F487223
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 975 | 388 | 1950 | 204 |
Family's Representative Sequence
| Representative Sequence | 3300005467|Ga0070706_100112996|Ga0070706_1001129962 |
| Length | 238 |
| Sequence | MNRDYRDSILICVYLLKSDRGEVNVFTGIIEEVGKVEAINVAGEKRRLTIACSKLLPEIKVGNSVSVSGVCLTAVEIGKNSFAADLAHETWVRTSLSRLRPGALVNLELPMRANGRFDGHIVQGHVDGTGTVISLAPIPEWIDYVLAINVPSELTRYIVAKGSLSIEGISLTVAAIEGTEVRVAIIPHTAEVTNLKSLDPGDPVNLEVDVIAKYVEKMMGGQKAESSITLEKLVRAGF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 2 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 3 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 4 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 5 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 6 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 7 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 8 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 10 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 16 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 49 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 57 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 64 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 66 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 67 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 68 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 70 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 71 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 72 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 73 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 74 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 75 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 76 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 77 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 78 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 79 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 80 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 81 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 82 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 84 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 85 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 86 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 87 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 88 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 89 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 90 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 91 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 93 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 94 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 95 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 96 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 97 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 98 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 99 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 100 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 101 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 102 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 104 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 132 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 133 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 134 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 135 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 136 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 137 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 138 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 139 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 140 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 201 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 202 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 206 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 207 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 208 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 209 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 210 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 211 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 212 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 213 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 214 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 215 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 216 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 217 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 218 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 219 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 220 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 221 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 222 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 223 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 224 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 225 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 226 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 227 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 228 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 229 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 230 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 231 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 232 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 233 | 3300036534 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 234 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 235 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 236 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 237 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 238 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 239 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 240 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 241 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 242 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 243 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 244 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 245 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 246 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 247 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 248 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 249 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 250 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 251 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 252 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 253 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 254 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 255 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 256 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 257 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 258 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 259 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 260 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 261 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 262 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 263 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 264 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 301 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 302 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 303 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 304 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 305 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 306 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 307 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 308 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 309 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 310 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 311 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 312 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 313 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 314 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 315 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 316 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 317 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 318 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 319 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 320 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 321 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 322 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 326 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 327 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 330 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 331 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 333 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 335 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 337 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 338 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 340 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 343 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 346 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 349 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 350 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 353 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 354 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 357 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 358 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 359 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 360 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 361 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 362 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 363 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 364 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 365 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 366 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 367 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 368 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 369 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 370 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 371 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 372 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 373 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 374 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 378 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 379 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 380 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 381 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 382 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 383 | 2522125168 | Dyadobacter beijingensis DSM 21582 | Isolate | Rhizosphere |
| 384 | 2728369359 | Paenibacillus polymyxa YC0136 | Isolate | Rhizosphere |
| 385 | 2739367656 | Pedobacter sp. CF523 | Isolate | Unclassified |
| 386 | 2875391855 | Streptomyces cavourensis 1AS2a | Isolate | Rhizosphere |
| 387 | 2904595352 | Paenibacillus sp. 1182 | Isolate | Unclassified |
| 388 | 2939702853 | Paenibacillus sp. PvR008 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.56 |
| Metatranscriptomes | 0.82 |
| Isolates | 0.62 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.59 |
| Nodule | 0 |
| Rhizoplane | 2.97 |
| Rhizosphere | 88.62 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.23 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070706_100112996 | 3300005467 | Unclassified | 2529 |
| 2 | rootH1_10077023 | 3300003316 | Bacteria | 3956 |
| 3 | rootH2_10058891 | 3300003320 | Bacteria | 3005 |
| 4 | rootL2_10318583 | 3300003322 | Bacteria | 1535 |
| 5 | Ga0055536_1005846 | 3300003781 | Bacteria | 5909 |
| 6 | Ga0055531_10000087 | 3300003794 | Bacteria | 101553 |
| 7 | Ga0065165_1000396 | 3300005262 | Bacteria | 70676 |
| 8 | Ga0065704_10282964 | 3300005289 | Bacteria | 919 |
| 9 | Ga0065712_10133099 | 3300005290 | Bacteria | 1505 |
| 10 | Ga0070658_10161126 | 3300005327 | Bacteria | 1882 |
| 11 | Ga0070658_10191294 | 3300005327 | Bacteria | 1725 |
| 12 | Ga0070676_10446797 | 3300005328 | Bacteria | 908 |
| 13 | Ga0070683_100002001 | 3300005329 | Bacteria | 15985 |
| 14 | Ga0070683_100029658 | 3300005329 | Bacteria | 4957 |
| 15 | Ga0070683_100045091 | 3300005329 | Bacteria | 4070 |
| 16 | Ga0070683_100066475 | 3300005329 | Bacteria | 3358 |
| 17 | Ga0070690_100016725 | 3300005330 | Bacteria | 4400 |
| 18 | Ga0070690_100062514 | 3300005330 | Bacteria | 2401 |
| 19 | Ga0070690_100218685 | 3300005330 | Bacteria | 1334 |
| 20 | Ga0070670_100000207 | 3300005331 | Bacteria | 54657 |
| 21 | Ga0070670_100762691 | 3300005331 | Bacteria | 872 |
| 22 | Ga0068869_100146319 | 3300005334 | Bacteria | 1829 |
| 23 | Ga0068869_100204435 | 3300005334 | Bacteria | 1559 |
| 24 | Ga0068869_100549970 | 3300005334 | Bacteria | 970 |
| 25 | Ga0068869_100637539 | 3300005334 | Bacteria | 903 |
| 26 | Ga0070666_10003775 | 3300005335 | Bacteria | 9184 |
| 27 | Ga0070666_10056449 | 3300005335 | Bacteria | 2651 |
| 28 | Ga0070666_10104433 | 3300005335 | Bacteria | 1955 |
| 29 | Ga0070680_100000851 | 3300005336 | Bacteria | 21636 |
| 30 | Ga0070680_100101365 | 3300005336 | Bacteria | 2390 |
| 31 | Ga0070680_100537881 | 3300005336 | Bacteria | 1001 |
| 32 | Ga0070682_100428117 | 3300005337 | Bacteria | 1008 |
| 33 | Ga0068868_100000724 | 3300005338 | Bacteria | 22276 |
| 34 | Ga0068868_100075031 | 3300005338 | Unclassified | 2702 |
| 35 | Ga0068868_100155897 | 3300005338 | Bacteria | 1883 |
| 36 | Ga0068868_100367217 | 3300005338 | Bacteria | 1236 |
| 37 | Ga0070660_100011360 | 3300005339 | Bacteria | 6322 |
| 38 | Ga0070660_100024216 | 3300005339 | Bacteria | 4503 |
| 39 | Ga0070689_100139540 | 3300005340 | Bacteria | 1949 |
| 40 | Ga0070689_100162576 | 3300005340 | Bacteria | 1805 |
| 41 | Ga0070691_10282498 | 3300005341 | Bacteria | 901 |
| 42 | Ga0070687_100038225 | 3300005343 | Bacteria | 2404 |
| 43 | Ga0070687_100419492 | 3300005343 | Unclassified | 882 |
| 44 | Ga0070661_100012774 | 3300005344 | Bacteria | 5880 |
| 45 | Ga0070661_100015958 | 3300005344 | Bacteria | 5301 |
| 46 | Ga0070661_100044366 | 3300005344 | Bacteria | 3248 |
| 47 | Ga0070692_10001566 | 3300005345 | Bacteria | 8390 |
| 48 | Ga0070692_10013844 | 3300005345 | Bacteria | 3770 |
| 49 | Ga0070668_100062267 | 3300005347 | Bacteria | 2890 |
| 50 | Ga0070668_100156042 | 3300005347 | Bacteria | 1849 |
| 51 | Ga0070669_100075250 | 3300005353 | Bacteria | 2504 |
| 52 | Ga0070669_100111541 | 3300005353 | Bacteria | 2076 |
| 53 | Ga0070675_100038493 | 3300005354 | Bacteria | 3898 |
| 54 | Ga0070675_100045451 | 3300005354 | Bacteria | 3593 |
| 55 | Ga0070675_100165680 | 3300005354 | Bacteria | 1903 |
| 56 | Ga0070671_100034456 | 3300005355 | Bacteria | 4191 |
| 57 | Ga0070671_100066279 | 3300005355 | Bacteria | 3009 |
| 58 | Ga0070674_100076211 | 3300005356 | Bacteria | 2384 |
| 59 | Ga0070688_100001589 | 3300005365 | Bacteria | 11359 |
| 60 | Ga0070688_100119157 | 3300005365 | Bacteria | 1765 |
| 61 | Ga0070659_100001330 | 3300005366 | Bacteria | 17814 |
| 62 | Ga0070659_100033625 | 3300005366 | Bacteria | 3983 |
| 63 | Ga0070667_100050175 | 3300005367 | Bacteria | 3516 |
| 64 | Ga0070667_100050393 | 3300005367 | Bacteria | 3509 |
| 65 | Ga0070709_10200179 | 3300005434 | Bacteria | 1414 |
| 66 | Ga0070709_10226004 | 3300005434 | Bacteria | 1337 |
| 67 | Ga0070714_100000998 | 3300005435 | Bacteria | 20196 |
| 68 | Ga0070714_100021407 | 3300005435 | Bacteria | 5292 |
| 69 | Ga0070714_100439629 | 3300005435 | Bacteria | 1238 |
| 70 | Ga0070714_101126792 | 3300005435 | Bacteria | 765 |
| 71 | Ga0070713_100001968 | 3300005436 | Bacteria | 13255 |
| 72 | Ga0070713_100023666 | 3300005436 | Bacteria | 4771 |
| 73 | Ga0070713_100104464 | 3300005436 | Bacteria | 2460 |
| 74 | Ga0070713_100121628 | 3300005436 | Bacteria | 2290 |
| 75 | Ga0070713_100164656 | 3300005436 | Bacteria | 1982 |
| 76 | Ga0070713_100360319 | 3300005436 | Unclassified | 1351 |
| 77 | Ga0070713_100424601 | 3300005436 | Unclassified | 1245 |
| 78 | Ga0070710_10035057 | 3300005437 | Bacteria | 2734 |
| 79 | Ga0070701_10062407 | 3300005438 | Bacteria | 1969 |
| 80 | Ga0070701_10089205 | 3300005438 | Bacteria | 1686 |
| 81 | Ga0070711_100129753 | 3300005439 | Bacteria | 1876 |
| 82 | Ga0070711_100160625 | 3300005439 | Bacteria | 1703 |
| 83 | Ga0070711_100177488 | 3300005439 | Bacteria | 1628 |
| 84 | Ga0070711_100266410 | 3300005439 | Bacteria | 1350 |
| 85 | Ga0070711_100715461 | 3300005439 | Bacteria | 844 |
| 86 | Ga0070705_100042378 | 3300005440 | Bacteria | 2602 |
| 87 | Ga0070705_100234203 | 3300005440 | Bacteria | 1279 |
| 88 | Ga0070705_100857552 | 3300005440 | Bacteria | 727 |
| 89 | Ga0070700_100006126 | 3300005441 | Bacteria | 6408 |
| 90 | Ga0070700_100109996 | 3300005441 | Bacteria | 1830 |
| 91 | Ga0070694_100064846 | 3300005444 | Bacteria | 2501 |
| 92 | Ga0070708_100002773 | 3300005445 | Bacteria | 13606 |
| 93 | Ga0070708_100897006 | 3300005445 | Bacteria | 832 |
| 94 | Ga0070663_100003770 | 3300005455 | Bacteria | 8802 |
| 95 | Ga0070663_100670193 | 3300005455 | Bacteria | 879 |
| 96 | Ga0070678_100043278 | 3300005456 | Bacteria | 3206 |
| 97 | Ga0070678_100054608 | 3300005456 | Bacteria | 2912 |
| 98 | Ga0070678_100297636 | 3300005456 | Bacteria | 1370 |
| 99 | Ga0070678_101219724 | 3300005456 | Unclassified | 698 |
| 100 | Ga0070662_100002142 | 3300005457 | Bacteria | 12101 |
| 101 | Ga0070681_10000229 | 3300005458 | Bacteria | 44150 |
| 102 | Ga0070681_10006386 | 3300005458 | Bacteria | 11463 |
| 103 | Ga0070681_10107572 | 3300005458 | Bacteria | 2729 |
| 104 | Ga0070681_10169999 | 3300005458 | Bacteria | 2102 |
| 105 | Ga0070681_10238924 | 3300005458 | Unclassified | 1730 |
| 106 | Ga0068867_100022943 | 3300005459 | Bacteria | 4465 |
| 107 | Ga0068867_100078397 | 3300005459 | Bacteria | 2485 |
| 108 | Ga0068867_100521761 | 3300005459 | Unclassified | 1024 |
| 109 | Ga0070685_10001752 | 3300005466 | Bacteria | 11359 |
| 110 | Ga0070685_10113659 | 3300005466 | Bacteria | 1672 |
| 111 | Ga0070706_100002983 | 3300005467 | Bacteria | 16773 |
| 112 | Ga0070706_100039185 | 3300005467 | Bacteria | 4375 |
| 113 | Ga0070707_100002460 | 3300005468 | Bacteria | 17648 |
| 114 | Ga0070707_100479089 | 3300005468 | Unclassified | 1206 |
| 115 | Ga0070698_100004516 | 3300005471 | Bacteria | 15295 |
| 116 | Ga0070698_100014925 | 3300005471 | Bacteria | 8213 |
| 117 | Ga0070698_101021314 | 3300005471 | Unclassified | 774 |
| 118 | Ga0070699_100012919 | 3300005518 | Bacteria | 7199 |
| 119 | Ga0070679_100000982 | 3300005530 | Bacteria | 24847 |
| 120 | Ga0070679_100001940 | 3300005530 | Bacteria | 18578 |
| 121 | Ga0070679_100028311 | 3300005530 | Bacteria | 5523 |
| 122 | Ga0070679_100036311 | 3300005530 | Bacteria | 4890 |
| 123 | Ga0070679_100159288 | 3300005530 | Bacteria | 2232 |
| 124 | Ga0070679_100220165 | 3300005530 | Bacteria | 1859 |
| 125 | Ga0070679_100274896 | 3300005530 | Bacteria | 1638 |
| 126 | Ga0070679_100989091 | 3300005530 | Bacteria | 785 |
| 127 | Ga0070684_100004657 | 3300005535 | Bacteria | 10468 |
| 128 | Ga0070684_100024983 | 3300005535 | Bacteria | 5017 |
| 129 | Ga0070684_100165626 | 3300005535 | Bacteria | 2006 |
| 130 | Ga0070684_100384105 | 3300005535 | Bacteria | 1294 |
| 131 | Ga0070684_100393209 | 3300005535 | Bacteria | 1278 |
| 132 | Ga0070697_100019771 | 3300005536 | Bacteria | 5320 |
| 133 | Ga0070697_100051147 | 3300005536 | Unclassified | 3357 |
| 134 | Ga0070697_100079032 | 3300005536 | Bacteria | 2708 |
| 135 | Ga0068853_100011034 | 3300005539 | Bacteria | 7328 |
| 136 | Ga0068853_100738132 | 3300005539 | Bacteria | 941 |
| 137 | Ga0068853_100782799 | 3300005539 | Bacteria | 913 |
| 138 | Ga0070672_100002719 | 3300005543 | Bacteria | 11314 |
| 139 | Ga0070672_100013963 | 3300005543 | Bacteria | 5682 |
| 140 | Ga0070672_100064638 | 3300005543 | Bacteria | 2891 |
| 141 | Ga0070672_100462153 | 3300005543 | Bacteria | 1094 |
| 142 | Ga0070686_100008137 | 3300005544 | Bacteria | 5865 |
| 143 | Ga0070686_100019718 | 3300005544 | Bacteria | 3979 |
| 144 | Ga0070695_100004688 | 3300005545 | Bacteria | 8042 |
| 145 | Ga0070695_100317512 | 3300005545 | Bacteria | 1157 |
| 146 | Ga0070693_100018891 | 3300005547 | Bacteria | 3607 |
| 147 | Ga0070693_100064150 | 3300005547 | Bacteria | 2143 |
| 148 | Ga0070693_100165851 | 3300005547 | Bacteria | 1411 |
| 149 | Ga0070693_100346207 | 3300005547 | Bacteria | 1016 |
| 150 | Ga0070693_100478570 | 3300005547 | Bacteria | 879 |
| 151 | Ga0070665_100006697 | 3300005548 | Bacteria | 11711 |
| 152 | Ga0070665_100207711 | 3300005548 | Bacteria | 1959 |
| 153 | Ga0070704_100176196 | 3300005549 | Bacteria | 1706 |
| 154 | Ga0070704_100206787 | 3300005549 | Bacteria | 1588 |
| 155 | Ga0068855_100001344 | 3300005563 | Bacteria | 30457 |
| 156 | Ga0068855_100016503 | 3300005563 | Bacteria | 8881 |
| 157 | Ga0070664_100001854 | 3300005564 | Bacteria | 16923 |
| 158 | Ga0070664_100028719 | 3300005564 | Bacteria | 4630 |
| 159 | Ga0070664_100125856 | 3300005564 | Bacteria | 2248 |
| 160 | Ga0070664_100152241 | 3300005564 | Bacteria | 2042 |
| 161 | Ga0070664_100158028 | 3300005564 | Unclassified | 2004 |
| 162 | Ga0070664_100700473 | 3300005564 | Bacteria | 943 |
| 163 | Ga0068857_100039760 | 3300005577 | Bacteria | 4168 |
| 164 | Ga0068857_100103851 | 3300005577 | Bacteria | 2551 |
| 165 | Ga0068857_100110624 | 3300005577 | Bacteria | 2469 |
| 166 | Ga0068857_100195728 | 3300005577 | Bacteria | 1842 |
| 167 | Ga0068857_100218093 | 3300005577 | Bacteria | 1742 |
| 168 | Ga0068854_100020944 | 3300005578 | Bacteria | 4431 |
| 169 | Ga0068854_100123766 | 3300005578 | Bacteria | 1967 |
| 170 | Ga0068854_100524395 | 3300005578 | Bacteria | 1001 |
| 171 | Ga0068856_100000269 | 3300005614 | Bacteria | 56597 |
| 172 | Ga0068856_100001308 | 3300005614 | Bacteria | 26215 |
| 173 | Ga0068856_100008504 | 3300005614 | Bacteria | 9980 |
| 174 | Ga0068856_100088073 | 3300005614 | Unclassified | 3087 |
| 175 | Ga0068856_100091155 | 3300005614 | Bacteria | 3032 |
| 176 | Ga0068856_100174140 | 3300005614 | Bacteria | 2164 |
| 177 | Ga0068856_100655858 | 3300005614 | Bacteria | 1070 |
| 178 | Ga0068856_100732069 | 3300005614 | Bacteria | 1009 |
| 179 | Ga0068856_100793496 | 3300005614 | Bacteria | 967 |
| 180 | Ga0070702_100024548 | 3300005615 | Bacteria | 3217 |
| 181 | Ga0068852_100011008 | 3300005616 | Bacteria | 6787 |
| 182 | Ga0068852_100025487 | 3300005616 | Bacteria | 4792 |
| 183 | Ga0068859_100003024 | 3300005617 | Bacteria | 17050 |
| 184 | Ga0068859_100110766 | 3300005617 | Bacteria | 2807 |
| 185 | Ga0068859_100111197 | 3300005617 | Bacteria | 2802 |
| 186 | Ga0068859_100211788 | 3300005617 | Bacteria | 2024 |
| 187 | Ga0068859_100383983 | 3300005617 | Bacteria | 1500 |
| 188 | Ga0068859_100956122 | 3300005617 | Unclassified | 940 |
| 189 | Ga0068864_100011330 | 3300005618 | Bacteria | 7368 |
| 190 | Ga0068864_100029472 | 3300005618 | Bacteria | 4650 |
| 191 | Ga0068864_100040860 | 3300005618 | Bacteria | 3966 |
| 192 | Ga0068864_100089807 | 3300005618 | Bacteria | 2707 |
| 193 | Ga0068864_100805718 | 3300005618 | Bacteria | 923 |
| 194 | Ga0068861_100015698 | 3300005719 | Bacteria | 5343 |
| 195 | Ga0068861_100896479 | 3300005719 | Bacteria | 839 |
| 196 | Ga0068851_10175736 | 3300005834 | Bacteria | 1184 |
| 197 | Ga0068870_10354194 | 3300005840 | Unclassified | 943 |
| 198 | Ga0068870_10606300 | 3300005840 | Bacteria | 744 |
| 199 | Ga0068863_100014094 | 3300005841 | Bacteria | 7701 |
| 200 | Ga0068863_100041704 | 3300005841 | Bacteria | 4364 |
| 201 | Ga0068863_100216470 | 3300005841 | Unclassified | 1845 |
| 202 | Ga0068863_100333525 | 3300005841 | Bacteria | 1475 |
| 203 | Ga0068863_100446634 | 3300005841 | Bacteria | 1269 |
| 204 | Ga0068858_100019598 | 3300005842 | Bacteria | 6324 |
| 205 | Ga0068858_100044626 | 3300005842 | Bacteria | 4108 |
| 206 | Ga0068858_100102323 | 3300005842 | Bacteria | 2672 |
| 207 | Ga0068858_100102729 | 3300005842 | Bacteria | 2666 |
| 208 | Ga0068858_100247528 | 3300005842 | Bacteria | 1693 |
| 209 | Ga0068858_100511347 | 3300005842 | Bacteria | 1161 |
| 210 | Ga0068860_100043979 | 3300005843 | Bacteria | 4258 |
| 211 | Ga0068860_100758300 | 3300005843 | Unclassified | 982 |
| 212 | Ga0068862_100056787 | 3300005844 | Bacteria | 3355 |
| 213 | Ga0068862_100249051 | 3300005844 | Bacteria | 1618 |
| 214 | Ga0068862_100251129 | 3300005844 | Bacteria | 1612 |
| 215 | Ga0068862_100622536 | 3300005844 | Bacteria | 1038 |
| 216 | Ga0081455_10008769 | 3300005937 | Bacteria | 10469 |
| 217 | Ga0081455_10038588 | 3300005937 | Bacteria | 4228 |
| 218 | Ga0081455_10098648 | 3300005937 | Bacteria | 2351 |
| 219 | Ga0081538_10001123 | 3300005981 | Bacteria | 28341 |
| 220 | Ga0081540_1000265 | 3300005983 | Bacteria | 55107 |
| 221 | Ga0081540_1002544 | 3300005983 | Bacteria | 14794 |
| 222 | Ga0081540_1157310 | 3300005983 | Bacteria | 887 |
| 223 | Ga0070717_10003751 | 3300006028 | Bacteria | 10908 |
| 224 | Ga0070717_10019093 | 3300006028 | Bacteria | 5368 |
| 225 | Ga0070717_10404830 | 3300006028 | Bacteria | 1226 |
| 226 | Ga0070717_10687979 | 3300006028 | Unclassified | 929 |
| 227 | Ga0075365_10017319 | 3300006038 | Bacteria | 4406 |
| 228 | Ga0075365_10033549 | 3300006038 | Bacteria | 3309 |
| 229 | Ga0075365_10102791 | 3300006038 | Bacteria | 1958 |
| 230 | Ga0075368_10022088 | 3300006042 | Bacteria | 2420 |
| 231 | Ga0075368_10051889 | 3300006042 | Bacteria | 1631 |
| 232 | Ga0075363_100046048 | 3300006048 | Bacteria | 2313 |
| 233 | Ga0075364_10009991 | 3300006051 | Bacteria | 5715 |
| 234 | Ga0070712_100153768 | 3300006175 | Bacteria | 1769 |
| 235 | Ga0070712_100393437 | 3300006175 | Bacteria | 1143 |
| 236 | Ga0075362_10011804 | 3300006177 | Bacteria | 3450 |
| 237 | Ga0075367_10001445 | 3300006178 | Bacteria | 10221 |
| 238 | Ga0075367_10072997 | 3300006178 | Bacteria | 2067 |
| 239 | Ga0075366_10000307 | 3300006195 | Bacteria | 22132 |
| 240 | Ga0075366_10176017 | 3300006195 | Bacteria | 1299 |
| 241 | Ga0075366_10274793 | 3300006195 | Bacteria | 1029 |
| 242 | Ga0097621_100001313 | 3300006237 | Bacteria | 17096 |
| 243 | Ga0097621_100012438 | 3300006237 | Bacteria | 6309 |
| 244 | Ga0097621_100051312 | 3300006237 | Bacteria | 3357 |
| 245 | Ga0097621_100057803 | 3300006237 | Unclassified | 3173 |
| 246 | Ga0097621_100220280 | 3300006237 | Bacteria | 1653 |
| 247 | Ga0075370_10039897 | 3300006353 | Bacteria | 2647 |
| 248 | Ga0068871_100000510 | 3300006358 | Bacteria | 26634 |
| 249 | Ga0068871_100004430 | 3300006358 | Bacteria | 9767 |
| 250 | Ga0068871_100077234 | 3300006358 | Bacteria | 2752 |
| 251 | Ga0068871_100244101 | 3300006358 | Bacteria | 1562 |
| 252 | Ga0068871_100252769 | 3300006358 | Bacteria | 1535 |
| 253 | Ga0068871_100402814 | 3300006358 | Bacteria | 1219 |
| 254 | Ga0075428_100004866 | 3300006844 | Bacteria | 14905 |
| 255 | Ga0075428_100017204 | 3300006844 | Bacteria | 7990 |
| 256 | Ga0075428_100039391 | 3300006844 | Bacteria | 5201 |
| 257 | Ga0075428_100196176 | 3300006844 | Bacteria | 2183 |
| 258 | Ga0075428_100511184 | 3300006844 | Bacteria | 1285 |
| 259 | Ga0075428_100747221 | 3300006844 | Bacteria | 1041 |
| 260 | Ga0075430_100002187 | 3300006846 | Bacteria | 16192 |
| 261 | Ga0075430_100093313 | 3300006846 | Bacteria | 2516 |
| 262 | Ga0075431_100001969 | 3300006847 | Bacteria | 19588 |
| 263 | Ga0075431_100028616 | 3300006847 | Bacteria | 5728 |
| 264 | Ga0075431_100043921 | 3300006847 | Bacteria | 4610 |
| 265 | Ga0075431_100056908 | 3300006847 | Bacteria | 4033 |
| 266 | Ga0075431_100320974 | 3300006847 | Bacteria | 1562 |
| 267 | Ga0075433_10050269 | 3300006852 | Bacteria | 3629 |
| 268 | Ga0075433_10057483 | 3300006852 | Bacteria | 3400 |
| 269 | Ga0075434_100014876 | 3300006871 | Bacteria | 7444 |
| 270 | Ga0075434_100101297 | 3300006871 | Bacteria | 2887 |
| 271 | Ga0075434_100242385 | 3300006871 | Bacteria | 1823 |
| 272 | Ga0075429_100005425 | 3300006880 | Bacteria | 10984 |
| 273 | Ga0075429_100061721 | 3300006880 | Bacteria | 3266 |
| 274 | Ga0075429_100106052 | 3300006880 | Bacteria | 2455 |
| 275 | Ga0075429_100259404 | 3300006880 | Bacteria | 1522 |
| 276 | Ga0075429_100515427 | 3300006880 | Bacteria | 1048 |
| 277 | Ga0068865_100000278 | 3300006881 | Bacteria | 28227 |
| 278 | Ga0068865_100054786 | 3300006881 | Bacteria | 2773 |
| 279 | Ga0068865_100394495 | 3300006881 | Unclassified | 1132 |
| 280 | Ga0075436_100133582 | 3300006914 | Unclassified | 1741 |
| 281 | Ga0097620_100003024 | 3300006931 | Bacteria | 17050 |
| 282 | Ga0097620_100110769 | 3300006931 | Bacteria | 2807 |
| 283 | Ga0097620_100111192 | 3300006931 | Bacteria | 2802 |
| 284 | Ga0097620_100211792 | 3300006931 | Bacteria | 2024 |
| 285 | Ga0097620_100383977 | 3300006931 | Bacteria | 1500 |
| 286 | Ga0097620_100956157 | 3300006931 | Unclassified | 940 |
| 287 | Ga0075435_100042467 | 3300007076 | Bacteria | 3638 |
| 288 | Ga0075435_100075480 | 3300007076 | Bacteria | 2761 |
| 289 | Ga0105240_10024854 | 3300009093 | Bacteria | 7886 |
| 290 | Ga0105240_10046731 | 3300009093 | Bacteria | 5483 |
| 291 | Ga0105240_10071285 | 3300009093 | Bacteria | 4298 |
| 292 | Ga0105240_10072327 | 3300009093 | Bacteria | 4262 |
| 293 | Ga0105240_10474392 | 3300009093 | Unclassified | 1396 |
| 294 | Ga0111539_10001522 | 3300009094 | Bacteria | 30921 |
| 295 | Ga0111539_10004893 | 3300009094 | Bacteria | 17438 |
| 296 | Ga0111539_10020295 | 3300009094 | Bacteria | 8186 |
| 297 | Ga0111539_10124142 | 3300009094 | Bacteria | 3026 |
| 298 | Ga0111539_10131290 | 3300009094 | Bacteria | 2933 |
| 299 | Ga0111539_10237972 | 3300009094 | Bacteria | 2119 |
| 300 | Ga0105245_10001072 | 3300009098 | Bacteria | 24802 |
| 301 | Ga0105245_10006775 | 3300009098 | Bacteria | 10043 |
| 302 | Ga0105245_10257004 | 3300009098 | Bacteria | 1699 |
| 303 | Ga0105245_10767243 | 3300009098 | Bacteria | 1001 |
| 304 | Ga0105247_10255968 | 3300009101 | Bacteria | 1198 |
| 305 | Ga0114129_10018514 | 3300009147 | Bacteria | 9915 |
| 306 | Ga0114129_10020185 | 3300009147 | Bacteria | 9483 |
| 307 | Ga0114129_10075416 | 3300009147 | Bacteria | 4696 |
| 308 | Ga0114129_10127258 | 3300009147 | Bacteria | 3502 |
| 309 | Ga0114129_10128563 | 3300009147 | Bacteria | 3481 |
| 310 | Ga0114129_10313351 | 3300009147 | Bacteria | 2088 |
| 311 | Ga0114129_10390841 | 3300009147 | Bacteria | 1835 |
| 312 | Ga0105243_10003742 | 3300009148 | Bacteria | 12192 |
| 313 | Ga0105243_10009769 | 3300009148 | Bacteria | 7303 |
| 314 | Ga0105241_10092768 | 3300009174 | Bacteria | 2385 |
| 315 | Ga0105241_10261739 | 3300009174 | Bacteria | 1470 |
| 316 | Ga0105241_10391606 | 3300009174 | Bacteria | 1217 |
| 317 | Ga0105241_10446339 | 3300009174 | Bacteria | 1143 |
| 318 | Ga0105248_10000008 | 3300009177 | Bacteria | 403910 |
| 319 | Ga0105248_10004704 | 3300009177 | Bacteria | 15098 |
| 320 | Ga0105248_10093286 | 3300009177 | Bacteria | 3390 |
| 321 | Ga0105248_10267500 | 3300009177 | Bacteria | 1925 |
| 322 | Ga0105248_10819466 | 3300009177 | Unclassified | 1050 |
| 323 | Ga0105237_10008678 | 3300009545 | Bacteria | 10978 |
| 324 | Ga0105237_10038987 | 3300009545 | Bacteria | 4797 |
| 325 | Ga0105237_10471748 | 3300009545 | Bacteria | 1261 |
| 326 | Ga0105237_10871108 | 3300009545 | Bacteria | 907 |
| 327 | Ga0105237_10963486 | 3300009545 | Bacteria | 860 |
| 328 | Ga0105238_10000743 | 3300009551 | Bacteria | 34004 |
| 329 | Ga0105238_10143194 | 3300009551 | Bacteria | 2367 |
| 330 | Ga0105238_10172407 | 3300009551 | Bacteria | 2140 |
| 331 | Ga0105238_10216549 | 3300009551 | Bacteria | 1891 |
| 332 | Ga0105238_10263920 | 3300009551 | Unclassified | 1702 |
| 333 | Ga0105238_10501006 | 3300009551 | Bacteria | 1215 |
| 334 | Ga0105249_10067038 | 3300009553 | Bacteria | 3305 |
| 335 | Ga0105239_10162831 | 3300010375 | Bacteria | 2493 |
| 336 | Ga0105239_10265027 | 3300010375 | Unclassified | 1931 |
| 337 | Ga0105239_10284433 | 3300010375 | Bacteria | 1862 |
| 338 | Ga0105239_10720749 | 3300010375 | Bacteria | 1141 |
| 339 | Ga0105239_10766630 | 3300010375 | Bacteria | 1104 |
| 340 | Ga0105246_10080451 | 3300011119 | Bacteria | 2320 |
| 341 | Ga0105246_10146247 | 3300011119 | Bacteria | 1784 |
| 342 | Ga0105246_10399415 | 3300011119 | Bacteria | 1141 |
| 343 | Ga0157373_10001156 | 3300013100 | Bacteria | 20223 |
| 344 | Ga0157373_10005500 | 3300013100 | Bacteria | 9503 |
| 345 | Ga0157373_10019021 | 3300013100 | Bacteria | 4999 |
| 346 | Ga0157373_10391170 | 3300013100 | Bacteria | 995 |
| 347 | Ga0157371_10007405 | 3300013102 | Bacteria | 8893 |
| 348 | Ga0157371_10048902 | 3300013102 | Bacteria | 3005 |
| 349 | Ga0157370_10017755 | 3300013104 | Bacteria | 7171 |
| 350 | Ga0157370_10330122 | 3300013104 | Bacteria | 1406 |
| 351 | Ga0157370_10585898 | 3300013104 | Bacteria | 1022 |
| 352 | Ga0157369_10003895 | 3300013105 | Bacteria | 17715 |
| 353 | Ga0157369_10005857 | 3300013105 | Bacteria | 14280 |
| 354 | Ga0157369_10006212 | 3300013105 | Bacteria | 13860 |
| 355 | Ga0157369_10142685 | 3300013105 | Bacteria | 2533 |
| 356 | Ga0157374_10000299 | 3300013296 | Bacteria | 45851 |
| 357 | Ga0157374_10000673 | 3300013296 | Bacteria | 30064 |
| 358 | Ga0157374_10117251 | 3300013296 | Bacteria | 2566 |
| 359 | Ga0157374_10317779 | 3300013296 | Bacteria | 1543 |
| 360 | Ga0157374_10399802 | 3300013296 | Bacteria | 1370 |
| 361 | Ga0157374_10661082 | 3300013296 | Bacteria | 1057 |
| 362 | Ga0157374_11129333 | 3300013296 | Unclassified | 804 |
| 363 | Ga0157378_10001436 | 3300013297 | Bacteria | 21459 |
| 364 | Ga0157378_10062392 | 3300013297 | Bacteria | 3328 |
| 365 | Ga0157378_10094349 | 3300013297 | Bacteria | 2725 |
| 366 | Ga0157378_10825682 | 3300013297 | Bacteria | 954 |
| 367 | Ga0163162_10002123 | 3300013306 | Bacteria | 18627 |
| 368 | Ga0163162_10150431 | 3300013306 | Bacteria | 2445 |
| 369 | Ga0163162_11102838 | 3300013306 | Bacteria | 899 |
| 370 | Ga0157372_10001884 | 3300013307 | Bacteria | 22743 |
| 371 | Ga0157372_10006669 | 3300013307 | Bacteria | 12282 |
| 372 | Ga0157372_10012317 | 3300013307 | Bacteria | 9114 |
| 373 | Ga0157372_10019286 | 3300013307 | Bacteria | 7344 |
| 374 | Ga0157372_10135620 | 3300013307 | Bacteria | 2834 |
| 375 | Ga0157372_10243090 | 3300013307 | Bacteria | 2089 |
| 376 | Ga0157372_10269452 | 3300013307 | Bacteria | 1978 |
| 377 | Ga0157372_10746042 | 3300013307 | Bacteria | 1138 |
| 378 | Ga0157375_10010182 | 3300013308 | Bacteria | 8276 |
| 379 | Ga0157375_10281333 | 3300013308 | Bacteria | 1827 |
| 380 | Ga0163163_10008634 | 3300014325 | Bacteria | 9061 |
| 381 | Ga0157380_10057403 | 3300014326 | Bacteria | 3100 |
| 382 | Ga0157377_10078658 | 3300014745 | Bacteria | 1922 |
| 383 | Ga0157377_10082872 | 3300014745 | Bacteria | 1878 |
| 384 | Ga0157379_10149226 | 3300014968 | Bacteria | 2109 |
| 385 | Ga0157379_10275650 | 3300014968 | Unclassified | 1530 |
| 386 | Ga0157376_10042614 | 3300014969 | Bacteria | 3721 |
| 387 | Ga0157376_10097705 | 3300014969 | Bacteria | 2559 |
| 388 | Ga0157376_10343753 | 3300014969 | Bacteria | 1426 |
| 389 | Ga0157376_11091258 | 3300014969 | Bacteria | 824 |
| 390 | Ga0206352_10810822 | 3300020078 | Bacteria | 1131 |
| 391 | Ga0206354_10638829 | 3300020081 | Bacteria | 1059 |
| 392 | Ga0206354_11335030 | 3300020081 | Bacteria | 1302 |
| 393 | Ga0206353_10828775 | 3300020082 | Bacteria | 3665 |
| 394 | Ga0206353_11254201 | 3300020082 | Bacteria | 947 |
| 395 | Ga0206353_11575633 | 3300020082 | Bacteria | 2566 |
| 396 | Ga0213873_10057946 | 3300021358 | Bacteria | 1041 |
| 397 | Ga0213873_10108185 | 3300021358 | Bacteria | 806 |
| 398 | Ga0213872_10010137 | 3300021361 | Unclassified | 4494 |
| 399 | Ga0213872_10186564 | 3300021361 | Bacteria | 894 |
| 400 | Ga0213874_10006235 | 3300021377 | Bacteria | 2817 |
| 401 | Ga0213876_10035356 | 3300021384 | Bacteria | 2635 |
| 402 | Ga0213875_10245052 | 3300021388 | Bacteria | 845 |
| 403 | Ga0224712_10085856 | 3300022467 | Bacteria | 1308 |
| 404 | Ga0209676_1000390 | 3300025292 | Bacteria | 80030 |
| 405 | Ga0209257_1000006 | 3300025304 | Bacteria | 1570111 |
| 406 | Ga0207682_10059553 | 3300025893 | Bacteria | 1596 |
| 407 | Ga0207692_10109217 | 3300025898 | Bacteria | 1532 |
| 408 | Ga0207710_10000461 | 3300025900 | Bacteria | 26087 |
| 409 | Ga0207688_10038104 | 3300025901 | Bacteria | 2667 |
| 410 | Ga0207680_10006566 | 3300025903 | Bacteria | 5636 |
| 411 | Ga0207680_10019201 | 3300025903 | Bacteria | 3651 |
| 412 | Ga0207680_10344043 | 3300025903 | Bacteria | 1047 |
| 413 | Ga0207647_10360618 | 3300025904 | Unclassified | 822 |
| 414 | Ga0207699_10128771 | 3300025906 | Bacteria | 1648 |
| 415 | Ga0207645_10527808 | 3300025907 | Bacteria | 800 |
| 416 | Ga0207705_10030411 | 3300025909 | Bacteria | 3854 |
| 417 | Ga0207705_10238238 | 3300025909 | Bacteria | 1385 |
| 418 | Ga0207654_10291855 | 3300025911 | Bacteria | 1106 |
| 419 | Ga0207654_10432580 | 3300025911 | Bacteria | 920 |
| 420 | Ga0207707_10014004 | 3300025912 | Bacteria | 6992 |
| 421 | Ga0207707_10024724 | 3300025912 | Bacteria | 5255 |
| 422 | Ga0207707_10040486 | 3300025912 | Bacteria | 4069 |
| 423 | Ga0207707_10128590 | 3300025912 | Bacteria | 2215 |
| 424 | Ga0207707_10202620 | 3300025912 | Unclassified | 1730 |
| 425 | Ga0207707_10385766 | 3300025912 | Bacteria | 1204 |
| 426 | Ga0207707_10584989 | 3300025912 | Bacteria | 946 |
| 427 | Ga0207695_10028344 | 3300025913 | Bacteria | 6214 |
| 428 | Ga0207695_10041471 | 3300025913 | Bacteria | 4927 |
| 429 | Ga0207695_10055642 | 3300025913 | Bacteria | 4121 |
| 430 | Ga0207695_10409617 | 3300025913 | Unclassified | 1240 |
| 431 | Ga0207671_10017218 | 3300025914 | Bacteria | 5582 |
| 432 | Ga0207671_10021736 | 3300025914 | Bacteria | 4862 |
| 433 | Ga0207693_10057358 | 3300025915 | Bacteria | 3052 |
| 434 | Ga0207693_10228569 | 3300025915 | Bacteria | 1461 |
| 435 | Ga0207663_10017300 | 3300025916 | Bacteria | 4013 |
| 436 | Ga0207663_10038567 | 3300025916 | Bacteria | 2889 |
| 437 | Ga0207663_10097229 | 3300025916 | Unclassified | 1969 |
| 438 | Ga0207660_10062435 | 3300025917 | Bacteria | 2684 |
| 439 | Ga0207660_10063532 | 3300025917 | Bacteria | 2662 |
| 440 | Ga0207660_10091988 | 3300025917 | Bacteria | 2251 |
| 441 | Ga0207660_10292424 | 3300025917 | Bacteria | 1296 |
| 442 | Ga0207660_10432504 | 3300025917 | Bacteria | 1063 |
| 443 | Ga0207657_10001043 | 3300025919 | Bacteria | 29329 |
| 444 | Ga0207657_10006978 | 3300025919 | Bacteria | 11630 |
| 445 | Ga0207649_10005811 | 3300025920 | Bacteria | 6680 |
| 446 | Ga0207649_10026774 | 3300025920 | Bacteria | 3377 |
| 447 | Ga0207649_10107598 | 3300025920 | Unclassified | 1857 |
| 448 | Ga0207652_10000709 | 3300025921 | Bacteria | 32351 |
| 449 | Ga0207652_10003467 | 3300025921 | Bacteria | 13008 |
| 450 | Ga0207652_10023611 | 3300025921 | Bacteria | 5096 |
| 451 | Ga0207652_10027875 | 3300025921 | Bacteria | 4710 |
| 452 | Ga0207652_10091136 | 3300025921 | Bacteria | 2680 |
| 453 | Ga0207652_10219796 | 3300025921 | Unclassified | 1712 |
| 454 | Ga0207646_10004328 | 3300025922 | Bacteria | 15489 |
| 455 | Ga0207681_10134285 | 3300025923 | Bacteria | 1834 |
| 456 | Ga0207681_10143723 | 3300025923 | Bacteria | 1780 |
| 457 | Ga0207681_10383007 | 3300025923 | Bacteria | 1132 |
| 458 | Ga0207694_10002021 | 3300025924 | Bacteria | 16807 |
| 459 | Ga0207694_10119877 | 3300025924 | Bacteria | 2099 |
| 460 | Ga0207694_10304051 | 3300025924 | Bacteria | 1314 |
| 461 | Ga0207694_10354626 | 3300025924 | Bacteria | 1215 |
| 462 | Ga0207694_10390330 | 3300025924 | Bacteria | 1156 |
| 463 | Ga0207694_10900454 | 3300025924 | Bacteria | 748 |
| 464 | Ga0207650_10002070 | 3300025925 | Bacteria | 14019 |
| 465 | Ga0207650_10167985 | 3300025925 | Bacteria | 1742 |
| 466 | Ga0207650_10280401 | 3300025925 | Bacteria | 1357 |
| 467 | Ga0207659_10005700 | 3300025926 | Bacteria | 7581 |
| 468 | Ga0207659_10218814 | 3300025926 | Bacteria | 1530 |
| 469 | Ga0207687_10000031 | 3300025927 | Bacteria | 150246 |
| 470 | Ga0207687_10005626 | 3300025927 | Bacteria | 8285 |
| 471 | Ga0207700_10003644 | 3300025928 | Bacteria | 8983 |
| 472 | Ga0207700_10076942 | 3300025928 | Bacteria | 2591 |
| 473 | Ga0207700_10144481 | 3300025928 | Bacteria | 1959 |
| 474 | Ga0207700_10344931 | 3300025928 | Bacteria | 1295 |
| 475 | Ga0207700_10458460 | 3300025928 | Unclassified | 1124 |
| 476 | Ga0207664_10128522 | 3300025929 | Bacteria | 2130 |
| 477 | Ga0207664_10159740 | 3300025929 | Bacteria | 1921 |
| 478 | Ga0207664_10270382 | 3300025929 | Bacteria | 1489 |
| 479 | Ga0207644_10007623 | 3300025931 | Bacteria | 7057 |
| 480 | Ga0207644_10077501 | 3300025931 | Bacteria | 2448 |
| 481 | Ga0207690_10011048 | 3300025932 | Bacteria | 5384 |
| 482 | Ga0207690_10039879 | 3300025932 | Bacteria | 3066 |
| 483 | Ga0207690_10139836 | 3300025932 | Bacteria | 1783 |
| 484 | Ga0207706_10006046 | 3300025933 | Bacteria | 11258 |
| 485 | Ga0207686_10050823 | 3300025934 | Bacteria | 2580 |
| 486 | Ga0207709_10009807 | 3300025935 | Bacteria | 5275 |
| 487 | Ga0207670_10015123 | 3300025936 | Bacteria | 4602 |
| 488 | Ga0207670_10053479 | 3300025936 | Bacteria | 2721 |
| 489 | Ga0207704_10000224 | 3300025938 | Bacteria | 28226 |
| 490 | Ga0207704_10012116 | 3300025938 | Bacteria | 4271 |
| 491 | Ga0207704_10500292 | 3300025938 | Unclassified | 979 |
| 492 | Ga0207691_10014953 | 3300025940 | Bacteria | 7392 |
| 493 | Ga0207691_10034869 | 3300025940 | Bacteria | 4675 |
| 494 | Ga0207691_10291638 | 3300025940 | Bacteria | 1403 |
| 495 | Ga0207711_10000006 | 3300025941 | Bacteria | 792692 |
| 496 | Ga0207711_10003308 | 3300025941 | Bacteria | 14001 |
| 497 | Ga0207711_10013477 | 3300025941 | Bacteria | 6789 |
| 498 | Ga0207689_10192097 | 3300025942 | Bacteria | 1685 |
| 499 | Ga0207689_10366554 | 3300025942 | Bacteria | 1198 |
| 500 | Ga0207661_10009481 | 3300025944 | Bacteria | 6984 |
| 501 | Ga0207661_10012272 | 3300025944 | Bacteria | 6222 |
| 502 | Ga0207661_10035290 | 3300025944 | Bacteria | 3895 |
| 503 | Ga0207661_10064139 | 3300025944 | Bacteria | 2977 |
| 504 | Ga0207661_10344080 | 3300025944 | Bacteria | 1344 |
| 505 | Ga0207679_10021834 | 3300025945 | Bacteria | 4347 |
| 506 | Ga0207679_10157124 | 3300025945 | Bacteria | 1858 |
| 507 | Ga0207679_10387965 | 3300025945 | Bacteria | 1226 |
| 508 | Ga0207679_11079190 | 3300025945 | Unclassified | 736 |
| 509 | Ga0207667_10008046 | 3300025949 | Bacteria | 12575 |
| 510 | Ga0207667_10027499 | 3300025949 | Bacteria | 6190 |
| 511 | Ga0207667_10054673 | 3300025949 | Bacteria | 4199 |
| 512 | Ga0207651_10078948 | 3300025960 | Bacteria | 2363 |
| 513 | Ga0207651_10261584 | 3300025960 | Bacteria | 1421 |
| 514 | Ga0207712_10033227 | 3300025961 | Bacteria | 3486 |
| 515 | Ga0207668_10026483 | 3300025972 | Bacteria | 3765 |
| 516 | Ga0207640_10248644 | 3300025981 | Bacteria | 1379 |
| 517 | Ga0207640_10655170 | 3300025981 | Bacteria | 895 |
| 518 | Ga0207658_10105465 | 3300025986 | Bacteria | 2217 |
| 519 | Ga0207658_10558350 | 3300025986 | Bacteria | 1025 |
| 520 | Ga0207677_10000385 | 3300026023 | Bacteria | 30475 |
| 521 | Ga0207677_10002302 | 3300026023 | Bacteria | 10038 |
| 522 | Ga0207677_10090209 | 3300026023 | Bacteria | 2227 |
| 523 | Ga0207677_10136772 | 3300026023 | Unclassified | 1869 |
| 524 | Ga0207677_10393925 | 3300026023 | Bacteria | 1173 |
| 525 | Ga0207703_10075473 | 3300026035 | Bacteria | 2794 |
| 526 | Ga0207703_10091407 | 3300026035 | Bacteria | 2560 |
| 527 | Ga0207703_10108045 | 3300026035 | Bacteria | 2369 |
| 528 | Ga0207703_10313435 | 3300026035 | Bacteria | 1435 |
| 529 | Ga0207703_10600090 | 3300026035 | Bacteria | 1041 |
| 530 | Ga0207703_11170135 | 3300026035 | Bacteria | 739 |
| 531 | Ga0207639_10027869 | 3300026041 | Bacteria | 4119 |
| 532 | Ga0207639_10163784 | 3300026041 | Bacteria | 1876 |
| 533 | Ga0207639_10370730 | 3300026041 | Bacteria | 1283 |
| 534 | Ga0207678_10000436 | 3300026067 | Bacteria | 37859 |
| 535 | Ga0207678_10009284 | 3300026067 | Bacteria | 8654 |
| 536 | Ga0207678_10034550 | 3300026067 | Bacteria | 4403 |
| 537 | Ga0207678_10885844 | 3300026067 | Bacteria | 789 |
| 538 | Ga0207708_10002776 | 3300026075 | Bacteria | 12866 |
| 539 | Ga0207708_10194459 | 3300026075 | Bacteria | 1616 |
| 540 | Ga0207702_10000304 | 3300026078 | Bacteria | 56789 |
| 541 | Ga0207702_10004007 | 3300026078 | Bacteria | 13229 |
| 542 | Ga0207702_10033370 | 3300026078 | Bacteria | 4299 |
| 543 | Ga0207702_10034868 | 3300026078 | Bacteria | 4208 |
| 544 | Ga0207702_10066598 | 3300026078 | Unclassified | 3088 |
| 545 | Ga0207702_10194518 | 3300026078 | Bacteria | 1876 |
| 546 | Ga0207702_10205268 | 3300026078 | Unclassified | 1829 |
| 547 | Ga0207702_10701597 | 3300026078 | Bacteria | 997 |
| 548 | Ga0207702_10836463 | 3300026078 | Bacteria | 911 |
| 549 | Ga0207641_10013721 | 3300026088 | Bacteria | 6647 |
| 550 | Ga0207641_10058540 | 3300026088 | Unclassified | 3279 |
| 551 | Ga0207641_10200440 | 3300026088 | Bacteria | 1840 |
| 552 | Ga0207641_10340477 | 3300026088 | Bacteria | 1427 |
| 553 | Ga0207641_10358455 | 3300026088 | Bacteria | 1392 |
| 554 | Ga0207648_10001324 | 3300026089 | Bacteria | 27539 |
| 555 | Ga0207648_10909541 | 3300026089 | Unclassified | 822 |
| 556 | Ga0207676_10017836 | 3300026095 | Bacteria | 5150 |
| 557 | Ga0207676_10137029 | 3300026095 | Bacteria | 2090 |
| 558 | Ga0207676_10350910 | 3300026095 | Bacteria | 1364 |
| 559 | Ga0207676_10987855 | 3300026095 | Bacteria | 829 |
| 560 | Ga0207674_10023497 | 3300026116 | Bacteria | 6602 |
| 561 | Ga0207674_10027671 | 3300026116 | Bacteria | 5993 |
| 562 | Ga0207674_10088139 | 3300026116 | Bacteria | 3096 |
| 563 | Ga0207674_10141236 | 3300026116 | Bacteria | 2367 |
| 564 | Ga0207674_10160721 | 3300026116 | Bacteria | 2201 |
| 565 | Ga0207674_10193320 | 3300026116 | Bacteria | 1985 |
| 566 | Ga0207675_100008274 | 3300026118 | Bacteria | 9797 |
| 567 | Ga0207675_100194822 | 3300026118 | Bacteria | 1945 |
| 568 | Ga0207683_10051765 | 3300026121 | Bacteria | 3598 |
| 569 | Ga0207683_10333286 | 3300026121 | Bacteria | 1391 |
| 570 | Ga0207683_10467171 | 3300026121 | Bacteria | 1164 |
| 571 | Ga0207698_10020509 | 3300026142 | Bacteria | 4551 |
| 572 | Ga0207698_10248507 | 3300026142 | Unclassified | 1626 |
| 573 | Ga0209813_10008133 | 3300027866 | Bacteria | 2639 |
| 574 | Ga0209813_10126233 | 3300027866 | Bacteria | 895 |
| 575 | Ga0207428_10000032 | 3300027907 | Bacteria | 232162 |
| 576 | Ga0207428_10147218 | 3300027907 | Bacteria | 1794 |
| 577 | Ga0207428_10155814 | 3300027907 | Bacteria | 1737 |
| 578 | Ga0207428_10195035 | 3300027907 | Bacteria | 1525 |
| 579 | Ga0268266_10000114 | 3300028379 | Bacteria | 166519 |
| 580 | Ga0268265_10046620 | 3300028380 | Bacteria | 3241 |
| 581 | Ga0268265_10120344 | 3300028380 | Bacteria | 2162 |
| 582 | Ga0268265_10389032 | 3300028380 | Bacteria | 1285 |
| 583 | Ga0268264_10039968 | 3300028381 | Bacteria | 3875 |
| 584 | Ga0268264_10056395 | 3300028381 | Bacteria | 3285 |
| 585 | Ga0307511_10137685 | 3300030521 | Bacteria | 1447 |
| 586 | Ga0307511_10280011 | 3300030521 | Bacteria | 772 |
| 587 | Ga0265327_10003797 | 3300031251 | Bacteria | 13989 |
| 588 | Ga0307509_10043062 | 3300031507 | Bacteria | 4887 |
| 589 | Ga0307509_10259619 | 3300031507 | Bacteria | 1514 |
| 590 | Ga0307408_100088219 | 3300031548 | Bacteria | 2336 |
| 591 | Ga0307408_100222095 | 3300031548 | Bacteria | 1542 |
| 592 | Ga0307508_10041829 | 3300031616 | Bacteria | 4112 |
| 593 | Ga0307514_10059318 | 3300031649 | Bacteria | 2924 |
| 594 | Ga0316576_10015783 | 3300031727 | Bacteria | 5079 |
| 595 | Ga0316576_10072009 | 3300031727 | Bacteria | 2550 |
| 596 | Ga0316578_10002626 | 3300031728 | Bacteria | 7969 |
| 597 | Ga0316578_10006327 | 3300031728 | Bacteria | 5834 |
| 598 | Ga0307405_10150359 | 3300031731 | Bacteria | 1636 |
| 599 | Ga0307405_10265501 | 3300031731 | Bacteria | 1284 |
| 600 | Ga0316577_10001160 | 3300031733 | Bacteria | 12069 |
| 601 | Ga0316577_10017999 | 3300031733 | Bacteria | 3906 |
| 602 | Ga0307410_10035745 | 3300031852 | Bacteria | 3230 |
| 603 | Ga0307406_10403739 | 3300031901 | Bacteria | 1084 |
| 604 | Ga0307406_10896801 | 3300031901 | Unclassified | 754 |
| 605 | Ga0307412_10930658 | 3300031911 | Bacteria | 764 |
| 606 | Ga0307409_101011768 | 3300031995 | Bacteria | 849 |
| 607 | Ga0307409_101076497 | 3300031995 | Bacteria | 824 |
| 608 | Ga0307409_101494949 | 3300031995 | Bacteria | 703 |
| 609 | Ga0307416_100013675 | 3300032002 | Bacteria | 5526 |
| 610 | Ga0307416_100077692 | 3300032002 | Bacteria | 2789 |
| 611 | Ga0307414_10000794 | 3300032004 | Bacteria | 16161 |
| 612 | Ga0307414_10297327 | 3300032004 | Bacteria | 1364 |
| 613 | Ga0307414_11454626 | 3300032004 | Bacteria | 637 |
| 614 | Ga0307411_11277051 | 3300032005 | Bacteria | 668 |
| 615 | Ga0307415_100007983 | 3300032126 | Bacteria | 5835 |
| 616 | Ga0307415_100699684 | 3300032126 | Bacteria | 914 |
| 617 | Ga0316580_10012229 | 3300032139 | Bacteria | 2613 |
| 618 | Ga0307507_10000038 | 3300033179 | Bacteria | 184517 |
| 619 | Ga0373936_0002576 | 3300035113 | Bacteria | 6802 |
| 620 | Ga0373936_0015130 | 3300035113 | Bacteria | 2956 |
| 621 | Ga0373956_0354633 | 3300035119 | Bacteria | 699 |
| 622 | Ga0373957_0012616 | 3300035120 | Bacteria | 2849 |
| 623 | Ga0373957_0319091 | 3300035120 | Bacteria | 661 |
| 624 | Ga0373955_0077124 | 3300035172 | Bacteria | 1876 |
| 625 | Ga0316574_0006666 | 3300035398 | Bacteria | 6265 |
| 626 | Ga0316574_0096275 | 3300035398 | Bacteria | 1891 |
| 627 | Ga0316574_0103860 | 3300035398 | Bacteria | 1819 |
| 628 | Ga0373927_0167263 | 3300035695 | Bacteria | 1441 |
| 629 | Ga0373947_0027384 | 3300035725 | Bacteria | 3336 |
| 630 | Ga0373937_0006335 | 3300036401 | Bacteria | 10205 |
| 631 | Ga0373937_0047105 | 3300036401 | Bacteria | 3944 |
| 632 | Ga0373937_0070560 | 3300036401 | Bacteria | 3223 |
| 633 | Ga0310109_000028 | 3300036534 | Bacteria | 7045 |
| 634 | Ga0316582_0001621 | 3300036647 | Bacteria | 10033 |
| 635 | Ga0316582_0006238 | 3300036647 | Bacteria | 6236 |
| 636 | Ga0316582_0021318 | 3300036647 | Bacteria | 3826 |
| 637 | Ga0316582_0407055 | 3300036647 | Bacteria | 937 |
| 638 | Ga0316584_0000394 | 3300036712 | Bacteria | 22706 |
| 639 | Ga0316584_0002381 | 3300036712 | Bacteria | 11868 |
| 640 | Ga0373925_0004880 | 3300037068 | Bacteria | 10092 |
| 641 | Ga0373925_0185478 | 3300037068 | Bacteria | 1649 |
| 642 | Ga0395898_0202186 | 3300037466 | Bacteria | 1896 |
| 643 | Ga0395898_0247849 | 3300037466 | Bacteria | 1699 |
| 644 | Ga0395905_0000147 | 3300037471 | Bacteria | 116389 |
| 645 | Ga0436364_0850190 | 3300037853 | Bacteria | 1463 |
| 646 | Ga0395901_0001140 | 3300038443 | Bacteria | 28163 |
| 647 | Ga0436365_0412417 | 3300039437 | Bacteria | 3951 |
| 648 | Ga0436365_0594896 | 3300039437 | Bacteria | 715 |
| 649 | Ga0436365_1320901 | 3300039437 | Bacteria | 2137 |
| 650 | Ga0436360_0036559 | 3300039438 | Bacteria | 1229 |
| 651 | Ga0436360_1076493 | 3300039438 | Bacteria | 1174 |
| 652 | Ga0436361_0037487 | 3300039447 | Bacteria | 1553 |
| 653 | Ga0436361_0223467 | 3300039447 | Bacteria | 9217 |
| 654 | Ga0436363_0805533 | 3300039450 | Bacteria | 51825 |
| 655 | Ga0436363_1501310 | 3300039450 | Bacteria | 891 |
| 656 | Ga0436362_0823064 | 3300039453 | Bacteria | 1143 |
| 657 | Ga0436362_0828385 | 3300039453 | Bacteria | 714 |
| 658 | Ga0436362_1291930 | 3300039453 | Bacteria | 1092 |
| 659 | Ga0451797_1243763 | 3300041453 | Bacteria | 955 |
| 660 | Ga0451802_0867806 | 3300041460 | Bacteria | 906 |
| 661 | Ga0451849_1354144 | 3300041505 | Bacteria | 966 |
| 662 | Ga0451855_0825867 | 3300041511 | Unclassified | 756 |
| 663 | Ga0451853_1152909 | 3300041512 | Bacteria | 2613 |
| 664 | Ga0451853_2595326 | 3300041512 | Bacteria | 1390 |
| 665 | Ga0451577_0002721 | 3300042876 | Bacteria | 20559 |
| 666 | Ga0451577_0004444 | 3300042876 | Bacteria | 14807 |
| 667 | Ga0451577_0026279 | 3300042876 | Bacteria | 5274 |
| 668 | Ga0466969_0002360 | 3300044656 | Bacteria | 10094 |
| 669 | Ga0466969_0020644 | 3300044656 | Bacteria | 3409 |
| 670 | Ga0466969_0109521 | 3300044656 | Bacteria | 1294 |
| 671 | Ga0466966_0030263 | 3300044684 | Bacteria | 3515 |
| 672 | Ga0466966_0088634 | 3300044684 | Bacteria | 1922 |
| 673 | Ga0466966_0247844 | 3300044684 | Bacteria | 1073 |
| 674 | Ga0466961_0010893 | 3300044693 | Bacteria | 5808 |
| 675 | Ga0466961_0028311 | 3300044693 | Bacteria | 3602 |
| 676 | Ga0466961_0163205 | 3300044693 | Bacteria | 1388 |
| 677 | Ga0466963_0035075 | 3300044694 | Bacteria | 3267 |
| 678 | Ga0466963_0092858 | 3300044694 | Bacteria | 2057 |
| 679 | Ga0466963_0170263 | 3300044694 | Bacteria | 1518 |
| 680 | Ga0453684_0008872 | 3300044712 | Bacteria | 17813 |
| 681 | Ga0453684_0009766 | 3300044712 | Bacteria | 16663 |
| 682 | Ga0453684_0020745 | 3300044712 | Bacteria | 9885 |
| 683 | Ga0453684_0476512 | 3300044712 | Bacteria | 1385 |
| 684 | Ga0466971_0000154 | 3300044719 | Bacteria | 25646 |
| 685 | Ga0466971_0010789 | 3300044719 | Bacteria | 3996 |
| 686 | Ga0466971_0073475 | 3300044719 | Bacteria | 1554 |
| 687 | Ga0466957_0010209 | 3300044842 | Bacteria | 5379 |
| 688 | Ga0466957_0068108 | 3300044842 | Bacteria | 2197 |
| 689 | Ga0466957_0250875 | 3300044842 | Bacteria | 1177 |
| 690 | Ga0466960_0080621 | 3300044901 | Bacteria | 1639 |
| 691 | Ga0466959_0006560 | 3300045049 | Bacteria | 8075 |
| 692 | Ga0466959_0026879 | 3300045049 | Bacteria | 4268 |
| 693 | Ga0466959_0622582 | 3300045049 | Bacteria | 725 |
| 694 | Ga0451576_0007064 | 3300045051 | Bacteria | 13567 |
| 695 | Ga0451576_0265807 | 3300045051 | Bacteria | 1793 |
| 696 | Ga0466958_0004946 | 3300045836 | Bacteria | 7110 |
| 697 | Ga0466967_0435595 | 3300045976 | Bacteria | 1279 |
| 698 | Ga0495592_0011617 | 3300046454 | Bacteria | 6668 |
| 699 | Ga0495592_0308563 | 3300046454 | Bacteria | 1026 |
| 700 | Ga0495629_0145363 | 3300046459 | Bacteria | 1649 |
| 701 | Ga0495638_0007463 | 3300046460 | Bacteria | 7836 |
| 702 | Ga0495651_0006018 | 3300046462 | Bacteria | 9263 |
| 703 | Ga0495580_0140279 | 3300046472 | Unclassified | 1675 |
| 704 | Ga0495582_0155162 | 3300046473 | Bacteria | 1301 |
| 705 | Ga0495639_0281018 | 3300046475 | Bacteria | 827 |
| 706 | Ga0495664_0093820 | 3300046477 | Bacteria | 1806 |
| 707 | Ga0495584_0412390 | 3300046491 | Bacteria | 687 |
| 708 | Ga0495608_0014836 | 3300046511 | Bacteria | 5406 |
| 709 | Ga0495618_0374164 | 3300046514 | Bacteria | 875 |
| 710 | Ga0495628_0203930 | 3300046516 | Bacteria | 1489 |
| 711 | Ga0495628_0430483 | 3300046516 | Bacteria | 960 |
| 712 | Ga0495630_0687006 | 3300046517 | Unclassified | 783 |
| 713 | Ga0495652_0001107 | 3300046529 | Bacteria | 30520 |
| 714 | Ga0495621_0088620 | 3300046539 | Bacteria | 1164 |
| 715 | Ga0495645_0156182 | 3300046543 | Bacteria | 1580 |
| 716 | Ga0495667_0002634 | 3300046559 | Bacteria | 11984 |
| 717 | Ga0495656_0110278 | 3300046615 | Bacteria | 1286 |
| 718 | Ga0495634_0132612 | 3300046642 | Bacteria | 1587 |
| 719 | Ga0495635_0059579 | 3300046663 | Bacteria | 2625 |
| 720 | Ga0495588_0161338 | 3300046674 | Bacteria | 1186 |
| 721 | Ga0495657_0002235 | 3300046675 | Bacteria | 16391 |
| 722 | Ga0495599_0262802 | 3300046678 | Bacteria | 1048 |
| 723 | Ga0495623_0288585 | 3300046679 | Bacteria | 910 |
| 724 | Ga0495646_0015096 | 3300046680 | Bacteria | 4907 |
| 725 | Ga0495647_0247522 | 3300046681 | Bacteria | 793 |
| 726 | Ga0495658_0047886 | 3300046683 | Bacteria | 2409 |
| 727 | Ga0495613_0010774 | 3300046689 | Bacteria | 6783 |
| 728 | Ga0495613_0326137 | 3300046689 | Bacteria | 1059 |
| 729 | Ga0495600_0033115 | 3300046809 | Bacteria | 3354 |
| 730 | Ga0495600_0440679 | 3300046809 | Bacteria | 806 |
| 731 | Ga0495674_0131414 | 3300047319 | Bacteria | 2109 |
| 732 | Ga0495674_0521780 | 3300047319 | Bacteria | 948 |
| 733 | Ga0495676_0326088 | 3300047321 | Bacteria | 1031 |
| 734 | Ga0495680_0096004 | 3300047322 | Bacteria | 2215 |
| 735 | Ga0495675_0047311 | 3300047444 | Bacteria | 2737 |
| 736 | Ga0495675_0173012 | 3300047444 | Bacteria | 1325 |
| 737 | Ga0495677_0174206 | 3300047445 | Bacteria | 833 |
| 738 | Ga0495684_0113314 | 3300047471 | Bacteria | 2045 |
| 739 | Ga0495602_0056089 | 3300048088 | Bacteria | 3467 |
| 740 | Ga0495602_0114003 | 3300048088 | Bacteria | 2190 |
| 741 | Ga0496100_0002656 | 3300048903 | Bacteria | 9115 |
| 742 | Ga0496100_0065121 | 3300048903 | Bacteria | 2414 |
| 743 | Ga0496100_0748985 | 3300048903 | Bacteria | 764 |
| 744 | Ga0496101_0331298 | 3300048904 | Bacteria | 1195 |
| 745 | Ga0496102_0004755 | 3300048905 | Bacteria | 11494 |
| 746 | Ga0496102_0158676 | 3300048905 | Bacteria | 2127 |
| 747 | Ga0496103_0011593 | 3300048906 | Bacteria | 5227 |
| 748 | Ga0496103_0180384 | 3300048906 | Bacteria | 1357 |
| 749 | Ga0496103_0474459 | 3300048906 | Bacteria | 801 |
| 750 | Ga0496104_0000004 | 3300048907 | Bacteria | 641830 |
| 751 | Ga0496104_0062014 | 3300048907 | Bacteria | 3545 |
| 752 | Ga0496105_0000001 | 3300048908 | Bacteria | 1328178 |
| 753 | Ga0496105_0047865 | 3300048908 | Bacteria | 3528 |
| 754 | Ga0496107_0004422 | 3300048910 | Bacteria | 9527 |
| 755 | Ga0496108_0011228 | 3300048911 | Bacteria | 7276 |
| 756 | Ga0496108_0014324 | 3300048911 | Bacteria | 6473 |
| 757 | Ga0496109_0000115 | 3300048912 | Bacteria | 82707 |
| 758 | Ga0496109_0010805 | 3300048912 | Bacteria | 7816 |
| 759 | Ga0496109_0330696 | 3300048912 | Bacteria | 1439 |
| 760 | Ga0496109_0511940 | 3300048912 | Bacteria | 1133 |
| 761 | Ga0496109_0519282 | 3300048912 | Bacteria | 1124 |
| 762 | Ga0496110_0008225 | 3300048913 | Bacteria | 8384 |
| 763 | Ga0496112_0006052 | 3300048915 | Bacteria | 10566 |
| 764 | Ga0496112_0083212 | 3300048915 | Unclassified | 3165 |
| 765 | Ga0496114_0789523 | 3300048917 | Bacteria | 828 |
| 766 | Ga0496115_0000012 | 3300048918 | Bacteria | 215509 |
| 767 | Ga0496115_0000017 | 3300048918 | Bacteria | 185702 |
| 768 | Ga0496116_0000360 | 3300048919 | Bacteria | 70849 |
| 769 | Ga0496116_0118744 | 3300048919 | Bacteria | 1535 |
| 770 | Ga0496116_0163150 | 3300048919 | Bacteria | 1219 |
| 771 | Ga0496117_0045326 | 3300048920 | Bacteria | 3177 |
| 772 | Ga0496118_0001416 | 3300048921 | Bacteria | 36186 |
| 773 | Ga0496118_0015490 | 3300048921 | Bacteria | 7055 |
| 774 | Ga0496118_0093331 | 3300048921 | Bacteria | 2062 |
| 775 | Ga0496118_0094965 | 3300048921 | Bacteria | 2037 |
| 776 | Ga0496119_0003375 | 3300048922 | Bacteria | 16614 |
| 777 | Ga0496119_0019417 | 3300048922 | Bacteria | 5007 |
| 778 | Ga0496119_0124658 | 3300048922 | Bacteria | 1411 |
| 779 | Ga0496119_0216138 | 3300048922 | Bacteria | 983 |
| 780 | Ga0496120_0008036 | 3300048923 | Bacteria | 7760 |
| 781 | Ga0496120_0216837 | 3300048923 | Bacteria | 917 |
| 782 | Ga0496121_0021569 | 3300048924 | Bacteria | 6302 |
| 783 | Ga0496121_0176915 | 3300048924 | Bacteria | 1544 |
| 784 | Ga0496124_0080587 | 3300048927 | Bacteria | 2678 |
| 785 | Ga0496124_0209001 | 3300048927 | Bacteria | 1478 |
| 786 | Ga0496125_0017162 | 3300048928 | Bacteria | 6918 |
| 787 | Ga0496125_0162238 | 3300048928 | Bacteria | 1516 |
| 788 | Ga0496126_0160626 | 3300048929 | Bacteria | 1920 |
| 789 | Ga0501031_0000672 | 3300049568 | Bacteria | 20373 |
| 790 | Ga0501031_0022901 | 3300049568 | Bacteria | 4074 |
| 791 | Ga0501031_0077876 | 3300049568 | Bacteria | 2159 |
| 792 | Ga0501031_0081159 | 3300049568 | Bacteria | 2114 |
| 793 | Ga0501031_0129227 | 3300049568 | Archaea | 1650 |
| 794 | Ga0501031_0176225 | 3300049568 | Bacteria | 1397 |
| 795 | Ga0501032_0000408 | 3300049569 | Bacteria | 35429 |
| 796 | Ga0501032_0001581 | 3300049569 | Bacteria | 18150 |
| 797 | Ga0501032_0030727 | 3300049569 | Bacteria | 3686 |
| 798 | Ga0501032_0070393 | 3300049569 | Bacteria | 2333 |
| 799 | Ga0501032_0542727 | 3300049569 | Bacteria | 741 |
| 800 | Ga0501033_0002830 | 3300049570 | Bacteria | 14532 |
| 801 | Ga0501033_0009823 | 3300049570 | Bacteria | 7345 |
| 802 | Ga0501034_0002858 | 3300049571 | Bacteria | 20122 |
| 803 | Ga0501034_0004186 | 3300049571 | Bacteria | 16102 |
| 804 | Ga0501034_0038297 | 3300049571 | Bacteria | 4856 |
| 805 | Ga0501034_0079277 | 3300049571 | Bacteria | 3288 |
| 806 | Ga0501034_0093021 | 3300049571 | Bacteria | 3012 |
| 807 | Ga0501034_0562069 | 3300049571 | Bacteria | 1049 |
| 808 | Ga0501036_0006356 | 3300049572 | Bacteria | 9590 |
| 809 | Ga0501036_0013492 | 3300049572 | Bacteria | 6790 |
| 810 | Ga0501036_0013729 | 3300049572 | Bacteria | 6734 |
| 811 | Ga0501036_0212006 | 3300049572 | Bacteria | 1627 |
| 812 | Ga0501037_0002310 | 3300049573 | Bacteria | 13771 |
| 813 | Ga0501037_0003119 | 3300049573 | Bacteria | 12014 |
| 814 | Ga0501037_0541080 | 3300049573 | Unclassified | 787 |
| 815 | Ga0501037_0584544 | 3300049573 | Bacteria | 751 |
| 816 | Ga0501038_0002847 | 3300049574 | Bacteria | 16103 |
| 817 | Ga0501038_0003709 | 3300049574 | Bacteria | 14236 |
| 818 | Ga0501038_0027683 | 3300049574 | Bacteria | 5041 |
| 819 | Ga0501038_0213155 | 3300049574 | Bacteria | 1544 |
| 820 | Ga0501039_0012900 | 3300049575 | Bacteria | 6390 |
| 821 | Ga0501040_0202598 | 3300049576 | Bacteria | 1409 |
| 822 | Ga0501041_0020677 | 3300049577 | Bacteria | 3937 |
| 823 | Ga0501041_0155983 | 3300049577 | Bacteria | 1426 |
| 824 | Ga0501042_0154913 | 3300049578 | Bacteria | 1653 |
| 825 | Ga0501043_0001699 | 3300049579 | Bacteria | 19065 |
| 826 | Ga0501043_0023253 | 3300049579 | Bacteria | 4860 |
| 827 | Ga0501046_0000914 | 3300049580 | Bacteria | 28893 |
| 828 | Ga0501046_0134605 | 3300049580 | Bacteria | 1872 |
| 829 | Ga0501046_0401799 | 3300049580 | Bacteria | 990 |
| 830 | Ga0501047_0001308 | 3300049581 | Bacteria | 24558 |
| 831 | Ga0501047_0012908 | 3300049581 | Bacteria | 7914 |
| 832 | Ga0501047_0013835 | 3300049581 | Bacteria | 7660 |
| 833 | Ga0501047_0031159 | 3300049581 | Bacteria | 5143 |
| 834 | Ga0501047_0089254 | 3300049581 | Bacteria | 2960 |
| 835 | Ga0501047_0354987 | 3300049581 | Bacteria | 1302 |
| 836 | Ga0501048_0000126 | 3300049582 | Bacteria | 44703 |
| 837 | Ga0501048_0020915 | 3300049582 | Bacteria | 4793 |
| 838 | Ga0501048_0190486 | 3300049582 | Bacteria | 1453 |
| 839 | Ga0501048_0540764 | 3300049582 | Bacteria | 836 |
| 840 | Ga0501048_0708063 | 3300049582 | Bacteria | 723 |
| 841 | Ga0501067_0000587 | 3300049583 | Bacteria | 19598 |
| 842 | Ga0501067_0003173 | 3300049583 | Bacteria | 9073 |
| 843 | Ga0501068_0001780 | 3300049584 | Bacteria | 11457 |
| 844 | Ga0501068_0042478 | 3300049584 | Bacteria | 2734 |
| 845 | Ga0501069_0000824 | 3300049585 | Bacteria | 14643 |
| 846 | Ga0501069_0036206 | 3300049585 | Bacteria | 2720 |
| 847 | Ga0501069_0155096 | 3300049585 | Bacteria | 1317 |
| 848 | Ga0501070_0002563 | 3300049586 | Bacteria | 15897 |
| 849 | Ga0501070_0085405 | 3300049586 | Bacteria | 2613 |
| 850 | Ga0501070_0247057 | 3300049586 | Bacteria | 1460 |
| 851 | Ga0501071_0001042 | 3300049587 | Bacteria | 15352 |
| 852 | Ga0501071_0090453 | 3300049587 | Bacteria | 2247 |
| 853 | Ga0501071_0166152 | 3300049587 | Bacteria | 1651 |
| 854 | Ga0501072_0064051 | 3300049588 | Bacteria | 2899 |
| 855 | Ga0501072_0234297 | 3300049588 | Bacteria | 1462 |
| 856 | Ga0501072_0364895 | 3300049588 | Bacteria | 1146 |
| 857 | Ga0501073_0015155 | 3300049589 | Bacteria | 5592 |
| 858 | Ga0501073_0016821 | 3300049589 | Bacteria | 5298 |
| 859 | Ga0501073_0028840 | 3300049589 | Bacteria | 3965 |
| 860 | Ga0501073_0085973 | 3300049589 | Bacteria | 2187 |
| 861 | Ga0501074_0001349 | 3300049590 | Bacteria | 16261 |
| 862 | Ga0501074_0057911 | 3300049590 | Bacteria | 2792 |
| 863 | Ga0501074_0067643 | 3300049590 | Bacteria | 2568 |
| 864 | Ga0501074_0277971 | 3300049590 | Bacteria | 1190 |
| 865 | Ga0501075_0632972 | 3300049591 | Bacteria | 816 |
| 866 | Ga0501076_0009291 | 3300049592 | Bacteria | 7254 |
| 867 | Ga0501076_0138681 | 3300049592 | Bacteria | 1975 |
| 868 | Ga0501076_0201820 | 3300049592 | Bacteria | 1624 |
| 869 | Ga0501076_0324659 | 3300049592 | Bacteria | 1262 |
| 870 | Ga0501077_0022038 | 3300049593 | Bacteria | 4035 |
| 871 | Ga0501077_0041532 | 3300049593 | Bacteria | 2927 |
| 872 | Ga0501249_069821 | 3300049679 | Bacteria | 820 |
| 873 | Ga0501225_0051255 | 3300049705 | Bacteria | 1149 |
| 874 | Ga0501079_0003550 | 3300049741 | Bacteria | 11467 |
| 875 | Ga0501079_0309114 | 3300049741 | Bacteria | 1237 |
| 876 | Ga0501079_0377251 | 3300049741 | Bacteria | 1112 |
| 877 | Ga0501079_0506649 | 3300049741 | Bacteria | 949 |
| 878 | Ga0501080_0000390 | 3300049742 | Bacteria | 33829 |
| 879 | Ga0501080_0010505 | 3300049742 | Bacteria | 8477 |
| 880 | Ga0501080_0035034 | 3300049742 | Bacteria | 4686 |
| 881 | Ga0501081_0681531 | 3300049743 | Bacteria | 771 |
| 882 | Ga0501083_0014925 | 3300049744 | Bacteria | 5434 |
| 883 | Ga0501083_0026462 | 3300049744 | Bacteria | 4009 |
| 884 | Ga0501083_0027635 | 3300049744 | Bacteria | 3913 |
| 885 | Ga0501083_0058815 | 3300049744 | Bacteria | 2571 |
| 886 | Ga0501083_0096375 | 3300049744 | Bacteria | 1952 |
| 887 | Ga0501035_0001653 | 3300049822 | Bacteria | 22528 |
| 888 | Ga0501035_0010137 | 3300049822 | Bacteria | 8745 |
| 889 | Ga0501035_0064080 | 3300049822 | Bacteria | 3267 |
| 890 | Ga0501035_0194050 | 3300049822 | Bacteria | 1745 |
| 891 | Ga0501035_0808261 | 3300049822 | Bacteria | 748 |
| 892 | Ga0501044_0003244 | 3300049823 | Bacteria | 18288 |
| 893 | Ga0501044_0006361 | 3300049823 | Bacteria | 13055 |
| 894 | Ga0501044_0185619 | 3300049823 | Bacteria | 2045 |
| 895 | Ga0501044_0616789 | 3300049823 | Bacteria | 977 |
| 896 | Ga0501044_0647063 | 3300049823 | Bacteria | 946 |
| 897 | Ga0501044_0673821 | 3300049823 | Bacteria | 921 |
| 898 | Ga0501044_0693920 | 3300049823 | Bacteria | 904 |
| 899 | Ga0501045_0012395 | 3300049824 | Bacteria | 6004 |
| 900 | Ga0501045_0016471 | 3300049824 | Bacteria | 5252 |
| 901 | Ga0501045_0044941 | 3300049824 | Bacteria | 3217 |
| 902 | Ga0501045_0189622 | 3300049824 | Bacteria | 1532 |
| 903 | nmdc:mga03683_44275_c1 | 3300050489 | Bacteria | 1839 |
| 904 | nmdc:mga00v17_489556_c1 | 3300050491 | Bacteria | 797 |
| 905 | nmdc:mga00v17_8262_c1 | 3300050491 | Bacteria | 5600 |
| 906 | nmdc:mga0yw44_1545_c1 | 3300050492 | Bacteria | 9211 |
| 907 | nmdc:mga0yw44_33003_c1 | 3300050492 | Bacteria | 3021 |
| 908 | nmdc:mga0k408_1062_c1 | 3300050493 | Bacteria | 15089 |
| 909 | nmdc:mga0k408_188523_c1 | 3300050493 | Bacteria | 1230 |
| 910 | nmdc:mga06z11_1317_c1 | 3300050494 | Bacteria | 9184 |
| 911 | nmdc:mga04h51_3149_c1 | 3300050495 | Bacteria | 3980 |
| 912 | nmdc:mga07m45_26566_c1 | 3300050496 | Bacteria | 3183 |
| 913 | nmdc:mga05p37_116979_c1 | 3300050507 | Bacteria | 3276 |
| 914 | nmdc:mga05p37_23148_c1 | 3300050507 | Bacteria | 7537 |
| 915 | nmdc:mga05p37_3488_c1 | 3300050507 | Bacteria | 18382 |
| 916 | nmdc:mga05p37_359038_c1 | 3300050507 | Bacteria | 1713 |
| 917 | nmdc:mga05p37_38094_c1 | 3300050507 | Bacteria | 5897 |
| 918 | nmdc:mga05p37_61598_c1 | 3300050507 | Bacteria | 4618 |
| 919 | nmdc:mga09592_161874_c1 | 3300050508 | Bacteria | 1933 |
| 920 | nmdc:mga09592_20362_c1 | 3300050508 | Bacteria | 5453 |
| 921 | nmdc:mga09592_212835_c1 | 3300050508 | Bacteria | 1675 |
| 922 | nmdc:mga09592_47249_c1 | 3300050508 | Bacteria | 3627 |
| 923 | nmdc:mga09592_57007_c1 | 3300050508 | Bacteria | 3301 |
| 924 | nmdc:mga09592_71456_c1 | 3300050508 | Bacteria | 2945 |
| 925 | nmdc:mga0qj67_187989_c1 | 3300050509 | Bacteria | 1678 |
| 926 | nmdc:mga0qj67_8930_c1 | 3300050509 | Bacteria | 7435 |
| 927 | nmdc:mga06r32_1524_c1 | 3300050510 | Bacteria | 20826 |
| 928 | nmdc:mga06r32_690619_c1 | 3300050510 | Bacteria | 987 |
| 929 | nmdc:mga08y16_133869_c1 | 3300050511 | Bacteria | 2576 |
| 930 | nmdc:mga08y16_144_c1 | 3300050511 | Bacteria | 61900 |
| 931 | nmdc:mga08y16_147890_c1 | 3300050511 | Bacteria | 2442 |
| 932 | nmdc:mga08y16_157527_c1 | 3300050511 | Bacteria | 2360 |
| 933 | nmdc:mga08y16_29841_c1 | 3300050511 | Bacteria | 5743 |
| 934 | nmdc:mga08y16_89758_c1 | 3300050511 | Bacteria | 3203 |
| 935 | nmdc:mga0n895_111492_c1 | 3300050512 | Bacteria | 2752 |
| 936 | nmdc:mga0n895_27653_c1 | 3300050512 | Bacteria | 5390 |
| 937 | nmdc:mga0n895_813980_c1 | 3300050512 | Bacteria | 924 |
| 938 | nmdc:mga0rr50_32276_c1 | 3300050513 | Bacteria | 3730 |
| 939 | nmdc:mga0rr50_55280_c1 | 3300050513 | Bacteria | 2961 |
| 940 | nmdc:mga08x19_710179_c1 | 3300050514 | Unclassified | 713 |
| 941 | nmdc:mga0a205_32741_c1 | 3300050515 | Bacteria | 4983 |
| 942 | nmdc:mga0a205_56771_c1 | 3300050515 | Bacteria | 3780 |
| 943 | nmdc:mga0a205_817910_c1 | 3300050515 | Bacteria | 779 |
| 944 | nmdc:mga0a205_890755_c1 | 3300050515 | Bacteria | 737 |
| 945 | nmdc:mga0a205_89306_c1 | 3300050515 | Bacteria | 2979 |
| 946 | nmdc:mga0sz30_98124_c1 | 3300050516 | Bacteria | 1278 |
| 947 | Ga0495601_0079115 | 3300053077 | Bacteria | 2107 |
| 948 | Ga0495601_0099111 | 3300053077 | Bacteria | 1881 |
| 949 | Ga0495612_0004589 | 3300053078 | Bacteria | 5727 |
| 950 | Ga0495619_0000037 | 3300053085 | Bacteria | 124007 |
| 951 | Ga0495619_0035313 | 3300053085 | Bacteria | 3251 |
| 952 | Ga0495619_0310845 | 3300053085 | Bacteria | 1091 |
| 953 | Ga0500566_0005610 | 3300053094 | Bacteria | 7453 |
| 954 | Ga0500566_0124061 | 3300053094 | Bacteria | 1389 |
| 955 | Ga0500595_026833 | 3300053119 | Bacteria | 1980 |
| 956 | Ga0501084_0000570 | 3300054114 | Bacteria | 28154 |
| 957 | Ga0501084_0012755 | 3300054114 | Bacteria | 6961 |
| 958 | Ga0501084_0150022 | 3300054114 | Bacteria | 1965 |
| 959 | Ga0501084_0376445 | 3300054114 | Bacteria | 1200 |
| 960 | Ga0501084_0381214 | 3300054114 | Bacteria | 1192 |
| 961 | Ga0501082_0014056 | 3300060353 | Bacteria | 6885 |
| 962 | Ga0501082_0031185 | 3300060353 | Bacteria | 4595 |
| 963 | Ga0501082_0091084 | 3300060353 | Bacteria | 2633 |
| 964 | Ga0501082_0240646 | 3300060353 | Bacteria | 1575 |
| 965 | Ga0501082_0613535 | 3300060353 | Bacteria | 952 |
| 966 | Ga0466962_0000909 | 3300061719 | Bacteria | 13428 |
| 967 | Ga0466962_0145483 | 3300061719 | Bacteria | 1149 |
| 968 | Ga0530510_0059141 | 3300061734 | Bacteria | 2772 |
| 969 | Ga0530510_0221702 | 3300061734 | Bacteria | 1406 |
| 970 | 2522548016 | 2522125168 | Bacteria | 7376607 |
| 971 | 2730135315 | 2728369359 | Bacteria | 5621728 |
| 972 | 2739616828 | 2739367656 | Bacteria | 5152243 |
| 973 | 2875392641 | 2875391855 | Bacteria | 7600475 |
| 974 | 2904595484 | 2904595352 | Bacteria | 6124848 |
| 975 | 2939705239 | 2939702853 | Bacteria | 5139229 |
| 976 | Ga0070706_100112996 | |||
| 977 | rootH1_10077023 | |||
| 978 | rootH2_10058891 | |||
| 979 | rootL2_10318583 | |||
| 980 | Ga0055536_1005846 | |||
| 981 | Ga0055531_10000087 | |||
| 982 | Ga0065165_1000396 | |||
| 983 | Ga0065704_10282964 | |||
| 984 | Ga0065712_10133099 | |||
| 985 | Ga0070658_10161126 | |||
| 986 | Ga0070658_10191294 | |||
| 987 | Ga0070676_10446797 | |||
| 988 | Ga0070683_100002001 | |||
| 989 | Ga0070683_100029658 | |||
| 990 | Ga0070683_100045091 | |||
| 991 | Ga0070683_100066475 | |||
| 992 | Ga0070690_100016725 | |||
| 993 | Ga0070690_100062514 | |||
| 994 | Ga0070690_100218685 | |||
| 995 | Ga0070670_100000207 | |||
| 996 | Ga0070670_100762691 | |||
| 997 | Ga0068869_100146319 | |||
| 998 | Ga0068869_100204435 | |||
| 999 | Ga0068869_100549970 | |||
| 1000 | Ga0068869_100637539 | |||
| 1001 | Ga0070666_10003775 | |||
| 1002 | Ga0070666_10056449 | |||
| 1003 | Ga0070666_10104433 | |||
| 1004 | Ga0070680_100000851 | |||
| 1005 | Ga0070680_100101365 | |||
| 1006 | Ga0070680_100537881 | |||
| 1007 | Ga0070682_100428117 | |||
| 1008 | Ga0068868_100000724 | |||
| 1009 | Ga0068868_100075031 | |||
| 1010 | Ga0068868_100155897 | |||
| 1011 | Ga0068868_100367217 | |||
| 1012 | Ga0070660_100011360 | |||
| 1013 | Ga0070660_100024216 | |||
| 1014 | Ga0070689_100139540 | |||
| 1015 | Ga0070689_100162576 | |||
| 1016 | Ga0070691_10282498 | |||
| 1017 | Ga0070687_100038225 | |||
| 1018 | Ga0070687_100419492 | |||
| 1019 | Ga0070661_100012774 | |||
| 1020 | Ga0070661_100015958 | |||
| 1021 | Ga0070661_100044366 | |||
| 1022 | Ga0070692_10001566 | |||
| 1023 | Ga0070692_10013844 | |||
| 1024 | Ga0070668_100062267 | |||
| 1025 | Ga0070668_100156042 | |||
| 1026 | Ga0070669_100075250 | |||
| 1027 | Ga0070669_100111541 | |||
| 1028 | Ga0070675_100038493 | |||
| 1029 | Ga0070675_100045451 | |||
| 1030 | Ga0070675_100165680 | |||
| 1031 | Ga0070671_100034456 | |||
| 1032 | Ga0070671_100066279 | |||
| 1033 | Ga0070674_100076211 | |||
| 1034 | Ga0070688_100001589 | |||
| 1035 | Ga0070688_100119157 | |||
| 1036 | Ga0070659_100001330 | |||
| 1037 | Ga0070659_100033625 | |||
| 1038 | Ga0070667_100050175 | |||
| 1039 | Ga0070667_100050393 | |||
| 1040 | Ga0070709_10200179 | |||
| 1041 | Ga0070709_10226004 | |||
| 1042 | Ga0070714_100000998 | |||
| 1043 | Ga0070714_100021407 | |||
| 1044 | Ga0070714_100439629 | |||
| 1045 | Ga0070714_101126792 | |||
| 1046 | Ga0070713_100001968 | |||
| 1047 | Ga0070713_100023666 | |||
| 1048 | Ga0070713_100104464 | |||
| 1049 | Ga0070713_100121628 | |||
| 1050 | Ga0070713_100164656 | |||
| 1051 | Ga0070713_100360319 | |||
| 1052 | Ga0070713_100424601 | |||
| 1053 | Ga0070710_10035057 | |||
| 1054 | Ga0070701_10062407 | |||
| 1055 | Ga0070701_10089205 | |||
| 1056 | Ga0070711_100129753 | |||
| 1057 | Ga0070711_100160625 | |||
| 1058 | Ga0070711_100177488 | |||
| 1059 | Ga0070711_100266410 | |||
| 1060 | Ga0070711_100715461 | |||
| 1061 | Ga0070705_100042378 | |||
| 1062 | Ga0070705_100234203 | |||
| 1063 | Ga0070705_100857552 | |||
| 1064 | Ga0070700_100006126 | |||
| 1065 | Ga0070700_100109996 | |||
| 1066 | Ga0070694_100064846 | |||
| 1067 | Ga0070708_100002773 | |||
| 1068 | Ga0070708_100897006 | |||
| 1069 | Ga0070663_100003770 | |||
| 1070 | Ga0070663_100670193 | |||
| 1071 | Ga0070678_100043278 | |||
| 1072 | Ga0070678_100054608 | |||
| 1073 | Ga0070678_100297636 | |||
| 1074 | Ga0070678_101219724 | |||
| 1075 | Ga0070662_100002142 | |||
| 1076 | Ga0070681_10000229 | |||
| 1077 | Ga0070681_10006386 | |||
| 1078 | Ga0070681_10107572 | |||
| 1079 | Ga0070681_10169999 | |||
| 1080 | Ga0070681_10238924 | |||
| 1081 | Ga0068867_100022943 | |||
| 1082 | Ga0068867_100078397 | |||
| 1083 | Ga0068867_100521761 | |||
| 1084 | Ga0070685_10001752 | |||
| 1085 | Ga0070685_10113659 | |||
| 1086 | Ga0070706_100002983 | |||
| 1087 | Ga0070706_100039185 | |||
| 1088 | Ga0070707_100002460 | |||
| 1089 | Ga0070707_100479089 | |||
| 1090 | Ga0070698_100004516 | |||
| 1091 | Ga0070698_100014925 | |||
| 1092 | Ga0070698_101021314 | |||
| 1093 | Ga0070699_100012919 | |||
| 1094 | Ga0070679_100000982 | |||
| 1095 | Ga0070679_100001940 | |||
| 1096 | Ga0070679_100028311 | |||
| 1097 | Ga0070679_100036311 | |||
| 1098 | Ga0070679_100159288 | |||
| 1099 | Ga0070679_100220165 | |||
| 1100 | Ga0070679_100274896 | |||
| 1101 | Ga0070679_100989091 | |||
| 1102 | Ga0070684_100004657 | |||
| 1103 | Ga0070684_100024983 | |||
| 1104 | Ga0070684_100165626 | |||
| 1105 | Ga0070684_100384105 | |||
| 1106 | Ga0070684_100393209 | |||
| 1107 | Ga0070697_100019771 | |||
| 1108 | Ga0070697_100051147 | |||
| 1109 | Ga0070697_100079032 | |||
| 1110 | Ga0068853_100011034 | |||
| 1111 | Ga0068853_100738132 | |||
| 1112 | Ga0068853_100782799 | |||
| 1113 | Ga0070672_100002719 | |||
| 1114 | Ga0070672_100013963 | |||
| 1115 | Ga0070672_100064638 | |||
| 1116 | Ga0070672_100462153 | |||
| 1117 | Ga0070686_100008137 | |||
| 1118 | Ga0070686_100019718 | |||
| 1119 | Ga0070695_100004688 | |||
| 1120 | Ga0070695_100317512 | |||
| 1121 | Ga0070693_100018891 | |||
| 1122 | Ga0070693_100064150 | |||
| 1123 | Ga0070693_100165851 | |||
| 1124 | Ga0070693_100346207 | |||
| 1125 | Ga0070693_100478570 | |||
| 1126 | Ga0070665_100006697 | |||
| 1127 | Ga0070665_100207711 | |||
| 1128 | Ga0070704_100176196 | |||
| 1129 | Ga0070704_100206787 | |||
| 1130 | Ga0068855_100001344 | |||
| 1131 | Ga0068855_100016503 | |||
| 1132 | Ga0070664_100001854 | |||
| 1133 | Ga0070664_100028719 | |||
| 1134 | Ga0070664_100125856 | |||
| 1135 | Ga0070664_100152241 | |||
| 1136 | Ga0070664_100158028 | |||
| 1137 | Ga0070664_100700473 | |||
| 1138 | Ga0068857_100039760 | |||
| 1139 | Ga0068857_100103851 | |||
| 1140 | Ga0068857_100110624 | |||
| 1141 | Ga0068857_100195728 | |||
| 1142 | Ga0068857_100218093 | |||
| 1143 | Ga0068854_100020944 | |||
| 1144 | Ga0068854_100123766 | |||
| 1145 | Ga0068854_100524395 | |||
| 1146 | Ga0068856_100000269 | |||
| 1147 | Ga0068856_100001308 | |||
| 1148 | Ga0068856_100008504 | |||
| 1149 | Ga0068856_100088073 | |||
| 1150 | Ga0068856_100091155 | |||
| 1151 | Ga0068856_100174140 | |||
| 1152 | Ga0068856_100655858 | |||
| 1153 | Ga0068856_100732069 | |||
| 1154 | Ga0068856_100793496 | |||
| 1155 | Ga0070702_100024548 | |||
| 1156 | Ga0068852_100011008 | |||
| 1157 | Ga0068852_100025487 | |||
| 1158 | Ga0068859_100003024 | |||
| 1159 | Ga0068859_100110766 | |||
| 1160 | Ga0068859_100111197 | |||
| 1161 | Ga0068859_100211788 | |||
| 1162 | Ga0068859_100383983 | |||
| 1163 | Ga0068859_100956122 | |||
| 1164 | Ga0068864_100011330 | |||
| 1165 | Ga0068864_100029472 | |||
| 1166 | Ga0068864_100040860 | |||
| 1167 | Ga0068864_100089807 | |||
| 1168 | Ga0068864_100805718 | |||
| 1169 | Ga0068861_100015698 | |||
| 1170 | Ga0068861_100896479 | |||
| 1171 | Ga0068851_10175736 | |||
| 1172 | Ga0068870_10354194 | |||
| 1173 | Ga0068870_10606300 | |||
| 1174 | Ga0068863_100014094 | |||
| 1175 | Ga0068863_100041704 | |||
| 1176 | Ga0068863_100216470 | |||
| 1177 | Ga0068863_100333525 | |||
| 1178 | Ga0068863_100446634 | |||
| 1179 | Ga0068858_100019598 | |||
| 1180 | Ga0068858_100044626 | |||
| 1181 | Ga0068858_100102323 | |||
| 1182 | Ga0068858_100102729 | |||
| 1183 | Ga0068858_100247528 | |||
| 1184 | Ga0068858_100511347 | |||
| 1185 | Ga0068860_100043979 | |||
| 1186 | Ga0068860_100758300 | |||
| 1187 | Ga0068862_100056787 | |||
| 1188 | Ga0068862_100249051 | |||
| 1189 | Ga0068862_100251129 | |||
| 1190 | Ga0068862_100622536 | |||
| 1191 | Ga0081455_10008769 | |||
| 1192 | Ga0081455_10038588 | |||
| 1193 | Ga0081455_10098648 | |||
| 1194 | Ga0081538_10001123 | |||
| 1195 | Ga0081540_1000265 | |||
| 1196 | Ga0081540_1002544 | |||
| 1197 | Ga0081540_1157310 | |||
| 1198 | Ga0070717_10003751 | |||
| 1199 | Ga0070717_10019093 | |||
| 1200 | Ga0070717_10404830 | |||
| 1201 | Ga0070717_10687979 | |||
| 1202 | Ga0075365_10017319 | |||
| 1203 | Ga0075365_10033549 | |||
| 1204 | Ga0075365_10102791 | |||
| 1205 | Ga0075368_10022088 | |||
| 1206 | Ga0075368_10051889 | |||
| 1207 | Ga0075363_100046048 | |||
| 1208 | Ga0075364_10009991 | |||
| 1209 | Ga0070712_100153768 | |||
| 1210 | Ga0070712_100393437 | |||
| 1211 | Ga0075362_10011804 | |||
| 1212 | Ga0075367_10001445 | |||
| 1213 | Ga0075367_10072997 | |||
| 1214 | Ga0075366_10000307 | |||
| 1215 | Ga0075366_10176017 | |||
| 1216 | Ga0075366_10274793 | |||
| 1217 | Ga0097621_100001313 | |||
| 1218 | Ga0097621_100012438 | |||
| 1219 | Ga0097621_100051312 | |||
| 1220 | Ga0097621_100057803 | |||
| 1221 | Ga0097621_100220280 | |||
| 1222 | Ga0075370_10039897 | |||
| 1223 | Ga0068871_100000510 | |||
| 1224 | Ga0068871_100004430 | |||
| 1225 | Ga0068871_100077234 | |||
| 1226 | Ga0068871_100244101 | |||
| 1227 | Ga0068871_100252769 | |||
| 1228 | Ga0068871_100402814 | |||
| 1229 | Ga0075428_100004866 | |||
| 1230 | Ga0075428_100017204 | |||
| 1231 | Ga0075428_100039391 | |||
| 1232 | Ga0075428_100196176 | |||
| 1233 | Ga0075428_100511184 | |||
| 1234 | Ga0075428_100747221 | |||
| 1235 | Ga0075430_100002187 | |||
| 1236 | Ga0075430_100093313 | |||
| 1237 | Ga0075431_100001969 | |||
| 1238 | Ga0075431_100028616 | |||
| 1239 | Ga0075431_100043921 | |||
| 1240 | Ga0075431_100056908 | |||
| 1241 | Ga0075431_100320974 | |||
| 1242 | Ga0075433_10050269 | |||
| 1243 | Ga0075433_10057483 | |||
| 1244 | Ga0075434_100014876 | |||
| 1245 | Ga0075434_100101297 | |||
| 1246 | Ga0075434_100242385 | |||
| 1247 | Ga0075429_100005425 | |||
| 1248 | Ga0075429_100061721 | |||
| 1249 | Ga0075429_100106052 | |||
| 1250 | Ga0075429_100259404 | |||
| 1251 | Ga0075429_100515427 | |||
| 1252 | Ga0068865_100000278 | |||
| 1253 | Ga0068865_100054786 | |||
| 1254 | Ga0068865_100394495 | |||
| 1255 | Ga0075436_100133582 | |||
| 1256 | Ga0097620_100003024 | |||
| 1257 | Ga0097620_100110769 | |||
| 1258 | Ga0097620_100111192 | |||
| 1259 | Ga0097620_100211792 | |||
| 1260 | Ga0097620_100383977 | |||
| 1261 | Ga0097620_100956157 | |||
| 1262 | Ga0075435_100042467 | |||
| 1263 | Ga0075435_100075480 | |||
| 1264 | Ga0105240_10024854 | |||
| 1265 | Ga0105240_10046731 | |||
| 1266 | Ga0105240_10071285 | |||
| 1267 | Ga0105240_10072327 | |||
| 1268 | Ga0105240_10474392 | |||
| 1269 | Ga0111539_10001522 | |||
| 1270 | Ga0111539_10004893 | |||
| 1271 | Ga0111539_10020295 | |||
| 1272 | Ga0111539_10124142 | |||
| 1273 | Ga0111539_10131290 | |||
| 1274 | Ga0111539_10237972 | |||
| 1275 | Ga0105245_10001072 | |||
| 1276 | Ga0105245_10006775 | |||
| 1277 | Ga0105245_10257004 | |||
| 1278 | Ga0105245_10767243 | |||
| 1279 | Ga0105247_10255968 | |||
| 1280 | Ga0114129_10018514 | |||
| 1281 | Ga0114129_10020185 | |||
| 1282 | Ga0114129_10075416 | |||
| 1283 | Ga0114129_10127258 | |||
| 1284 | Ga0114129_10128563 | |||
| 1285 | Ga0114129_10313351 | |||
| 1286 | Ga0114129_10390841 | |||
| 1287 | Ga0105243_10003742 | |||
| 1288 | Ga0105243_10009769 | |||
| 1289 | Ga0105241_10092768 | |||
| 1290 | Ga0105241_10261739 | |||
| 1291 | Ga0105241_10391606 | |||
| 1292 | Ga0105241_10446339 | |||
| 1293 | Ga0105248_10000008 | |||
| 1294 | Ga0105248_10004704 | |||
| 1295 | Ga0105248_10093286 | |||
| 1296 | Ga0105248_10267500 | |||
| 1297 | Ga0105248_10819466 | |||
| 1298 | Ga0105237_10008678 | |||
| 1299 | Ga0105237_10038987 | |||
| 1300 | Ga0105237_10471748 | |||
| 1301 | Ga0105237_10871108 | |||
| 1302 | Ga0105237_10963486 | |||
| 1303 | Ga0105238_10000743 | |||
| 1304 | Ga0105238_10143194 | |||
| 1305 | Ga0105238_10172407 | |||
| 1306 | Ga0105238_10216549 | |||
| 1307 | Ga0105238_10263920 | |||
| 1308 | Ga0105238_10501006 | |||
| 1309 | Ga0105249_10067038 | |||
| 1310 | Ga0105239_10162831 | |||
| 1311 | Ga0105239_10265027 | |||
| 1312 | Ga0105239_10284433 | |||
| 1313 | Ga0105239_10720749 | |||
| 1314 | Ga0105239_10766630 | |||
| 1315 | Ga0105246_10080451 | |||
| 1316 | Ga0105246_10146247 | |||
| 1317 | Ga0105246_10399415 | |||
| 1318 | Ga0157373_10001156 | |||
| 1319 | Ga0157373_10005500 | |||
| 1320 | Ga0157373_10019021 | |||
| 1321 | Ga0157373_10391170 | |||
| 1322 | Ga0157371_10007405 | |||
| 1323 | Ga0157371_10048902 | |||
| 1324 | Ga0157370_10017755 | |||
| 1325 | Ga0157370_10330122 | |||
| 1326 | Ga0157370_10585898 | |||
| 1327 | Ga0157369_10003895 | |||
| 1328 | Ga0157369_10005857 | |||
| 1329 | Ga0157369_10006212 | |||
| 1330 | Ga0157369_10142685 | |||
| 1331 | Ga0157374_10000299 | |||
| 1332 | Ga0157374_10000673 | |||
| 1333 | Ga0157374_10117251 | |||
| 1334 | Ga0157374_10317779 | |||
| 1335 | Ga0157374_10399802 | |||
| 1336 | Ga0157374_10661082 | |||
| 1337 | Ga0157374_11129333 | |||
| 1338 | Ga0157378_10001436 | |||
| 1339 | Ga0157378_10062392 | |||
| 1340 | Ga0157378_10094349 | |||
| 1341 | Ga0157378_10825682 | |||
| 1342 | Ga0163162_10002123 | |||
| 1343 | Ga0163162_10150431 | |||
| 1344 | Ga0163162_11102838 | |||
| 1345 | Ga0157372_10001884 | |||
| 1346 | Ga0157372_10006669 | |||
| 1347 | Ga0157372_10012317 | |||
| 1348 | Ga0157372_10019286 | |||
| 1349 | Ga0157372_10135620 | |||
| 1350 | Ga0157372_10243090 | |||
| 1351 | Ga0157372_10269452 | |||
| 1352 | Ga0157372_10746042 | |||
| 1353 | Ga0157375_10010182 | |||
| 1354 | Ga0157375_10281333 | |||
| 1355 | Ga0163163_10008634 | |||
| 1356 | Ga0157380_10057403 | |||
| 1357 | Ga0157377_10078658 | |||
| 1358 | Ga0157377_10082872 | |||
| 1359 | Ga0157379_10149226 | |||
| 1360 | Ga0157379_10275650 | |||
| 1361 | Ga0157376_10042614 | |||
| 1362 | Ga0157376_10097705 | |||
| 1363 | Ga0157376_10343753 | |||
| 1364 | Ga0157376_11091258 | |||
| 1365 | Ga0206352_10810822 | |||
| 1366 | Ga0206354_10638829 | |||
| 1367 | Ga0206354_11335030 | |||
| 1368 | Ga0206353_10828775 | |||
| 1369 | Ga0206353_11254201 | |||
| 1370 | Ga0206353_11575633 | |||
| 1371 | Ga0213873_10057946 | |||
| 1372 | Ga0213873_10108185 | |||
| 1373 | Ga0213872_10010137 | |||
| 1374 | Ga0213872_10186564 | |||
| 1375 | Ga0213874_10006235 | |||
| 1376 | Ga0213876_10035356 | |||
| 1377 | Ga0213875_10245052 | |||
| 1378 | Ga0224712_10085856 | |||
| 1379 | Ga0209676_1000390 | |||
| 1380 | Ga0209257_1000006 | |||
| 1381 | Ga0207682_10059553 | |||
| 1382 | Ga0207692_10109217 | |||
| 1383 | Ga0207710_10000461 | |||
| 1384 | Ga0207688_10038104 | |||
| 1385 | Ga0207680_10006566 | |||
| 1386 | Ga0207680_10019201 | |||
| 1387 | Ga0207680_10344043 | |||
| 1388 | Ga0207647_10360618 | |||
| 1389 | Ga0207699_10128771 | |||
| 1390 | Ga0207645_10527808 | |||
| 1391 | Ga0207705_10030411 | |||
| 1392 | Ga0207705_10238238 | |||
| 1393 | Ga0207654_10291855 | |||
| 1394 | Ga0207654_10432580 | |||
| 1395 | Ga0207707_10014004 | |||
| 1396 | Ga0207707_10024724 | |||
| 1397 | Ga0207707_10040486 | |||
| 1398 | Ga0207707_10128590 | |||
| 1399 | Ga0207707_10202620 | |||
| 1400 | Ga0207707_10385766 | |||
| 1401 | Ga0207707_10584989 | |||
| 1402 | Ga0207695_10028344 | |||
| 1403 | Ga0207695_10041471 | |||
| 1404 | Ga0207695_10055642 | |||
| 1405 | Ga0207695_10409617 | |||
| 1406 | Ga0207671_10017218 | |||
| 1407 | Ga0207671_10021736 | |||
| 1408 | Ga0207693_10057358 | |||
| 1409 | Ga0207693_10228569 | |||
| 1410 | Ga0207663_10017300 | |||
| 1411 | Ga0207663_10038567 | |||
| 1412 | Ga0207663_10097229 | |||
| 1413 | Ga0207660_10062435 | |||
| 1414 | Ga0207660_10063532 | |||
| 1415 | Ga0207660_10091988 | |||
| 1416 | Ga0207660_10292424 | |||
| 1417 | Ga0207660_10432504 | |||
| 1418 | Ga0207657_10001043 | |||
| 1419 | Ga0207657_10006978 | |||
| 1420 | Ga0207649_10005811 | |||
| 1421 | Ga0207649_10026774 | |||
| 1422 | Ga0207649_10107598 | |||
| 1423 | Ga0207652_10000709 | |||
| 1424 | Ga0207652_10003467 | |||
| 1425 | Ga0207652_10023611 | |||
| 1426 | Ga0207652_10027875 | |||
| 1427 | Ga0207652_10091136 | |||
| 1428 | Ga0207652_10219796 | |||
| 1429 | Ga0207646_10004328 | |||
| 1430 | Ga0207681_10134285 | |||
| 1431 | Ga0207681_10143723 | |||
| 1432 | Ga0207681_10383007 | |||
| 1433 | Ga0207694_10002021 | |||
| 1434 | Ga0207694_10119877 | |||
| 1435 | Ga0207694_10304051 | |||
| 1436 | Ga0207694_10354626 | |||
| 1437 | Ga0207694_10390330 | |||
| 1438 | Ga0207694_10900454 | |||
| 1439 | Ga0207650_10002070 | |||
| 1440 | Ga0207650_10167985 | |||
| 1441 | Ga0207650_10280401 | |||
| 1442 | Ga0207659_10005700 | |||
| 1443 | Ga0207659_10218814 | |||
| 1444 | Ga0207687_10000031 | |||
| 1445 | Ga0207687_10005626 | |||
| 1446 | Ga0207700_10003644 | |||
| 1447 | Ga0207700_10076942 | |||
| 1448 | Ga0207700_10144481 | |||
| 1449 | Ga0207700_10344931 | |||
| 1450 | Ga0207700_10458460 | |||
| 1451 | Ga0207664_10128522 | |||
| 1452 | Ga0207664_10159740 | |||
| 1453 | Ga0207664_10270382 | |||
| 1454 | Ga0207644_10007623 | |||
| 1455 | Ga0207644_10077501 | |||
| 1456 | Ga0207690_10011048 | |||
| 1457 | Ga0207690_10039879 | |||
| 1458 | Ga0207690_10139836 | |||
| 1459 | Ga0207706_10006046 | |||
| 1460 | Ga0207686_10050823 | |||
| 1461 | Ga0207709_10009807 | |||
| 1462 | Ga0207670_10015123 | |||
| 1463 | Ga0207670_10053479 | |||
| 1464 | Ga0207704_10000224 | |||
| 1465 | Ga0207704_10012116 | |||
| 1466 | Ga0207704_10500292 | |||
| 1467 | Ga0207691_10014953 | |||
| 1468 | Ga0207691_10034869 | |||
| 1469 | Ga0207691_10291638 | |||
| 1470 | Ga0207711_10000006 | |||
| 1471 | Ga0207711_10003308 | |||
| 1472 | Ga0207711_10013477 | |||
| 1473 | Ga0207689_10192097 | |||
| 1474 | Ga0207689_10366554 | |||
| 1475 | Ga0207661_10009481 | |||
| 1476 | Ga0207661_10012272 | |||
| 1477 | Ga0207661_10035290 | |||
| 1478 | Ga0207661_10064139 | |||
| 1479 | Ga0207661_10344080 | |||
| 1480 | Ga0207679_10021834 | |||
| 1481 | Ga0207679_10157124 | |||
| 1482 | Ga0207679_10387965 | |||
| 1483 | Ga0207679_11079190 | |||
| 1484 | Ga0207667_10008046 | |||
| 1485 | Ga0207667_10027499 | |||
| 1486 | Ga0207667_10054673 | |||
| 1487 | Ga0207651_10078948 | |||
| 1488 | Ga0207651_10261584 | |||
| 1489 | Ga0207712_10033227 | |||
| 1490 | Ga0207668_10026483 | |||
| 1491 | Ga0207640_10248644 | |||
| 1492 | Ga0207640_10655170 | |||
| 1493 | Ga0207658_10105465 | |||
| 1494 | Ga0207658_10558350 | |||
| 1495 | Ga0207677_10000385 | |||
| 1496 | Ga0207677_10002302 | |||
| 1497 | Ga0207677_10090209 | |||
| 1498 | Ga0207677_10136772 | |||
| 1499 | Ga0207677_10393925 | |||
| 1500 | Ga0207703_10075473 | |||
| 1501 | Ga0207703_10091407 | |||
| 1502 | Ga0207703_10108045 | |||
| 1503 | Ga0207703_10313435 | |||
| 1504 | Ga0207703_10600090 | |||
| 1505 | Ga0207703_11170135 | |||
| 1506 | Ga0207639_10027869 | |||
| 1507 | Ga0207639_10163784 | |||
| 1508 | Ga0207639_10370730 | |||
| 1509 | Ga0207678_10000436 | |||
| 1510 | Ga0207678_10009284 | |||
| 1511 | Ga0207678_10034550 | |||
| 1512 | Ga0207678_10885844 | |||
| 1513 | Ga0207708_10002776 | |||
| 1514 | Ga0207708_10194459 | |||
| 1515 | Ga0207702_10000304 | |||
| 1516 | Ga0207702_10004007 | |||
| 1517 | Ga0207702_10033370 | |||
| 1518 | Ga0207702_10034868 | |||
| 1519 | Ga0207702_10066598 | |||
| 1520 | Ga0207702_10194518 | |||
| 1521 | Ga0207702_10205268 | |||
| 1522 | Ga0207702_10701597 | |||
| 1523 | Ga0207702_10836463 | |||
| 1524 | Ga0207641_10013721 | |||
| 1525 | Ga0207641_10058540 | |||
| 1526 | Ga0207641_10200440 | |||
| 1527 | Ga0207641_10340477 | |||
| 1528 | Ga0207641_10358455 | |||
| 1529 | Ga0207648_10001324 | |||
| 1530 | Ga0207648_10909541 | |||
| 1531 | Ga0207676_10017836 | |||
| 1532 | Ga0207676_10137029 | |||
| 1533 | Ga0207676_10350910 | |||
| 1534 | Ga0207676_10987855 | |||
| 1535 | Ga0207674_10023497 | |||
| 1536 | Ga0207674_10027671 | |||
| 1537 | Ga0207674_10088139 | |||
| 1538 | Ga0207674_10141236 | |||
| 1539 | Ga0207674_10160721 | |||
| 1540 | Ga0207674_10193320 | |||
| 1541 | Ga0207675_100008274 | |||
| 1542 | Ga0207675_100194822 | |||
| 1543 | Ga0207683_10051765 | |||
| 1544 | Ga0207683_10333286 | |||
| 1545 | Ga0207683_10467171 | |||
| 1546 | Ga0207698_10020509 | |||
| 1547 | Ga0207698_10248507 | |||
| 1548 | Ga0209813_10008133 | |||
| 1549 | Ga0209813_10126233 | |||
| 1550 | Ga0207428_10000032 | |||
| 1551 | Ga0207428_10147218 | |||
| 1552 | Ga0207428_10155814 | |||
| 1553 | Ga0207428_10195035 | |||
| 1554 | Ga0268266_10000114 | |||
| 1555 | Ga0268265_10046620 | |||
| 1556 | Ga0268265_10120344 | |||
| 1557 | Ga0268265_10389032 | |||
| 1558 | Ga0268264_10039968 | |||
| 1559 | Ga0268264_10056395 | |||
| 1560 | Ga0307511_10137685 | |||
| 1561 | Ga0307511_10280011 | |||
| 1562 | Ga0265327_10003797 | |||
| 1563 | Ga0307509_10043062 | |||
| 1564 | Ga0307509_10259619 | |||
| 1565 | Ga0307408_100088219 | |||
| 1566 | Ga0307408_100222095 | |||
| 1567 | Ga0307508_10041829 | |||
| 1568 | Ga0307514_10059318 | |||
| 1569 | Ga0316576_10015783 | |||
| 1570 | Ga0316576_10072009 | |||
| 1571 | Ga0316578_10002626 | |||
| 1572 | Ga0316578_10006327 | |||
| 1573 | Ga0307405_10150359 | |||
| 1574 | Ga0307405_10265501 | |||
| 1575 | Ga0316577_10001160 | |||
| 1576 | Ga0316577_10017999 | |||
| 1577 | Ga0307410_10035745 | |||
| 1578 | Ga0307406_10403739 | |||
| 1579 | Ga0307406_10896801 | |||
| 1580 | Ga0307412_10930658 | |||
| 1581 | Ga0307409_101011768 | |||
| 1582 | Ga0307409_101076497 | |||
| 1583 | Ga0307409_101494949 | |||
| 1584 | Ga0307416_100013675 | |||
| 1585 | Ga0307416_100077692 | |||
| 1586 | Ga0307414_10000794 | |||
| 1587 | Ga0307414_10297327 | |||
| 1588 | Ga0307414_11454626 | |||
| 1589 | Ga0307411_11277051 | |||
| 1590 | Ga0307415_100007983 | |||
| 1591 | Ga0307415_100699684 | |||
| 1592 | Ga0316580_10012229 | |||
| 1593 | Ga0307507_10000038 | |||
| 1594 | Ga0373936_0002576 | |||
| 1595 | Ga0373936_0015130 | |||
| 1596 | Ga0373956_0354633 | |||
| 1597 | Ga0373957_0012616 | |||
| 1598 | Ga0373957_0319091 | |||
| 1599 | Ga0373955_0077124 | |||
| 1600 | Ga0316574_0006666 | |||
| 1601 | Ga0316574_0096275 | |||
| 1602 | Ga0316574_0103860 | |||
| 1603 | Ga0373927_0167263 | |||
| 1604 | Ga0373947_0027384 | |||
| 1605 | Ga0373937_0006335 | |||
| 1606 | Ga0373937_0047105 | |||
| 1607 | Ga0373937_0070560 | |||
| 1608 | Ga0310109_000028 | |||
| 1609 | Ga0316582_0001621 | |||
| 1610 | Ga0316582_0006238 | |||
| 1611 | Ga0316582_0021318 | |||
| 1612 | Ga0316582_0407055 | |||
| 1613 | Ga0316584_0000394 | |||
| 1614 | Ga0316584_0002381 | |||
| 1615 | Ga0373925_0004880 | |||
| 1616 | Ga0373925_0185478 | |||
| 1617 | Ga0395898_0202186 | |||
| 1618 | Ga0395898_0247849 | |||
| 1619 | Ga0395905_0000147 | |||
| 1620 | Ga0436364_0850190 | |||
| 1621 | Ga0395901_0001140 | |||
| 1622 | Ga0436365_0412417 | |||
| 1623 | Ga0436365_0594896 | |||
| 1624 | Ga0436365_1320901 | |||
| 1625 | Ga0436360_0036559 | |||
| 1626 | Ga0436360_1076493 | |||
| 1627 | Ga0436361_0037487 | |||
| 1628 | Ga0436361_0223467 | |||
| 1629 | Ga0436363_0805533 | |||
| 1630 | Ga0436363_1501310 | |||
| 1631 | Ga0436362_0823064 | |||
| 1632 | Ga0436362_0828385 | |||
| 1633 | Ga0436362_1291930 | |||
| 1634 | Ga0451797_1243763 | |||
| 1635 | Ga0451802_0867806 | |||
| 1636 | Ga0451849_1354144 | |||
| 1637 | Ga0451855_0825867 | |||
| 1638 | Ga0451853_1152909 | |||
| 1639 | Ga0451853_2595326 | |||
| 1640 | Ga0451577_0002721 | |||
| 1641 | Ga0451577_0004444 | |||
| 1642 | Ga0451577_0026279 | |||
| 1643 | Ga0466969_0002360 | |||
| 1644 | Ga0466969_0020644 | |||
| 1645 | Ga0466969_0109521 | |||
| 1646 | Ga0466966_0030263 | |||
| 1647 | Ga0466966_0088634 | |||
| 1648 | Ga0466966_0247844 | |||
| 1649 | Ga0466961_0010893 | |||
| 1650 | Ga0466961_0028311 | |||
| 1651 | Ga0466961_0163205 | |||
| 1652 | Ga0466963_0035075 | |||
| 1653 | Ga0466963_0092858 | |||
| 1654 | Ga0466963_0170263 | |||
| 1655 | Ga0453684_0008872 | |||
| 1656 | Ga0453684_0009766 | |||
| 1657 | Ga0453684_0020745 | |||
| 1658 | Ga0453684_0476512 | |||
| 1659 | Ga0466971_0000154 | |||
| 1660 | Ga0466971_0010789 | |||
| 1661 | Ga0466971_0073475 | |||
| 1662 | Ga0466957_0010209 | |||
| 1663 | Ga0466957_0068108 | |||
| 1664 | Ga0466957_0250875 | |||
| 1665 | Ga0466960_0080621 | |||
| 1666 | Ga0466959_0006560 | |||
| 1667 | Ga0466959_0026879 | |||
| 1668 | Ga0466959_0622582 | |||
| 1669 | Ga0451576_0007064 | |||
| 1670 | Ga0451576_0265807 | |||
| 1671 | Ga0466958_0004946 | |||
| 1672 | Ga0466967_0435595 | |||
| 1673 | Ga0495592_0011617 | |||
| 1674 | Ga0495592_0308563 | |||
| 1675 | Ga0495629_0145363 | |||
| 1676 | Ga0495638_0007463 | |||
| 1677 | Ga0495651_0006018 | |||
| 1678 | Ga0495580_0140279 | |||
| 1679 | Ga0495582_0155162 | |||
| 1680 | Ga0495639_0281018 | |||
| 1681 | Ga0495664_0093820 | |||
| 1682 | Ga0495584_0412390 | |||
| 1683 | Ga0495608_0014836 | |||
| 1684 | Ga0495618_0374164 | |||
| 1685 | Ga0495628_0203930 | |||
| 1686 | Ga0495628_0430483 | |||
| 1687 | Ga0495630_0687006 | |||
| 1688 | Ga0495652_0001107 | |||
| 1689 | Ga0495621_0088620 | |||
| 1690 | Ga0495645_0156182 | |||
| 1691 | Ga0495667_0002634 | |||
| 1692 | Ga0495656_0110278 | |||
| 1693 | Ga0495634_0132612 | |||
| 1694 | Ga0495635_0059579 | |||
| 1695 | Ga0495588_0161338 | |||
| 1696 | Ga0495657_0002235 | |||
| 1697 | Ga0495599_0262802 | |||
| 1698 | Ga0495623_0288585 | |||
| 1699 | Ga0495646_0015096 | |||
| 1700 | Ga0495647_0247522 | |||
| 1701 | Ga0495658_0047886 | |||
| 1702 | Ga0495613_0010774 | |||
| 1703 | Ga0495613_0326137 | |||
| 1704 | Ga0495600_0033115 | |||
| 1705 | Ga0495600_0440679 | |||
| 1706 | Ga0495674_0131414 | |||
| 1707 | Ga0495674_0521780 | |||
| 1708 | Ga0495676_0326088 | |||
| 1709 | Ga0495680_0096004 | |||
| 1710 | Ga0495675_0047311 | |||
| 1711 | Ga0495675_0173012 | |||
| 1712 | Ga0495677_0174206 | |||
| 1713 | Ga0495684_0113314 | |||
| 1714 | Ga0495602_0056089 | |||
| 1715 | Ga0495602_0114003 | |||
| 1716 | Ga0496100_0002656 | |||
| 1717 | Ga0496100_0065121 | |||
| 1718 | Ga0496100_0748985 | |||
| 1719 | Ga0496101_0331298 | |||
| 1720 | Ga0496102_0004755 | |||
| 1721 | Ga0496102_0158676 | |||
| 1722 | Ga0496103_0011593 | |||
| 1723 | Ga0496103_0180384 | |||
| 1724 | Ga0496103_0474459 | |||
| 1725 | Ga0496104_0000004 | |||
| 1726 | Ga0496104_0062014 | |||
| 1727 | Ga0496105_0000001 | |||
| 1728 | Ga0496105_0047865 | |||
| 1729 | Ga0496107_0004422 | |||
| 1730 | Ga0496108_0011228 | |||
| 1731 | Ga0496108_0014324 | |||
| 1732 | Ga0496109_0000115 | |||
| 1733 | Ga0496109_0010805 | |||
| 1734 | Ga0496109_0330696 | |||
| 1735 | Ga0496109_0511940 | |||
| 1736 | Ga0496109_0519282 | |||
| 1737 | Ga0496110_0008225 | |||
| 1738 | Ga0496112_0006052 | |||
| 1739 | Ga0496112_0083212 | |||
| 1740 | Ga0496114_0789523 | |||
| 1741 | Ga0496115_0000012 | |||
| 1742 | Ga0496115_0000017 | |||
| 1743 | Ga0496116_0000360 | |||
| 1744 | Ga0496116_0118744 | |||
| 1745 | Ga0496116_0163150 | |||
| 1746 | Ga0496117_0045326 | |||
| 1747 | Ga0496118_0001416 | |||
| 1748 | Ga0496118_0015490 | |||
| 1749 | Ga0496118_0093331 | |||
| 1750 | Ga0496118_0094965 | |||
| 1751 | Ga0496119_0003375 | |||
| 1752 | Ga0496119_0019417 | |||
| 1753 | Ga0496119_0124658 | |||
| 1754 | Ga0496119_0216138 | |||
| 1755 | Ga0496120_0008036 | |||
| 1756 | Ga0496120_0216837 | |||
| 1757 | Ga0496121_0021569 | |||
| 1758 | Ga0496121_0176915 | |||
| 1759 | Ga0496124_0080587 | |||
| 1760 | Ga0496124_0209001 | |||
| 1761 | Ga0496125_0017162 | |||
| 1762 | Ga0496125_0162238 | |||
| 1763 | Ga0496126_0160626 | |||
| 1764 | Ga0501031_0000672 | |||
| 1765 | Ga0501031_0022901 | |||
| 1766 | Ga0501031_0077876 | |||
| 1767 | Ga0501031_0081159 | |||
| 1768 | Ga0501031_0129227 | |||
| 1769 | Ga0501031_0176225 | |||
| 1770 | Ga0501032_0000408 | |||
| 1771 | Ga0501032_0001581 | |||
| 1772 | Ga0501032_0030727 | |||
| 1773 | Ga0501032_0070393 | |||
| 1774 | Ga0501032_0542727 | |||
| 1775 | Ga0501033_0002830 | |||
| 1776 | Ga0501033_0009823 | |||
| 1777 | Ga0501034_0002858 | |||
| 1778 | Ga0501034_0004186 | |||
| 1779 | Ga0501034_0038297 | |||
| 1780 | Ga0501034_0079277 | |||
| 1781 | Ga0501034_0093021 | |||
| 1782 | Ga0501034_0562069 | |||
| 1783 | Ga0501036_0006356 | |||
| 1784 | Ga0501036_0013492 | |||
| 1785 | Ga0501036_0013729 | |||
| 1786 | Ga0501036_0212006 | |||
| 1787 | Ga0501037_0002310 | |||
| 1788 | Ga0501037_0003119 | |||
| 1789 | Ga0501037_0541080 | |||
| 1790 | Ga0501037_0584544 | |||
| 1791 | Ga0501038_0002847 | |||
| 1792 | Ga0501038_0003709 | |||
| 1793 | Ga0501038_0027683 | |||
| 1794 | Ga0501038_0213155 | |||
| 1795 | Ga0501039_0012900 | |||
| 1796 | Ga0501040_0202598 | |||
| 1797 | Ga0501041_0020677 | |||
| 1798 | Ga0501041_0155983 | |||
| 1799 | Ga0501042_0154913 | |||
| 1800 | Ga0501043_0001699 | |||
| 1801 | Ga0501043_0023253 | |||
| 1802 | Ga0501046_0000914 | |||
| 1803 | Ga0501046_0134605 | |||
| 1804 | Ga0501046_0401799 | |||
| 1805 | Ga0501047_0001308 | |||
| 1806 | Ga0501047_0012908 | |||
| 1807 | Ga0501047_0013835 | |||
| 1808 | Ga0501047_0031159 | |||
| 1809 | Ga0501047_0089254 | |||
| 1810 | Ga0501047_0354987 | |||
| 1811 | Ga0501048_0000126 | |||
| 1812 | Ga0501048_0020915 | |||
| 1813 | Ga0501048_0190486 | |||
| 1814 | Ga0501048_0540764 | |||
| 1815 | Ga0501048_0708063 | |||
| 1816 | Ga0501067_0000587 | |||
| 1817 | Ga0501067_0003173 | |||
| 1818 | Ga0501068_0001780 | |||
| 1819 | Ga0501068_0042478 | |||
| 1820 | Ga0501069_0000824 | |||
| 1821 | Ga0501069_0036206 | |||
| 1822 | Ga0501069_0155096 | |||
| 1823 | Ga0501070_0002563 | |||
| 1824 | Ga0501070_0085405 | |||
| 1825 | Ga0501070_0247057 | |||
| 1826 | Ga0501071_0001042 | |||
| 1827 | Ga0501071_0090453 | |||
| 1828 | Ga0501071_0166152 | |||
| 1829 | Ga0501072_0064051 | |||
| 1830 | Ga0501072_0234297 | |||
| 1831 | Ga0501072_0364895 | |||
| 1832 | Ga0501073_0015155 | |||
| 1833 | Ga0501073_0016821 | |||
| 1834 | Ga0501073_0028840 | |||
| 1835 | Ga0501073_0085973 | |||
| 1836 | Ga0501074_0001349 | |||
| 1837 | Ga0501074_0057911 | |||
| 1838 | Ga0501074_0067643 | |||
| 1839 | Ga0501074_0277971 | |||
| 1840 | Ga0501075_0632972 | |||
| 1841 | Ga0501076_0009291 | |||
| 1842 | Ga0501076_0138681 | |||
| 1843 | Ga0501076_0201820 | |||
| 1844 | Ga0501076_0324659 | |||
| 1845 | Ga0501077_0022038 | |||
| 1846 | Ga0501077_0041532 | |||
| 1847 | Ga0501249_069821 | |||
| 1848 | Ga0501225_0051255 | |||
| 1849 | Ga0501079_0003550 | |||
| 1850 | Ga0501079_0309114 | |||
| 1851 | Ga0501079_0377251 | |||
| 1852 | Ga0501079_0506649 | |||
| 1853 | Ga0501080_0000390 | |||
| 1854 | Ga0501080_0010505 | |||
| 1855 | Ga0501080_0035034 | |||
| 1856 | Ga0501081_0681531 | |||
| 1857 | Ga0501083_0014925 | |||
| 1858 | Ga0501083_0026462 | |||
| 1859 | Ga0501083_0027635 | |||
| 1860 | Ga0501083_0058815 | |||
| 1861 | Ga0501083_0096375 | |||
| 1862 | Ga0501035_0001653 | |||
| 1863 | Ga0501035_0010137 | |||
| 1864 | Ga0501035_0064080 | |||
| 1865 | Ga0501035_0194050 | |||
| 1866 | Ga0501035_0808261 | |||
| 1867 | Ga0501044_0003244 | |||
| 1868 | Ga0501044_0006361 | |||
| 1869 | Ga0501044_0185619 | |||
| 1870 | Ga0501044_0616789 | |||
| 1871 | Ga0501044_0647063 | |||
| 1872 | Ga0501044_0673821 | |||
| 1873 | Ga0501044_0693920 | |||
| 1874 | Ga0501045_0012395 | |||
| 1875 | Ga0501045_0016471 | |||
| 1876 | Ga0501045_0044941 | |||
| 1877 | Ga0501045_0189622 | |||
| 1878 | nmdc:mga03683_44275_c1 | |||
| 1879 | nmdc:mga00v17_489556_c1 | |||
| 1880 | nmdc:mga00v17_8262_c1 | |||
| 1881 | nmdc:mga0yw44_1545_c1 | |||
| 1882 | nmdc:mga0yw44_33003_c1 | |||
| 1883 | nmdc:mga0k408_1062_c1 | |||
| 1884 | nmdc:mga0k408_188523_c1 | |||
| 1885 | nmdc:mga06z11_1317_c1 | |||
| 1886 | nmdc:mga04h51_3149_c1 | |||
| 1887 | nmdc:mga07m45_26566_c1 | |||
| 1888 | nmdc:mga05p37_116979_c1 | |||
| 1889 | nmdc:mga05p37_23148_c1 | |||
| 1890 | nmdc:mga05p37_3488_c1 | |||
| 1891 | nmdc:mga05p37_359038_c1 | |||
| 1892 | nmdc:mga05p37_38094_c1 | |||
| 1893 | nmdc:mga05p37_61598_c1 | |||
| 1894 | nmdc:mga09592_161874_c1 | |||
| 1895 | nmdc:mga09592_20362_c1 | |||
| 1896 | nmdc:mga09592_212835_c1 | |||
| 1897 | nmdc:mga09592_47249_c1 | |||
| 1898 | nmdc:mga09592_57007_c1 | |||
| 1899 | nmdc:mga09592_71456_c1 | |||
| 1900 | nmdc:mga0qj67_187989_c1 | |||
| 1901 | nmdc:mga0qj67_8930_c1 | |||
| 1902 | nmdc:mga06r32_1524_c1 | |||
| 1903 | nmdc:mga06r32_690619_c1 | |||
| 1904 | nmdc:mga08y16_133869_c1 | |||
| 1905 | nmdc:mga08y16_144_c1 | |||
| 1906 | nmdc:mga08y16_147890_c1 | |||
| 1907 | nmdc:mga08y16_157527_c1 | |||
| 1908 | nmdc:mga08y16_29841_c1 | |||
| 1909 | nmdc:mga08y16_89758_c1 | |||
| 1910 | nmdc:mga0n895_111492_c1 | |||
| 1911 | nmdc:mga0n895_27653_c1 | |||
| 1912 | nmdc:mga0n895_813980_c1 | |||
| 1913 | nmdc:mga0rr50_32276_c1 | |||
| 1914 | nmdc:mga0rr50_55280_c1 | |||
| 1915 | nmdc:mga08x19_710179_c1 | |||
| 1916 | nmdc:mga0a205_32741_c1 | |||
| 1917 | nmdc:mga0a205_56771_c1 | |||
| 1918 | nmdc:mga0a205_817910_c1 | |||
| 1919 | nmdc:mga0a205_890755_c1 | |||
| 1920 | nmdc:mga0a205_89306_c1 | |||
| 1921 | nmdc:mga0sz30_98124_c1 | |||
| 1922 | Ga0495601_0079115 | |||
| 1923 | Ga0495601_0099111 | |||
| 1924 | Ga0495612_0004589 | |||
| 1925 | Ga0495619_0000037 | |||
| 1926 | Ga0495619_0035313 | |||
| 1927 | Ga0495619_0310845 | |||
| 1928 | Ga0500566_0005610 | |||
| 1929 | Ga0500566_0124061 | |||
| 1930 | Ga0500595_026833 | |||
| 1931 | Ga0501084_0000570 | |||
| 1932 | Ga0501084_0012755 | |||
| 1933 | Ga0501084_0150022 | |||
| 1934 | Ga0501084_0376445 | |||
| 1935 | Ga0501084_0381214 | |||
| 1936 | Ga0501082_0014056 | |||
| 1937 | Ga0501082_0031185 | |||
| 1938 | Ga0501082_0091084 | |||
| 1939 | Ga0501082_0240646 | |||
| 1940 | Ga0501082_0613535 | |||
| 1941 | Ga0466962_0000909 | |||
| 1942 | Ga0466962_0145483 | |||
| 1943 | Ga0530510_0059141 | |||
| 1944 | Ga0530510_0221702 | |||
| 1945 | 2522548016 | |||
| 1946 | 2730135315 | |||
| 1947 | 2739616828 | |||
| 1948 | 2875392641 | |||
| 1949 | 2904595484 | |||
| 1950 | 2939705239 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4g6i-assembly1.cif.gz_B | crystallographic structure of trimeric riboflavin synthase from brucella abortus in complex with roseoflavin | 0.964 | 1 | 194 |
| 1pkv-assembly1.cif.gz_B | the n-terminal domain of riboflavin synthase in complex with riboflavin | 0.9593 | 1 | 85 |
| 4fxu-assembly1.cif.gz_A | crystallographic structure of trimeric riboflavin synthase from brucella abortus | 0.959 | 1 | 193 |
| 4gqn-assembly1.cif.gz_C | crystallographic structure of trimeric riboflavin synthase from brucella abortus in complex with 5-nitro-6-(d-ribitylamino)-2,4(1h,3h) pyrimidinedione | 0.9577 | 1 | 193 |
| 4g6i-assembly1.cif.gz_B | crystallographic structure of trimeric riboflavin synthase from brucella abortus in complex with roseoflavin | 0.9497 | 1 | 194 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FXG0_1_88_2.40.30.20 | Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; | 0.9702 | 1 | 87 | 2.40.30.20 |
| af_P9WK35_1_88_2.40.30.20 | Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; | 0.9688 | 1 | 86 | 2.40.30.20 |
| af_P0AFU8_1_89_2.40.30.20 | Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; | 0.9686 | 1 | 87 | 2.40.30.20 |
| af_Q2FXG0_1_88_2.40.30.20 | Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; | 0.9489 | 1 | 87 | 2.40.30.20 |
| 4fxuA01 | Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; | 0.9486 | 1 | 87 | 2.40.30.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5D0JIU0-F1-model_v4 | Riboflavin synthase (EC 2.5.1.9) | 0.9952 | 16 | 195 |
GO:0004746
GO:0009231 |
| AF-A0A4R3AS50-F1-model_v4 | Riboflavin synthase (EC 2.5.1.9) | 0.9913 | 2 | 196 |
GO:0004746
GO:0009231 |
| AF-A0A359CT85-F1-model_v4 | Riboflavin synthase (EC 2.5.1.9) | 0.99 | 1 | 195 |
GO:0004746
GO:0009231 |
| AF-A0A1Z8UNC1-F1-model_v4 | Riboflavin synthase (EC 2.5.1.9) | 0.9896 | 1 | 176 |
GO:0004746
GO:0009231 |
| AF-A3J2R8-F1-model_v4 | Riboflavin synthase (EC 2.5.1.9) | 0.989 | 1 | 196 |
GO:0004746
GO:0009231 GO:0016020 |