0111539_10060204 | 3300009094 | Bacteria | 4500 |
| 315 | Ga0105245_10010967 | 3300009098 | Bacteria | 7886 |
| 316 | Ga0105245_10032337 | 3300009098 | Bacteria | 4632 |
| 317 | Ga0105245_10050485 | 3300009098 | Bacteria | 3728 |
| 318 | Ga0105245_10335906 | 3300009098 | Bacteria | 1493 |
| 319 | Ga0105247_10007921 | 3300009101 | Bacteria | 6496 |
| 320 | Ga0114129_10232513 | 3300009147 | Bacteria | 2482 |
| 321 | Ga0114129_10240327 | 3300009147 | Bacteria | 2434 |
| 322 | Ga0114129_10444982 | 3300009147 | Bacteria | 1700 |
| 323 | Ga0114129_10726224 | 3300009147 | Bacteria | 1274 |
| 324 | Ga0105241_10220027 | 3300009174 | Bacteria | 1595 |
| 325 | Ga0105242_10024661 | 3300009176 | Bacteria | 4751 |
| 326 | Ga0105242_10213435 | 3300009176 | Bacteria | 1721 |
| 327 | Ga0105242_10309544 | 3300009176 | Bacteria | 1445 |
| 328 | Ga0105248_10001225 | 3300009177 | Bacteria | 28644 |
| 329 | Ga0105248_10135388 | 3300009177 | Bacteria | 2779 |
| 330 | Ga0105248_10265962 | 3300009177 | Bacteria | 1930 |
| 331 | Ga0105237_10105489 | 3300009545 | Bacteria | 2809 |
| 332 | Ga0105237_10220558 | 3300009545 | Bacteria | 1896 |
| 333 | Ga0105237_10252110 | 3300009545 | Bacteria | 1767 |
| 334 | Ga0105238_10008927 | 3300009551 | Bacteria | 10033 |
| 335 | Ga0105238_10039286 | 3300009551 | Bacteria | 4798 |
| 336 | Ga0105238_10196799 | 3300009551 | Bacteria | 1991 |
| 337 | Ga0105238_10303709 | 3300009551 | Bacteria | 1580 |
| 338 | Ga0105249_10066620 | 3300009553 | Bacteria | 3316 |
| 339 | Ga0105249_10092876 | 3300009553 | Bacteria | 2826 |
| 340 | Ga0105249_10231855 | 3300009553 | Bacteria | 1821 |
| 341 | Ga0105239_10070454 | 3300010375 | Bacteria | 3841 |
| 342 | Ga0105239_10113547 | 3300010375 | Bacteria | 3004 |
| 343 | Ga0105239_10152195 | 3300010375 | Bacteria | 2582 |
| 344 | Ga0105239_10527065 | 3300010375 | Bacteria | 1344 |
| 345 | Ga0105246_10040771 | 3300011119 | Bacteria | 3135 |
| 346 | Ga0157373_10001379 | 3300013100 | Bacteria | 18633 |
| 347 | Ga0157373_10015272 | 3300013100 | Bacteria | 5613 |
| 348 | Ga0157373_10019295 | 3300013100 | Bacteria | 4966 |
| 349 | Ga0157373_10189553 | 3300013100 | Bacteria | 1449 |
| 350 | Ga0157371_10005607 | 3300013102 | Bacteria | 10554 |
| 351 | Ga0157371_10106698 | 3300013102 | Bacteria | 1988 |
| 352 | Ga0157371_10179597 | 3300013102 | Bacteria | 1514 |
| 353 | Ga0157370_10002935 | 3300013104 | Bacteria | 20300 |
| 354 | Ga0157370_10013191 | 3300013104 | Bacteria | 8522 |
| 355 | Ga0157370_10014097 | 3300013104 | Bacteria | 8199 |
| 356 | Ga0157370_10020764 | 3300013104 | Bacteria | 6554 |
| 357 | Ga0157370_10032253 | 3300013104 | Bacteria | 5116 |
| 358 | Ga0157370_10056890 | 3300013104 | Bacteria | 3721 |
| 359 | Ga0157370_10143469 | 3300013104 | Bacteria | 2224 |
| 360 | Ga0157370_10266230 | 3300013104 | Bacteria | 1584 |
| 361 | Ga0157369_10005349 | 3300013105 | Bacteria | 14960 |
| 362 | Ga0157369_10040426 | 3300013105 | Bacteria | 5091 |
| 363 | Ga0157369_10213141 | 3300013105 | Bacteria | 2024 |
| 364 | Ga0157369_10461971 | 3300013105 | Bacteria | 1314 |
| 365 | Ga0157374_10000924 | 3300013296 | Bacteria | 25554 |
| 366 | Ga0157374_10005165 | 3300013296 | Bacteria | 10949 |
| 367 | Ga0157374_10021418 | 3300013296 | Bacteria | 5752 |
| 368 | Ga0157374_10080988 | 3300013296 | Bacteria | 3081 |
| 369 | Ga0157374_10179947 | 3300013296 | Bacteria | 2065 |
| 370 | Ga0157374_10184643 | 3300013296 | Bacteria | 2038 |
| 371 | Ga0157378_10004871 | 3300013297 | Bacteria | 11773 |
| 372 | Ga0157378_10052080 | 3300013297 | Bacteria | 3642 |
| 373 | Ga0157378_10191448 | 3300013297 | Bacteria | 1929 |
| 374 | Ga0157378_10208896 | 3300013297 | Bacteria | 1850 |
| 375 | Ga0157378_10379672 | 3300013297 | Bacteria | 1387 |
| 376 | Ga0163162_10004885 | 3300013306 | Bacteria | 12926 |
| 377 | Ga0163162_10041348 | 3300013306 | Bacteria | 4612 |
| 378 | Ga0163162_10059011 | 3300013306 | Bacteria | 3868 |
| 379 | Ga0163162_10115317 | 3300013306 | Bacteria | 2786 |
| 380 | Ga0163162_10136132 | 3300013306 | Bacteria | 2567 |
| 381 | Ga0157372_10001772 | 3300013307 | Bacteria | 23417 |
| 382 | Ga0157372_10015325 | 3300013307 | Bacteria | 8214 |
| 383 | Ga0157372_10018658 | 3300013307 | Bacteria | 7462 |
| 384 | Ga0157372_10139004 | 3300013307 | Bacteria | 2797 |
| 385 | Ga0157372_10194792 | 3300013307 | Bacteria | 2348 |
| 386 | Ga0157372_10349325 | 3300013307 | Bacteria | 1723 |
| 387 | Ga0157375_10004384 | 3300013308 | Bacteria | 12257 |
| 388 | Ga0157375_10106761 | 3300013308 | Bacteria | 2892 |
| 389 | Ga0157375_10385748 | 3300013308 | Bacteria | 1568 |
| 390 | Ga0157375_10455019 | 3300013308 | Bacteria | 1445 |
| 391 | Ga0163163_10229130 | 3300014325 | Bacteria | 1907 |
| 392 | Ga0163163_10229622 | 3300014325 | Bacteria | 1905 |
| 393 | Ga0157380_10085349 | 3300014326 | Bacteria | 2591 |
| 394 | Ga0157380_10095741 | 3300014326 | Bacteria | 2460 |
| 395 | Ga0157380_10399210 | 3300014326 | Bacteria | 1304 |
| 396 | Ga0157377_10009541 | 3300014745 | Bacteria | 4767 |
| 397 | Ga0157377_10251800 | 3300014745 | Bacteria | 1145 |
| 398 | Ga0157379_10001374 | 3300014968 | Bacteria | 19913 |
| 399 | Ga0157379_10011623 | 3300014968 | Bacteria | 7686 |
| 400 | Ga0157379_10012130 | 3300014968 | Bacteria | 7526 |
| 401 | Ga0157379_10017214 | 3300014968 | Bacteria | 6367 |
| 402 | Ga0157379_10059206 | 3300014968 | Bacteria | 3425 |
| 403 | Ga0157379_10093104 | 3300014968 | Bacteria | 2704 |
| 404 | Ga0157379_10115348 | 3300014968 | Bacteria | 2415 |
| 405 | Ga0157376_10021708 | 3300014969 | Bacteria | 4990 |
| 406 | Ga0157376_10028228 | 3300014969 | Bacteria | 4458 |
| 407 | Ga0157376_10047180 | 3300014969 | Bacteria | 3555 |
| 408 | Ga0157376_10273364 | 3300014969 | Bacteria | 1588 |
| 409 | Ga0163161_10053766 | 3300017792 | Bacteria | 2921 |
| 410 | Ga0163161_10057587 | 3300017792 | Bacteria | 2823 |
| 411 | Ga0163161_10091122 | 3300017792 | Bacteria | 2256 |
| 412 | Ga0163161_10120716 | 3300017792 | Bacteria | 1969 |
| 413 | Ga0206356_11461543 | 3300020070 | Bacteria | 2998 |
| 414 | Ga0206353_10236115 | 3300020082 | Bacteria | 1445 |
| 415 | Ga0213872_10000333 | 3300021361 | Bacteria | 40014 |
| 416 | Ga0213872_10002733 | 3300021361 | Bacteria | 10128 |
| 417 | Ga0213872_10004503 | 3300021361 | Bacteria | 7382 |
| 418 | Ga0207697_10001482 | 3300025315 | Bacteria | 12807 |
| 419 | Ga0207697_10007231 | 3300025315 | Bacteria | 4961 |
| 420 | Ga0207697_10020055 | 3300025315 | Bacteria | 2738 |
| 421 | Ga0207682_10000993 | 3300025893 | Bacteria | 13099 |
| 422 | Ga0207682_10001318 | 3300025893 | Bacteria | 11412 |
| 423 | Ga0207682_10007381 | 3300025893 | Bacteria | 4382 |
| 424 | Ga0207692_10041356 | 3300025898 | Bacteria | 2281 |
| 425 | Ga0207642_10008244 | 3300025899 | Bacteria | 3563 |
| 426 | Ga0207688_10006119 | 3300025901 | Bacteria | 6549 |
| 427 | Ga0207688_10041079 | 3300025901 | Bacteria | 2571 |
| 428 | Ga0207680_10004681 | 3300025903 | Bacteria | 6499 |
| 429 | Ga0207680_10078757 | 3300025903 | Bacteria | 2065 |
| 430 | Ga0207680_10142648 | 3300025903 | Bacteria | 1589 |
| 431 | Ga0207645_10000039 | 3300025907 | Bacteria | 88205 |
| 432 | Ga0207645_10000331 | 3300025907 | Bacteria | 39499 |
| 433 | Ga0207645_10007484 | 3300025907 | Bacteria | 7707 |
| 434 | Ga0207645_10020552 | 3300025907 | Bacteria | 4321 |
| 435 | Ga0207645_10059692 | 3300025907 | Bacteria | 2436 |
| 436 | Ga0207643_10001108 | 3300025908 | Bacteria | 15982 |
| 437 | Ga0207643_10003518 | 3300025908 | Bacteria | 8424 |
| 438 | Ga0207643_10111769 | 3300025908 | Bacteria | 1610 |
| 439 | Ga0207705_10114288 | 3300025909 | Bacteria | 1997 |
| 440 | Ga0207705_10128151 | 3300025909 | Bacteria | 1887 |
| 441 | Ga0207705_10190102 | 3300025909 | Bacteria | 1552 |
| 442 | Ga0207705_10190370 | 3300025909 | Bacteria | 1551 |
| 443 | Ga0207684_10046819 | 3300025910 | Bacteria | 3669 |
| 444 | Ga0207684_10102396 | 3300025910 | Bacteria | 2448 |
| 445 | Ga0207654_10060700 | 3300025911 | Bacteria | 2210 |
| 446 | Ga0207654_10145140 | 3300025911 | Bacteria | 1518 |
| 447 | Ga0207707_10008263 | 3300025912 | Bacteria | 9037 |
| 448 | Ga0207707_10046343 | 3300025912 | Bacteria | 3786 |
| 449 | Ga0207707_10058381 | 3300025912 | Bacteria | 3358 |
| 450 | Ga0207707_10069403 | 3300025912 | Bacteria | 3071 |
| 451 | Ga0207707_10139098 | 3300025912 | Bacteria | 2123 |
| 452 | Ga0207707_10144033 | 3300025912 | Bacteria | 2083 |
| 453 | Ga0207695_10074196 | 3300025913 | Bacteria | 3464 |
| 454 | Ga0207695_10167310 | 3300025913 | Bacteria | 2126 |
| 455 | Ga0207693_10000397 | 3300025915 | Bacteria | 40037 |
| 456 | Ga0207693_10027063 | 3300025915 | Bacteria | 4535 |
| 457 | Ga0207693_10091135 | 3300025915 | Bacteria | 2390 |
| 458 | Ga0207663_10028987 | 3300025916 | Bacteria | 3246 |
| 459 | Ga0207660_10022105 | 3300025917 | Bacteria | 4283 |
| 460 | Ga0207660_10095518 | 3300025917 | Bacteria | 2212 |
| 461 | Ga0207660_10176845 | 3300025917 | Bacteria | 1655 |
| 462 | Ga0207662_10065329 | 3300025918 | Bacteria | 2191 |
| 463 | Ga0207662_10096349 | 3300025918 | Bacteria | 1828 |
| 464 | Ga0207657_10000394 | 3300025919 | Bacteria | 46090 |
| 465 | Ga0207657_10001000 | 3300025919 | Bacteria | 30068 |
| 466 | Ga0207657_10014530 | 3300025919 | Bacteria | 7677 |
| 467 | Ga0207657_10032471 | 3300025919 | Bacteria | 4716 |
| 468 | Ga0207657_10119234 | 3300025919 | Bacteria | 2171 |
| 469 | Ga0207657_10125730 | 3300025919 | Bacteria | 2106 |
| 470 | Ga0207649_10006345 | 3300025920 | Bacteria | 6427 |
| 471 | Ga0207652_10009287 | 3300025921 | Bacteria | 7905 |
| 472 | Ga0207652_10018041 | 3300025921 | Bacteria | 5785 |
| 473 | Ga0207646_10018213 | 3300025922 | Bacteria | 6555 |
| 474 | Ga0207646_10037198 | 3300025922 | Bacteria | 4389 |
| 475 | Ga0207681_10002345 | 3300025923 | Bacteria | 12049 |
| 476 | Ga0207681_10011778 | 3300025923 | Bacteria | 5379 |
| 477 | Ga0207681_10049092 | 3300025923 | Bacteria | 2851 |
| 478 | Ga0207694_10014534 | 3300025924 | Bacteria | 5936 |
| 479 | Ga0207694_10021564 | 3300025924 | Bacteria | 4881 |
| 480 | Ga0207650_10001745 | 3300025925 | Bacteria | 15450 |
| 481 | Ga0207650_10026853 | 3300025925 | Bacteria | 4114 |
| 482 | Ga0207650_10034273 | 3300025925 | Bacteria | 3681 |
| 483 | Ga0207650_10044835 | 3300025925 | Bacteria | 3251 |
| 484 | Ga0207650_10056570 | 3300025925 | Bacteria | 2915 |
| 485 | Ga0207650_10057719 | 3300025925 | Bacteria | 2888 |
| 486 | Ga0207650_10061300 | 3300025925 | Bacteria | 2808 |
| 487 | Ga0207650_10274402 | 3300025925 | Bacteria | 1371 |
| 488 | Ga0207659_10014770 | 3300025926 | Bacteria | 5046 |
| 489 | Ga0207659_10026217 | 3300025926 | Bacteria | 3930 |
| 490 | Ga0207659_10084411 | 3300025926 | Bacteria | 2356 |
| 491 | Ga0207659_10161435 | 3300025926 | Bacteria | 1760 |
| 492 | Ga0207687_10000188 | 3300025927 | Bacteria | 41329 |
| 493 | Ga0207687_10007739 | 3300025927 | Bacteria | 7050 |
| 494 | Ga0207700_10000074 | 3300025928 | Bacteria | 61772 |
| 495 | Ga0207700_10010760 | 3300025928 | Bacteria | 5796 |
| 496 | Ga0207700_10029252 | 3300025928 | Bacteria | 3885 |
| 497 | Ga0207700_10037722 | 3300025928 | Bacteria | 3502 |
| 498 | Ga0207664_10001185 | 3300025929 | Bacteria | 17338 |
| 499 | Ga0207664_10049607 | 3300025929 | Bacteria | 3306 |
| 500 | Ga0207664_10072300 | 3300025929 | Bacteria | 2780 |
| 501 | Ga0207644_10003932 | 3300025931 | Bacteria | 9638 |
| 502 | Ga0207644_10008387 | 3300025931 | Bacteria | 6762 |
| 503 | Ga0207644_10011828 | 3300025931 | Bacteria | 5780 |
| 504 | Ga0207644_10038706 | 3300025931 | Bacteria | 3361 |
| 505 | Ga0207644_10143201 | 3300025931 | Bacteria | 1843 |
| 506 | Ga0207690_10017644 | 3300025932 | Bacteria | 4364 |
| 507 | Ga0207690_10158258 | 3300025932 | Bacteria | 1686 |
| 508 | Ga0207690_10265407 | 3300025932 | Bacteria | 1332 |
| 509 | Ga0207706_10000854 | 3300025933 | Bacteria | 31369 |
| 510 | Ga0207706_10002859 | 3300025933 | Bacteria | 16752 |
| 511 | Ga0207706_10007248 | 3300025933 | Bacteria | 10252 |
| 512 | Ga0207706_10015396 | 3300025933 | Bacteria | 6909 |
| 513 | Ga0207706_10048226 | 3300025933 | Bacteria | 3767 |
| 514 | Ga0207706_10184716 | 3300025933 | Bacteria | 1831 |
| 515 | Ga0207706_10294380 | 3300025933 | Bacteria | 1415 |
| 516 | Ga0207706_10332238 | 3300025933 | Bacteria | 1322 |
| 517 | Ga0207686_10000211 | 3300025934 | Bacteria | 44316 |
| 518 | Ga0207686_10149671 | 3300025934 | Bacteria | 1623 |
| 519 | Ga0207709_10031657 | 3300025935 | Bacteria | 3092 |
| 520 | Ga0207670_10129669 | 3300025936 | Bacteria | 1845 |
| 521 | Ga0207670_10136754 | 3300025936 | Bacteria | 1802 |
| 522 | Ga0207669_10002807 | 3300025937 | Bacteria | 7460 |
| 523 | Ga0207669_10055040 | 3300025937 | Bacteria | 2407 |
| 524 | Ga0207669_10111983 | 3300025937 | Bacteria | 1831 |
| 525 | Ga0207669_10186463 | 3300025937 | Bacteria | 1492 |
| 526 | Ga0207704_10019141 | 3300025938 | Bacteria | 3590 |
| 527 | Ga0207704_10064358 | 3300025938 | Bacteria | 2291 |
| 528 | Ga0207665_10054762 | 3300025939 | Bacteria | 2691 |
| 529 | Ga0207665_10126862 | 3300025939 | Bacteria | 1808 |
| 530 | Ga0207691_10000027 | 3300025940 | Bacteria | 126502 |
| 531 | Ga0207691_10000122 | 3300025940 | Bacteria | 70474 |
| 532 | Ga0207691_10000772 | 3300025940 | Bacteria | 31685 |
| 533 | Ga0207691_10100924 | 3300025940 | Bacteria | 2575 |
| 534 | Ga0207711_10000116 | 3300025941 | Bacteria | 83390 |
| 535 | Ga0207711_10036322 | 3300025941 | Bacteria | 4181 |
| 536 | Ga0207711_10138857 | 3300025941 | Bacteria | 2185 |
| 537 | Ga0207689_10000548 | 3300025942 | Bacteria | 35796 |
| 538 | Ga0207689_10001927 | 3300025942 | Bacteria | 19632 |
| 539 | Ga0207689_10006355 | 3300025942 | Bacteria | 10463 |
| 540 | Ga0207689_10008896 | 3300025942 | Bacteria | 8710 |
| 541 | Ga0207689_10040830 | 3300025942 | Bacteria | 3839 |
| 542 | Ga0207689_10085284 | 3300025942 | Bacteria | 2596 |
| 543 | Ga0207661_10010299 | 3300025944 | Bacteria | 6725 |
| 544 | Ga0207661_10178940 | 3300025944 | Bacteria | 1851 |
| 545 | Ga0207679_10015734 | 3300025945 | Bacteria | 5009 |
| 546 | Ga0207679_10078160 | 3300025945 | Bacteria | 2520 |
| 547 | Ga0207679_10251969 | 3300025945 | Bacteria | 1501 |
| 548 | Ga0207679_10268270 | 3300025945 | Bacteria | 1459 |
| 549 | Ga0207679_10279485 | 3300025945 | Bacteria | 1431 |
| 550 | Ga0207679_10324702 | 3300025945 | Bacteria | 1334 |
| 551 | Ga0207667_10002343 | 3300025949 | Bacteria | 23727 |
| 552 | Ga0207667_10094773 | 3300025949 | Bacteria | 3082 |
| 553 | Ga0207667_10204862 | 3300025949 | Bacteria | 2023 |
| 554 | Ga0207667_10214468 | 3300025949 | Bacteria | 1973 |
| 555 | Ga0207651_10044425 | 3300025960 | Bacteria | 2973 |
| 556 | Ga0207651_10161962 | 3300025960 | Bacteria | 1755 |
| 557 | Ga0207651_10329329 | 3300025960 | Bacteria | 1279 |
| 558 | Ga0207712_10085235 | 3300025961 | Bacteria | 2311 |
| 559 | Ga0207712_10192494 | 3300025961 | Bacteria | 1611 |
| 560 | Ga0207668_10002876 | 3300025972 | Bacteria | 10102 |
| 561 | Ga0207668_10005221 | 3300025972 | Bacteria | 7644 |
| 562 | Ga0207668_10018007 | 3300025972 | Bacteria | 4436 |
| 563 | Ga0207640_10008758 | 3300025981 | Bacteria | 5631 |
| 564 | Ga0207640_10049870 | 3300025981 | Bacteria | 2713 |
| 565 | Ga0207640_10072147 | 3300025981 | Bacteria | 2328 |
| 566 | Ga0207640_10182049 | 3300025981 | Bacteria | 1576 |
| 567 | Ga0207658_10012633 | 3300025986 | Bacteria | 5766 |
| 568 | Ga0207658_10013907 | 3300025986 | Bacteria | 5507 |
| 569 | Ga0207658_10013937 | 3300025986 | Bacteria | 5501 |
| 570 | Ga0207658_10019542 | 3300025986 | Bacteria | 4686 |
| 571 | Ga0207658_10071368 | 3300025986 | Bacteria | 2629 |
| 572 | Ga0207658_10181302 | 3300025986 | Bacteria | 1743 |
| 573 | Ga0207658_10437021 | 3300025986 | Bacteria | 1156 |
| 574 | Ga0207677_10000598 | 3300026023 | Bacteria | 22232 |
| 575 | Ga0207677_10018321 | 3300026023 | Bacteria | 4199 |
| 576 | Ga0207677_10036280 | 3300026023 | Bacteria | 3212 |
| 577 | Ga0207677_10058229 | 3300026023 | Bacteria | 2659 |
| 578 | Ga0207677_10065700 | 3300026023 | Bacteria | 2532 |
| 579 | Ga0207677_10072764 | 3300026023 | Bacteria | 2431 |
| 580 | Ga0207677_10231064 | 3300026023 | Bacteria | 1490 |
| 581 | Ga0207703_10000357 | 3300026035 | Bacteria | 49166 |
| 582 | Ga0207703_10000746 | 3300026035 | Bacteria | 32065 |
| 583 | Ga0207703_10024218 | 3300026035 | Bacteria | 4776 |
| 584 | Ga0207703_10043079 | 3300026035 | Bacteria | 3621 |
| 585 | Ga0207703_10128218 | 3300026035 | Bacteria | 2187 |
| 586 | Ga0207639_10009491 | 3300026041 | Bacteria | 6716 |
| 587 | Ga0207639_10029203 | 3300026041 | Bacteria | 4035 |
| 588 | Ga0207678_10007312 | 3300026067 | Bacteria | 9785 |
| 589 | Ga0207678_10011189 | 3300026067 | Bacteria | 7881 |
| 590 | Ga0207678_10015432 | 3300026067 | Bacteria | 6716 |
| 591 | Ga0207678_10082708 | 3300026067 | Bacteria | 2747 |
| 592 | Ga0207678_10207134 | 3300026067 | Bacteria | 1678 |
| 593 | Ga0207678_10208163 | 3300026067 | Bacteria | 1673 |
| 594 | Ga0207708_10004145 | 3300026075 | Bacteria | 10665 |
| 595 | Ga0207708_10007951 | 3300026075 | Bacteria | 7859 |
| 596 | Ga0207708_10234001 | 3300026075 | Bacteria | 1476 |
| 597 | Ga0207702_10003836 | 3300026078 | Bacteria | 13562 |
| 598 | Ga0207702_10014082 | 3300026078 | Bacteria | 6641 |
| 599 | Ga0207702_10029159 | 3300026078 | Bacteria | 4590 |
| 600 | Ga0207702_10045737 | 3300026078 | Bacteria | 3682 |
| 601 | Ga0207702_10049161 | 3300026078 | Bacteria | 3558 |
| 602 | Ga0207702_10088947 | 3300026078 | Bacteria | 2700 |
| 603 | Ga0207702_10146000 | 3300026078 | Bacteria | 2147 |
| 604 | Ga0207641_10007190 | 3300026088 | Bacteria | 9281 |
| 605 | Ga0207641_10009017 | 3300026088 | Bacteria | 8237 |
| 606 | Ga0207641_10072505 | 3300026088 | Bacteria | 2966 |
| 607 | Ga0207641_10125576 | 3300026088 | Bacteria | 2296 |
| 608 | Ga0207641_10304927 | 3300026088 | Bacteria | 1505 |
| 609 | Ga0207648_10000149 | 3300026089 | Bacteria | 70199 |
| 610 | Ga0207648_10007044 | 3300026089 | Bacteria | 11113 |
| 611 | Ga0207648_10014327 | 3300026089 | Bacteria | 7329 |
| 612 | Ga0207648_10014574 | 3300026089 | Bacteria | 7260 |
| 613 | Ga0207648_10017253 | 3300026089 | Bacteria | 6578 |
| 614 | Ga0207648_10019771 | 3300026089 | Bacteria | 6077 |
| 615 | Ga0207648_10023267 | 3300026089 | Bacteria | 5556 |
| 616 | Ga0207648_10048131 | 3300026089 | Bacteria | 3734 |
| 617 | Ga0207676_10000236 | 3300026095 | Bacteria | 48498 |
| 618 | Ga0207676_10006704 | 3300026095 | Bacteria | 8145 |
| 619 | Ga0207676_10012337 | 3300026095 | Bacteria | 6120 |
| 620 | Ga0207674_10000694 | 3300026116 | Bacteria | 43838 |
| 621 | Ga0207674_10001128 | 3300026116 | Bacteria | 34654 |
| 622 | Ga0207674_10006144 | 3300026116 | Bacteria | 14184 |
| 623 | Ga0207674_10022289 | 3300026116 | Bacteria | 6803 |
| 624 | Ga0207674_10022536 | 3300026116 | Bacteria | 6761 |
| 625 | Ga0207674_10026234 | 3300026116 | Bacteria | 6194 |
| 626 | Ga0207674_10210919 | 3300026116 | Bacteria | 1891 |
| 627 | Ga0207675_100000230 | 3300026118 | Bacteria | 52816 |
| 628 | Ga0207675_100000871 | 3300026118 | Bacteria | 30087 |
| 629 | Ga0207675_100002944 | 3300026118 | Bacteria | 16745 |
| 630 | Ga0207675_100004627 | 3300026118 | Bacteria | 13261 |
| 631 | Ga0207675_100030831 | 3300026118 | Bacteria | 4994 |
| 632 | Ga0207683_10000005 | 3300026121 | Bacteria | 187889 |
| 633 | Ga0207683_10000285 | 3300026121 | Bacteria | 45347 |
| 634 | Ga0207683_10000364 | 3300026121 | Bacteria | 41505 |
| 635 | Ga0207683_10004773 | 3300026121 | Bacteria | 11668 |
| 636 | Ga0207683_10006165 | 3300026121 | Bacteria | 10276 |
| 637 | Ga0207683_10015805 | 3300026121 | Bacteria | 6425 |
| 638 | Ga0207683_10084179 | 3300026121 | Bacteria | 2827 |
| 639 | Ga0207683_10321686 | 3300026121 | Bacteria | 1417 |
| 640 | Ga0207698_10001960 | 3300026142 | Bacteria | 12097 |
| 641 | Ga0207698_10021781 | 3300026142 | Bacteria | 4440 |
| 642 | Ga0207698_10025539 | 3300026142 | Bacteria | 4164 |
| 643 | Ga0207698_10341426 | 3300026142 | Bacteria | 1411 |
| 644 | Ga0209969_1000136 | 3300027360 | Bacteria | 9537 |
| 645 | Ga0209996_1002378 | 3300027395 | Bacteria | 2330 |
| 646 | Ga0210000_1000292 | 3300027462 | Bacteria | 7188 |
| 647 | Ga0209995_1011156 | 3300027471 | Bacteria | 1461 |
| 648 | Ga0209983_1002782 | 3300027665 | Bacteria | 3788 |
| 649 | Ga0209971_1007936 | 3300027682 | Bacteria | 2519 |
| 650 | Ga0209813_10001571 | 3300027866 | Bacteria | 5126 |
| 651 | Ga0209974_10000335 | 3300027876 | Bacteria | 15422 |
| 652 | Ga0209974_10002039 | 3300027876 | Bacteria | 7374 |
| 653 | Ga0209974_10007387 | 3300027876 | Bacteria | 3788 |
| 654 | Ga0209974_10040668 | 3300027876 | Bacteria | 1548 |
| 655 | Ga0207428_10011849 | 3300027907 | Bacteria | 7683 |
| 656 | Ga0207428_10098368 | 3300027907 | Bacteria | 2264 |
| 657 | Ga0268266_10008117 | 3300028379 | Bacteria | 9374 |
| 658 | Ga0268266_10034562 | 3300028379 | Bacteria | 4299 |
| 659 | Ga0268266_10213272 | 3300028379 | Bacteria | 1771 |
| 660 | Ga0268266_10402793 | 3300028379 | Bacteria | 1294 |
| 661 | Ga0268265_10005441 | 3300028380 | Bacteria | 8703 |
| 662 | Ga0268265_10018470 | 3300028380 | Bacteria | 4833 |
| 663 | Ga0268265_10047984 | 3300028380 | Bacteria | 3203 |
| 664 | Ga0268264_10002371 | 3300028381 | Bacteria | 16625 |
| 665 | Ga0268264_10013772 | 3300028381 | Bacteria | 6653 |
| 666 | Ga0268264_10039446 | 3300028381 | Bacteria | 3902 |
| 667 | Ga0268264_10044953 | 3300028381 | Bacteria | 3666 |
| 668 | Ga0265324_10000001 | 3300029957 | Bacteria | 562975 |
| 669 | Ga0265324_10004084 | 3300029957 | Bacteria | 6703 |
| 670 | Ga0265330_10011554 | 3300031235 | Bacteria | 4138 |
| 671 | Ga0265332_10083577 | 3300031238 | Bacteria | 1353 |
| 672 | Ga0265328_10000020 | 3300031239 | Bacteria | 125715 |
| 673 | Ga0265328_10003722 | 3300031239 | Bacteria | 6724 |
| 674 | Ga0265328_10009523 | 3300031239 | Bacteria | 3951 |
| 675 | Ga0265325_10000542 | 3300031241 | Bacteria | 27351 |
| 676 | Ga0265325_10039496 | 3300031241 | Bacteria | 2485 |
| 677 | Ga0265331_10000144 | 3300031250 | Bacteria | 92791 |
| 678 | Ga0265331_10004577 | 3300031250 | Bacteria | 8610 |
| 679 | Ga0265331_10012989 | 3300031250 | Bacteria | 4489 |
| 680 | Ga0265331_10021602 | 3300031250 | Bacteria | 3291 |
| 681 | Ga0265331_10028015 | 3300031250 | Bacteria | 2819 |
| 682 | Ga0265331_10038261 | 3300031250 | Bacteria | 2346 |
| 683 | Ga0265331_10062312 | 3300031250 | Bacteria | 1759 |
| 684 | Ga0265331_10065006 | 3300031250 | Bacteria | 1716 |
| 685 | Ga0265327_10000044 | 3300031251 | Bacteria | 284808 |
| 686 | Ga0265327_10000136 | 3300031251 | Bacteria | 160868 |
| 687 | Ga0265327_10000314 | 3300031251 | Bacteria | 92783 |
| 688 | Ga0265327_10000475 | 3300031251 | Bacteria | 70831 |
| 689 | Ga0265327_10000730 | 3300031251 | Bacteria | 51310 |
| 690 | Ga0265327_10001767 | 3300031251 | Bacteria | 25537 |
| 691 | Ga0265327_10006826 | 3300031251 | Bacteria | 8995 |
| 692 | Ga0265327_10008949 | 3300031251 | Bacteria | 7339 |
| 693 | Ga0265327_10013003 | 3300031251 | Bacteria | 5564 |
| 694 | Ga0265327_10015340 | 3300031251 | Bacteria | 4953 |
| 695 | Ga0265327_10071561 | 3300031251 | Bacteria | 1734 |
| 696 | Ga0265316_10016572 | 3300031344 | Bacteria | 6388 |
| 697 | Ga0265316_10224637 | 3300031344 | Bacteria | 1384 |
| 698 | Ga0307408_100002911 | 3300031548 | Bacteria | 11869 |
| 699 | Ga0307408_100057101 | 3300031548 | Bacteria | 2832 |
| 700 | Ga0307408_100106422 | 3300031548 | Bacteria | 2146 |
| 701 | Ga0316575_10000042 | 3300031665 | Bacteria | 31213 |
| 702 | Ga0316579_10003975 | 3300031691 | Bacteria | 5828 |
| 703 | Ga0316579_10010044 | 3300031691 | Bacteria | 3992 |
| 704 | Ga0265314_10007067 | 3300031711 | Bacteria | 9799 |
| 705 | Ga0265314_10111146 | 3300031711 | Bacteria | 1741 |
| 706 | Ga0265314_10157317 | 3300031711 | Bacteria | 1386 |
| 707 | Ga0316576_10048257 | 3300031727 | Bacteria | 3087 |
| 708 | Ga0316578_10010133 | 3300031728 | Bacteria | 4878 |
| 709 | Ga0307405_10003878 | 3300031731 | Bacteria | 6974 |
| 710 | Ga0307405_10017485 | 3300031731 | Bacteria | 3935 |
| 711 | Ga0316577_10003010 | 3300031733 | Bacteria | 8441 |
| 712 | Ga0307413_10001237 | 3300031824 | Bacteria | 9496 |
| 713 | Ga0307410_10009907 | 3300031852 | Bacteria | 5373 |
| 714 | Ga0307410_10014406 | 3300031852 | Bacteria | 4651 |
| 715 | Ga0307410_10137685 | 3300031852 | Bacteria | 1802 |
| 716 | Ga0307406_10004415 | 3300031901 | Bacteria | 7650 |
| 717 | Ga0307406_10034187 | 3300031901 | Bacteria | 3116 |
| 718 | Ga0307407_10064001 | 3300031903 | Bacteria | 2159 |
| 719 | Ga0307407_10112942 | 3300031903 | Bacteria | 1709 |
| 720 | Ga0307412_10028767 | 3300031911 | Bacteria | 3481 |
| 721 | Ga0307409_100029836 | 3300031995 | Bacteria | 3909 |
| 722 | Ga0307409_100117877 | 3300031995 | Bacteria | 2241 |
| 723 | Ga0307416_100035373 | 3300032002 | Bacteria | 3813 |
| 724 | Ga0307414_10261984 | 3300032004 | Bacteria | 1443 |
| 725 | Ga0307411_10000127 | 3300032005 | Bacteria | 23867 |
| 726 | Ga0307411_10042097 | 3300032005 | Bacteria | 2911 |
| 727 | Ga0307411_10358727 | 3300032005 | Bacteria | 1191 |
| 728 | Ga0307415_100003315 | 3300032126 | Bacteria | 8174 |
| 729 | Ga0316583_10008955 | 3300032133 | Bacteria | 3608 |
| 730 | Ga0316583_10030946 | 3300032133 | Bacteria | 1905 |
| 731 | Ga0316583_10048555 | 3300032133 | Bacteria | 1494 |
| 732 | Ga0316585_10016146 | 3300032137 | Bacteria | 2246 |
| 733 | Ga0316580_10018726 | 3300032139 | Bacteria | 2131 |
| 734 | Ga0316593_10030950 | 3300032168 | Bacteria | 1740 |
| 735 | Ga0316596_1002051 | 3300033541 | Bacteria | 4243 |
| 736 | Ga0373928_0014325 | 3300035084 | Bacteria | 1602 |
| 737 | Ga0373928_0052041 | 3300035084 | Bacteria | 970 |
| 738 | Ga0373934_0000450 | 3300035086 | Bacteria | 14370 |
| 739 | Ga0373952_0002096 | 3300035092 | Bacteria | 3588 |
| 740 | Ga0373945_0042501 | 3300035116 | Bacteria | 1647 |
| 741 | Ga0373953_0004449 | 3300035117 | Bacteria | 4470 |
| 742 | Ga0373954_0000090 | 3300035118 | Bacteria | 31033 |
| 743 | Ga0373956_0004386 | 3300035119 | Bacteria | 5651 |
| 744 | Ga0373957_0004734 | 3300035120 | Bacteria | 4164 |
| 745 | Ga0373943_0009829 | 3300035170 | Bacteria | 4283 |
| 746 | Ga0373943_0038768 | 3300035170 | Bacteria | 2292 |
| 747 | Ga0373946_0113841 | 3300035171 | Bacteria | 1227 |
| 748 | Ga0316574_0001261 | 3300035398 | Bacteria | 11807 |
| 749 | Ga0316574_0004450 | 3300035398 | Bacteria | 7347 |
| 750 | Ga0316574_0033809 | 3300035398 | Bacteria | 3113 |
| 751 | Ga0373935_0023065 | 3300035692 | Bacteria | 3822 |
| 752 | Ga0373935_0256356 | 3300035692 | Bacteria | 1225 |
| 753 | Ga0373927_0019318 | 3300035695 | Bacteria | 4469 |
| 754 | Ga0373927_0030999 | 3300035695 | Bacteria | 3487 |
| 755 | Ga0373927_0117713 | 3300035695 | Bacteria | 1733 |
| 756 | Ga0373947_0038846 | 3300035725 | Bacteria | 2830 |
| 757 | Ga0373947_0312313 | 3300035725 | Bacteria | 1050 |
| 758 | Ga0373937_0031264 | 3300036401 | Bacteria | 4822 |
| 759 | Ga0373937_0040788 | 3300036401 | Bacteria | 4232 |
| 760 | Ga0373937_0125613 | 3300036401 | Bacteria | 2393 |
| 761 | Ga0373937_0132013 | 3300036401 | Bacteria | 2333 |
| 762 | Ga0373937_0168682 | 3300036401 | Bacteria | 2053 |
| 763 | Ga0316582_0009509 | 3300036647 | Bacteria | 5279 |
| 764 | Ga0316582_0055880 | 3300036647 | Bacteria | 2517 |
| 765 | Ga0316584_0002039 | 3300036712 | Bacteria | 12637 |
| 766 | Ga0316584_0004127 | 3300036712 | Bacteria | 9583 |
| 767 | Ga0373925_0216161 | 3300037068 | Bacteria | 1529 |
| 768 | Ga0373925_0395196 | 3300037068 | Bacteria | 1127 |
| 769 | Ga0395899_0214769 | 3300037312 | Bacteria | 1335 |
| 770 | Ga0395900_0099978 | 3300037418 | Bacteria | 2979 |
| 771 | Ga0395900_0395256 | 3300037418 | Bacteria | 1348 |
| 772 | Ga0395901_0040793 | 3300038443 | Bacteria | 4808 |
| 773 | Ga0400483_128908 | 3300039062 | Bacteria | 1812 |
| 774 | Ga0436361_0060436 | 3300039447 | Bacteria | 2382 |
| 775 | Ga0436361_0235627 | 3300039447 | Bacteria | 11028 |
| 776 | Ga0436361_0891393 | 3300039447 | Bacteria | 99242 |
| 777 | Ga0451807_0812292 | 3300041486 | Bacteria | 4489 |
| 778 | Ga0451853_2089945 | 3300041512 | Bacteria | 2193 |
| 779 | Ga0439441_001329 | 3300042001 | Bacteria | 3190 |
| 780 | Ga0439455_0050163 | 3300042012 | Bacteria | 1089 |
| 781 | Ga0451577_0000002 | 3300042876 | Bacteria | 1731375 |
| 782 | Ga0451577_0000395 | 3300042876 | Bacteria | 80169 |
| 783 | Ga0451577_0001764 | 3300042876 | Bacteria | 27851 |
| 784 | Ga0451577_0137433 | 3300042876 | Bacteria | 2195 |
| 785 | Ga0451577_0178970 | 3300042876 | Bacteria | 1911 |
| 786 | Ga0451577_0192340 | 3300042876 | Bacteria | 1841 |
| 787 | Ga0451577_0369281 | 3300042876 | Bacteria | 1301 |
| 788 | Ga0453683_0000011 | 3300044673 | Bacteria | 412765 |
| 789 | Ga0453683_0003829 | 3300044673 | Bacteria | 10922 |
| 790 | Ga0453684_0000002 | 3300044712 | Bacteria | 1731375 |
| 791 | Ga0453684_0000694 | 3300044712 | Bacteria | 119688 |
| 792 | Ga0453684_0001529 | 3300044712 | Bacteria | 64683 |
| 793 | Ga0453684_0002108 | 3300044712 | Bacteria | 50205 |
| 794 | Ga0453684_0013161 | 3300044712 | Bacteria | 13491 |
| 795 | Ga0453684_0034047 | 3300044712 | Bacteria | 7083 |
| 796 | Ga0453684_0303582 | 3300044712 | Bacteria | 1814 |
| 797 | Ga0451576_0000004 | 3300045051 | Bacteria | 1312238 |
| 798 | Ga0451576_0000006 | 3300045051 | Bacteria | 949698 |
| 799 | Ga0451576_0001977 | 3300045051 | Bacteria | 32557 |
| 800 | Ga0451576_0002214 | 3300045051 | Bacteria | 29931 |
| 801 | Ga0451576_0002633 | 3300045051 | Bacteria | 26264 |
| 802 | Ga0451576_0006277 | 3300045051 | Bacteria | 14626 |
| 803 | Ga0451576_0018556 | 3300045051 | Bacteria | 7621 |
| 804 | Ga0451576_0069900 | 3300045051 | Bacteria | 3654 |
| 805 | Ga0451576_0082691 | 3300045051 | Bacteria | 3340 |
| 806 | Ga0451576_0138914 | 3300045051 | Bacteria | 2535 |
| 807 | Ga0466967_0480879 | 3300045976 | Bacteria | 1217 |
| 808 | Ga0495629_0072973 | 3300046459 | Bacteria | 2396 |
| 809 | Ga0495629_0122088 | 3300046459 | Bacteria | 1815 |
| 810 | Ga0495629_0373400 | 3300046459 | Bacteria | 971 |
| 811 | Ga0495580_0046345 | 3300046472 | Bacteria | 3085 |
| 812 | Ga0495580_0142954 | 3300046472 | Bacteria | 1658 |
| 813 | Ga0495582_0018395 | 3300046473 | Bacteria | 3821 |
| 814 | Ga0495639_0029001 | 3300046475 | Bacteria | 2454 |
| 815 | Ga0495665_0031115 | 3300046531 | Bacteria | 2856 |
| 816 | Ga0495587_0040968 | 3300046536 | Bacteria | 2765 |
| 817 | Ga0495621_0004496 | 3300046539 | Bacteria | 3930 |
| 818 | Ga0495621_0029257 | 3300046539 | Bacteria | 1877 |
| 819 | Ga0495645_0179809 | 3300046543 | Bacteria | 1450 |
| 820 | Ga0495635_0003129 | 3300046663 | Bacteria | 11389 |
| 821 | Ga0495659_0008400 | 3300046664 | Bacteria | 3286 |
| 822 | Ga0495658_0227644 | 3300046683 | Bacteria | 1168 |
| 823 | Ga0495600_0013499 | 3300046809 | Bacteria | 5135 |
| 824 | Ga0495581_0009908 | 3300047315 | Bacteria | 5512 |
| 825 | Ga0495604_0086299 | 3300047317 | Bacteria | 2340 |
| 826 | Ga0495674_0121424 | 3300047319 | Bacteria | 2207 |
| 827 | Ga0495680_0027794 | 3300047322 | Bacteria | 4642 |
| 828 | Ga0495675_0145128 | 3300047444 | Bacteria | 1469 |
| 829 | Ga0495684_0052242 | 3300047471 | Bacteria | 3118 |
| 830 | Ga0496100_0049877 | 3300048903 | Bacteria | 2709 |
| 831 | Ga0496101_0009759 | 3300048904 | Bacteria | 6320 |
| 832 | Ga0496101_0156327 | 3300048904 | Bacteria | 1747 |
| 833 | Ga0496102_0013642 | 3300048905 | Bacteria | 7042 |
| 834 | Ga0496102_0095561 | 3300048905 | Bacteria | 2755 |
| 835 | Ga0496103_0037694 | 3300048906 | Bacteria | 2963 |
| 836 | Ga0496103_0122994 | 3300048906 | Bacteria | 1654 |
| 837 | Ga0496104_0035404 | 3300048907 | Bacteria | 4661 |
| 838 | Ga0496104_0266122 | 3300048907 | Bacteria | 1627 |
| 839 | Ga0496105_0010312 | 3300048908 | Bacteria | 7345 |
| 840 | Ga0496105_0020268 | 3300048908 | Bacteria | 5373 |
| 841 | Ga0496106_0037450 | 3300048909 | Bacteria | 3629 |
| 842 | Ga0496106_0044631 | 3300048909 | Bacteria | 3327 |
| 843 | Ga0496106_0100662 | 3300048909 | Bacteria | 2241 |
| 844 | Ga0496106_0197689 | 3300048909 | Bacteria | 1600 |
| 845 | Ga0496107_0037001 | 3300048910 | Bacteria | 3502 |
| 846 | Ga0496107_0059285 | 3300048910 | Bacteria | 2770 |
| 847 | Ga0496108_0001943 | 3300048911 | Bacteria | 16553 |
| 848 | Ga0496108_0028099 | 3300048911 | Bacteria | 4653 |
| 849 | Ga0496108_0061510 | 3300048911 | Bacteria | 3160 |
| 850 | Ga0496109_0007082 | 3300048912 | Bacteria | 9465 |
| 851 | Ga0496109_0021461 | 3300048912 | Bacteria | 5710 |
| 852 | Ga0496109_0087616 | 3300048912 | Bacteria | 2876 |
| 853 | Ga0496109_0116251 | 3300048912 | Bacteria | 2489 |
| 854 | Ga0496110_0041351 | 3300048913 | Bacteria | 4022 |
| 855 | Ga0496110_0110755 | 3300048913 | Bacteria | 2467 |
| 856 | Ga0496112_0000540 | 3300048915 | Bacteria | 25909 |
| 857 | Ga0496112_0019957 | 3300048915 | Bacteria | 6342 |
| 858 | Ga0496112_0130501 | 3300048915 | Bacteria | 2484 |
| 859 | Ga0496114_0065630 | 3300048917 | Bacteria | 3041 |
| 860 | Ga0496114_0081151 | 3300048917 | Bacteria | 2740 |
| 861 | Ga0496114_0086431 | 3300048917 | Bacteria | 2658 |
| 862 | Ga0496114_0100347 | 3300048917 | Bacteria | 2470 |
| 863 | Ga0496114_0341069 | 3300048917 | Bacteria | 1325 |
| 864 | Ga0496114_0363031 | 3300048917 | Bacteria | 1281 |
| 865 | Ga0501031_0006233 | 3300049568 | Bacteria | 7778 |
| 866 | Ga0501031_0009246 | 3300049568 | Bacteria | 6405 |
| 867 | Ga0501031_0066973 | 3300049568 | Bacteria | 2340 |
| 868 | Ga0501032_0000403 | 3300049569 | Bacteria | 35638 |
| 869 | Ga0501032_0007680 | 3300049569 | Bacteria | 7860 |
| 870 | Ga0501032_0051359 | 3300049569 | Bacteria | 2780 |
| 871 | Ga0501032_0072552 | 3300049569 | Bacteria | 2295 |
| 872 | Ga0501033_0000709 | 3300049570 | Bacteria | 30657 |
| 873 | Ga0501033_0001808 | 3300049570 | Bacteria | 18685 |
| 874 | Ga0501033_0016892 | 3300049570 | Bacteria | 5517 |
| 875 | Ga0501034_0000759 | 3300049571 | Bacteria | 48520 |
| 876 | Ga0501034_0008103 | 3300049571 | Bacteria | 11145 |
| 877 | Ga0501034_0077421 | 3300049571 | Bacteria | 3331 |
| 878 | Ga0501034_0080850 | 3300049571 | Bacteria | 3253 |
| 879 | Ga0501036_0000268 | 3300049572 | Bacteria | 35567 |
| 880 | Ga0501036_0001606 | 3300049572 | Bacteria | 17453 |
| 881 | Ga0501036_0219371 | 3300049572 | Bacteria | 1597 |
| 882 | Ga0501037_0023208 | 3300049573 | Bacteria | 4587 |
| 883 | Ga0501037_0102228 | 3300049573 | Bacteria | 2067 |
| 884 | Ga0501037_0142279 | 3300049573 | Bacteria | 1716 |
| 885 | Ga0501038_0000280 | 3300049574 | Bacteria | 43290 |
| 886 | Ga0501038_0001255 | 3300049574 | Bacteria | 23022 |
| 887 | Ga0501038_0004118 | 3300049574 | Bacteria | 13528 |
| 888 | Ga0501038_0019910 | 3300049574 | Bacteria | 6039 |
| 889 | Ga0501038_0047069 | 3300049574 | Bacteria | 3737 |
| 890 | Ga0501038_0076106 | 3300049574 | Bacteria | 2835 |
| 891 | Ga0501038_0279571 | 3300049574 | Bacteria | 1314 |
| 892 | Ga0501039_0030324 | 3300049575 | Bacteria | 4170 |
| 893 | Ga0501039_0084871 | 3300049575 | Unclassified | 2467 |
| 894 | Ga0501039_0167569 | 3300049575 | Bacteria | 1727 |
| 895 | Ga0501039_0272400 | 3300049575 | Bacteria | 1330 |
| 896 | Ga0501040_0001121 | 3300049576 | Bacteria | 16964 |
| 897 | Ga0501040_0050934 | 3300049576 | Bacteria | 2833 |
| 898 | Ga0501042_0125352 | 3300049578 | Bacteria | 1849 |
| 899 | Ga0501043_0001507 | 3300049579 | Bacteria | 20331 |
| 900 | Ga0501043_0003838 | 3300049579 | Bacteria | 12355 |
| 901 | Ga0501043_0020315 | 3300049579 | Bacteria | 5210 |
| 902 | Ga0501046_0008472 | 3300049580 | Bacteria | 8958 |
| 903 | Ga0501046_0141840 | 3300049580 | Bacteria | 1818 |
| 904 | Ga0501047_0002525 | 3300049581 | Bacteria | 17435 |
| 905 | Ga0501047_0017182 | 3300049581 | Bacteria | 6925 |
| 906 | Ga0501048_0006099 | 3300049582 | Bacteria | 9181 |
| 907 | Ga0501067_0005678 | 3300049583 | Bacteria | 6928 |
| 908 | Ga0501068_0013549 | 3300049584 | Bacteria | 4641 |
| 909 | Ga0501069_0087657 | 3300049585 | Bacteria | 1758 |
| 910 | Ga0501069_0105584 | 3300049585 | Bacteria | 1601 |
| 911 | Ga0501072_0007494 | 3300049588 | Bacteria | 8281 |
| 912 | Ga0501072_0105355 | 3300049588 | Bacteria | 2242 |
| 913 | Ga0501073_0006424 | 3300049589 | Bacteria | 8751 |
| 914 | Ga0501073_0061438 | 3300049589 | Bacteria | 2622 |
| 915 | Ga0501073_0113961 | 3300049589 | Bacteria | 1875 |
| 916 | Ga0501074_0039704 | 3300049590 | Bacteria | 3409 |
| 917 | Ga0501074_0128000 | 3300049590 | Bacteria | 1817 |
| 918 | Ga0501075_0042183 | 3300049591 | Bacteria | 3420 |
| 919 | Ga0501076_0014178 | 3300049592 | Bacteria | 5997 |
| 920 | Ga0501077_0027329 | 3300049593 | Bacteria | 3624 |
| 921 | Ga0501079_0001860 | 3300049741 | Bacteria | 15133 |
| 922 | Ga0501080_0003681 | 3300049742 | Bacteria | 13520 |
| 923 | Ga0501080_0019259 | 3300049742 | Bacteria | 6321 |
| 924 | Ga0501081_0016868 | 3300049743 | Bacteria | 4826 |
| 925 | Ga0501083_0068897 | 3300049744 | Bacteria | 2354 |
| 926 | Ga0501035_0000270 | 3300049822 | Bacteria | 61516 |
| 927 | Ga0501035_0004552 | 3300049822 | Bacteria | 13160 |
| 928 | Ga0501035_0007685 | 3300049822 | Bacteria | 10073 |
| 929 | Ga0501035_0068178 | 3300049822 | Bacteria | 3155 |
| 930 | Ga0501035_0111503 | 3300049822 | Bacteria | 2397 |
| 931 | Ga0501044_0000261 | 3300049823 | Bacteria | 66869 |
| 932 | Ga0501044_0000482 | 3300049823 | Bacteria | 48412 |
| 933 | Ga0501044_0004065 | 3300049823 | Bacteria | 16403 |
| 934 | Ga0501045_0000564 | 3300049824 | Bacteria | 23265 |
| 935 | Ga0501045_0030960 | 3300049824 | Bacteria | 3874 |
| 936 | nmdc:mga03683_10226_c1 | 3300050489 | Bacteria | 3361 |
| 937 | nmdc:mga03n38_981_c1 | 3300050490 | Bacteria | 7780 |
| 938 | nmdc:mga00v17_5571_c1 | 3300050491 | Bacteria | 6638 |
| 939 | nmdc:mga0yw44_172_c1 | 3300050492 | Bacteria | 22648 |
| 940 | nmdc:mga0k408_12910_c1 | 3300050493 | Bacteria | 4574 |
| 941 | nmdc:mga0k408_35783_c1 | 3300050493 | Bacteria | 2848 |
| 942 | nmdc:mga06z11_1401_c1 | 3300050494 | Bacteria | 8957 |
| 943 | nmdc:mga04h51_1093_c1 | 3300050495 | Bacteria | 6254 |
| 944 | nmdc:mga05p37_240457_c1 | 3300050507 | Bacteria | 2177 |
| 945 | nmdc:mga05p37_300622_c1 | 3300050507 | Bacteria | 1907 |
| 946 | nmdc:mga09592_30954_c1 | 3300050508 | Bacteria | 4456 |
| 947 | nmdc:mga08y16_128607_c1 | 3300050511 | Bacteria | 2635 |
| 948 | nmdc:mga08y16_27570_c1 | 3300050511 | Bacteria | 5985 |
| 949 | nmdc:mga08y16_71407_c1 | 3300050511 | Bacteria | 3618 |
| 950 | nmdc:mga08y16_84834_c1 | 3300050511 | Bacteria | 3301 |
| 951 | nmdc:mga0n895_111670_c1 | 3300050512 | Bacteria | 2750 |
| 952 | nmdc:mga0n895_17716_c1 | 3300050512 | Bacteria | 6571 |
| 953 | nmdc:mga0n895_185344_c1 | 3300050512 | Bacteria | 2112 |
| 954 | nmdc:mga0n895_255694_c1 | 3300050512 | Bacteria | 1777 |
| 955 | nmdc:mga0n895_432_c1 | 3300050512 | Bacteria | 28136 |
| 956 | nmdc:mga0rr50_1318_c1 | 3300050513 | Bacteria | 13536 |
| 957 | nmdc:mga0rr50_49968_c1 | 3300050513 | Bacteria | 3097 |
| 958 | nmdc:mga0rr50_5859_c1 | 3300050513 | Bacteria | 7390 |
| 959 | nmdc:mga0rr50_72129_c1 | 3300050513 | Bacteria | 2636 |
| 960 | nmdc:mga0rr50_97216_c1 | 3300050513 | Bacteria | 2305 |
| 961 | nmdc:mga08x19_60696_c1 | 3300050514 | Bacteria | 2449 |
| 962 | nmdc:mga0sz30_9987_c1 | 3300050516 | Bacteria | 3629 |
| 963 | Ga0495619_0010282 | 3300053085 | Bacteria | 5892 |
| 964 | Ga0500594_0004257 | 3300053118 | Bacteria | 3156 |
| 965 | Ga0500622_0000019 | 3300053156 | Bacteria | 275028 |
| 966 | Ga0501082_0034997 | 3300060353 | Bacteria | 4328 |
| 967 | Ga0501082_0045730 | 3300060353 | Bacteria | 3775 |
| 968 | Ga0530510_0080048 | 3300061734 | Bacteria | 2377 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025927 | Ga0207687_10000188 | Ga0207687_1000018838 | 295 |
| 2 | 3300026023 | Ga0207677_10065700 | Ga0207677_100657003 | 299 |
| 3 | 3300046459 | Ga0495629_0373400 | Ga0495629_0373400_14_925 | 299 |
| 4 | 3300035084 | Ga0373928_0052041 | Ga0373928_0052041_32_940 | 300 |
| 5 | 3300037068 | Ga0373925_0395196 | Ga0373925_0395196_193_1101 | 300 |
| 6 | 3300046539 | Ga0495621_0029257 | Ga0495621_0029257_940_1848 | 300 |
| 7 | 3300047319 | Ga0495674_0121424 | Ga0495674_0121424_1280_2188 | 300 |
| 8 | 3300047444 | Ga0495675_0145128 | Ga0495675_0145128_502_1410 | 300 |
| 9 | 3300014745 | Ga0157377_10251800 | Ga0157377_102518001 | 302 |
| 10 | 3300011119 | Ga0105246_10040771 | Ga0105246_100407713 | 318 |
| 11 | 3300035725 | Ga0373947_0312313 | Ga0373947_0312313_14_1006 | 318 |
| 12 | 3300025933 | Ga0207706_10294380 | Ga0207706_102943802 | 321 |
| 13 | 3300046536 | Ga0495587_0040968 | Ga0495587_0040968_773_1777 | 322 |
| 14 | 3300014968 | Ga0157379_10115348 | Ga0157379_101153483 | 327 |
| 15 | iso_pu_bacteria | 2894510363 | 2894514810 | 327 |
| 16 | iso_pu_bacteria | 2989392574 | 2989396658 | 327 |
| 17 | 3300005340 | Ga0070689_100108700 | Ga0070689_1001087002 | 328 |
| 18 | 3300005615 | Ga0070702_100098242 | Ga0070702_1000982421 | 328 |
| 19 | 3300025931 | Ga0207644_10143201 | Ga0207644_101432012 | 328 |
| 20 | iso_pu_bacteria | 2547132103 | 2547372644 | 328 |
| 21 | iso_pu_bacteria | 2843690924 | 2843691647 | 328 |
| 22 | iso_pu_bacteria | 2846033681 | 2846037063 | 328 |
| 23 | iso_pu_bacteria | 2846037992 | 2846040145 | 328 |
| 24 | iso_pu_bacteria | 2891633521 | 2891637714 | 328 |
| 25 | iso_pu_bacteria | 8001522603 | 8001524634 | 328 |
| 26 | 3300039062 | Ga0400483_128908 | Ga0400483_128908_26_1054 | 330 |
| 27 | 3300006038 | Ga0075365_10032640 | Ga0075365_100326403 | 331 |
| 28 | 3300006042 | Ga0075368_10005372 | Ga0075368_100053726 | 331 |
| 29 | 3300006178 | Ga0075367_10002132 | Ga0075367_100021329 | 331 |
| 30 | 3300006186 | Ga0075369_10000546 | Ga0075369_100005469 | 331 |
| 31 | 3300006195 | Ga0075366_10010257 | Ga0075366_100102573 | 331 |
| 32 | 3300027866 | Ga0209813_10001571 | Ga0209813_100015713 | 331 |
| 33 | 3300031251 | Ga0265327_10015340 | Ga0265327_100153403 | 331 |
| 34 | 3300042876 | Ga0451577_0000395 | Ga0451577_0000395_19310_20338 | 331 |
| 35 | 3300044712 | Ga0453684_0002108 | Ga0453684_0002108_40396_41424 | 331 |
| 36 | 3300044712 | Ga0453684_0034047 | Ga0453684_0034047_2208_3236 | 331 |
| 37 | 3300045051 | Ga0451576_0082691 | Ga0451576_0082691_1876_2904 | 331 |
| 38 | 3300050489 | nmdc:mga03683_10226_c1 | nmdc:mga03683_10226_c1_2245_3276 | 331 |
| 39 | 3300050490 | nmdc:mga03n38_981_c1 | nmdc:mga03n38_981_c1_3280_4311 | 331 |
| 40 | 3300050491 | nmdc:mga00v17_5571_c1 | nmdc:mga00v17_5571_c1_282_1313 | 331 |
| 41 | 3300050492 | nmdc:mga0yw44_172_c1 | nmdc:mga0yw44_172_c1_10590_11621 | 331 |
| 42 | 3300050493 | nmdc:mga0k408_35783_c1 | nmdc:mga0k408_35783_c1_227_1258 | 331 |
| 43 | 3300050494 | nmdc:mga06z11_1401_c1 | nmdc:mga06z11_1401_c1_3470_4501 | 331 |
| 44 | 3300050495 | nmdc:mga04h51_1093_c1 | nmdc:mga04h51_1093_c1_226_1257 | 331 |
| 45 | 3300050516 | nmdc:mga0sz30_9987_c1 | nmdc:mga0sz30_9987_c1_783_1814 | 331 |
| 46 | 3300053118 | Ga0500594_0004257 | Ga0500594_0004257_2001_3032 | 331 |
| 47 | 3300005333 | Ga0070677_10010233 | Ga0070677_100102334 | 332 |
| 48 | 3300005336 | Ga0070680_100170045 | Ga0070680_1001700452 | 332 |
| 49 | 3300005339 | Ga0070660_100031943 | Ga0070660_1000319436 | 332 |
| 50 | 3300005340 | Ga0070689_100064761 | Ga0070689_1000647613 | 332 |
| 51 | 3300005343 | Ga0070687_100074952 | Ga0070687_1000749522 | 332 |
| 52 | 3300005344 | Ga0070661_100002576 | Ga0070661_10000257612 | 332 |
| 53 | 3300005344 | Ga0070661_100090669 | Ga0070661_1000906693 | 332 |
| 54 | 3300005347 | Ga0070668_100001538 | Ga0070668_1000015387 | 332 |
| 55 | 3300005347 | Ga0070668_100071300 | Ga0070668_1000713003 | 332 |
| 56 | 3300005355 | Ga0070671_100022630 | Ga0070671_1000226306 | 332 |
| 57 | 3300005366 | Ga0070659_100177741 | Ga0070659_1001777413 | 332 |
| 58 | 3300005366 | Ga0070659_100322161 | Ga0070659_1003221611 | 332 |
| 59 | 3300005367 | Ga0070667_100104911 | Ga0070667_1001049114 | 332 |
| 60 | 3300005441 | Ga0070700_100005754 | Ga0070700_1000057542 | 332 |
| 61 | 3300005441 | Ga0070700_100072465 | Ga0070700_1000724651 | 332 |
| 62 | 3300005444 | Ga0070694_100071367 | Ga0070694_1000713673 | 332 |
| 63 | 3300005456 | Ga0070678_100037493 | Ga0070678_1000374934 | 332 |
| 64 | 3300005457 | Ga0070662_100040507 | Ga0070662_1000405072 | 332 |
| 65 | 3300005458 | Ga0070681_10007813 | Ga0070681_1000781310 | 332 |
| 66 | 3300005458 | Ga0070681_10022742 | Ga0070681_100227429 | 332 |
| 67 | 3300005467 | Ga0070706_100022655 | Ga0070706_1000226558 | 332 |
| 68 | 3300005468 | Ga0070707_100015911 | Ga0070707_1000159112 | 332 |
| 69 | 3300005468 | Ga0070707_100175192 | Ga0070707_1001751921 | 332 |
| 70 | 3300005518 | Ga0070699_100328116 | Ga0070699_1003281161 | 332 |
| 71 | 3300005530 | Ga0070679_100033388 | Ga0070679_1000333886 | 332 |
| 72 | 3300005539 | Ga0068853_100045026 | Ga0068853_1000450262 | 332 |
| 73 | 3300005543 | Ga0070672_100186266 | Ga0070672_1001862662 | 332 |
| 74 | 3300005544 | Ga0070686_100096000 | Ga0070686_1000960002 | 332 |
| 75 | 3300005545 | Ga0070695_100030795 | Ga0070695_1000307952 | 332 |
| 76 | 3300005546 | Ga0070696_100032438 | Ga0070696_1000324384 | 332 |
| 77 | 3300005546 | Ga0070696_100063601 | Ga0070696_1000636013 | 332 |
| 78 | 3300005548 | Ga0070665_100030720 | Ga0070665_1000307202 | 332 |
| 79 | 3300005563 | Ga0068855_100106814 | Ga0068855_1001068144 | 332 |
| 80 | 3300005564 | Ga0070664_100206990 | Ga0070664_1002069902 | 332 |
| 81 | 3300005615 | Ga0070702_100046528 | Ga0070702_1000465281 | 332 |
| 82 | 3300005617 | Ga0068859_100116149 | Ga0068859_1001161493 | 332 |
| 83 | 3300005842 | Ga0068858_100031566 | Ga0068858_1000315666 | 332 |
| 84 | 3300005843 | Ga0068860_100206852 | Ga0068860_1002068522 | 332 |
| 85 | 3300005844 | Ga0068862_100183721 | Ga0068862_1001837212 | 332 |
| 86 | 3300006195 | Ga0075366_10029099 | Ga0075366_100290993 | 332 |
| 87 | 3300006237 | Ga0097621_100138178 | Ga0097621_1001381783 | 332 |
| 88 | 3300006844 | Ga0075428_100002887 | Ga0075428_1000028875 | 332 |
| 89 | 3300006846 | Ga0075430_100134415 | Ga0075430_1001344153 | 332 |
| 90 | 3300006871 | Ga0075434_100000306 | Ga0075434_1000003063 | 332 |
| 91 | 3300006871 | Ga0075434_100174691 | Ga0075434_1001746912 | 332 |
| 92 | 3300006880 | Ga0075429_100033953 | Ga0075429_1000339534 | 332 |
| 93 | 3300006881 | Ga0068865_100162841 | Ga0068865_1001628411 | 332 |
| 94 | 3300006914 | Ga0075436_100152988 | Ga0075436_1001529882 | 332 |
| 95 | 3300006931 | Ga0097620_100116144 | Ga0097620_1001161443 | 332 |
| 96 | 3300007076 | Ga0075435_100040195 | Ga0075435_1000401955 | 332 |
| 97 | 3300007265 | Ga0099794_10122638 | Ga0099794_101226382 | 332 |
| 98 | 3300009094 | Ga0111539_10000957 | Ga0111539_1000095713 | 332 |
| 99 | 3300009094 | Ga0111539_10039536 | Ga0111539_100395365 | 332 |
| 100 | 3300009094 | Ga0111539_10057738 | Ga0111539_100577383 | 332 |
| 101 | 3300009094 | Ga0111539_10060204 | Ga0111539_100602044 | 332 |
| 102 | 3300009147 | Ga0114129_10444982 | Ga0114129_104449822 | 332 |
| 103 | 3300009176 | Ga0105242_10024661 | Ga0105242_100246612 | 332 |
| 104 | 3300009176 | Ga0105242_10213435 | Ga0105242_102134353 | 332 |
| 105 | 3300009553 | Ga0105249_10066620 | Ga0105249_100666202 | 332 |
| 106 | 3300013104 | Ga0157370_10014097 | Ga0157370_100140974 | 332 |
| 107 | 3300013296 | Ga0157374_10000924 | Ga0157374_100009247 | 332 |
| 108 | 3300013297 | Ga0157378_10052080 | Ga0157378_100520805 | 332 |
| 109 | 3300013297 | Ga0157378_10208896 | Ga0157378_102088962 | 332 |
| 110 | 3300013307 | Ga0157372_10015325 | Ga0157372_100153253 | 332 |
| 111 | 3300013308 | Ga0157375_10385748 | Ga0157375_103857482 | 332 |
| 112 | 3300014326 | Ga0157380_10085349 | Ga0157380_100853494 | 332 |
| 113 | 3300014745 | Ga0157377_10009541 | Ga0157377_100095416 | 332 |
| 114 | 3300014968 | Ga0157379_10059206 | Ga0157379_100592063 | 332 |
| 115 | 3300014969 | Ga0157376_10273364 | Ga0157376_102733641 | 332 |
| 116 | 3300021361 | Ga0213872_10000333 | Ga0213872_100003339 | 332 |
| 117 | 3300021361 | Ga0213872_10002733 | Ga0213872_100027332 | 332 |
| 118 | 3300021361 | Ga0213872_10004503 | Ga0213872_100045035 | 332 |
| 119 | 3300025315 | Ga0207697_10007231 | Ga0207697_100072313 | 332 |
| 120 | 3300025893 | Ga0207682_10000993 | Ga0207682_1000099312 | 332 |
| 121 | 3300025901 | Ga0207688_10006119 | Ga0207688_100061197 | 332 |
| 122 | 3300025901 | Ga0207688_10041079 | Ga0207688_100410793 | 332 |
| 123 | 3300025907 | Ga0207645_10007484 | Ga0207645_100074847 | 332 |
| 124 | 3300025908 | Ga0207643_10003518 | Ga0207643_100035189 | 332 |
| 125 | 3300025910 | Ga0207684_10046819 | Ga0207684_100468196 | 332 |
| 126 | 3300025912 | Ga0207707_10046343 | Ga0207707_100463433 | 332 |
| 127 | 3300025912 | Ga0207707_10139098 | Ga0207707_101390983 | 332 |
| 128 | 3300025912 | Ga0207707_10144033 | Ga0207707_101440333 | 332 |
| 129 | 3300025917 | Ga0207660_10095518 | Ga0207660_100955183 | 332 |
| 130 | 3300025918 | Ga0207662_10096349 | Ga0207662_100963492 | 332 |
| 131 | 3300025922 | Ga0207646_10018213 | Ga0207646_100182132 | 332 |
| 132 | 3300025925 | Ga0207650_10274402 | Ga0207650_102744022 | 332 |
| 133 | 3300025932 | Ga0207690_10265407 | Ga0207690_102654072 | 332 |
| 134 | 3300025933 | Ga0207706_10048226 | Ga0207706_100482264 | 332 |
| 135 | 3300025934 | Ga0207686_10149671 | Ga0207686_101496712 | 332 |
| 136 | 3300025935 | Ga0207709_10031657 | Ga0207709_100316575 | 332 |
| 137 | 3300025937 | Ga0207669_10055040 | Ga0207669_100550403 | 332 |
| 138 | 3300025942 | Ga0207689_10008896 | Ga0207689_100088968 | 332 |
| 139 | 3300025945 | Ga0207679_10324702 | Ga0207679_103247022 | 332 |
| 140 | 3300025961 | Ga0207712_10085235 | Ga0207712_100852353 | 332 |
| 141 | 3300025972 | Ga0207668_10005221 | Ga0207668_100052216 | 332 |
| 142 | 3300025981 | Ga0207640_10182049 | Ga0207640_101820492 | 332 |
| 143 | 3300025986 | Ga0207658_10437021 | Ga0207658_104370211 | 332 |
| 144 | 3300026067 | Ga0207678_10207134 | Ga0207678_102071341 | 332 |
| 145 | 3300026075 | Ga0207708_10004145 | Ga0207708_100041459 | 332 |
| 146 | 3300026075 | Ga0207708_10007951 | Ga0207708_100079518 | 332 |
| 147 | 3300026078 | Ga0207702_10029159 | Ga0207702_100291593 | 332 |
| 148 | 3300026089 | Ga0207648_10023267 | Ga0207648_100232676 | 332 |
| 149 | 3300026116 | Ga0207674_10022289 | Ga0207674_100222897 | 332 |
| 150 | 3300026118 | Ga0207675_100002944 | Ga0207675_1000029445 | 332 |
| 151 | 3300026121 | Ga0207683_10006165 | Ga0207683_100061654 | 332 |
| 152 | 3300027360 | Ga0209969_1000136 | Ga0209969_10001367 | 332 |
| 153 | 3300027395 | Ga0209996_1002378 | Ga0209996_10023782 | 332 |
| 154 | 3300027462 | Ga0210000_1000292 | Ga0210000_10002927 | 332 |
| 155 | 3300027665 | Ga0209983_1002782 | Ga0209983_10027825 | 332 |
| 156 | 3300027682 | Ga0209971_1007936 | Ga0209971_10079362 | 332 |
| 157 | 3300027876 | Ga0209974_10000335 | Ga0209974_100003358 | 332 |
| 158 | 3300027876 | Ga0209974_10007387 | Ga0209974_100073871 | 332 |
| 159 | 3300027907 | Ga0207428_10011849 | Ga0207428_1001184910 | 332 |
| 160 | 3300027907 | Ga0207428_10098368 | Ga0207428_100983682 | 332 |
| 161 | 3300028380 | Ga0268265_10047984 | Ga0268265_100479845 | 332 |
| 162 | 3300029957 | Ga0265324_10004084 | Ga0265324_100040844 | 332 |
| 163 | 3300031235 | Ga0265330_10011554 | Ga0265330_100115545 | 332 |
| 164 | 3300031238 | Ga0265332_10083577 | Ga0265332_100835771 | 332 |
| 165 | 3300031239 | Ga0265328_10000020 | Ga0265328_10000020119 | 332 |
| 166 | 3300031239 | Ga0265328_10003722 | Ga0265328_100037227 | 332 |
| 167 | 3300031239 | Ga0265328_10009523 | Ga0265328_100095234 | 332 |
| 168 | 3300031241 | Ga0265325_10039496 | Ga0265325_100394963 | 332 |
| 169 | 3300031250 | Ga0265331_10000144 | Ga0265331_1000014489 | 332 |
| 170 | 3300031250 | Ga0265331_10004577 | Ga0265331_100045777 | 332 |
| 171 | 3300031250 | Ga0265331_10012989 | Ga0265331_100129893 | 332 |
| 172 | 3300031250 | Ga0265331_10021602 | Ga0265331_100216024 | 332 |
| 173 | 3300031250 | Ga0265331_10028015 | Ga0265331_100280153 | 332 |
| 174 | 3300031250 | Ga0265331_10038261 | Ga0265331_100382612 | 332 |
| 175 | 3300031250 | Ga0265331_10062312 | Ga0265331_100623122 | 332 |
| 176 | 3300031250 | Ga0265331_10065006 | Ga0265331_100650062 | 332 |
| 177 | 3300031251 | Ga0265327_10000044 | Ga0265327_100000448 | 332 |
| 178 | 3300031251 | Ga0265327_10000136 | Ga0265327_10000136122 | 332 |
| 179 | 3300031251 | Ga0265327_10000314 | Ga0265327_1000031489 | 332 |
| 180 | 3300031251 | Ga0265327_10000475 | Ga0265327_1000047571 | 332 |
| 181 | 3300031251 | Ga0265327_10000730 | Ga0265327_1000073048 | 332 |
| 182 | 3300031251 | Ga0265327_10001767 | Ga0265327_100017679 | 332 |
| 183 | 3300031251 | Ga0265327_10006826 | Ga0265327_100068266 | 332 |
| 184 | 3300031251 | Ga0265327_10008949 | Ga0265327_100089492 | 332 |
| 185 | 3300031251 | Ga0265327_10013003 | Ga0265327_100130033 | 332 |
| 186 | 3300031251 | Ga0265327_10071561 | Ga0265327_100715612 | 332 |
| 187 | 3300031344 | Ga0265316_10016572 | Ga0265316_100165724 | 332 |
| 188 | 3300031665 | Ga0316575_10000042 | Ga0316575_1000004211 | 332 |
| 189 | 3300031711 | Ga0265314_10007067 | Ga0265314_100070677 | 332 |
| 190 | 3300031711 | Ga0265314_10111146 | Ga0265314_101111462 | 332 |
| 191 | 3300032133 | Ga0316583_10008955 | Ga0316583_100089553 | 332 |
| 192 | 3300032168 | Ga0316593_10030950 | Ga0316593_100309503 | 332 |
| 193 | 3300035084 | Ga0373928_0014325 | Ga0373928_0014325_187_1215 | 332 |
| 194 | 3300035092 | Ga0373952_0002096 | Ga0373952_0002096_840_1868 | 332 |
| 195 | 3300036401 | Ga0373937_0132013 | Ga0373937_0132013_118_1155 | 332 |
| 196 | 3300037418 | Ga0395900_0099978 | Ga0395900_0099978_1499_2527 | 332 |
| 197 | 3300039447 | Ga0436361_0060436 | Ga0436361_0060436_103_1131 | 332 |
| 198 | 3300039447 | Ga0436361_0235627 | Ga0436361_0235627_6500_7528 | 332 |
| 199 | 3300039447 | Ga0436361_0891393 | Ga0436361_0891393_64986_66014 | 332 |
| 200 | 3300042001 | Ga0439441_001329 | Ga0439441_001329_74_1138 | 332 |
| 201 | 3300042876 | Ga0451577_0000002 | Ga0451577_0000002_1206917_1207945 | 332 |
| 202 | 3300042876 | Ga0451577_0001764 | Ga0451577_0001764_908_1948 | 332 |
| 203 | 3300042876 | Ga0451577_0137433 | Ga0451577_0137433_678_1706 | 332 |
| 204 | 3300042876 | Ga0451577_0178970 | Ga0451577_0178970_732_1790 | 332 |
| 205 | 3300042876 | Ga0451577_0369281 | Ga0451577_0369281_41_1069 | 332 |
| 206 | 3300044673 | Ga0453683_0000011 | Ga0453683_0000011_261436_262464 | 332 |
| 207 | 3300044673 | Ga0453683_0003829 | Ga0453683_0003829_1789_2817 | 332 |
| 208 | 3300044712 | Ga0453684_0000002 | Ga0453684_0000002_523431_524459 | 332 |
| 209 | 3300044712 | Ga0453684_0000694 | Ga0453684_0000694_41616_42644 | 332 |
| 210 | 3300044712 | Ga0453684_0001529 | Ga0453684_0001529_60467_61495 | 332 |
| 211 | 3300044712 | Ga0453684_0013161 | Ga0453684_0013161_3955_4983 | 332 |
| 212 | 3300044712 | Ga0453684_0303582 | Ga0453684_0303582_602_1630 | 332 |
| 213 | 3300045051 | Ga0451576_0000004 | Ga0451576_0000004_150071_151099 | 332 |
| 214 | 3300045051 | Ga0451576_0000006 | Ga0451576_0000006_56959_57987 | 332 |
| 215 | 3300045051 | Ga0451576_0001977 | Ga0451576_0001977_16706_17734 | 332 |
| 216 | 3300045051 | Ga0451576_0002214 | Ga0451576_0002214_17056_18096 | 332 |
| 217 | 3300045051 | Ga0451576_0002633 | Ga0451576_0002633_7026_8066 | 332 |
| 218 | 3300045051 | Ga0451576_0006277 | Ga0451576_0006277_13544_14572 | 332 |
| 219 | 3300045051 | Ga0451576_0018556 | Ga0451576_0018556_3886_4914 | 332 |
| 220 | 3300045051 | Ga0451576_0069900 | Ga0451576_0069900_2295_3323 | 332 |
| 221 | 3300045051 | Ga0451576_0138914 | Ga0451576_0138914_1461_2492 | 332 |
| 222 | 3300046459 | Ga0495629_0122088 | Ga0495629_0122088_141_1181 | 332 |
| 223 | 3300046539 | Ga0495621_0004496 | Ga0495621_0004496_424_1464 | 332 |
| 224 | 3300048907 | Ga0496104_0266122 | Ga0496104_0266122_450_1490 | 332 |
| 225 | 3300048911 | Ga0496108_0028099 | Ga0496108_0028099_832_1860 | 332 |
| 226 | 3300048913 | Ga0496110_0041351 | Ga0496110_0041351_2110_3138 | 332 |
| 227 | 3300048917 | Ga0496114_0081151 | Ga0496114_0081151_1261_2301 | 332 |
| 228 | 3300048917 | Ga0496114_0341069 | Ga0496114_0341069_165_1205 | 332 |
| 229 | 3300049568 | Ga0501031_0006233 | Ga0501031_0006233_3325_4353 | 332 |
| 230 | 3300049568 | Ga0501031_0009246 | Ga0501031_0009246_229_1257 | 332 |
| 231 | 3300049568 | Ga0501031_0066973 | Ga0501031_0066973_1241_2269 | 332 |
| 232 | 3300049569 | Ga0501032_0000403 | Ga0501032_0000403_33739_34767 | 332 |
| 233 | 3300049569 | Ga0501032_0007680 | Ga0501032_0007680_864_1892 | 332 |
| 234 | 3300049569 | Ga0501032_0051359 | Ga0501032_0051359_558_1586 | 332 |
| 235 | 3300049569 | Ga0501032_0072552 | Ga0501032_0072552_394_1434 | 332 |
| 236 | 3300049570 | Ga0501033_0000709 | Ga0501033_0000709_4416_5444 | 332 |
| 237 | 3300049570 | Ga0501033_0001808 | Ga0501033_0001808_4388_5416 | 332 |
| 238 | 3300049570 | Ga0501033_0016892 | Ga0501033_0016892_1481_2509 | 332 |
| 239 | 3300049571 | Ga0501034_0000759 | Ga0501034_0000759_41792_42820 | 332 |
| 240 | 3300049571 | Ga0501034_0008103 | Ga0501034_0008103_3453_4481 | 332 |
| 241 | 3300049571 | Ga0501034_0077421 | Ga0501034_0077421_1897_2925 | 332 |
| 242 | 3300049571 | Ga0501034_0080850 | Ga0501034_0080850_1065_2108 | 332 |
| 243 | 3300049572 | Ga0501036_0000268 | Ga0501036_0000268_13687_14928 | 332 |
| 244 | 3300049572 | Ga0501036_0001606 | Ga0501036_0001606_3774_4802 | 332 |
| 245 | 3300049572 | Ga0501036_0219371 | Ga0501036_0219371_49_1077 | 332 |
| 246 | 3300049573 | Ga0501037_0023208 | Ga0501037_0023208_441_1469 | 332 |
| 247 | 3300049573 | Ga0501037_0102228 | Ga0501037_0102228_248_1276 | 332 |
| 248 | 3300049573 | Ga0501037_0142279 | Ga0501037_0142279_497_1525 | 332 |
| 249 | 3300049574 | Ga0501038_0000280 | Ga0501038_0000280_3463_4491 | 332 |
| 250 | 3300049574 | Ga0501038_0001255 | Ga0501038_0001255_4646_5674 | 332 |
| 251 | 3300049574 | Ga0501038_0004118 | Ga0501038_0004118_10695_11723 | 332 |
| 252 | 3300049574 | Ga0501038_0019910 | Ga0501038_0019910_3910_4938 | 332 |
| 253 | 3300049574 | Ga0501038_0047069 | Ga0501038_0047069_1696_2937 | 332 |
| 254 | 3300049574 | Ga0501038_0076106 | Ga0501038_0076106_682_1710 | 332 |
| 255 | 3300049574 | Ga0501038_0279571 | Ga0501038_0279571_129_1169 | 332 |
| 256 | 3300049575 | Ga0501039_0030324 | Ga0501039_0030324_248_1288 | 332 |
| 257 | 3300049575 | Ga0501039_0084871 | Ga0501039_0084871_10_1038 | 332 |
| 258 | 3300049575 | Ga0501039_0167569 | Ga0501039_0167569_55_1083 | 332 |
| 259 | 3300049575 | Ga0501039_0272400 | Ga0501039_0272400_286_1314 | 332 |
| 260 | 3300049576 | Ga0501040_0001121 | Ga0501040_0001121_12640_13668 | 332 |
| 261 | 3300049576 | Ga0501040_0050934 | Ga0501040_0050934_935_1975 | 332 |
| 262 | 3300049579 | Ga0501043_0001507 | Ga0501043_0001507_14645_15886 | 332 |
| 263 | 3300049579 | Ga0501043_0003838 | Ga0501043_0003838_3414_4442 | 332 |
| 264 | 3300049579 | Ga0501043_0020315 | Ga0501043_0020315_893_1921 | 332 |
| 265 | 3300049580 | Ga0501046_0008472 | Ga0501046_0008472_7914_8942 | 332 |
| 266 | 3300049580 | Ga0501046_0141840 | Ga0501046_0141840_154_1182 | 332 |
| 267 | 3300049581 | Ga0501047_0002525 | Ga0501047_0002525_7914_8942 | 332 |
| 268 | 3300049581 | Ga0501047_0017182 | Ga0501047_0017182_881_1924 | 332 |
| 269 | 3300049582 | Ga0501048_0006099 | Ga0501048_0006099_240_1268 | 332 |
| 270 | 3300049583 | Ga0501067_0005678 | Ga0501067_0005678_4826_5869 | 332 |
| 271 | 3300049584 | Ga0501068_0013549 | Ga0501068_0013549_1479_2507 | 332 |
| 272 | 3300049588 | Ga0501072_0007494 | Ga0501072_0007494_1575_2603 | 332 |
| 273 | 3300049588 | Ga0501072_0105355 | Ga0501072_0105355_260_1303 | 332 |
| 274 | 3300049589 | Ga0501073_0006424 | Ga0501073_0006424_2337_3380 | 332 |
| 275 | 3300049589 | Ga0501073_0061438 | Ga0501073_0061438_860_1900 | 332 |
| 276 | 3300049589 | Ga0501073_0113961 | Ga0501073_0113961_434_1471 | 332 |
| 277 | 3300049590 | Ga0501074_0128000 | Ga0501074_0128000_552_1595 | 332 |
| 278 | 3300049591 | Ga0501075_0042183 | Ga0501075_0042183_948_1988 | 332 |
| 279 | 3300049592 | Ga0501076_0014178 | Ga0501076_0014178_4748_5788 | 332 |
| 280 | 3300049593 | Ga0501077_0027329 | Ga0501077_0027329_1962_3002 | 332 |
| 281 | 3300049741 | Ga0501079_0001860 | Ga0501079_0001860_11492_12532 | 332 |
| 282 | 3300049742 | Ga0501080_0003681 | Ga0501080_0003681_10105_11148 | 332 |
| 283 | 3300049742 | Ga0501080_0019259 | Ga0501080_0019259_603_1643 | 332 |
| 284 | 3300049743 | Ga0501081_0016868 | Ga0501081_0016868_2607_3647 | 332 |
| 285 | 3300049744 | Ga0501083_0068897 | Ga0501083_0068897_490_1533 | 332 |
| 286 | 3300049822 | Ga0501035_0000270 | Ga0501035_0000270_25499_26527 | 332 |
| 287 | 3300049822 | Ga0501035_0004552 | Ga0501035_0004552_1078_2319 | 332 |
| 288 | 3300049822 | Ga0501035_0007685 | Ga0501035_0007685_144_1172 | 332 |
| 289 | 3300049822 | Ga0501035_0068178 | Ga0501035_0068178_1118_2161 | 332 |
| 290 | 3300049822 | Ga0501035_0111503 | Ga0501035_0111503_265_1293 | 332 |
| 291 | 3300049823 | Ga0501044_0000261 | Ga0501044_0000261_31809_33050 | 332 |
| 292 | 3300049823 | Ga0501044_0000482 | Ga0501044_0000482_37757_38785 | 332 |
| 293 | 3300049823 | Ga0501044_0004065 | Ga0501044_0004065_10364_11392 | 332 |
| 294 | 3300049824 | Ga0501045_0000564 | Ga0501045_0000564_8313_9341 | 332 |
| 295 | 3300049824 | Ga0501045_0030960 | Ga0501045_0030960_314_1354 | 332 |
| 296 | 3300050493 | nmdc:mga0k408_12910_c1 | nmdc:mga0k408_12910_c1_355_1383 | 332 |
| 297 | 3300050507 | nmdc:mga05p37_300622_c1 | nmdc:mga05p37_300622_c1_610_1653 | 332 |
| 298 | 3300050508 | nmdc:mga09592_30954_c1 | nmdc:mga09592_30954_c1_1637_2680 | 332 |
| 299 | 3300050511 | nmdc:mga08y16_128607_c1 | nmdc:mga08y16_128607_c1_789_1952 | 332 |
| 300 | 3300050511 | nmdc:mga08y16_27570_c1 | nmdc:mga08y16_27570_c1_1528_2571 | 332 |
| 301 | 3300050511 | nmdc:mga08y16_71407_c1 | nmdc:mga08y16_71407_c1_1688_2728 | 332 |
| 302 | 3300050512 | nmdc:mga0n895_17716_c1 | nmdc:mga0n895_17716_c1_4931_5986 | 332 |
| 303 | 3300050512 | nmdc:mga0n895_432_c1 | nmdc:mga0n895_432_c1_25732_26775 | 332 |
| 304 | 3300050513 | nmdc:mga0rr50_1318_c1 | nmdc:mga0rr50_1318_c1_1949_2992 | 332 |
| 305 | 3300053156 | Ga0500622_0000019 | Ga0500622_0000019_7139_8185 | 332 |
| 306 | 3300060353 | Ga0501082_0034997 | Ga0501082_0034997_2650_3690 | 332 |
| 307 | 3300060353 | Ga0501082_0045730 | Ga0501082_0045730_1126_2169 | 332 |
| 308 | 3300061734 | Ga0530510_0080048 | Ga0530510_0080048_358_1398 | 332 |
| 309 | 3300005327 | Ga0070658_10062501 | Ga0070658_100625015 | 333 |
| 310 | 3300005327 | Ga0070658_10244643 | Ga0070658_102446432 | 333 |
| 311 | 3300005328 | Ga0070676_10002569 | Ga0070676_100025692 | 333 |
| 312 | 3300005328 | Ga0070676_10016017 | Ga0070676_100160175 | 333 |
| 313 | 3300005328 | Ga0070676_10051661 | Ga0070676_100516612 | 333 |
| 314 | 3300005329 | Ga0070683_100085505 | Ga0070683_1000855053 | 333 |
| 315 | 3300005329 | Ga0070683_100105796 | Ga0070683_1001057963 | 333 |
| 316 | 3300005329 | Ga0070683_100140236 | Ga0070683_1001402363 | 333 |
| 317 | 3300005331 | Ga0070670_100044437 | Ga0070670_1000444374 | 333 |
| 318 | 3300005331 | Ga0070670_100192052 | Ga0070670_1001920522 | 333 |
| 319 | 3300005331 | Ga0070670_100196571 | Ga0070670_1001965712 | 333 |
| 320 | 3300005331 | Ga0070670_100455308 | Ga0070670_1004553081 | 333 |
| 321 | 3300005333 | Ga0070677_10000757 | Ga0070677_100007579 | 333 |
| 322 | 3300005333 | Ga0070677_10034506 | Ga0070677_100345062 | 333 |
| 323 | 3300005334 | Ga0068869_100051928 | Ga0068869_1000519281 | 333 |
| 324 | 3300005334 | Ga0068869_100097098 | Ga0068869_1000970981 | 333 |
| 325 | 3300005334 | Ga0068869_100162601 | Ga0068869_1001626012 | 333 |
| 326 | 3300005335 | Ga0070666_10005640 | Ga0070666_100056405 | 333 |
| 327 | 3300005336 | Ga0070680_100086024 | Ga0070680_1000860242 | 333 |
| 328 | 3300005337 | Ga0070682_100054343 | Ga0070682_1000543434 | 333 |
| 329 | 3300005338 | Ga0068868_100001787 | Ga0068868_1000017876 | 333 |
| 330 | 3300005338 | Ga0068868_100081007 | Ga0068868_1000810072 | 333 |
| 331 | 3300005339 | Ga0070660_100008470 | Ga0070660_1000084703 | 333 |
| 332 | 3300005339 | Ga0070660_100010171 | Ga0070660_1000101715 | 333 |
| 333 | 3300005339 | Ga0070660_100096643 | Ga0070660_1000966432 | 333 |
| 334 | 3300005339 | Ga0070660_100219837 | Ga0070660_1002198372 | 333 |
| 335 | 3300005339 | Ga0070660_100280309 | Ga0070660_1002803091 | 333 |
| 336 | 3300005339 | Ga0070660_100280723 | Ga0070660_1002807231 | 333 |
| 337 | 3300005344 | Ga0070661_100000486 | Ga0070661_10000048630 | 333 |
| 338 | 3300005344 | Ga0070661_100004760 | Ga0070661_1000047606 | 333 |
| 339 | 3300005344 | Ga0070661_100023250 | Ga0070661_1000232504 | 333 |
| 340 | 3300005344 | Ga0070661_100064312 | Ga0070661_1000643123 | 333 |
| 341 | 3300005347 | Ga0070668_100001746 | Ga0070668_10000174618 | 333 |
| 342 | 3300005347 | Ga0070668_100007313 | Ga0070668_1000073139 | 333 |
| 343 | 3300005347 | Ga0070668_100196338 | Ga0070668_1001963382 | 333 |
| 344 | 3300005353 | Ga0070669_100035008 | Ga0070669_1000350085 | 333 |
| 345 | 3300005353 | Ga0070669_100051179 | Ga0070669_1000511793 | 333 |
| 346 | 3300005353 | Ga0070669_100164569 | Ga0070669_1001645692 | 333 |
| 347 | 3300005354 | Ga0070675_100001675 | Ga0070675_1000016759 | 333 |
| 348 | 3300005354 | Ga0070675_100004036 | Ga0070675_1000040362 | 333 |
| 349 | 3300005354 | Ga0070675_100202401 | Ga0070675_1002024011 | 333 |
| 350 | 3300005355 | Ga0070671_100000564 | Ga0070671_1000005646 | 333 |
| 351 | 3300005355 | Ga0070671_100005329 | Ga0070671_10000532910 | 333 |
| 352 | 3300005355 | Ga0070671_100167950 | Ga0070671_1001679502 | 333 |
| 353 | 3300005355 | Ga0070671_100177322 | Ga0070671_1001773223 | 333 |
| 354 | 3300005356 | Ga0070674_100000536 | Ga0070674_10000053619 | 333 |
| 355 | 3300005356 | Ga0070674_100195196 | Ga0070674_1001951961 | 333 |
| 356 | 3300005364 | Ga0070673_100004988 | Ga0070673_1000049886 | 333 |
| 357 | 3300005364 | Ga0070673_100060747 | Ga0070673_1000607473 | 333 |
| 358 | 3300005364 | Ga0070673_100211976 | Ga0070673_1002119762 | 333 |
| 359 | 3300005364 | Ga0070673_100284724 | Ga0070673_1002847242 | 333 |
| 360 | 3300005365 | Ga0070688_100017316 | Ga0070688_1000173165 | 333 |
| 361 | 3300005365 | Ga0070688_100123425 | Ga0070688_1001234251 | 333 |
| 362 | 3300005366 | Ga0070659_100002814 | Ga0070659_1000028145 | 333 |
| 363 | 3300005366 | Ga0070659_100021771 | Ga0070659_1000217713 | 333 |
| 364 | 3300005366 | Ga0070659_100070700 | Ga0070659_1000707001 | 333 |
| 365 | 3300005366 | Ga0070659_100071020 | Ga0070659_1000710202 | 333 |
| 366 | 3300005366 | Ga0070659_100146538 | Ga0070659_1001465382 | 333 |
| 367 | 3300005367 | Ga0070667_100002948 | Ga0070667_10000294815 | 333 |
| 368 | 3300005367 | Ga0070667_100101410 | Ga0070667_1001014103 | 333 |
| 369 | 3300005367 | Ga0070667_100106245 | Ga0070667_1001062453 | 333 |
| 370 | 3300005367 | Ga0070667_100107754 | Ga0070667_1001077543 | 333 |
| 371 | 3300005367 | Ga0070667_100277606 | Ga0070667_1002776062 | 333 |
| 372 | 3300005434 | Ga0070709_10037095 | Ga0070709_100370953 | 333 |
| 373 | 3300005435 | Ga0070714_100394505 | Ga0070714_1003945051 | 333 |
| 374 | 3300005455 | Ga0070663_100039170 | Ga0070663_1000391704 | 333 |
| 375 | 3300005455 | Ga0070663_100114377 | Ga0070663_1001143772 | 333 |
| 376 | 3300005456 | Ga0070678_100000428 | Ga0070678_1000004288 | 333 |
| 377 | 3300005456 | Ga0070678_100024746 | Ga0070678_1000247465 | 333 |
| 378 | 3300005456 | Ga0070678_100292715 | Ga0070678_1002927151 | 333 |
| 379 | 3300005457 | Ga0070662_100014943 | Ga0070662_1000149433 | 333 |
| 380 | 3300005458 | Ga0070681_10003494 | Ga0070681_100034943 | 333 |
| 381 | 3300005458 | Ga0070681_10157812 | Ga0070681_101578122 | 333 |
| 382 | 3300005458 | Ga0070681_10270679 | Ga0070681_102706791 | 333 |
| 383 | 3300005459 | Ga0068867_100011744 | Ga0068867_1000117442 | 333 |
| 384 | 3300005459 | Ga0068867_100017233 | Ga0068867_1000172337 | 333 |
| 385 | 3300005459 | Ga0068867_100139599 | Ga0068867_1001395991 | 333 |
| 386 | 3300005466 | Ga0070685_10141158 | Ga0070685_101411582 | 333 |
| 387 | 3300005530 | Ga0070679_100049459 | Ga0070679_1000494595 | 333 |
| 388 | 3300005530 | Ga0070679_100315167 | Ga0070679_1003151672 | 333 |
| 389 | 3300005535 | Ga0070684_100013991 | Ga0070684_1000139915 | 333 |
| 390 | 3300005535 | Ga0070684_100140760 | Ga0070684_1001407603 | 333 |
| 391 | 3300005535 | Ga0070684_100166102 | Ga0070684_1001661022 | 333 |
| 392 | 3300005539 | Ga0068853_100031441 | Ga0068853_1000314412 | 333 |
| 393 | 3300005539 | Ga0068853_100051879 | Ga0068853_1000518792 | 333 |
| 394 | 3300005539 | Ga0068853_100126441 | Ga0068853_1001264412 | 333 |
| 395 | 3300005543 | Ga0070672_100004110 | Ga0070672_1000041108 | 333 |
| 396 | 3300005543 | Ga0070672_100011327 | Ga0070672_1000113276 | 333 |
| 397 | 3300005543 | Ga0070672_100145533 | Ga0070672_1001455332 | 333 |
| 398 | 3300005544 | Ga0070686_100089558 | Ga0070686_1000895583 | 333 |
| 399 | 3300005546 | Ga0070696_100005910 | Ga0070696_10000591010 | 333 |
| 400 | 3300005548 | Ga0070665_100003863 | Ga0070665_10000386316 | 333 |
| 401 | 3300005548 | Ga0070665_100073966 | Ga0070665_1000739664 | 333 |
| 402 | 3300005548 | Ga0070665_100308078 | Ga0070665_1003080781 | 333 |
| 403 | 3300005563 | Ga0068855_100039133 | Ga0068855_1000391337 | 333 |
| 404 | 3300005563 | Ga0068855_100050332 | Ga0068855_1000503325 | 333 |
| 405 | 3300005563 | Ga0068855_100059170 | Ga0068855_1000591703 | 333 |
| 406 | 3300005563 | Ga0068855_100194206 | Ga0068855_1001942063 | 333 |
| 407 | 3300005563 | Ga0068855_100201114 | Ga0068855_1002011143 | 333 |
| 408 | 3300005563 | Ga0068855_100438595 | Ga0068855_1004385952 | 333 |
| 409 | 3300005564 | Ga0070664_100005958 | Ga0070664_1000059583 | 333 |
| 410 | 3300005564 | Ga0070664_100009645 | Ga0070664_1000096456 | 333 |
| 411 | 3300005564 | Ga0070664_100022299 | Ga0070664_1000222994 | 333 |
| 412 | 3300005564 | Ga0070664_100032335 | Ga0070664_1000323351 | 333 |
| 413 | 3300005564 | Ga0070664_100037072 | Ga0070664_1000370722 | 333 |
| 414 | 3300005564 | Ga0070664_100117042 | Ga0070664_1001170423 | 333 |
| 415 | 3300005564 | Ga0070664_100323360 | Ga0070664_1003233602 | 333 |
| 416 | 3300005577 | Ga0068857_100018143 | Ga0068857_1000181437 | 333 |
| 417 | 3300005578 | Ga0068854_100006946 | Ga0068854_1000069466 | 333 |
| 418 | 3300005578 | Ga0068854_100015337 | Ga0068854_1000153375 | 333 |
| 419 | 3300005578 | Ga0068854_100069798 | Ga0068854_1000697983 | 333 |
| 420 | 3300005578 | Ga0068854_100184510 | Ga0068854_1001845102 | 333 |
| 421 | 3300005614 | Ga0068856_100002081 | Ga0068856_10000208119 | 333 |
| 422 | 3300005614 | Ga0068856_100003025 | Ga0068856_10000302514 | 333 |
| 423 | 3300005614 | Ga0068856_100006440 | Ga0068856_1000064408 | 333 |
| 424 | 3300005614 | Ga0068856_100010386 | Ga0068856_1000103866 | 333 |
| 425 | 3300005614 | Ga0068856_100050306 | Ga0068856_1000503062 | 333 |
| 426 | 3300005616 | Ga0068852_100002732 | Ga0068852_1000027324 | 333 |
| 427 | 3300005616 | Ga0068852_100003279 | Ga0068852_1000032796 | 333 |
| 428 | 3300005616 | Ga0068852_100019123 | Ga0068852_1000191233 | 333 |
| 429 | 3300005617 | Ga0068859_100015281 | Ga0068859_1000152813 | 333 |
| 430 | 3300005618 | Ga0068864_100007105 | Ga0068864_1000071053 | 333 |
| 431 | 3300005618 | Ga0068864_100017132 | Ga0068864_1000171322 | 333 |
| 432 | 3300005618 | Ga0068864_100018403 | Ga0068864_1000184037 | 333 |
| 433 | 3300005618 | Ga0068864_100133674 | Ga0068864_1001336742 | 333 |
| 434 | 3300005719 | Ga0068861_100020915 | Ga0068861_1000209153 | 333 |
| 435 | 3300005719 | Ga0068861_100271443 | Ga0068861_1002714432 | 333 |
| 436 | 3300005834 | Ga0068851_10001640 | Ga0068851_100016406 | 333 |
| 437 | 3300005834 | Ga0068851_10037711 | Ga0068851_100377112 | 333 |
| 438 | 3300005834 | Ga0068851_10100016 | Ga0068851_101000162 | 333 |
| 439 | 3300005840 | Ga0068870_10058606 | Ga0068870_100586062 | 333 |
| 440 | 3300005841 | Ga0068863_100015542 | Ga0068863_1000155422 | 333 |
| 441 | 3300005841 | Ga0068863_100212633 | Ga0068863_1002126332 | 333 |
| 442 | 3300005841 | Ga0068863_100216006 | Ga0068863_1002160062 | 333 |
| 443 | 3300005842 | Ga0068858_100072444 | Ga0068858_1000724442 | 333 |
| 444 | 3300005842 | Ga0068858_100182551 | Ga0068858_1001825511 | 333 |
| 445 | 3300005843 | Ga0068860_100065334 | Ga0068860_1000653344 | 333 |
| 446 | 3300005843 | Ga0068860_100077094 | Ga0068860_1000770944 | 333 |
| 447 | 3300005844 | Ga0068862_100055523 | Ga0068862_1000555233 | 333 |
| 448 | 3300005985 | Ga0081539_10042797 | Ga0081539_100427972 | 333 |
| 449 | 3300006175 | Ga0070712_100096413 | Ga0070712_1000964134 | 333 |
| 450 | 3300006237 | Ga0097621_100013194 | Ga0097621_1000131944 | 333 |
| 451 | 3300006237 | Ga0097621_100056010 | Ga0097621_1000560105 | 333 |
| 452 | 3300006237 | Ga0097621_100117195 | Ga0097621_1001171952 | 333 |
| 453 | 3300006237 | Ga0097621_100133217 | Ga0097621_1001332172 | 333 |
| 454 | 3300006358 | Ga0068871_100004698 | Ga0068871_1000046986 | 333 |
| 455 | 3300006358 | Ga0068871_100071275 | Ga0068871_1000712754 | 333 |
| 456 | 3300006358 | Ga0068871_100084361 | Ga0068871_1000843612 | 333 |
| 457 | 3300006358 | Ga0068871_100258476 | Ga0068871_1002584761 | 333 |
| 458 | 3300006844 | Ga0075428_100267822 | Ga0075428_1002678222 | 333 |
| 459 | 3300006871 | Ga0075434_100088450 | Ga0075434_1000884503 | 333 |
| 460 | 3300006871 | Ga0075434_100321121 | Ga0075434_1003211212 | 333 |
| 461 | 3300006881 | Ga0068865_100061221 | Ga0068865_1000612212 | 333 |
| 462 | 3300006881 | Ga0068865_100130768 | Ga0068865_1001307683 | 333 |
| 463 | 3300006931 | Ga0097620_100015279 | Ga0097620_1000152793 | 333 |
| 464 | 3300009093 | Ga0105240_10018384 | Ga0105240_1001838410 | 333 |
| 465 | 3300009093 | Ga0105240_10020207 | Ga0105240_100202076 | 333 |
| 466 | 3300009093 | Ga0105240_10028464 | Ga0105240_100284644 | 333 |
| 467 | 3300009147 | Ga0114129_10726224 | Ga0114129_107262241 | 333 |
| 468 | 3300009176 | Ga0105242_10309544 | Ga0105242_103095442 | 333 |
| 469 | 3300009177 | Ga0105248_10001225 | Ga0105248_1000122526 | 333 |
| 470 | 3300009177 | Ga0105248_10135388 | Ga0105248_101353882 | 333 |
| 471 | 3300009545 | Ga0105237_10220558 | Ga0105237_102205582 | 333 |
| 472 | 3300009545 | Ga0105237_10252110 | Ga0105237_102521102 | 333 |
| 473 | 3300009551 | Ga0105238_10008927 | Ga0105238_100089275 | 333 |
| 474 | 3300009551 | Ga0105238_10196799 | Ga0105238_101967992 | 333 |
| 475 | 3300009553 | Ga0105249_10092876 | Ga0105249_100928763 | 333 |
| 476 | 3300009553 | Ga0105249_10231855 | Ga0105249_102318552 | 333 |
| 477 | 3300010375 | Ga0105239_10070454 | Ga0105239_100704543 | 333 |
| 478 | 3300010375 | Ga0105239_10152195 | Ga0105239_101521951 | 333 |
| 479 | 3300010375 | Ga0105239_10527065 | Ga0105239_105270651 | 333 |
| 480 | 3300013100 | Ga0157373_10001379 | Ga0157373_1000137913 | 333 |
| 481 | 3300013100 | Ga0157373_10015272 | Ga0157373_100152723 | 333 |
| 482 | 3300013100 | Ga0157373_10019295 | Ga0157373_100192955 | 333 |
| 483 | 3300013100 | Ga0157373_10189553 | Ga0157373_101895532 | 333 |
| 484 | 3300013102 | Ga0157371_10005607 | Ga0157371_1000560710 | 333 |
| 485 | 3300013102 | Ga0157371_10106698 | Ga0157371_101066982 | 333 |
| 486 | 3300013102 | Ga0157371_10179597 | Ga0157371_101795972 | 333 |
| 487 | 3300013104 | Ga0157370_10002935 | Ga0157370_1000293518 | 333 |
| 488 | 3300013104 | Ga0157370_10013191 | Ga0157370_100131916 | 333 |
| 489 | 3300013104 | Ga0157370_10020764 | Ga0157370_100207645 | 333 |
| 490 | 3300013104 | Ga0157370_10056890 | Ga0157370_100568903 | 333 |
| 491 | 3300013104 | Ga0157370_10143469 | Ga0157370_101434693 | 333 |
| 492 | 3300013104 | Ga0157370_10266230 | Ga0157370_102662302 | 333 |
| 493 | 3300013105 | Ga0157369_10005349 | Ga0157369_1000534912 | 333 |
| 494 | 3300013105 | Ga0157369_10040426 | Ga0157369_100404265 | 333 |
| 495 | 3300013105 | Ga0157369_10213141 | Ga0157369_102131412 | 333 |
| 496 | 3300013105 | Ga0157369_10461971 | Ga0157369_104619712 | 333 |
| 497 | 3300013296 | Ga0157374_10021418 | Ga0157374_100214183 | 333 |
| 498 | 3300013296 | Ga0157374_10080988 | Ga0157374_100809883 | 333 |
| 499 | 3300013296 | Ga0157374_10179947 | Ga0157374_101799472 | 333 |
| 500 | 3300013296 | Ga0157374_10184643 | Ga0157374_101846432 | 333 |
| 501 | 3300013297 | Ga0157378_10191448 | Ga0157378_101914481 | 333 |
| 502 | 3300013297 | Ga0157378_10379672 | Ga0157378_103796721 | 333 |
| 503 | 3300013306 | Ga0163162_10059011 | Ga0163162_100590113 | 333 |
| 504 | 3300013306 | Ga0163162_10115317 | Ga0163162_101153172 | 333 |
| 505 | 3300013306 | Ga0163162_10136132 | Ga0163162_101361322 | 333 |
| 506 | 3300013307 | Ga0157372_10001772 | Ga0157372_1000177225 | 333 |
| 507 | 3300013307 | Ga0157372_10018658 | Ga0157372_100186588 | 333 |
| 508 | 3300013307 | Ga0157372_10139004 | Ga0157372_101390044 | 333 |
| 509 | 3300013307 | Ga0157372_10194792 | Ga0157372_101947922 | 333 |
| 510 | 3300013307 | Ga0157372_10349325 | Ga0157372_103493252 | 333 |
| 511 | 3300013308 | Ga0157375_10106761 | Ga0157375_101067614 | 333 |
| 512 | 3300013308 | Ga0157375_10455019 | Ga0157375_104550192 | 333 |
| 513 | 3300014325 | Ga0163163_10229130 | Ga0163163_102291302 | 333 |
| 514 | 3300014325 | Ga0163163_10229622 | Ga0163163_102296221 | 333 |
| 515 | 3300014326 | Ga0157380_10095741 | Ga0157380_100957413 | 333 |
| 516 | 3300014326 | Ga0157380_10399210 | Ga0157380_103992101 | 333 |
| 517 | 3300014968 | Ga0157379_10012130 | Ga0157379_100121302 | 333 |
| 518 | 3300014968 | Ga0157379_10017214 | Ga0157379_100172144 | 333 |
| 519 | 3300014968 | Ga0157379_10093104 | Ga0157379_100931043 | 333 |
| 520 | 3300014969 | Ga0157376_10047180 | Ga0157376_100471804 | 333 |
| 521 | 3300017792 | Ga0163161_10053766 | Ga0163161_100537662 | 333 |
| 522 | 3300017792 | Ga0163161_10057587 | Ga0163161_100575873 | 333 |
| 523 | 3300017792 | Ga0163161_10120716 | Ga0163161_101207162 | 333 |
| 524 | 3300020070 | Ga0206356_11461543 | Ga0206356_114615434 | 333 |
| 525 | 3300020082 | Ga0206353_10236115 | Ga0206353_102361152 | 333 |
| 526 | 3300025315 | Ga0207697_10001482 | Ga0207697_1000148214 | 333 |
| 527 | 3300025893 | Ga0207682_10001318 | Ga0207682_100013189 | 333 |
| 528 | 3300025893 | Ga0207682_10007381 | Ga0207682_100073812 | 333 |
| 529 | 3300025903 | Ga0207680_10142648 | Ga0207680_101426482 | 333 |
| 530 | 3300025907 | Ga0207645_10000331 | Ga0207645_1000033122 | 333 |
| 531 | 3300025907 | Ga0207645_10020552 | Ga0207645_100205526 | 333 |
| 532 | 3300025907 | Ga0207645_10059692 | Ga0207645_100596922 | 333 |
| 533 | 3300025908 | Ga0207643_10001108 | Ga0207643_1000110813 | 333 |
| 534 | 3300025908 | Ga0207643_10111769 | Ga0207643_101117691 | 333 |
| 535 | 3300025909 | Ga0207705_10114288 | Ga0207705_101142882 | 333 |
| 536 | 3300025909 | Ga0207705_10128151 | Ga0207705_101281513 | 333 |
| 537 | 3300025909 | Ga0207705_10190102 | Ga0207705_101901022 | 333 |
| 538 | 3300025909 | Ga0207705_10190370 | Ga0207705_101903702 | 333 |
| 539 | 3300025912 | Ga0207707_10008263 | Ga0207707_100082632 | 333 |
| 540 | 3300025912 | Ga0207707_10069403 | Ga0207707_100694035 | 333 |
| 541 | 3300025913 | Ga0207695_10074196 | Ga0207695_100741961 | 333 |
| 542 | 3300025913 | Ga0207695_10167310 | Ga0207695_101673102 | 333 |
| 543 | 3300025915 | Ga0207693_10091135 | Ga0207693_100911354 | 333 |
| 544 | 3300025917 | Ga0207660_10022105 | Ga0207660_100221053 | 333 |
| 545 | 3300025917 | Ga0207660_10176845 | Ga0207660_101768452 | 333 |
| 546 | 3300025919 | Ga0207657_10001000 | Ga0207657_100010006 | 333 |
| 547 | 3300025919 | Ga0207657_10014530 | Ga0207657_100145306 | 333 |
| 548 | 3300025919 | Ga0207657_10032471 | Ga0207657_100324713 | 333 |
| 549 | 3300025919 | Ga0207657_10119234 | Ga0207657_101192343 | 333 |
| 550 | 3300025919 | Ga0207657_10125730 | Ga0207657_101257302 | 333 |
| 551 | 3300025920 | Ga0207649_10006345 | Ga0207649_100063456 | 333 |
| 552 | 3300025921 | Ga0207652_10009287 | Ga0207652_100092876 | 333 |
| 553 | 3300025921 | Ga0207652_10018041 | Ga0207652_100180416 | 333 |
| 554 | 3300025923 | Ga0207681_10049092 | Ga0207681_100490923 | 333 |
| 555 | 3300025924 | Ga0207694_10014534 | Ga0207694_100145346 | 333 |
| 556 | 3300025924 | Ga0207694_10021564 | Ga0207694_100215644 | 333 |
| 557 | 3300025925 | Ga0207650_10034273 | Ga0207650_100342733 | 333 |
| 558 | 3300025925 | Ga0207650_10044835 | Ga0207650_100448353 | 333 |
| 559 | 3300025925 | Ga0207650_10056570 | Ga0207650_100565703 | 333 |
| 560 | 3300025925 | Ga0207650_10057719 | Ga0207650_100577193 | 333 |
| 561 | 3300025925 | Ga0207650_10061300 | Ga0207650_100613003 | 333 |
| 562 | 3300025926 | Ga0207659_10014770 | Ga0207659_100147706 | 333 |
| 563 | 3300025926 | Ga0207659_10026217 | Ga0207659_100262174 | 333 |
| 564 | 3300025926 | Ga0207659_10084411 | Ga0207659_100844113 | 333 |
| 565 | 3300025928 | Ga0207700_10037722 | Ga0207700_100377225 | 333 |
| 566 | 3300025929 | Ga0207664_10049607 | Ga0207664_100496073 | 333 |
| 567 | 3300025929 | Ga0207664_10072300 | Ga0207664_100723004 | 333 |
| 568 | 3300025931 | Ga0207644_10003932 | Ga0207644_100039324 | 333 |
| 569 | 3300025931 | Ga0207644_10008387 | Ga0207644_100083876 | 333 |
| 570 | 3300025931 | Ga0207644_10011828 | Ga0207644_100118284 | 333 |
| 571 | 3300025932 | Ga0207690_10017644 | Ga0207690_100176444 | 333 |
| 572 | 3300025932 | Ga0207690_10158258 | Ga0207690_101582582 | 333 |
| 573 | 3300025933 | Ga0207706_10000854 | Ga0207706_1000085422 | 333 |
| 574 | 3300025933 | Ga0207706_10007248 | Ga0207706_1000724810 | 333 |
| 575 | 3300025933 | Ga0207706_10015396 | Ga0207706_100153967 | 333 |
| 576 | 3300025933 | Ga0207706_10332238 | Ga0207706_103322382 | 333 |
| 577 | 3300025936 | Ga0207670_10129669 | Ga0207670_101296692 | 333 |
| 578 | 3300025937 | Ga0207669_10002807 | Ga0207669_100028079 | 333 |
| 579 | 3300025937 | Ga0207669_10111983 | Ga0207669_101119832 | 333 |
| 580 | 3300025937 | Ga0207669_10186463 | Ga0207669_101864632 | 333 |
| 581 | 3300025938 | Ga0207704_10019141 | Ga0207704_100191413 | 333 |
| 582 | 3300025938 | Ga0207704_10064358 | Ga0207704_100643582 | 333 |
| 583 | 3300025940 | Ga0207691_10000122 | Ga0207691_1000012214 | 333 |
| 584 | 3300025940 | Ga0207691_10000772 | Ga0207691_1000077232 | 333 |
| 585 | 3300025940 | Ga0207691_10100924 | Ga0207691_101009243 | 333 |
| 586 | 3300025941 | Ga0207711_10138857 | Ga0207711_101388572 | 333 |
| 587 | 3300025942 | Ga0207689_10001927 | Ga0207689_1000192714 | 333 |
| 588 | 3300025942 | Ga0207689_10040830 | Ga0207689_100408305 | 333 |
| 589 | 3300025944 | Ga0207661_10010299 | Ga0207661_100102995 | 333 |
| 590 | 3300025944 | Ga0207661_10178940 | Ga0207661_101789402 | 333 |
| 591 | 3300025945 | Ga0207679_10015734 | Ga0207679_100157343 | 333 |
| 592 | 3300025945 | Ga0207679_10078160 | Ga0207679_100781603 | 333 |
| 593 | 3300025945 | Ga0207679_10251969 | Ga0207679_102519692 | 333 |
| 594 | 3300025945 | Ga0207679_10268270 | Ga0207679_102682702 | 333 |
| 595 | 3300025945 | Ga0207679_10279485 | Ga0207679_102794852 | 333 |
| 596 | 3300025949 | Ga0207667_10002343 | Ga0207667_100023438 | 333 |
| 597 | 3300025949 | Ga0207667_10094773 | Ga0207667_100947733 | 333 |
| 598 | 3300025949 | Ga0207667_10204862 | Ga0207667_102048623 | 333 |
| 599 | 3300025949 | Ga0207667_10214468 | Ga0207667_102144682 | 333 |
| 600 | 3300025960 | Ga0207651_10044425 | Ga0207651_100444254 | 333 |
| 601 | 3300025960 | Ga0207651_10161962 | Ga0207651_101619622 | 333 |
| 602 | 3300025961 | Ga0207712_10192494 | Ga0207712_101924942 | 333 |
| 603 | 3300025972 | Ga0207668_10018007 | Ga0207668_100180076 | 333 |
| 604 | 3300025981 | Ga0207640_10008758 | Ga0207640_100087583 | 333 |
| 605 | 3300025981 | Ga0207640_10049870 | Ga0207640_100498702 | 333 |
| 606 | 3300025986 | Ga0207658_10013937 | Ga0207658_100139376 | 333 |
| 607 | 3300025986 | Ga0207658_10019542 | Ga0207658_100195422 | 333 |
| 608 | 3300025986 | Ga0207658_10071368 | Ga0207658_100713683 | 333 |
| 609 | 3300025986 | Ga0207658_10181302 | Ga0207658_101813022 | 333 |
| 610 | 3300026023 | Ga0207677_10018321 | Ga0207677_100183215 | 333 |
| 611 | 3300026023 | Ga0207677_10072764 | Ga0207677_100727643 | 333 |
| 612 | 3300026023 | Ga0207677_10231064 | Ga0207677_102310642 | 333 |
| 613 | 3300026035 | Ga0207703_10024218 | Ga0207703_100242185 | 333 |
| 614 | 3300026035 | Ga0207703_10043079 | Ga0207703_100430793 | 333 |
| 615 | 3300026035 | Ga0207703_10128218 | Ga0207703_101282182 | 333 |
| 616 | 3300026041 | Ga0207639_10009491 | Ga0207639_100094913 | 333 |
| 617 | 3300026041 | Ga0207639_10029203 | Ga0207639_100292033 | 333 |
| 618 | 3300026067 | Ga0207678_10007312 | Ga0207678_100073122 | 333 |
| 619 | 3300026067 | Ga0207678_10011189 | Ga0207678_100111896 | 333 |
| 620 | 3300026067 | Ga0207678_10015432 | Ga0207678_100154323 | 333 |
| 621 | 3300026067 | Ga0207678_10208163 | Ga0207678_102081632 | 333 |
| 622 | 3300026075 | Ga0207708_10234001 | Ga0207708_102340012 | 333 |
| 623 | 3300026078 | Ga0207702_10003836 | Ga0207702_100038364 | 333 |
| 624 | 3300026078 | Ga0207702_10014082 | Ga0207702_100140824 | 333 |
| 625 | 3300026078 | Ga0207702_10045737 | Ga0207702_100457373 | 333 |
| 626 | 3300026078 | Ga0207702_10049161 | Ga0207702_100491613 | 333 |
| 627 | 3300026078 | Ga0207702_10146000 | Ga0207702_101460003 | 333 |
| 628 | 3300026088 | Ga0207641_10072505 | Ga0207641_100725055 | 333 |
| 629 | 3300026088 | Ga0207641_10125576 | Ga0207641_101255761 | 333 |
| 630 | 3300026088 | Ga0207641_10304927 | Ga0207641_103049272 | 333 |
| 631 | 3300026089 | Ga0207648_10014574 | Ga0207648_100145743 | 333 |
| 632 | 3300026089 | Ga0207648_10017253 | Ga0207648_100172537 | 333 |
| 633 | 3300026089 | Ga0207648_10019771 | Ga0207648_100197718 | 333 |
| 634 | 3300026089 | Ga0207648_10048131 | Ga0207648_100481312 | 333 |
| 635 | 3300026095 | Ga0207676_10006704 | Ga0207676_100067041 | 333 |
| 636 | 3300026116 | Ga0207674_10000694 | Ga0207674_1000069439 | 333 |
| 637 | 3300026116 | Ga0207674_10001128 | Ga0207674_1000112810 | 333 |
| 638 | 3300026116 | Ga0207674_10006144 | Ga0207674_100061448 | 333 |
| 639 | 3300026116 | Ga0207674_10210919 | Ga0207674_102109191 | 333 |
| 640 | 3300026118 | Ga0207675_100000871 | Ga0207675_1000008713 | 333 |
| 641 | 3300026118 | Ga0207675_100004627 | Ga0207675_1000046276 | 333 |
| 642 | 3300026118 | Ga0207675_100030831 | Ga0207675_1000308312 | 333 |
| 643 | 3300026121 | Ga0207683_10000005 | Ga0207683_1000000536 | 333 |
| 644 | 3300026121 | Ga0207683_10004773 | Ga0207683_100047732 | 333 |
| 645 | 3300026121 | Ga0207683_10015805 | Ga0207683_100158056 | 333 |
| 646 | 3300026121 | Ga0207683_10084179 | Ga0207683_100841793 | 333 |
| 647 | 3300026121 | Ga0207683_10321686 | Ga0207683_103216861 | 333 |
| 648 | 3300026142 | Ga0207698_10001960 | Ga0207698_100019606 | 333 |
| 649 | 3300026142 | Ga0207698_10021781 | Ga0207698_100217814 | 333 |
| 650 | 3300026142 | Ga0207698_10025539 | Ga0207698_100255395 | 333 |
| 651 | 3300026142 | Ga0207698_10341426 | Ga0207698_103414261 | 333 |
| 652 | 3300027471 | Ga0209995_1011156 | Ga0209995_10111561 | 333 |
| 653 | 3300027876 | Ga0209974_10002039 | Ga0209974_100020393 | 333 |
| 654 | 3300027876 | Ga0209974_10040668 | Ga0209974_100406682 | 333 |
| 655 | 3300028379 | Ga0268266_10034562 | Ga0268266_100345625 | 333 |
| 656 | 3300028379 | Ga0268266_10213272 | Ga0268266_102132721 | 333 |
| 657 | 3300028379 | Ga0268266_10402793 | Ga0268266_104027932 | 333 |
| 658 | 3300028380 | Ga0268265_10018470 | Ga0268265_100184703 | 333 |
| 659 | 3300028381 | Ga0268264_10013772 | Ga0268264_100137726 | 333 |
| 660 | 3300028381 | Ga0268264_10044953 | Ga0268264_100449531 | 333 |
| 661 | 3300029957 | Ga0265324_10000001 | Ga0265324_10000001200 | 333 |
| 662 | 3300031241 | Ga0265325_10000542 | Ga0265325_100005427 | 333 |
| 663 | 3300031344 | Ga0265316_10224637 | Ga0265316_102246372 | 333 |
| 664 | 3300031548 | Ga0307408_100002911 | Ga0307408_10000291111 | 333 |
| 665 | 3300031548 | Ga0307408_100057101 | Ga0307408_1000571012 | 333 |
| 666 | 3300031548 | Ga0307408_100106422 | Ga0307408_1001064223 | 333 |
| 667 | 3300031691 | Ga0316579_10003975 | Ga0316579_100039754 | 333 |
| 668 | 3300031691 | Ga0316579_10010044 | Ga0316579_100100445 | 333 |
| 669 | 3300031711 | Ga0265314_10157317 | Ga0265314_101573172 | 333 |
| 670 | 3300031727 | Ga0316576_10048257 | Ga0316576_100482574 | 333 |
| 671 | 3300031728 | Ga0316578_10010133 | Ga0316578_100101331 | 333 |
| 672 | 3300031731 | Ga0307405_10003878 | Ga0307405_100038783 | 333 |
| 673 | 3300031731 | Ga0307405_10017485 | Ga0307405_100174855 | 333 |
| 674 | 3300031733 | Ga0316577_10003010 | Ga0316577_100030101 | 333 |
| 675 | 3300031824 | Ga0307413_10001237 | Ga0307413_100012378 | 333 |
| 676 | 3300031852 | Ga0307410_10009907 | Ga0307410_100099074 | 333 |
| 677 | 3300031852 | Ga0307410_10014406 | Ga0307410_100144063 | 333 |
| 678 | 3300031852 | Ga0307410_10137685 | Ga0307410_101376851 | 333 |
| 679 | 3300031901 | Ga0307406_10004415 | Ga0307406_100044154 | 333 |
| 680 | 3300031901 | Ga0307406_10034187 | Ga0307406_100341871 | 333 |
| 681 | 3300031903 | Ga0307407_10064001 | Ga0307407_100640011 | 333 |
| 682 | 3300031903 | Ga0307407_10112942 | Ga0307407_101129422 | 333 |
| 683 | 3300031911 | Ga0307412_10028767 | Ga0307412_100287674 | 333 |
| 684 | 3300031995 | Ga0307409_100029836 | Ga0307409_1000298365 | 333 |
| 685 | 3300031995 | Ga0307409_100117877 | Ga0307409_1001178772 | 333 |
| 686 | 3300032002 | Ga0307416_100035373 | Ga0307416_1000353734 | 333 |
| 687 | 3300032004 | Ga0307414_10261984 | Ga0307414_102619842 | 333 |
| 688 | 3300032005 | Ga0307411_10000127 | Ga0307411_1000012715 | 333 |
| 689 | 3300032005 | Ga0307411_10042097 | Ga0307411_100420973 | 333 |
| 690 | 3300032005 | Ga0307411_10358727 | Ga0307411_103587271 | 333 |
| 691 | 3300032126 | Ga0307415_100003315 | Ga0307415_1000033152 | 333 |
| 692 | 3300032133 | Ga0316583_10030946 | Ga0316583_100309462 | 333 |
| 693 | 3300032133 | Ga0316583_10048555 | Ga0316583_100485551 | 333 |
| 694 | 3300032137 | Ga0316585_10016146 | Ga0316585_100161461 | 333 |
| 695 | 3300032139 | Ga0316580_10018726 | Ga0316580_100187262 | 333 |
| 696 | 3300033541 | Ga0316596_1002051 | Ga0316596_10020511 | 333 |
| 697 | 3300035398 | Ga0316574_0001261 | Ga0316574_0001261_5786_6826 | 333 |
| 698 | 3300035398 | Ga0316574_0004450 | Ga0316574_0004450_4250_5281 | 333 |
| 699 | 3300035398 | Ga0316574_0033809 | Ga0316574_0033809_298_1329 | 333 |
| 700 | 3300035695 | Ga0373927_0117713 | Ga0373927_0117713_557_1588 | 333 |
| 701 | 3300036401 | Ga0373937_0040788 | Ga0373937_0040788_2109_3140 | 333 |
| 702 | 3300036401 | Ga0373937_0168682 | Ga0373937_0168682_577_1608 | 333 |
| 703 | 3300036647 | Ga0316582_0009509 | Ga0316582_0009509_3745_4776 | 333 |
| 704 | 3300036647 | Ga0316582_0055880 | Ga0316582_0055880_719_1750 | 333 |
| 705 | 3300036712 | Ga0316584_0002039 | Ga0316584_0002039_1435_2466 | 333 |
| 706 | 3300036712 | Ga0316584_0004127 | Ga0316584_0004127_2575_3606 | 333 |
| 707 | 3300037068 | Ga0373925_0216161 | Ga0373925_0216161_212_1243 | 333 |
| 708 | 3300037312 | Ga0395899_0214769 | Ga0395899_0214769_186_1217 | 333 |
| 709 | 3300037418 | Ga0395900_0395256 | Ga0395900_0395256_56_1087 | 333 |
| 710 | 3300038443 | Ga0395901_0040793 | Ga0395901_0040793_591_1622 | 333 |
| 711 | 3300041512 | Ga0451853_2089945 | Ga0451853_2089945_261_1292 | 333 |
| 712 | 3300042012 | Ga0439455_0050163 | Ga0439455_0050163_34_1065 | 333 |
| 713 | 3300042876 | Ga0451577_0192340 | Ga0451577_0192340_121_1152 | 333 |
| 714 | 3300045976 | Ga0466967_0480879 | Ga0466967_0480879_127_1158 | 333 |
| 715 | 3300048903 | Ga0496100_0049877 | Ga0496100_0049877_86_1117 | 333 |
| 716 | 3300048904 | Ga0496101_0156327 | Ga0496101_0156327_154_1185 | 333 |
| 717 | 3300048905 | Ga0496102_0013642 | Ga0496102_0013642_744_1775 | 333 |
| 718 | 3300048908 | Ga0496105_0020268 | Ga0496105_0020268_3890_4921 | 333 |
| 719 | 3300048909 | Ga0496106_0044631 | Ga0496106_0044631_1883_2914 | 333 |
| 720 | 3300048909 | Ga0496106_0100662 | Ga0496106_0100662_42_1073 | 333 |
| 721 | 3300048909 | Ga0496106_0197689 | Ga0496106_0197689_366_1397 | 333 |
| 722 | 3300048910 | Ga0496107_0037001 | Ga0496107_0037001_2243_3274 | 333 |
| 723 | 3300048911 | Ga0496108_0001943 | Ga0496108_0001943_4686_5717 | 333 |
| 724 | 3300048912 | Ga0496109_0007082 | Ga0496109_0007082_5184_6215 | 333 |
| 725 | 3300048912 | Ga0496109_0087616 | Ga0496109_0087616_1101_2132 | 333 |
| 726 | 3300048913 | Ga0496110_0110755 | Ga0496110_0110755_24_1055 | 333 |
| 727 | 3300048915 | Ga0496112_0019957 | Ga0496112_0019957_1113_2144 | 333 |
| 728 | 3300048915 | Ga0496112_0130501 | Ga0496112_0130501_82_1161 | 333 |
| 729 | 3300048917 | Ga0496114_0100347 | Ga0496114_0100347_1024_2055 | 333 |
| 730 | 3300048917 | Ga0496114_0363031 | Ga0496114_0363031_93_1124 | 333 |
| 731 | 3300049578 | Ga0501042_0125352 | Ga0501042_0125352_68_1111 | 333 |
| 732 | 3300049585 | Ga0501069_0087657 | Ga0501069_0087657_353_1396 | 333 |
| 733 | 3300049590 | Ga0501074_0039704 | Ga0501074_0039704_1348_2391 | 333 |
| 734 | 3300050511 | nmdc:mga08y16_84834_c1 | nmdc:mga08y16_84834_c1_881_1912 | 333 |
| 735 | 3300050512 | nmdc:mga0n895_185344_c1 | nmdc:mga0n895_185344_c1_289_1320 | 333 |
| 736 | 3300050512 | nmdc:mga0n895_255694_c1 | nmdc:mga0n895_255694_c1_283_1314 | 333 |
| 737 | 3300050513 | nmdc:mga0rr50_49968_c1 | nmdc:mga0rr50_49968_c1_1697_2728 | 333 |
| 738 | 3300005293 | Ga0065715_10172172 | Ga0065715_101721721 | 334 |
| 739 | 3300005328 | Ga0070676_10028584 | Ga0070676_100285842 | 334 |
| 740 | 3300005330 | Ga0070690_100000521 | Ga0070690_1000005213 | 334 |
| 741 | 3300005331 | Ga0070670_100078531 | Ga0070670_1000785313 | 334 |
| 742 | 3300005331 | Ga0070670_100110155 | Ga0070670_1001101552 | 334 |
| 743 | 3300005334 | Ga0068869_100000591 | Ga0068869_10000059114 | 334 |
| 744 | 3300005334 | Ga0068869_100152584 | Ga0068869_1001525842 | 334 |
| 745 | 3300005334 | Ga0068869_100214924 | Ga0068869_1002149242 | 334 |
| 746 | 3300005335 | Ga0070666_10000774 | Ga0070666_1000077417 | 334 |
| 747 | 3300005335 | Ga0070666_10001704 | Ga0070666_1000170412 | 334 |
| 748 | 3300005338 | Ga0068868_100044081 | Ga0068868_1000440812 | 334 |
| 749 | 3300005338 | Ga0068868_100136300 | Ga0068868_1001363002 | 334 |
| 750 | 3300005338 | Ga0068868_100189384 | Ga0068868_1001893842 | 334 |
| 751 | 3300005339 | Ga0070660_100015683 | Ga0070660_1000156835 | 334 |
| 752 | 3300005340 | Ga0070689_100001865 | Ga0070689_10000186514 | 334 |
| 753 | 3300005344 | Ga0070661_100008317 | Ga0070661_1000083176 | 334 |
| 754 | 3300005347 | Ga0070668_100001121 | Ga0070668_1000011214 | 334 |
| 755 | 3300005347 | Ga0070668_100006569 | Ga0070668_1000065698 | 334 |
| 756 | 3300005353 | Ga0070669_100014524 | Ga0070669_1000145242 | 334 |
| 757 | 3300005353 | Ga0070669_100147678 | Ga0070669_1001476781 | 334 |
| 758 | 3300005355 | Ga0070671_100014880 | Ga0070671_1000148804 | 334 |
| 759 | 3300005356 | Ga0070674_100006377 | Ga0070674_1000063778 | 334 |
| 760 | 3300005364 | Ga0070673_100001471 | Ga0070673_10000147114 | 334 |
| 761 | 3300005364 | Ga0070673_100001499 | Ga0070673_10000149914 | 334 |
| 762 | 3300005365 | Ga0070688_100001931 | Ga0070688_1000019318 | 334 |
| 763 | 3300005365 | Ga0070688_100162213 | Ga0070688_1001622132 | 334 |
| 764 | 3300005366 | Ga0070659_100162190 | Ga0070659_1001621902 | 334 |
| 765 | 3300005367 | Ga0070667_100000863 | Ga0070667_1000008636 | 334 |
| 766 | 3300005367 | Ga0070667_100168479 | Ga0070667_1001684792 | 334 |
| 767 | 3300005435 | Ga0070714_100003499 | Ga0070714_1000034998 | 334 |
| 768 | 3300005436 | Ga0070713_100000853 | Ga0070713_10000085321 | 334 |
| 769 | 3300005436 | Ga0070713_100006960 | Ga0070713_1000069604 | 334 |
| 770 | 3300005436 | Ga0070713_100016724 | Ga0070713_1000167243 | 334 |
| 771 | 3300005437 | Ga0070710_10021886 | Ga0070710_100218863 | 334 |
| 772 | 3300005439 | Ga0070711_100010124 | Ga0070711_1000101246 | 334 |
| 773 | 3300005440 | Ga0070705_100027467 | Ga0070705_1000274674 | 334 |
| 774 | 3300005444 | Ga0070694_100116447 | Ga0070694_1001164472 | 334 |
| 775 | 3300005445 | Ga0070708_100120336 | Ga0070708_1001203361 | 334 |
| 776 | 3300005457 | Ga0070662_100012355 | Ga0070662_1000123555 | 334 |
| 777 | 3300005457 | Ga0070662_100156813 | Ga0070662_1001568132 | 334 |
| 778 | 3300005459 | Ga0068867_100003381 | Ga0068867_10000338112 | 334 |
| 779 | 3300005467 | Ga0070706_100009375 | Ga0070706_1000093757 | 334 |
| 780 | 3300005467 | Ga0070706_100018225 | Ga0070706_1000182256 | 334 |
| 781 | 3300005467 | Ga0070706_100079995 | Ga0070706_1000799952 | 334 |
| 782 | 3300005468 | Ga0070707_100039220 | Ga0070707_1000392203 | 334 |
| 783 | 3300005468 | Ga0070707_100044145 | Ga0070707_1000441453 | 334 |
| 784 | 3300005468 | Ga0070707_100130285 | Ga0070707_1001302852 | 334 |
| 785 | 3300005468 | Ga0070707_100138387 | Ga0070707_1001383872 | 334 |
| 786 | 3300005471 | Ga0070698_100043258 | Ga0070698_1000432584 | 334 |
| 787 | 3300005518 | Ga0070699_100020295 | Ga0070699_1000202955 | 334 |
| 788 | 3300005536 | Ga0070697_100066453 | Ga0070697_1000664532 | 334 |
| 789 | 3300005536 | Ga0070697_100129359 | Ga0070697_1001293591 | 334 |
| 790 | 3300005536 | Ga0070697_100178686 | Ga0070697_1001786862 | 334 |
| 791 | 3300005544 | Ga0070686_100099309 | Ga0070686_1000993092 | 334 |
| 792 | 3300005545 | Ga0070695_100013699 | Ga0070695_1000136995 | 334 |
| 793 | 3300005546 | Ga0070696_100160214 | Ga0070696_1001602142 | 334 |
| 794 | 3300005546 | Ga0070696_100163669 | Ga0070696_1001636691 | 334 |
| 795 | 3300005547 | Ga0070693_100000378 | Ga0070693_1000003788 | 334 |
| 796 | 3300005548 | Ga0070665_100005926 | Ga0070665_1000059264 | 334 |
| 797 | 3300005549 | Ga0070704_100015536 | Ga0070704_1000155363 | 334 |
| 798 | 3300005563 | Ga0068855_100038385 | Ga0068855_1000383854 | 334 |
| 799 | 3300005577 | Ga0068857_100019755 | Ga0068857_1000197556 | 334 |
| 800 | 3300005578 | Ga0068854_100024845 | Ga0068854_1000248455 | 334 |
| 801 | 3300005614 | Ga0068856_100051117 | Ga0068856_1000511173 | 334 |
| 802 | 3300005615 | Ga0070702_100030449 | Ga0070702_1000304494 | 334 |
| 803 | 3300005617 | Ga0068859_100000594 | Ga0068859_10000059432 | 334 |
| 804 | 3300005617 | Ga0068859_100002773 | Ga0068859_1000027738 | 334 |
| 805 | 3300005618 | Ga0068864_100001433 | Ga0068864_1000014338 | 334 |
| 806 | 3300005618 | Ga0068864_100002465 | Ga0068864_1000024657 | 334 |
| 807 | 3300005618 | Ga0068864_100083623 | Ga0068864_1000836234 | 334 |
| 808 | 3300005718 | Ga0068866_10016847 | Ga0068866_100168472 | 334 |
| 809 | 3300005719 | Ga0068861_100000705 | Ga0068861_10000070515 | 334 |
| 810 | 3300005840 | Ga0068870_10038881 | Ga0068870_100388813 | 334 |
| 811 | 3300005841 | Ga0068863_100002710 | Ga0068863_1000027102 | 334 |
| 812 | 3300005841 | Ga0068863_100004302 | Ga0068863_10000430215 | 334 |
| 813 | 3300005841 | Ga0068863_100008973 | Ga0068863_1000089733 | 334 |
| 814 | 3300005842 | Ga0068858_100006368 | Ga0068858_10000636813 | 334 |
| 815 | 3300005842 | Ga0068858_100042025 | Ga0068858_1000420253 | 334 |
| 816 | 3300005843 | Ga0068860_100024779 | Ga0068860_1000247796 | 334 |
| 817 | 3300005843 | Ga0068860_100036963 | Ga0068860_1000369636 | 334 |
| 818 | 3300005843 | Ga0068860_100053257 | Ga0068860_1000532572 | 334 |
| 819 | 3300005843 | Ga0068860_100093577 | Ga0068860_1000935773 | 334 |
| 820 | 3300005844 | Ga0068862_100005456 | Ga0068862_1000054568 | 334 |
| 821 | 3300006173 | Ga0070716_100032117 | Ga0070716_1000321172 | 334 |
| 822 | 3300006173 | Ga0070716_100060768 | Ga0070716_1000607683 | 334 |
| 823 | 3300006175 | Ga0070712_100059884 | Ga0070712_1000598842 | 334 |
| 824 | 3300006358 | Ga0068871_100142392 | Ga0068871_1001423922 | 334 |
| 825 | 3300006358 | Ga0068871_100258510 | Ga0068871_1002585102 | 334 |
| 826 | 3300006871 | Ga0075434_100030898 | Ga0075434_1000308984 | 334 |
| 827 | 3300006881 | Ga0068865_100079218 | Ga0068865_1000792183 | 334 |
| 828 | 3300006931 | Ga0097620_100000594 | Ga0097620_10000059432 | 334 |
| 829 | 3300006931 | Ga0097620_100002774 | Ga0097620_10000277413 | 334 |
| 830 | 3300007076 | Ga0075435_100039517 | Ga0075435_1000395175 | 334 |
| 831 | 3300007076 | Ga0075435_100148515 | Ga0075435_1001485153 | 334 |
| 832 | 3300009098 | Ga0105245_10010967 | Ga0105245_100109673 | 334 |
| 833 | 3300009098 | Ga0105245_10032337 | Ga0105245_100323375 | 334 |
| 834 | 3300009098 | Ga0105245_10050485 | Ga0105245_100504855 | 334 |
| 835 | 3300009098 | Ga0105245_10335906 | Ga0105245_103359062 | 334 |
| 836 | 3300009101 | Ga0105247_10007921 | Ga0105247_100079215 | 334 |
| 837 | 3300009147 | Ga0114129_10232513 | Ga0114129_102325132 | 334 |
| 838 | 3300009147 | Ga0114129_10240327 | Ga0114129_102403274 | 334 |
| 839 | 3300009174 | Ga0105241_10220027 | Ga0105241_102200272 | 334 |
| 840 | 3300009177 | Ga0105248_10265962 | Ga0105248_102659622 | 334 |
| 841 | 3300009545 | Ga0105237_10105489 | Ga0105237_101054892 | 334 |
| 842 | 3300009551 | Ga0105238_10039286 | Ga0105238_100392865 | 334 |
| 843 | 3300009551 | Ga0105238_10303709 | Ga0105238_103037091 | 334 |
| 844 | 3300010375 | Ga0105239_10113547 | Ga0105239_101135473 | 334 |
| 845 | 3300013104 | Ga0157370_10032253 | Ga0157370_100322534 | 334 |
| 846 | 3300013296 | Ga0157374_10005165 | Ga0157374_100051654 | 334 |
| 847 | 3300013297 | Ga0157378_10004871 | Ga0157378_1000487113 | 334 |
| 848 | 3300013306 | Ga0163162_10004885 | Ga0163162_1000488512 | 334 |
| 849 | 3300013306 | Ga0163162_10041348 | Ga0163162_100413485 | 334 |
| 850 | 3300013308 | Ga0157375_10004384 | Ga0157375_100043848 | 334 |
| 851 | 3300014968 | Ga0157379_10001374 | Ga0157379_100013748 | 334 |
| 852 | 3300014968 | Ga0157379_10011623 | Ga0157379_100116234 | 334 |
| 853 | 3300014969 | Ga0157376_10021708 | Ga0157376_100217084 | 334 |
| 854 | 3300014969 | Ga0157376_10028228 | Ga0157376_100282285 | 334 |
| 855 | 3300017792 | Ga0163161_10091122 | Ga0163161_100911222 | 334 |
| 856 | 3300025315 | Ga0207697_10020055 | Ga0207697_100200554 | 334 |
| 857 | 3300025898 | Ga0207692_10041356 | Ga0207692_100413562 | 334 |
| 858 | 3300025899 | Ga0207642_10008244 | Ga0207642_100082444 | 334 |
| 859 | 3300025903 | Ga0207680_10004681 | Ga0207680_100046815 | 334 |
| 860 | 3300025903 | Ga0207680_10078757 | Ga0207680_100787572 | 334 |
| 861 | 3300025907 | Ga0207645_10000039 | Ga0207645_1000003982 | 334 |
| 862 | 3300025910 | Ga0207684_10102396 | Ga0207684_101023961 | 334 |
| 863 | 3300025911 | Ga0207654_10060700 | Ga0207654_100607003 | 334 |
| 864 | 3300025911 | Ga0207654_10145140 | Ga0207654_101451402 | 334 |
| 865 | 3300025912 | Ga0207707_10058381 | Ga0207707_100583812 | 334 |
| 866 | 3300025915 | Ga0207693_10000397 | Ga0207693_100003973 | 334 |
| 867 | 3300025915 | Ga0207693_10027063 | Ga0207693_100270632 | 334 |
| 868 | 3300025916 | Ga0207663_10028987 | Ga0207663_100289872 | 334 |
| 869 | 3300025918 | Ga0207662_10065329 | Ga0207662_100653292 | 334 |
| 870 | 3300025919 | Ga0207657_10000394 | Ga0207657_1000039412 | 334 |
| 871 | 3300025922 | Ga0207646_10037198 | Ga0207646_100371983 | 334 |
| 872 | 3300025923 | Ga0207681_10002345 | Ga0207681_100023456 | 334 |
| 873 | 3300025923 | Ga0207681_10011778 | Ga0207681_100117785 | 334 |
| 874 | 3300025925 | Ga0207650_10001745 | Ga0207650_100017457 | 334 |
| 875 | 3300025925 | Ga0207650_10026853 | Ga0207650_100268533 | 334 |
| 876 | 3300025926 | Ga0207659_10161435 | Ga0207659_101614352 | 334 |
| 877 | 3300025927 | Ga0207687_10007739 | Ga0207687_100077397 | 334 |
| 878 | 3300025928 | Ga0207700_10000074 | Ga0207700_1000007448 | 334 |
| 879 | 3300025928 | Ga0207700_10010760 | Ga0207700_100107606 | 334 |
| 880 | 3300025928 | Ga0207700_10029252 | Ga0207700_100292524 | 334 |
| 881 | 3300025929 | Ga0207664_10001185 | Ga0207664_100011856 | 334 |
| 882 | 3300025931 | Ga0207644_10038706 | Ga0207644_100387062 | 334 |
| 883 | 3300025933 | Ga0207706_10002859 | Ga0207706_100028598 | 334 |
| 884 | 3300025933 | Ga0207706_10184716 | Ga0207706_101847161 | 334 |
| 885 | 3300025934 | Ga0207686_10000211 | Ga0207686_1000021133 | 334 |
| 886 | 3300025936 | Ga0207670_10136754 | Ga0207670_101367542 | 334 |
| 887 | 3300025939 | Ga0207665_10054762 | Ga0207665_100547622 | 334 |
| 888 | 3300025939 | Ga0207665_10126862 | Ga0207665_101268622 | 334 |
| 889 | 3300025940 | Ga0207691_10000027 | Ga0207691_1000002737 | 334 |
| 890 | 3300025941 | Ga0207711_10000116 | Ga0207711_1000011652 | 334 |
| 891 | 3300025941 | Ga0207711_10036322 | Ga0207711_100363223 | 334 |
| 892 | 3300025942 | Ga0207689_10000548 | Ga0207689_100005488 | 334 |
| 893 | 3300025942 | Ga0207689_10006355 | Ga0207689_100063559 | 334 |
| 894 | 3300025942 | Ga0207689_10085284 | Ga0207689_100852841 | 334 |
| 895 | 3300025960 | Ga0207651_10329329 | Ga0207651_103293291 | 334 |
| 896 | 3300025972 | Ga0207668_10002876 | Ga0207668_100028765 | 334 |
| 897 | 3300025981 | Ga0207640_10072147 | Ga0207640_100721473 | 334 |
| 898 | 3300025986 | Ga0207658_10012633 | Ga0207658_100126332 | 334 |
| 899 | 3300025986 | Ga0207658_10013907 | Ga0207658_100139073 | 334 |
| 900 | 3300026023 | Ga0207677_10000598 | Ga0207677_100005988 | 334 |
| 901 | 3300026023 | Ga0207677_10036280 | Ga0207677_100362802 | 334 |
| 902 | 3300026023 | Ga0207677_10058229 | Ga0207677_100582293 | 334 |
| 903 | 3300026035 | Ga0207703_10000357 | Ga0207703_1000035726 | 334 |
| 904 | 3300026035 | Ga0207703_10000746 | Ga0207703_100007468 | 334 |
| 905 | 3300026067 | Ga0207678_10082708 | Ga0207678_100827083 | 334 |
| 906 | 3300026078 | Ga0207702_10088947 | Ga0207702_100889472 | 334 |
| 907 | 3300026088 | Ga0207641_10007190 | Ga0207641_100071905 | 334 |
| 908 | 3300026088 | Ga0207641_10009017 | Ga0207641_1000901710 | 334 |
| 909 | 3300026089 | Ga0207648_10000149 | Ga0207648_1000014949 | 334 |
| 910 | 3300026089 | Ga0207648_10007044 | Ga0207648_1000704413 | 334 |
| 911 | 3300026089 | Ga0207648_10014327 | Ga0207648_100143272 | 334 |
| 912 | 3300026095 | Ga0207676_10000236 | Ga0207676_1000023618 | 334 |
| 913 | 3300026095 | Ga0207676_10012337 | Ga0207676_100123372 | 334 |
| 914 | 3300026116 | Ga0207674_10022536 | Ga0207674_100225365 | 334 |
| 915 | 3300026116 | Ga0207674_10026234 | Ga0207674_100262346 | 334 |
| 916 | 3300026118 | Ga0207675_100000230 | Ga0207675_10000023019 | 334 |
| 917 | 3300026121 | Ga0207683_10000285 | Ga0207683_1000028536 | 334 |
| 918 | 3300026121 | Ga0207683_10000364 | Ga0207683_100003642 | 334 |
| 919 | 3300028379 | Ga0268266_10008117 | Ga0268266_1000811710 | 334 |
| 920 | 3300028380 | Ga0268265_10005441 | Ga0268265_100054418 | 334 |
| 921 | 3300028381 | Ga0268264_10002371 | Ga0268264_100023716 | 334 |
| 922 | 3300028381 | Ga0268264_10039446 | Ga0268264_100394465 | 334 |
| 923 | 3300035086 | Ga0373934_0000450 | Ga0373934_0000450_11229_12269 | 334 |
| 924 | 3300035116 | Ga0373945_0042501 | Ga0373945_0042501_148_1188 | 334 |
| 925 | 3300035117 | Ga0373953_0004449 | Ga0373953_0004449_793_1833 | 334 |
| 926 | 3300035118 | Ga0373954_0000090 | Ga0373954_0000090_1826_2866 | 334 |
| 927 | 3300035119 | Ga0373956_0004386 | Ga0373956_0004386_643_1683 | 334 |
| 928 | 3300035120 | Ga0373957_0004734 | Ga0373957_0004734_637_1677 | 334 |
| 929 | 3300035170 | Ga0373943_0009829 | Ga0373943_0009829_579_1619 | 334 |
| 930 | 3300035170 | Ga0373943_0038768 | Ga0373943_0038768_809_1849 | 334 |
| 931 | 3300035171 | Ga0373946_0113841 | Ga0373946_0113841_15_1055 | 334 |
| 932 | 3300035692 | Ga0373935_0023065 | Ga0373935_0023065_1952_2992 | 334 |
| 933 | 3300035692 | Ga0373935_0256356 | Ga0373935_0256356_173_1213 | 334 |
| 934 | 3300035695 | Ga0373927_0019318 | Ga0373927_0019318_1031_2071 | 334 |
| 935 | 3300035695 | Ga0373927_0030999 | Ga0373927_0030999_1594_2634 | 334 |
| 936 | 3300035725 | Ga0373947_0038846 | Ga0373947_0038846_517_1557 | 334 |
| 937 | 3300036401 | Ga0373937_0031264 | Ga0373937_0031264_1372_2412 | 334 |
| 938 | 3300036401 | Ga0373937_0125613 | Ga0373937_0125613_1063_2106 | 334 |
| 939 | 3300041486 | Ga0451807_0812292 | Ga0451807_0812292_794_1828 | 334 |
| 940 | 3300046459 | Ga0495629_0072973 | Ga0495629_0072973_1314_2354 | 334 |
| 941 | 3300046472 | Ga0495580_0046345 | Ga0495580_0046345_637_1677 | 334 |
| 942 | 3300046472 | Ga0495580_0142954 | Ga0495580_0142954_578_1618 | 334 |
| 943 | 3300046473 | Ga0495582_0018395 | Ga0495582_0018395_1952_2992 | 334 |
| 944 | 3300046475 | Ga0495639_0029001 | Ga0495639_0029001_175_1215 | 334 |
| 945 | 3300046531 | Ga0495665_0031115 | Ga0495665_0031115_1747_2787 | 334 |
| 946 | 3300046543 | Ga0495645_0179809 | Ga0495645_0179809_227_1267 | 334 |
| 947 | 3300046663 | Ga0495635_0003129 | Ga0495635_0003129_4160_5200 | 334 |
| 948 | 3300046664 | Ga0495659_0008400 | Ga0495659_0008400_761_1801 | 334 |
| 949 | 3300046683 | Ga0495658_0227644 | Ga0495658_0227644_43_1083 | 334 |
| 950 | 3300046809 | Ga0495600_0013499 | Ga0495600_0013499_2429_3469 | 334 |
| 951 | 3300047315 | Ga0495581_0009908 | Ga0495581_0009908_2317_3357 | 334 |
| 952 | 3300047317 | Ga0495604_0086299 | Ga0495604_0086299_652_1692 | 334 |
| 953 | 3300047322 | Ga0495680_0027794 | Ga0495680_0027794_1668_2708 | 334 |
| 954 | 3300047471 | Ga0495684_0052242 | Ga0495684_0052242_375_1415 | 334 |
| 955 | 3300048904 | Ga0496101_0009759 | Ga0496101_0009759_1698_2738 | 334 |
| 956 | 3300048905 | Ga0496102_0095561 | Ga0496102_0095561_365_1399 | 334 |
| 957 | 3300048906 | Ga0496103_0037694 | Ga0496103_0037694_584_1618 | 334 |
| 958 | 3300048906 | Ga0496103_0122994 | Ga0496103_0122994_482_1522 | 334 |
| 959 | 3300048907 | Ga0496104_0035404 | Ga0496104_0035404_1530_2570 | 334 |
| 960 | 3300048908 | Ga0496105_0010312 | Ga0496105_0010312_5104_6144 | 334 |
| 961 | 3300048909 | Ga0496106_0037450 | Ga0496106_0037450_1753_2787 | 334 |
| 962 | 3300048910 | Ga0496107_0059285 | Ga0496107_0059285_252_1292 | 334 |
| 963 | 3300048911 | Ga0496108_0061510 | Ga0496108_0061510_880_1920 | 334 |
| 964 | 3300048912 | Ga0496109_0021461 | Ga0496109_0021461_1411_2445 | 334 |
| 965 | 3300048912 | Ga0496109_0116251 | Ga0496109_0116251_536_1576 | 334 |
| 966 | 3300048915 | Ga0496112_0000540 | Ga0496112_0000540_851_1891 | 334 |
| 967 | 3300048917 | Ga0496114_0065630 | Ga0496114_0065630_272_1312 | 334 |
| 968 | 3300048917 | Ga0496114_0086431 | Ga0496114_0086431_1495_2529 | 334 |
| 969 | 3300049585 | Ga0501069_0105584 | Ga0501069_0105584_316_1356 | 334 |
| 970 | 3300050507 | nmdc:mga05p37_240457_c1 | nmdc:mga05p37_240457_c1_976_2049 | 334 |
| 971 | 3300050512 | nmdc:mga0n895_111670_c1 | nmdc:mga0n895_111670_c1_1230_2303 | 334 |
| 972 | 3300050513 | nmdc:mga0rr50_5859_c1 | nmdc:mga0rr50_5859_c1_624_1697 | 334 |
| 973 | 3300050513 | nmdc:mga0rr50_72129_c1 | nmdc:mga0rr50_72129_c1_527_1567 | 334 |
| 974 | 3300050513 | nmdc:mga0rr50_97216_c1 | nmdc:mga0rr50_97216_c1_795_1838 | 334 |
| 975 | 3300050514 | nmdc:mga08x19_60696_c1 | nmdc:mga08x19_60696_c1_687_1730 | 334 |
| 976 | 3300053085 | Ga0495619_0010282 | Ga0495619_0010282_1020_2060 | 334 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2cvo-assembly1.cif.gz_C | crystal structure of putative n-acetyl-gamma-glutamyl-phosphate reductase (ak071544) from rice (oryza sativa) | 0.9234 | 2 | 334 |
| 2cvo-assembly1.cif.gz_C | crystal structure of putative n-acetyl-gamma-glutamyl-phosphate reductase (ak071544) from rice (oryza sativa) | 0.9181 | 2 | 334 |
| 1xyg-assembly1.cif.gz_D | x-ray structure of gene product from arabidopsis thaliana at2g19940 | 0.9093 | 2 | 334 |
| 8afv-assembly1.cif.gz_A | daargc3 - engineered formyl phosphate reductase with 3 substitutions (s178v, g182v, l233i) | 0.9061 | 3 | 327 |
| 8afu-assembly2.cif.gz_A-2 | daargc - n-acetyl-gamma-glutamyl-phosphate reductase of denitrovibrio acetiphilus | 0.9058 | 1 | 327 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2G1H4_146_311_3.30.360.10 | Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 | 0.9063 | 139 | 302 | 3.30.360.10 |
| af_Q2G1H4_146_311_3.30.360.10 | Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 | 0.8908 | 139 | 302 | 3.30.360.10 |
| 2i3gB02 | Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 | 0.8907 | 138 | 302 | 3.30.360.10 |
| af_I1KL32_193_359_3.30.360.10 | Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 | 0.887 | 138 | 302 | 3.30.360.10 |
| 2i3gB02 | Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 | 0.8857 | 138 | 302 | 3.30.360.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5E6N168-F1-model_v4 | N-acetyl-gamma-glutamyl-phosphate reductase (EC) (EC 1.2.1.38) | 0.9866 | 233 | 334 |
GO:0003942
|
| AF-A0A455UKX9-F1-model_v4 | Uncharacterized protein | 0.9843 | 228 | 334 |
|
| AF-A0A455UKX9-F1-model_v4 | Uncharacterized protein | 0.9753 | 228 | 334 |
|
| AF-A0A5E6N168-F1-model_v4 | N-acetyl-gamma-glutamyl-phosphate reductase (EC) (EC 1.2.1.38) | 0.9678 | 233 | 334 |
GO:0003942
|
| AF-A0A849TEG7-F1-model_v4 | N-acetyl-gamma-glutamyl-phosphate reductase (EC 1.2.1.38) | 0.9619 | 1 | 171 |
GO:0003942
GO:0006526 GO:0051287 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar