F487223

General Info

Members Datasets Scaffolds Average Seq Length
975 388 1950 204

Family's Representative Sequence

Representative Sequence 3300005467|Ga0070706_100112996|Ga0070706_1001129962
Length 238
Sequence MNRDYRDSILICVYLLKSDRGEVNVFTGIIEEVGKVEAINVAGEKRRLTIACSKLLPEIKVGNSVSVSGVCLTAVEIGKNSFAADLAHETWVRTSLSRLRPGALVNLELPMRANGRFDGHIVQGHVDGTGTVISLAPIPEWIDYVLAINVPSELTRYIVAKGSLSIEGISLTVAAIEGTEVRVAIIPHTAEVTNLKSLDPGDPVNLEVDVIAKYVEKMMGGQKAESSITLEKLVRAGF

Samples

Sample ID Description Type Environment
1 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
6 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
7 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
38 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
39 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
40 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
41 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
42 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
43 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
48 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
49 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
50 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
51 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
52 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
53 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
54 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
55 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
56 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
57 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
58 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
59 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
60 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
63 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
64 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
65 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
66 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
67 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
68 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
69 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
70 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
71 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
72 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
73 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
74 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
75 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
76 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
77 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
78 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
79 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
80 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
81 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
82 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
83 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
84 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
85 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
86 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
87 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
88 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
89 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
90 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
91 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
93 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
94 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
95 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
96 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
97 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
98 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
99 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
100 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
101 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
102 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
103 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
104 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
105 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
106 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
107 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
108 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
109 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
110 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
111 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
112 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
113 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
114 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
115 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
116 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
117 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
118 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
119 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
120 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
121 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
122 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
123 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
124 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
125 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
126 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
127 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
128 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
129 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
130 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
131 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
132 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
133 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
134 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
135 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
136 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
137 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
138 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
139 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
140 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
201 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
202 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
206 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
207 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
208 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
209 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
210 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
211 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
212 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
213 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
214 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
215 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
216 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
217 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
218 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
219 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
220 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
221 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
222 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
223 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
224 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
225 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
226 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
227 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
228 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
229 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
230 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
231 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
232 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
233 3300036534 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
234 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
235 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
236 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
237 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
238 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
239 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
240 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
241 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
242 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
243 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
244 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
245 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
246 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
247 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
248 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
249 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
250 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
251 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
252 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
253 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
254 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
255 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
256 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
257 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
258 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
259 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
260 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
261 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
262 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
263 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
264 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
265 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
266 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
267 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
268 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
269 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
270 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
271 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
272 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
273 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
274 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
275 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
276 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
277 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
278 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
279 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
280 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
281 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
282 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
283 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
284 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
285 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
286 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
287 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
288 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
289 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
290 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
291 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
292 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
293 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
294 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
295 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
296 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
297 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
298 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
299 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
300 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
301 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
302 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
303 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
304 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
305 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
306 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
307 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
308 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
309 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
310 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
311 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
312 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
313 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
314 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
315 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
316 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
317 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
318 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
319 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
320 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
321 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
322 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
323 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
324 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
325 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
326 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
327 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
328 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
329 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
330 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
331 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
332 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
333 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
334 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
335 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
336 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
337 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
338 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
339 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
340 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
341 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
342 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
343 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
344 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
345 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
346 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
347 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
348 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
349 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
350 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
351 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
352 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
353 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
354 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
355 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
356 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
357 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
358 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
359 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
360 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
361 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
362 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
363 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
364 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
365 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
366 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
367 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
368 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
369 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
370 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
371 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
372 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
373 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
374 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
375 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
376 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
377 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
378 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
379 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
380 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
381 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
382 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
383 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
384 2728369359 Paenibacillus polymyxa YC0136 Isolate Rhizosphere
385 2739367656 Pedobacter sp. CF523 Isolate Unclassified
386 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
387 2904595352 Paenibacillus sp. 1182 Isolate Unclassified
388 2939702853 Paenibacillus sp. PvR008 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.56
Metatranscriptomes 0.82
Isolates 0.62

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.59
Nodule 0
Rhizoplane 2.97
Rhizosphere 88.62
Stem 0
Stem Tuber 0
Unclassified 5.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070706_100112996 3300005467 Unclassified 2529
2 rootH1_10077023 3300003316 Bacteria 3956
3 rootH2_10058891 3300003320 Bacteria 3005
4 rootL2_10318583 3300003322 Bacteria 1535
5 Ga0055536_1005846 3300003781 Bacteria 5909
6 Ga0055531_10000087 3300003794 Bacteria 101553
7 Ga0065165_1000396 3300005262 Bacteria 70676
8 Ga0065704_10282964 3300005289 Bacteria 919
9 Ga0065712_10133099 3300005290 Bacteria 1505
10 Ga0070658_10161126 3300005327 Bacteria 1882
11 Ga0070658_10191294 3300005327 Bacteria 1725
12 Ga0070676_10446797 3300005328 Bacteria 908
13 Ga0070683_100002001 3300005329 Bacteria 15985
14 Ga0070683_100029658 3300005329 Bacteria 4957
15 Ga0070683_100045091 3300005329 Bacteria 4070
16 Ga0070683_100066475 3300005329 Bacteria 3358
17 Ga0070690_100016725 3300005330 Bacteria 4400
18 Ga0070690_100062514 3300005330 Bacteria 2401
19 Ga0070690_100218685 3300005330 Bacteria 1334
20 Ga0070670_100000207 3300005331 Bacteria 54657
21 Ga0070670_100762691 3300005331 Bacteria 872
22 Ga0068869_100146319 3300005334 Bacteria 1829
23 Ga0068869_100204435 3300005334 Bacteria 1559
24 Ga0068869_100549970 3300005334 Bacteria 970
25 Ga0068869_100637539 3300005334 Bacteria 903
26 Ga0070666_10003775 3300005335 Bacteria 9184
27 Ga0070666_10056449 3300005335 Bacteria 2651
28 Ga0070666_10104433 3300005335 Bacteria 1955
29 Ga0070680_100000851 3300005336 Bacteria 21636
30 Ga0070680_100101365 3300005336 Bacteria 2390
31 Ga0070680_100537881 3300005336 Bacteria 1001
32 Ga0070682_100428117 3300005337 Bacteria 1008
33 Ga0068868_100000724 3300005338 Bacteria 22276
34 Ga0068868_100075031 3300005338 Unclassified 2702
35 Ga0068868_100155897 3300005338 Bacteria 1883
36 Ga0068868_100367217 3300005338 Bacteria 1236
37 Ga0070660_100011360 3300005339 Bacteria 6322
38 Ga0070660_100024216 3300005339 Bacteria 4503
39 Ga0070689_100139540 3300005340 Bacteria 1949
40 Ga0070689_100162576 3300005340 Bacteria 1805
41 Ga0070691_10282498 3300005341 Bacteria 901
42 Ga0070687_100038225 3300005343 Bacteria 2404
43 Ga0070687_100419492 3300005343 Unclassified 882
44 Ga0070661_100012774 3300005344 Bacteria 5880
45 Ga0070661_100015958 3300005344 Bacteria 5301
46 Ga0070661_100044366 3300005344 Bacteria 3248
47 Ga0070692_10001566 3300005345 Bacteria 8390
48 Ga0070692_10013844 3300005345 Bacteria 3770
49 Ga0070668_100062267 3300005347 Bacteria 2890
50 Ga0070668_100156042 3300005347 Bacteria 1849
51 Ga0070669_100075250 3300005353 Bacteria 2504
52 Ga0070669_100111541 3300005353 Bacteria 2076
53 Ga0070675_100038493 3300005354 Bacteria 3898
54 Ga0070675_100045451 3300005354 Bacteria 3593
55 Ga0070675_100165680 3300005354 Bacteria 1903
56 Ga0070671_100034456 3300005355 Bacteria 4191
57 Ga0070671_100066279 3300005355 Bacteria 3009
58 Ga0070674_100076211 3300005356 Bacteria 2384
59 Ga0070688_100001589 3300005365 Bacteria 11359
60 Ga0070688_100119157 3300005365 Bacteria 1765
61 Ga0070659_100001330 3300005366 Bacteria 17814
62 Ga0070659_100033625 3300005366 Bacteria 3983
63 Ga0070667_100050175 3300005367 Bacteria 3516
64 Ga0070667_100050393 3300005367 Bacteria 3509
65 Ga0070709_10200179 3300005434 Bacteria 1414
66 Ga0070709_10226004 3300005434 Bacteria 1337
67 Ga0070714_100000998 3300005435 Bacteria 20196
68 Ga0070714_100021407 3300005435 Bacteria 5292
69 Ga0070714_100439629 3300005435 Bacteria 1238
70 Ga0070714_101126792 3300005435 Bacteria 765
71 Ga0070713_100001968 3300005436 Bacteria 13255
72 Ga0070713_100023666 3300005436 Bacteria 4771
73 Ga0070713_100104464 3300005436 Bacteria 2460
74 Ga0070713_100121628 3300005436 Bacteria 2290
75 Ga0070713_100164656 3300005436 Bacteria 1982
76 Ga0070713_100360319 3300005436 Unclassified 1351
77 Ga0070713_100424601 3300005436 Unclassified 1245
78 Ga0070710_10035057 3300005437 Bacteria 2734
79 Ga0070701_10062407 3300005438 Bacteria 1969
80 Ga0070701_10089205 3300005438 Bacteria 1686
81 Ga0070711_100129753 3300005439 Bacteria 1876
82 Ga0070711_100160625 3300005439 Bacteria 1703
83 Ga0070711_100177488 3300005439 Bacteria 1628
84 Ga0070711_100266410 3300005439 Bacteria 1350
85 Ga0070711_100715461 3300005439 Bacteria 844
86 Ga0070705_100042378 3300005440 Bacteria 2602
87 Ga0070705_100234203 3300005440 Bacteria 1279
88 Ga0070705_100857552 3300005440 Bacteria 727
89 Ga0070700_100006126 3300005441 Bacteria 6408
90 Ga0070700_100109996 3300005441 Bacteria 1830
91 Ga0070694_100064846 3300005444 Bacteria 2501
92 Ga0070708_100002773 3300005445 Bacteria 13606
93 Ga0070708_100897006 3300005445 Bacteria 832
94 Ga0070663_100003770 3300005455 Bacteria 8802
95 Ga0070663_100670193 3300005455 Bacteria 879
96 Ga0070678_100043278 3300005456 Bacteria 3206
97 Ga0070678_100054608 3300005456 Bacteria 2912
98 Ga0070678_100297636 3300005456 Bacteria 1370
99 Ga0070678_101219724 3300005456 Unclassified 698
100 Ga0070662_100002142 3300005457 Bacteria 12101
101 Ga0070681_10000229 3300005458 Bacteria 44150
102 Ga0070681_10006386 3300005458 Bacteria 11463
103 Ga0070681_10107572 3300005458 Bacteria 2729
104 Ga0070681_10169999 3300005458 Bacteria 2102
105 Ga0070681_10238924 3300005458 Unclassified 1730
106 Ga0068867_100022943 3300005459 Bacteria 4465
107 Ga0068867_100078397 3300005459 Bacteria 2485
108 Ga0068867_100521761 3300005459 Unclassified 1024
109 Ga0070685_10001752 3300005466 Bacteria 11359
110 Ga0070685_10113659 3300005466 Bacteria 1672
111 Ga0070706_100002983 3300005467 Bacteria 16773
112 Ga0070706_100039185 3300005467 Bacteria 4375
113 Ga0070707_100002460 3300005468 Bacteria 17648
114 Ga0070707_100479089 3300005468 Unclassified 1206
115 Ga0070698_100004516 3300005471 Bacteria 15295
116 Ga0070698_100014925 3300005471 Bacteria 8213
117 Ga0070698_101021314 3300005471 Unclassified 774
118 Ga0070699_100012919 3300005518 Bacteria 7199
119 Ga0070679_100000982 3300005530 Bacteria 24847
120 Ga0070679_100001940 3300005530 Bacteria 18578
121 Ga0070679_100028311 3300005530 Bacteria 5523
122 Ga0070679_100036311 3300005530 Bacteria 4890
123 Ga0070679_100159288 3300005530 Bacteria 2232
124 Ga0070679_100220165 3300005530 Bacteria 1859
125 Ga0070679_100274896 3300005530 Bacteria 1638
126 Ga0070679_100989091 3300005530 Bacteria 785
127 Ga0070684_100004657 3300005535 Bacteria 10468
128 Ga0070684_100024983 3300005535 Bacteria 5017
129 Ga0070684_100165626 3300005535 Bacteria 2006
130 Ga0070684_100384105 3300005535 Bacteria 1294
131 Ga0070684_100393209 3300005535 Bacteria 1278
132 Ga0070697_100019771 3300005536 Bacteria 5320
133 Ga0070697_100051147 3300005536 Unclassified 3357
134 Ga0070697_100079032 3300005536 Bacteria 2708
135 Ga0068853_100011034 3300005539 Bacteria 7328
136 Ga0068853_100738132 3300005539 Bacteria 941
137 Ga0068853_100782799 3300005539 Bacteria 913
138 Ga0070672_100002719 3300005543 Bacteria 11314
139 Ga0070672_100013963 3300005543 Bacteria 5682
140 Ga0070672_100064638 3300005543 Bacteria 2891
141 Ga0070672_100462153 3300005543 Bacteria 1094
142 Ga0070686_100008137 3300005544 Bacteria 5865
143 Ga0070686_100019718 3300005544 Bacteria 3979
144 Ga0070695_100004688 3300005545 Bacteria 8042
145 Ga0070695_100317512 3300005545 Bacteria 1157
146 Ga0070693_100018891 3300005547 Bacteria 3607
147 Ga0070693_100064150 3300005547 Bacteria 2143
148 Ga0070693_100165851 3300005547 Bacteria 1411
149 Ga0070693_100346207 3300005547 Bacteria 1016
150 Ga0070693_100478570 3300005547 Bacteria 879
151 Ga0070665_100006697 3300005548 Bacteria 11711
152 Ga0070665_100207711 3300005548 Bacteria 1959
153 Ga0070704_100176196 3300005549 Bacteria 1706
154 Ga0070704_100206787 3300005549 Bacteria 1588
155 Ga0068855_100001344 3300005563 Bacteria 30457
156 Ga0068855_100016503 3300005563 Bacteria 8881
157 Ga0070664_100001854 3300005564 Bacteria 16923
158 Ga0070664_100028719 3300005564 Bacteria 4630
159 Ga0070664_100125856 3300005564 Bacteria 2248
160 Ga0070664_100152241 3300005564 Bacteria 2042
161 Ga0070664_100158028 3300005564 Unclassified 2004
162 Ga0070664_100700473 3300005564 Bacteria 943
163 Ga0068857_100039760 3300005577 Bacteria 4168
164 Ga0068857_100103851 3300005577 Bacteria 2551
165 Ga0068857_100110624 3300005577 Bacteria 2469
166 Ga0068857_100195728 3300005577 Bacteria 1842
167 Ga0068857_100218093 3300005577 Bacteria 1742
168 Ga0068854_100020944 3300005578 Bacteria 4431
169 Ga0068854_100123766 3300005578 Bacteria 1967
170 Ga0068854_100524395 3300005578 Bacteria 1001
171 Ga0068856_100000269 3300005614 Bacteria 56597
172 Ga0068856_100001308 3300005614 Bacteria 26215
173 Ga0068856_100008504 3300005614 Bacteria 9980
174 Ga0068856_100088073 3300005614 Unclassified 3087
175 Ga0068856_100091155 3300005614 Bacteria 3032
176 Ga0068856_100174140 3300005614 Bacteria 2164
177 Ga0068856_100655858 3300005614 Bacteria 1070
178 Ga0068856_100732069 3300005614 Bacteria 1009
179 Ga0068856_100793496 3300005614 Bacteria 967
180 Ga0070702_100024548 3300005615 Bacteria 3217
181 Ga0068852_100011008 3300005616 Bacteria 6787
182 Ga0068852_100025487 3300005616 Bacteria 4792
183 Ga0068859_100003024 3300005617 Bacteria 17050
184 Ga0068859_100110766 3300005617 Bacteria 2807
185 Ga0068859_100111197 3300005617 Bacteria 2802
186 Ga0068859_100211788 3300005617 Bacteria 2024
187 Ga0068859_100383983 3300005617 Bacteria 1500
188 Ga0068859_100956122 3300005617 Unclassified 940
189 Ga0068864_100011330 3300005618 Bacteria 7368
190 Ga0068864_100029472 3300005618 Bacteria 4650
191 Ga0068864_100040860 3300005618 Bacteria 3966
192 Ga0068864_100089807 3300005618 Bacteria 2707
193 Ga0068864_100805718 3300005618 Bacteria 923
194 Ga0068861_100015698 3300005719 Bacteria 5343
195 Ga0068861_100896479 3300005719 Bacteria 839
196 Ga0068851_10175736 3300005834 Bacteria 1184
197 Ga0068870_10354194 3300005840 Unclassified 943
198 Ga0068870_10606300 3300005840 Bacteria 744
199 Ga0068863_100014094 3300005841 Bacteria 7701
200 Ga0068863_100041704 3300005841 Bacteria 4364
201 Ga0068863_100216470 3300005841 Unclassified 1845
202 Ga0068863_100333525 3300005841 Bacteria 1475
203 Ga0068863_100446634 3300005841 Bacteria 1269
204 Ga0068858_100019598 3300005842 Bacteria 6324
205 Ga0068858_100044626 3300005842 Bacteria 4108
206 Ga0068858_100102323 3300005842 Bacteria 2672
207 Ga0068858_100102729 3300005842 Bacteria 2666
208 Ga0068858_100247528 3300005842 Bacteria 1693
209 Ga0068858_100511347 3300005842 Bacteria 1161
210 Ga0068860_100043979 3300005843 Bacteria 4258
211 Ga0068860_100758300 3300005843 Unclassified 982
212 Ga0068862_100056787 3300005844 Bacteria 3355
213 Ga0068862_100249051 3300005844 Bacteria 1618
214 Ga0068862_100251129 3300005844 Bacteria 1612
215 Ga0068862_100622536 3300005844 Bacteria 1038
216 Ga0081455_10008769 3300005937 Bacteria 10469
217 Ga0081455_10038588 3300005937 Bacteria 4228
218 Ga0081455_10098648 3300005937 Bacteria 2351
219 Ga0081538_10001123 3300005981 Bacteria 28341
220 Ga0081540_1000265 3300005983 Bacteria 55107
221 Ga0081540_1002544 3300005983 Bacteria 14794
222 Ga0081540_1157310 3300005983 Bacteria 887
223 Ga0070717_10003751 3300006028 Bacteria 10908
224 Ga0070717_10019093 3300006028 Bacteria 5368
225 Ga0070717_10404830 3300006028 Bacteria 1226
226 Ga0070717_10687979 3300006028 Unclassified 929
227 Ga0075365_10017319 3300006038 Bacteria 4406
228 Ga0075365_10033549 3300006038 Bacteria 3309
229 Ga0075365_10102791 3300006038 Bacteria 1958
230 Ga0075368_10022088 3300006042 Bacteria 2420
231 Ga0075368_10051889 3300006042 Bacteria 1631
232 Ga0075363_100046048 3300006048 Bacteria 2313
233 Ga0075364_10009991 3300006051 Bacteria 5715
234 Ga0070712_100153768 3300006175 Bacteria 1769
235 Ga0070712_100393437 3300006175 Bacteria 1143
236 Ga0075362_10011804 3300006177 Bacteria 3450
237 Ga0075367_10001445 3300006178 Bacteria 10221
238 Ga0075367_10072997 3300006178 Bacteria 2067
239 Ga0075366_10000307 3300006195 Bacteria 22132
240 Ga0075366_10176017 3300006195 Bacteria 1299
241 Ga0075366_10274793 3300006195 Bacteria 1029
242 Ga0097621_100001313 3300006237 Bacteria 17096
243 Ga0097621_100012438 3300006237 Bacteria 6309
244 Ga0097621_100051312 3300006237 Bacteria 3357
245 Ga0097621_100057803 3300006237 Unclassified 3173
246 Ga0097621_100220280 3300006237 Bacteria 1653
247 Ga0075370_10039897 3300006353 Bacteria 2647
248 Ga0068871_100000510 3300006358 Bacteria 26634
249 Ga0068871_100004430 3300006358 Bacteria 9767
250 Ga0068871_100077234 3300006358 Bacteria 2752
251 Ga0068871_100244101 3300006358 Bacteria 1562
252 Ga0068871_100252769 3300006358 Bacteria 1535
253 Ga0068871_100402814 3300006358 Bacteria 1219
254 Ga0075428_100004866 3300006844 Bacteria 14905
255 Ga0075428_100017204 3300006844 Bacteria 7990
256 Ga0075428_100039391 3300006844 Bacteria 5201
257 Ga0075428_100196176 3300006844 Bacteria 2183
258 Ga0075428_100511184 3300006844 Bacteria 1285
259 Ga0075428_100747221 3300006844 Bacteria 1041
260 Ga0075430_100002187 3300006846 Bacteria 16192
261 Ga0075430_100093313 3300006846 Bacteria 2516
262 Ga0075431_100001969 3300006847 Bacteria 19588
263 Ga0075431_100028616 3300006847 Bacteria 5728
264 Ga0075431_100043921 3300006847 Bacteria 4610
265 Ga0075431_100056908 3300006847 Bacteria 4033
266 Ga0075431_100320974 3300006847 Bacteria 1562
267 Ga0075433_10050269 3300006852 Bacteria 3629
268 Ga0075433_10057483 3300006852 Bacteria 3400
269 Ga0075434_100014876 3300006871 Bacteria 7444
270 Ga0075434_100101297 3300006871 Bacteria 2887
271 Ga0075434_100242385 3300006871 Bacteria 1823
272 Ga0075429_100005425 3300006880 Bacteria 10984
273 Ga0075429_100061721 3300006880 Bacteria 3266
274 Ga0075429_100106052 3300006880 Bacteria 2455
275 Ga0075429_100259404 3300006880 Bacteria 1522
276 Ga0075429_100515427 3300006880 Bacteria 1048
277 Ga0068865_100000278 3300006881 Bacteria 28227
278 Ga0068865_100054786 3300006881 Bacteria 2773
279 Ga0068865_100394495 3300006881 Unclassified 1132
280 Ga0075436_100133582 3300006914 Unclassified 1741
281 Ga0097620_100003024 3300006931 Bacteria 17050
282 Ga0097620_100110769 3300006931 Bacteria 2807
283 Ga0097620_100111192 3300006931 Bacteria 2802
284 Ga0097620_100211792 3300006931 Bacteria 2024
285 Ga0097620_100383977 3300006931 Bacteria 1500
286 Ga0097620_100956157 3300006931 Unclassified 940
287 Ga0075435_100042467 3300007076 Bacteria 3638
288 Ga0075435_100075480 3300007076 Bacteria 2761
289 Ga0105240_10024854 3300009093 Bacteria 7886
290 Ga0105240_10046731 3300009093 Bacteria 5483
291 Ga0105240_10071285 3300009093 Bacteria 4298
292 Ga0105240_10072327 3300009093 Bacteria 4262
293 Ga0105240_10474392 3300009093 Unclassified 1396
294 Ga0111539_10001522 3300009094 Bacteria 30921
295 Ga0111539_10004893 3300009094 Bacteria 17438
296 Ga0111539_10020295 3300009094 Bacteria 8186
297 Ga0111539_10124142 3300009094 Bacteria 3026
298 Ga0111539_10131290 3300009094 Bacteria 2933
299 Ga0111539_10237972 3300009094 Bacteria 2119
300 Ga0105245_10001072 3300009098 Bacteria 24802
301 Ga0105245_10006775 3300009098 Bacteria 10043
302 Ga0105245_10257004 3300009098 Bacteria 1699
303 Ga0105245_10767243 3300009098 Bacteria 1001
304 Ga0105247_10255968 3300009101 Bacteria 1198
305 Ga0114129_10018514 3300009147 Bacteria 9915
306 Ga0114129_10020185 3300009147 Bacteria 9483
307 Ga0114129_10075416 3300009147 Bacteria 4696
308 Ga0114129_10127258 3300009147 Bacteria 3502
309 Ga0114129_10128563 3300009147 Bacteria 3481
310 Ga0114129_10313351 3300009147 Bacteria 2088
311 Ga0114129_10390841 3300009147 Bacteria 1835
312 Ga0105243_10003742 3300009148 Bacteria 12192
313 Ga0105243_10009769 3300009148 Bacteria 7303
314 Ga0105241_10092768 3300009174 Bacteria 2385
315 Ga0105241_10261739 3300009174 Bacteria 1470
316 Ga0105241_10391606 3300009174 Bacteria 1217
317 Ga0105241_10446339 3300009174 Bacteria 1143
318 Ga0105248_10000008 3300009177 Bacteria 403910
319 Ga0105248_10004704 3300009177 Bacteria 15098
320 Ga0105248_10093286 3300009177 Bacteria 3390
321 Ga0105248_10267500 3300009177 Bacteria 1925
322 Ga0105248_10819466 3300009177 Unclassified 1050
323 Ga0105237_10008678 3300009545 Bacteria 10978
324 Ga0105237_10038987 3300009545 Bacteria 4797
325 Ga0105237_10471748 3300009545 Bacteria 1261
326 Ga0105237_10871108 3300009545 Bacteria 907
327 Ga0105237_10963486 3300009545 Bacteria 860
328 Ga0105238_10000743 3300009551 Bacteria 34004
329 Ga0105238_10143194 3300009551 Bacteria 2367
330 Ga0105238_10172407 3300009551 Bacteria 2140
331 Ga0105238_10216549 3300009551 Bacteria 1891
332 Ga0105238_10263920 3300009551 Unclassified 1702
333 Ga0105238_10501006 3300009551 Bacteria 1215
334 Ga0105249_10067038 3300009553 Bacteria 3305
335 Ga0105239_10162831 3300010375 Bacteria 2493
336 Ga0105239_10265027 3300010375 Unclassified 1931
337 Ga0105239_10284433 3300010375 Bacteria 1862
338 Ga0105239_10720749 3300010375 Bacteria 1141
339 Ga0105239_10766630 3300010375 Bacteria 1104
340 Ga0105246_10080451 3300011119 Bacteria 2320
341 Ga0105246_10146247 3300011119 Bacteria 1784
342 Ga0105246_10399415 3300011119 Bacteria 1141
343 Ga0157373_10001156 3300013100 Bacteria 20223
344 Ga0157373_10005500 3300013100 Bacteria 9503
345 Ga0157373_10019021 3300013100 Bacteria 4999
346 Ga0157373_10391170 3300013100 Bacteria 995
347 Ga0157371_10007405 3300013102 Bacteria 8893
348 Ga0157371_10048902 3300013102 Bacteria 3005
349 Ga0157370_10017755 3300013104 Bacteria 7171
350 Ga0157370_10330122 3300013104 Bacteria 1406
351 Ga0157370_10585898 3300013104 Bacteria 1022
352 Ga0157369_10003895 3300013105 Bacteria 17715
353 Ga0157369_10005857 3300013105 Bacteria 14280
354 Ga0157369_10006212 3300013105 Bacteria 13860
355 Ga0157369_10142685 3300013105 Bacteria 2533
356 Ga0157374_10000299 3300013296 Bacteria 45851
357 Ga0157374_10000673 3300013296 Bacteria 30064
358 Ga0157374_10117251 3300013296 Bacteria 2566
359 Ga0157374_10317779 3300013296 Bacteria 1543
360 Ga0157374_10399802 3300013296 Bacteria 1370
361 Ga0157374_10661082 3300013296 Bacteria 1057
362 Ga0157374_11129333 3300013296 Unclassified 804
363 Ga0157378_10001436 3300013297 Bacteria 21459
364 Ga0157378_10062392 3300013297 Bacteria 3328
365 Ga0157378_10094349 3300013297 Bacteria 2725
366 Ga0157378_10825682 3300013297 Bacteria 954
367 Ga0163162_10002123 3300013306 Bacteria 18627
368 Ga0163162_10150431 3300013306 Bacteria 2445
369 Ga0163162_11102838 3300013306 Bacteria 899
370 Ga0157372_10001884 3300013307 Bacteria 22743
371 Ga0157372_10006669 3300013307 Bacteria 12282
372 Ga0157372_10012317 3300013307 Bacteria 9114
373 Ga0157372_10019286 3300013307 Bacteria 7344
374 Ga0157372_10135620 3300013307 Bacteria 2834
375 Ga0157372_10243090 3300013307 Bacteria 2089
376 Ga0157372_10269452 3300013307 Bacteria 1978
377 Ga0157372_10746042 3300013307 Bacteria 1138
378 Ga0157375_10010182 3300013308 Bacteria 8276
379 Ga0157375_10281333 3300013308 Bacteria 1827
380 Ga0163163_10008634 3300014325 Bacteria 9061
381 Ga0157380_10057403 3300014326 Bacteria 3100
382 Ga0157377_10078658 3300014745 Bacteria 1922
383 Ga0157377_10082872 3300014745 Bacteria 1878
384 Ga0157379_10149226 3300014968 Bacteria 2109
385 Ga0157379_10275650 3300014968 Unclassified 1530
386 Ga0157376_10042614 3300014969 Bacteria 3721
387 Ga0157376_10097705 3300014969 Bacteria 2559
388 Ga0157376_10343753 3300014969 Bacteria 1426
389 Ga0157376_11091258 3300014969 Bacteria 824
390 Ga0206352_10810822 3300020078 Bacteria 1131
391 Ga0206354_10638829 3300020081 Bacteria 1059
392 Ga0206354_11335030 3300020081 Bacteria 1302
393 Ga0206353_10828775 3300020082 Bacteria 3665
394 Ga0206353_11254201 3300020082 Bacteria 947
395 Ga0206353_11575633 3300020082 Bacteria 2566
396 Ga0213873_10057946 3300021358 Bacteria 1041
397 Ga0213873_10108185 3300021358 Bacteria 806
398 Ga0213872_10010137 3300021361 Unclassified 4494
399 Ga0213872_10186564 3300021361 Bacteria 894
400 Ga0213874_10006235 3300021377 Bacteria 2817
401 Ga0213876_10035356 3300021384 Bacteria 2635
402 Ga0213875_10245052 3300021388 Bacteria 845
403 Ga0224712_10085856 3300022467 Bacteria 1308
404 Ga0209676_1000390 3300025292 Bacteria 80030
405 Ga0209257_1000006 3300025304 Bacteria 1570111
406 Ga0207682_10059553 3300025893 Bacteria 1596
407 Ga0207692_10109217 3300025898 Bacteria 1532
408 Ga0207710_10000461 3300025900 Bacteria 26087
409 Ga0207688_10038104 3300025901 Bacteria 2667
410 Ga0207680_10006566 3300025903 Bacteria 5636
411 Ga0207680_10019201 3300025903 Bacteria 3651
412 Ga0207680_10344043 3300025903 Bacteria 1047
413 Ga0207647_10360618 3300025904 Unclassified 822
414 Ga0207699_10128771 3300025906 Bacteria 1648
415 Ga0207645_10527808 3300025907 Bacteria 800
416 Ga0207705_10030411 3300025909 Bacteria 3854
417 Ga0207705_10238238 3300025909 Bacteria 1385
418 Ga0207654_10291855 3300025911 Bacteria 1106
419 Ga0207654_10432580 3300025911 Bacteria 920
420 Ga0207707_10014004 3300025912 Bacteria 6992
421 Ga0207707_10024724 3300025912 Bacteria 5255
422 Ga0207707_10040486 3300025912 Bacteria 4069
423 Ga0207707_10128590 3300025912 Bacteria 2215
424 Ga0207707_10202620 3300025912 Unclassified 1730
425 Ga0207707_10385766 3300025912 Bacteria 1204
426 Ga0207707_10584989 3300025912 Bacteria 946
427 Ga0207695_10028344 3300025913 Bacteria 6214
428 Ga0207695_10041471 3300025913 Bacteria 4927
429 Ga0207695_10055642 3300025913 Bacteria 4121
430 Ga0207695_10409617 3300025913 Unclassified 1240
431 Ga0207671_10017218 3300025914 Bacteria 5582
432 Ga0207671_10021736 3300025914 Bacteria 4862
433 Ga0207693_10057358 3300025915 Bacteria 3052
434 Ga0207693_10228569 3300025915 Bacteria 1461
435 Ga0207663_10017300 3300025916 Bacteria 4013
436 Ga0207663_10038567 3300025916 Bacteria 2889
437 Ga0207663_10097229 3300025916 Unclassified 1969
438 Ga0207660_10062435 3300025917 Bacteria 2684
439 Ga0207660_10063532 3300025917 Bacteria 2662
440 Ga0207660_10091988 3300025917 Bacteria 2251
441 Ga0207660_10292424 3300025917 Bacteria 1296
442 Ga0207660_10432504 3300025917 Bacteria 1063
443 Ga0207657_10001043 3300025919 Bacteria 29329
444 Ga0207657_10006978 3300025919 Bacteria 11630
445 Ga0207649_10005811 3300025920 Bacteria 6680
446 Ga0207649_10026774 3300025920 Bacteria 3377
447 Ga0207649_10107598 3300025920 Unclassified 1857
448 Ga0207652_10000709 3300025921 Bacteria 32351
449 Ga0207652_10003467 3300025921 Bacteria 13008
450 Ga0207652_10023611 3300025921 Bacteria 5096
451 Ga0207652_10027875 3300025921 Bacteria 4710
452 Ga0207652_10091136 3300025921 Bacteria 2680
453 Ga0207652_10219796 3300025921 Unclassified 1712
454 Ga0207646_10004328 3300025922 Bacteria 15489
455 Ga0207681_10134285 3300025923 Bacteria 1834
456 Ga0207681_10143723 3300025923 Bacteria 1780
457 Ga0207681_10383007 3300025923 Bacteria 1132
458 Ga0207694_10002021 3300025924 Bacteria 16807
459 Ga0207694_10119877 3300025924 Bacteria 2099
460 Ga0207694_10304051 3300025924 Bacteria 1314
461 Ga0207694_10354626 3300025924 Bacteria 1215
462 Ga0207694_10390330 3300025924 Bacteria 1156
463 Ga0207694_10900454 3300025924 Bacteria 748
464 Ga0207650_10002070 3300025925 Bacteria 14019
465 Ga0207650_10167985 3300025925 Bacteria 1742
466 Ga0207650_10280401 3300025925 Bacteria 1357
467 Ga0207659_10005700 3300025926 Bacteria 7581
468 Ga0207659_10218814 3300025926 Bacteria 1530
469 Ga0207687_10000031 3300025927 Bacteria 150246
470 Ga0207687_10005626 3300025927 Bacteria 8285
471 Ga0207700_10003644 3300025928 Bacteria 8983
472 Ga0207700_10076942 3300025928 Bacteria 2591
473 Ga0207700_10144481 3300025928 Bacteria 1959
474 Ga0207700_10344931 3300025928 Bacteria 1295
475 Ga0207700_10458460 3300025928 Unclassified 1124
476 Ga0207664_10128522 3300025929 Bacteria 2130
477 Ga0207664_10159740 3300025929 Bacteria 1921
478 Ga0207664_10270382 3300025929 Bacteria 1489
479 Ga0207644_10007623 3300025931 Bacteria 7057
480 Ga0207644_10077501 3300025931 Bacteria 2448
481 Ga0207690_10011048 3300025932 Bacteria 5384
482 Ga0207690_10039879 3300025932 Bacteria 3066
483 Ga0207690_10139836 3300025932 Bacteria 1783
484 Ga0207706_10006046 3300025933 Bacteria 11258
485 Ga0207686_10050823 3300025934 Bacteria 2580
486 Ga0207709_10009807 3300025935 Bacteria 5275
487 Ga0207670_10015123 3300025936 Bacteria 4602
488 Ga0207670_10053479 3300025936 Bacteria 2721
489 Ga0207704_10000224 3300025938 Bacteria 28226
490 Ga0207704_10012116 3300025938 Bacteria 4271
491 Ga0207704_10500292 3300025938 Unclassified 979
492 Ga0207691_10014953 3300025940 Bacteria 7392
493 Ga0207691_10034869 3300025940 Bacteria 4675
494 Ga0207691_10291638 3300025940 Bacteria 1403
495 Ga0207711_10000006 3300025941 Bacteria 792692
496 Ga0207711_10003308 3300025941 Bacteria 14001
497 Ga0207711_10013477 3300025941 Bacteria 6789
498 Ga0207689_10192097 3300025942 Bacteria 1685
499 Ga0207689_10366554 3300025942 Bacteria 1198
500 Ga0207661_10009481 3300025944 Bacteria 6984
501 Ga0207661_10012272 3300025944 Bacteria 6222
502 Ga0207661_10035290 3300025944 Bacteria 3895
503 Ga0207661_10064139 3300025944 Bacteria 2977
504 Ga0207661_10344080 3300025944 Bacteria 1344
505 Ga0207679_10021834 3300025945 Bacteria 4347
506 Ga0207679_10157124 3300025945 Bacteria 1858
507 Ga0207679_10387965 3300025945 Bacteria 1226
508 Ga0207679_11079190 3300025945 Unclassified 736
509 Ga0207667_10008046 3300025949 Bacteria 12575
510 Ga0207667_10027499 3300025949 Bacteria 6190
511 Ga0207667_10054673 3300025949 Bacteria 4199
512 Ga0207651_10078948 3300025960 Bacteria 2363
513 Ga0207651_10261584 3300025960 Bacteria 1421
514 Ga0207712_10033227 3300025961 Bacteria 3486
515 Ga0207668_10026483 3300025972 Bacteria 3765
516 Ga0207640_10248644 3300025981 Bacteria 1379
517 Ga0207640_10655170 3300025981 Bacteria 895
518 Ga0207658_10105465 3300025986 Bacteria 2217
519 Ga0207658_10558350 3300025986 Bacteria 1025
520 Ga0207677_10000385 3300026023 Bacteria 30475
521 Ga0207677_10002302 3300026023 Bacteria 10038
522 Ga0207677_10090209 3300026023 Bacteria 2227
523 Ga0207677_10136772 3300026023 Unclassified 1869
524 Ga0207677_10393925 3300026023 Bacteria 1173
525 Ga0207703_10075473 3300026035 Bacteria 2794
526 Ga0207703_10091407 3300026035 Bacteria 2560
527 Ga0207703_10108045 3300026035 Bacteria 2369
528 Ga0207703_10313435 3300026035 Bacteria 1435
529 Ga0207703_10600090 3300026035 Bacteria 1041
530 Ga0207703_11170135 3300026035 Bacteria 739
531 Ga0207639_10027869 3300026041 Bacteria 4119
532 Ga0207639_10163784 3300026041 Bacteria 1876
533 Ga0207639_10370730 3300026041 Bacteria 1283
534 Ga0207678_10000436 3300026067 Bacteria 37859
535 Ga0207678_10009284 3300026067 Bacteria 8654
536 Ga0207678_10034550 3300026067 Bacteria 4403
537 Ga0207678_10885844 3300026067 Bacteria 789
538 Ga0207708_10002776 3300026075 Bacteria 12866
539 Ga0207708_10194459 3300026075 Bacteria 1616
540 Ga0207702_10000304 3300026078 Bacteria 56789
541 Ga0207702_10004007 3300026078 Bacteria 13229
542 Ga0207702_10033370 3300026078 Bacteria 4299
543 Ga0207702_10034868 3300026078 Bacteria 4208
544 Ga0207702_10066598 3300026078 Unclassified 3088
545 Ga0207702_10194518 3300026078 Bacteria 1876
546 Ga0207702_10205268 3300026078 Unclassified 1829
547 Ga0207702_10701597 3300026078 Bacteria 997
548 Ga0207702_10836463 3300026078 Bacteria 911
549 Ga0207641_10013721 3300026088 Bacteria 6647
550 Ga0207641_10058540 3300026088 Unclassified 3279
551 Ga0207641_10200440 3300026088 Bacteria 1840
552 Ga0207641_10340477 3300026088 Bacteria 1427
553 Ga0207641_10358455 3300026088 Bacteria 1392
554 Ga0207648_10001324 3300026089 Bacteria 27539
555 Ga0207648_10909541 3300026089 Unclassified 822
556 Ga0207676_10017836 3300026095 Bacteria 5150
557 Ga0207676_10137029 3300026095 Bacteria 2090
558 Ga0207676_10350910 3300026095 Bacteria 1364
559 Ga0207676_10987855 3300026095 Bacteria 829
560 Ga0207674_10023497 3300026116 Bacteria 6602
561 Ga0207674_10027671 3300026116 Bacteria 5993
562 Ga0207674_10088139 3300026116 Bacteria 3096
563 Ga0207674_10141236 3300026116 Bacteria 2367
564 Ga0207674_10160721 3300026116 Bacteria 2201
565 Ga0207674_10193320 3300026116 Bacteria 1985
566 Ga0207675_100008274 3300026118 Bacteria 9797
567 Ga0207675_100194822 3300026118 Bacteria 1945
568 Ga0207683_10051765 3300026121 Bacteria 3598
569 Ga0207683_10333286 3300026121 Bacteria 1391
570 Ga0207683_10467171 3300026121 Bacteria 1164
571 Ga0207698_10020509 3300026142 Bacteria 4551
572 Ga0207698_10248507 3300026142 Unclassified 1626
573 Ga0209813_10008133 3300027866 Bacteria 2639
574 Ga0209813_10126233 3300027866 Bacteria 895
575 Ga0207428_10000032 3300027907 Bacteria 232162
576 Ga0207428_10147218 3300027907 Bacteria 1794
577 Ga0207428_10155814 3300027907 Bacteria 1737
578 Ga0207428_10195035 3300027907 Bacteria 1525
579 Ga0268266_10000114 3300028379 Bacteria 166519
580 Ga0268265_10046620 3300028380 Bacteria 3241
581 Ga0268265_10120344 3300028380 Bacteria 2162
582 Ga0268265_10389032 3300028380 Bacteria 1285
583 Ga0268264_10039968 3300028381 Bacteria 3875
584 Ga0268264_10056395 3300028381 Bacteria 3285
585 Ga0307511_10137685 3300030521 Bacteria 1447
586 Ga0307511_10280011 3300030521 Bacteria 772
587 Ga0265327_10003797 3300031251 Bacteria 13989
588 Ga0307509_10043062 3300031507 Bacteria 4887
589 Ga0307509_10259619 3300031507 Bacteria 1514
590 Ga0307408_100088219 3300031548 Bacteria 2336
591 Ga0307408_100222095 3300031548 Bacteria 1542
592 Ga0307508_10041829 3300031616 Bacteria 4112
593 Ga0307514_10059318 3300031649 Bacteria 2924
594 Ga0316576_10015783 3300031727 Bacteria 5079
595 Ga0316576_10072009 3300031727 Bacteria 2550
596 Ga0316578_10002626 3300031728 Bacteria 7969
597 Ga0316578_10006327 3300031728 Bacteria 5834
598 Ga0307405_10150359 3300031731 Bacteria 1636
599 Ga0307405_10265501 3300031731 Bacteria 1284
600 Ga0316577_10001160 3300031733 Bacteria 12069
601 Ga0316577_10017999 3300031733 Bacteria 3906
602 Ga0307410_10035745 3300031852 Bacteria 3230
603 Ga0307406_10403739 3300031901 Bacteria 1084
604 Ga0307406_10896801 3300031901 Unclassified 754
605 Ga0307412_10930658 3300031911 Bacteria 764
606 Ga0307409_101011768 3300031995 Bacteria 849
607 Ga0307409_101076497 3300031995 Bacteria 824
608 Ga0307409_101494949 3300031995 Bacteria 703
609 Ga0307416_100013675 3300032002 Bacteria 5526
610 Ga0307416_100077692 3300032002 Bacteria 2789
611 Ga0307414_10000794 3300032004 Bacteria 16161
612 Ga0307414_10297327 3300032004 Bacteria 1364
613 Ga0307414_11454626 3300032004 Bacteria 637
614 Ga0307411_11277051 3300032005 Bacteria 668
615 Ga0307415_100007983 3300032126 Bacteria 5835
616 Ga0307415_100699684 3300032126 Bacteria 914
617 Ga0316580_10012229 3300032139 Bacteria 2613
618 Ga0307507_10000038 3300033179 Bacteria 184517
619 Ga0373936_0002576 3300035113 Bacteria 6802
620 Ga0373936_0015130 3300035113 Bacteria 2956
621 Ga0373956_0354633 3300035119 Bacteria 699
622 Ga0373957_0012616 3300035120 Bacteria 2849
623 Ga0373957_0319091 3300035120 Bacteria 661
624 Ga0373955_0077124 3300035172 Bacteria 1876
625 Ga0316574_0006666 3300035398 Bacteria 6265
626 Ga0316574_0096275 3300035398 Bacteria 1891
627 Ga0316574_0103860 3300035398 Bacteria 1819
628 Ga0373927_0167263 3300035695 Bacteria 1441
629 Ga0373947_0027384 3300035725 Bacteria 3336
630 Ga0373937_0006335 3300036401 Bacteria 10205
631 Ga0373937_0047105 3300036401 Bacteria 3944
632 Ga0373937_0070560 3300036401 Bacteria 3223
633 Ga0310109_000028 3300036534 Bacteria 7045
634 Ga0316582_0001621 3300036647 Bacteria 10033
635 Ga0316582_0006238 3300036647 Bacteria 6236
636 Ga0316582_0021318 3300036647 Bacteria 3826
637 Ga0316582_0407055 3300036647 Bacteria 937
638 Ga0316584_0000394 3300036712 Bacteria 22706
639 Ga0316584_0002381 3300036712 Bacteria 11868
640 Ga0373925_0004880 3300037068 Bacteria 10092
641 Ga0373925_0185478 3300037068 Bacteria 1649
642 Ga0395898_0202186 3300037466 Bacteria 1896
643 Ga0395898_0247849 3300037466 Bacteria 1699
644 Ga0395905_0000147 3300037471 Bacteria 116389
645 Ga0436364_0850190 3300037853 Bacteria 1463
646 Ga0395901_0001140 3300038443 Bacteria 28163
647 Ga0436365_0412417 3300039437 Bacteria 3951
648 Ga0436365_0594896 3300039437 Bacteria 715
649 Ga0436365_1320901 3300039437 Bacteria 2137
650 Ga0436360_0036559 3300039438 Bacteria 1229
651 Ga0436360_1076493 3300039438 Bacteria 1174
652 Ga0436361_0037487 3300039447 Bacteria 1553
653 Ga0436361_0223467 3300039447 Bacteria 9217
654 Ga0436363_0805533 3300039450 Bacteria 51825
655 Ga0436363_1501310 3300039450 Bacteria 891
656 Ga0436362_0823064 3300039453 Bacteria 1143
657 Ga0436362_0828385 3300039453 Bacteria 714
658 Ga0436362_1291930 3300039453 Bacteria 1092
659 Ga0451797_1243763 3300041453 Bacteria 955
660 Ga0451802_0867806 3300041460 Bacteria 906
661 Ga0451849_1354144 3300041505 Bacteria 966
662 Ga0451855_0825867 3300041511 Unclassified 756
663 Ga0451853_1152909 3300041512 Bacteria 2613
664 Ga0451853_2595326 3300041512 Bacteria 1390
665 Ga0451577_0002721 3300042876 Bacteria 20559
666 Ga0451577_0004444 3300042876 Bacteria 14807
667 Ga0451577_0026279 3300042876 Bacteria 5274
668 Ga0466969_0002360 3300044656 Bacteria 10094
669 Ga0466969_0020644 3300044656 Bacteria 3409
670 Ga0466969_0109521 3300044656 Bacteria 1294
671 Ga0466966_0030263 3300044684 Bacteria 3515
672 Ga0466966_0088634 3300044684 Bacteria 1922
673 Ga0466966_0247844 3300044684 Bacteria 1073
674 Ga0466961_0010893 3300044693 Bacteria 5808
675 Ga0466961_0028311 3300044693 Bacteria 3602
676 Ga0466961_0163205 3300044693 Bacteria 1388
677 Ga0466963_0035075 3300044694 Bacteria 3267
678 Ga0466963_0092858 3300044694 Bacteria 2057
679 Ga0466963_0170263 3300044694 Bacteria 1518
680 Ga0453684_0008872 3300044712 Bacteria 17813
681 Ga0453684_0009766 3300044712 Bacteria 16663
682 Ga0453684_0020745 3300044712 Bacteria 9885
683 Ga0453684_0476512 3300044712 Bacteria 1385
684 Ga0466971_0000154 3300044719 Bacteria 25646
685 Ga0466971_0010789 3300044719 Bacteria 3996
686 Ga0466971_0073475 3300044719 Bacteria 1554
687 Ga0466957_0010209 3300044842 Bacteria 5379
688 Ga0466957_0068108 3300044842 Bacteria 2197
689 Ga0466957_0250875 3300044842 Bacteria 1177
690 Ga0466960_0080621 3300044901 Bacteria 1639
691 Ga0466959_0006560 3300045049 Bacteria 8075
692 Ga0466959_0026879 3300045049 Bacteria 4268
693 Ga0466959_0622582 3300045049 Bacteria 725
694 Ga0451576_0007064 3300045051 Bacteria 13567
695 Ga0451576_0265807 3300045051 Bacteria 1793
696 Ga0466958_0004946 3300045836 Bacteria 7110
697 Ga0466967_0435595 3300045976 Bacteria 1279
698 Ga0495592_0011617 3300046454 Bacteria 6668
699 Ga0495592_0308563 3300046454 Bacteria 1026
700 Ga0495629_0145363 3300046459 Bacteria 1649
701 Ga0495638_0007463 3300046460 Bacteria 7836
702 Ga0495651_0006018 3300046462 Bacteria 9263
703 Ga0495580_0140279 3300046472 Unclassified 1675
704 Ga0495582_0155162 3300046473 Bacteria 1301
705 Ga0495639_0281018 3300046475 Bacteria 827
706 Ga0495664_0093820 3300046477 Bacteria 1806
707 Ga0495584_0412390 3300046491 Bacteria 687
708 Ga0495608_0014836 3300046511 Bacteria 5406
709 Ga0495618_0374164 3300046514 Bacteria 875
710 Ga0495628_0203930 3300046516 Bacteria 1489
711 Ga0495628_0430483 3300046516 Bacteria 960
712 Ga0495630_0687006 3300046517 Unclassified 783
713 Ga0495652_0001107 3300046529 Bacteria 30520
714 Ga0495621_0088620 3300046539 Bacteria 1164
715 Ga0495645_0156182 3300046543 Bacteria 1580
716 Ga0495667_0002634 3300046559 Bacteria 11984
717 Ga0495656_0110278 3300046615 Bacteria 1286
718 Ga0495634_0132612 3300046642 Bacteria 1587
719 Ga0495635_0059579 3300046663 Bacteria 2625
720 Ga0495588_0161338 3300046674 Bacteria 1186
721 Ga0495657_0002235 3300046675 Bacteria 16391
722 Ga0495599_0262802 3300046678 Bacteria 1048
723 Ga0495623_0288585 3300046679 Bacteria 910
724 Ga0495646_0015096 3300046680 Bacteria 4907
725 Ga0495647_0247522 3300046681 Bacteria 793
726 Ga0495658_0047886 3300046683 Bacteria 2409
727 Ga0495613_0010774 3300046689 Bacteria 6783
728 Ga0495613_0326137 3300046689 Bacteria 1059
729 Ga0495600_0033115 3300046809 Bacteria 3354
730 Ga0495600_0440679 3300046809 Bacteria 806
731 Ga0495674_0131414 3300047319 Bacteria 2109
732 Ga0495674_0521780 3300047319 Bacteria 948
733 Ga0495676_0326088 3300047321 Bacteria 1031
734 Ga0495680_0096004 3300047322 Bacteria 2215
735 Ga0495675_0047311 3300047444 Bacteria 2737
736 Ga0495675_0173012 3300047444 Bacteria 1325
737 Ga0495677_0174206 3300047445 Bacteria 833
738 Ga0495684_0113314 3300047471 Bacteria 2045
739 Ga0495602_0056089 3300048088 Bacteria 3467
740 Ga0495602_0114003 3300048088 Bacteria 2190
741 Ga0496100_0002656 3300048903 Bacteria 9115
742 Ga0496100_0065121 3300048903 Bacteria 2414
743 Ga0496100_0748985 3300048903 Bacteria 764
744 Ga0496101_0331298 3300048904 Bacteria 1195
745 Ga0496102_0004755 3300048905 Bacteria 11494
746 Ga0496102_0158676 3300048905 Bacteria 2127
747 Ga0496103_0011593 3300048906 Bacteria 5227
748 Ga0496103_0180384 3300048906 Bacteria 1357
749 Ga0496103_0474459 3300048906 Bacteria 801
750 Ga0496104_0000004 3300048907 Bacteria 641830
751 Ga0496104_0062014 3300048907 Bacteria 3545
752 Ga0496105_0000001 3300048908 Bacteria 1328178
753 Ga0496105_0047865 3300048908 Bacteria 3528
754 Ga0496107_0004422 3300048910 Bacteria 9527
755 Ga0496108_0011228 3300048911 Bacteria 7276
756 Ga0496108_0014324 3300048911 Bacteria 6473
757 Ga0496109_0000115 3300048912 Bacteria 82707
758 Ga0496109_0010805 3300048912 Bacteria 7816
759 Ga0496109_0330696 3300048912 Bacteria 1439
760 Ga0496109_0511940 3300048912 Bacteria 1133
761 Ga0496109_0519282 3300048912 Bacteria 1124
762 Ga0496110_0008225 3300048913 Bacteria 8384
763 Ga0496112_0006052 3300048915 Bacteria 10566
764 Ga0496112_0083212 3300048915 Unclassified 3165
765 Ga0496114_0789523 3300048917 Bacteria 828
766 Ga0496115_0000012 3300048918 Bacteria 215509
767 Ga0496115_0000017 3300048918 Bacteria 185702
768 Ga0496116_0000360 3300048919 Bacteria 70849
769 Ga0496116_0118744 3300048919 Bacteria 1535
770 Ga0496116_0163150 3300048919 Bacteria 1219
771 Ga0496117_0045326 3300048920 Bacteria 3177
772 Ga0496118_0001416 3300048921 Bacteria 36186
773 Ga0496118_0015490 3300048921 Bacteria 7055
774 Ga0496118_0093331 3300048921 Bacteria 2062
775 Ga0496118_0094965 3300048921 Bacteria 2037
776 Ga0496119_0003375 3300048922 Bacteria 16614
777 Ga0496119_0019417 3300048922 Bacteria 5007
778 Ga0496119_0124658 3300048922 Bacteria 1411
779 Ga0496119_0216138 3300048922 Bacteria 983
780 Ga0496120_0008036 3300048923 Bacteria 7760
781 Ga0496120_0216837 3300048923 Bacteria 917
782 Ga0496121_0021569 3300048924 Bacteria 6302
783 Ga0496121_0176915 3300048924 Bacteria 1544
784 Ga0496124_0080587 3300048927 Bacteria 2678
785 Ga0496124_0209001 3300048927 Bacteria 1478
786 Ga0496125_0017162 3300048928 Bacteria 6918
787 Ga0496125_0162238 3300048928 Bacteria 1516
788 Ga0496126_0160626 3300048929 Bacteria 1920
789 Ga0501031_0000672 3300049568 Bacteria 20373
790 Ga0501031_0022901 3300049568 Bacteria 4074
791 Ga0501031_0077876 3300049568 Bacteria 2159
792 Ga0501031_0081159 3300049568 Bacteria 2114
793 Ga0501031_0129227 3300049568 Archaea 1650
794 Ga0501031_0176225 3300049568 Bacteria 1397
795 Ga0501032_0000408 3300049569 Bacteria 35429
796 Ga0501032_0001581 3300049569 Bacteria 18150
797 Ga0501032_0030727 3300049569 Bacteria 3686
798 Ga0501032_0070393 3300049569 Bacteria 2333
799 Ga0501032_0542727 3300049569 Bacteria 741
800 Ga0501033_0002830 3300049570 Bacteria 14532
801 Ga0501033_0009823 3300049570 Bacteria 7345
802 Ga0501034_0002858 3300049571 Bacteria 20122
803 Ga0501034_0004186 3300049571 Bacteria 16102
804 Ga0501034_0038297 3300049571 Bacteria 4856
805 Ga0501034_0079277 3300049571 Bacteria 3288
806 Ga0501034_0093021 3300049571 Bacteria 3012
807 Ga0501034_0562069 3300049571 Bacteria 1049
808 Ga0501036_0006356 3300049572 Bacteria 9590
809 Ga0501036_0013492 3300049572 Bacteria 6790
810 Ga0501036_0013729 3300049572 Bacteria 6734
811 Ga0501036_0212006 3300049572 Bacteria 1627
812 Ga0501037_0002310 3300049573 Bacteria 13771
813 Ga0501037_0003119 3300049573 Bacteria 12014
814 Ga0501037_0541080 3300049573 Unclassified 787
815 Ga0501037_0584544 3300049573 Bacteria 751
816 Ga0501038_0002847 3300049574 Bacteria 16103
817 Ga0501038_0003709 3300049574 Bacteria 14236
818 Ga0501038_0027683 3300049574 Bacteria 5041
819 Ga0501038_0213155 3300049574 Bacteria 1544
820 Ga0501039_0012900 3300049575 Bacteria 6390
821 Ga0501040_0202598 3300049576 Bacteria 1409
822 Ga0501041_0020677 3300049577 Bacteria 3937
823 Ga0501041_0155983 3300049577 Bacteria 1426
824 Ga0501042_0154913 3300049578 Bacteria 1653
825 Ga0501043_0001699 3300049579 Bacteria 19065
826 Ga0501043_0023253 3300049579 Bacteria 4860
827 Ga0501046_0000914 3300049580 Bacteria 28893
828 Ga0501046_0134605 3300049580 Bacteria 1872
829 Ga0501046_0401799 3300049580 Bacteria 990
830 Ga0501047_0001308 3300049581 Bacteria 24558
831 Ga0501047_0012908 3300049581 Bacteria 7914
832 Ga0501047_0013835 3300049581 Bacteria 7660
833 Ga0501047_0031159 3300049581 Bacteria 5143
834 Ga0501047_0089254 3300049581 Bacteria 2960
835 Ga0501047_0354987 3300049581 Bacteria 1302
836 Ga0501048_0000126 3300049582 Bacteria 44703
837 Ga0501048_0020915 3300049582 Bacteria 4793
838 Ga0501048_0190486 3300049582 Bacteria 1453
839 Ga0501048_0540764 3300049582 Bacteria 836
840 Ga0501048_0708063 3300049582 Bacteria 723
841 Ga0501067_0000587 3300049583 Bacteria 19598
842 Ga0501067_0003173 3300049583 Bacteria 9073
843 Ga0501068_0001780 3300049584 Bacteria 11457
844 Ga0501068_0042478 3300049584 Bacteria 2734
845 Ga0501069_0000824 3300049585 Bacteria 14643
846 Ga0501069_0036206 3300049585 Bacteria 2720
847 Ga0501069_0155096 3300049585 Bacteria 1317
848 Ga0501070_0002563 3300049586 Bacteria 15897
849 Ga0501070_0085405 3300049586 Bacteria 2613
850 Ga0501070_0247057 3300049586 Bacteria 1460
851 Ga0501071_0001042 3300049587 Bacteria 15352
852 Ga0501071_0090453 3300049587 Bacteria 2247
853 Ga0501071_0166152 3300049587 Bacteria 1651
854 Ga0501072_0064051 3300049588 Bacteria 2899
855 Ga0501072_0234297 3300049588 Bacteria 1462
856 Ga0501072_0364895 3300049588 Bacteria 1146
857 Ga0501073_0015155 3300049589 Bacteria 5592
858 Ga0501073_0016821 3300049589 Bacteria 5298
859 Ga0501073_0028840 3300049589 Bacteria 3965
860 Ga0501073_0085973 3300049589 Bacteria 2187
861 Ga0501074_0001349 3300049590 Bacteria 16261
862 Ga0501074_0057911 3300049590 Bacteria 2792
863 Ga0501074_0067643 3300049590 Bacteria 2568
864 Ga0501074_0277971 3300049590 Bacteria 1190
865 Ga0501075_0632972 3300049591 Bacteria 816
866 Ga0501076_0009291 3300049592 Bacteria 7254
867 Ga0501076_0138681 3300049592 Bacteria 1975
868 Ga0501076_0201820 3300049592 Bacteria 1624
869 Ga0501076_0324659 3300049592 Bacteria 1262
870 Ga0501077_0022038 3300049593 Bacteria 4035
871 Ga0501077_0041532 3300049593 Bacteria 2927
872 Ga0501249_069821 3300049679 Bacteria 820
873 Ga0501225_0051255 3300049705 Bacteria 1149
874 Ga0501079_0003550 3300049741 Bacteria 11467
875 Ga0501079_0309114 3300049741 Bacteria 1237
876 Ga0501079_0377251 3300049741 Bacteria 1112
877 Ga0501079_0506649 3300049741 Bacteria 949
878 Ga0501080_0000390 3300049742 Bacteria 33829
879 Ga0501080_0010505 3300049742 Bacteria 8477
880 Ga0501080_0035034 3300049742 Bacteria 4686
881 Ga0501081_0681531 3300049743 Bacteria 771
882 Ga0501083_0014925 3300049744 Bacteria 5434
883 Ga0501083_0026462 3300049744 Bacteria 4009
884 Ga0501083_0027635 3300049744 Bacteria 3913
885 Ga0501083_0058815 3300049744 Bacteria 2571
886 Ga0501083_0096375 3300049744 Bacteria 1952
887 Ga0501035_0001653 3300049822 Bacteria 22528
888 Ga0501035_0010137 3300049822 Bacteria 8745
889 Ga0501035_0064080 3300049822 Bacteria 3267
890 Ga0501035_0194050 3300049822 Bacteria 1745
891 Ga0501035_0808261 3300049822 Bacteria 748
892 Ga0501044_0003244 3300049823 Bacteria 18288
893 Ga0501044_0006361 3300049823 Bacteria 13055
894 Ga0501044_0185619 3300049823 Bacteria 2045
895 Ga0501044_0616789 3300049823 Bacteria 977
896 Ga0501044_0647063 3300049823 Bacteria 946
897 Ga0501044_0673821 3300049823 Bacteria 921
898 Ga0501044_0693920 3300049823 Bacteria 904
899 Ga0501045_0012395 3300049824 Bacteria 6004
900 Ga0501045_0016471 3300049824 Bacteria 5252
901 Ga0501045_0044941 3300049824 Bacteria 3217
902 Ga0501045_0189622 3300049824 Bacteria 1532
903 nmdc:mga03683_44275_c1 3300050489 Bacteria 1839
904 nmdc:mga00v17_489556_c1 3300050491 Bacteria 797
905 nmdc:mga00v17_8262_c1 3300050491 Bacteria 5600
906 nmdc:mga0yw44_1545_c1 3300050492 Bacteria 9211
907 nmdc:mga0yw44_33003_c1 3300050492 Bacteria 3021
908 nmdc:mga0k408_1062_c1 3300050493 Bacteria 15089
909 nmdc:mga0k408_188523_c1 3300050493 Bacteria 1230
910 nmdc:mga06z11_1317_c1 3300050494 Bacteria 9184
911 nmdc:mga04h51_3149_c1 3300050495 Bacteria 3980
912 nmdc:mga07m45_26566_c1 3300050496 Bacteria 3183
913 nmdc:mga05p37_116979_c1 3300050507 Bacteria 3276
914 nmdc:mga05p37_23148_c1 3300050507 Bacteria 7537
915 nmdc:mga05p37_3488_c1 3300050507 Bacteria 18382
916 nmdc:mga05p37_359038_c1 3300050507 Bacteria 1713
917 nmdc:mga05p37_38094_c1 3300050507 Bacteria 5897
918 nmdc:mga05p37_61598_c1 3300050507 Bacteria 4618
919 nmdc:mga09592_161874_c1 3300050508 Bacteria 1933
920 nmdc:mga09592_20362_c1 3300050508 Bacteria 5453
921 nmdc:mga09592_212835_c1 3300050508 Bacteria 1675
922 nmdc:mga09592_47249_c1 3300050508 Bacteria 3627
923 nmdc:mga09592_57007_c1 3300050508 Bacteria 3301
924 nmdc:mga09592_71456_c1 3300050508 Bacteria 2945
925 nmdc:mga0qj67_187989_c1 3300050509 Bacteria 1678
926 nmdc:mga0qj67_8930_c1 3300050509 Bacteria 7435
927 nmdc:mga06r32_1524_c1 3300050510 Bacteria 20826
928 nmdc:mga06r32_690619_c1 3300050510 Bacteria 987
929 nmdc:mga08y16_133869_c1 3300050511 Bacteria 2576
930 nmdc:mga08y16_144_c1 3300050511 Bacteria 61900
931 nmdc:mga08y16_147890_c1 3300050511 Bacteria 2442
932 nmdc:mga08y16_157527_c1 3300050511 Bacteria 2360
933 nmdc:mga08y16_29841_c1 3300050511 Bacteria 5743
934 nmdc:mga08y16_89758_c1 3300050511 Bacteria 3203
935 nmdc:mga0n895_111492_c1 3300050512 Bacteria 2752
936 nmdc:mga0n895_27653_c1 3300050512 Bacteria 5390
937 nmdc:mga0n895_813980_c1 3300050512 Bacteria 924
938 nmdc:mga0rr50_32276_c1 3300050513 Bacteria 3730
939 nmdc:mga0rr50_55280_c1 3300050513 Bacteria 2961
940 nmdc:mga08x19_710179_c1 3300050514 Unclassified 713
941 nmdc:mga0a205_32741_c1 3300050515 Bacteria 4983
942 nmdc:mga0a205_56771_c1 3300050515 Bacteria 3780
943 nmdc:mga0a205_817910_c1 3300050515 Bacteria 779
944 nmdc:mga0a205_890755_c1 3300050515 Bacteria 737
945 nmdc:mga0a205_89306_c1 3300050515 Bacteria 2979
946 nmdc:mga0sz30_98124_c1 3300050516 Bacteria 1278
947 Ga0495601_0079115 3300053077 Bacteria 2107
948 Ga0495601_0099111 3300053077 Bacteria 1881
949 Ga0495612_0004589 3300053078 Bacteria 5727
950 Ga0495619_0000037 3300053085 Bacteria 124007
951 Ga0495619_0035313 3300053085 Bacteria 3251
952 Ga0495619_0310845 3300053085 Bacteria 1091
953 Ga0500566_0005610 3300053094 Bacteria 7453
954 Ga0500566_0124061 3300053094 Bacteria 1389
955 Ga0500595_026833 3300053119 Bacteria 1980
956 Ga0501084_0000570 3300054114 Bacteria 28154
957 Ga0501084_0012755 3300054114 Bacteria 6961
958 Ga0501084_0150022 3300054114 Bacteria 1965
959 Ga0501084_0376445 3300054114 Bacteria 1200
960 Ga0501084_0381214 3300054114 Bacteria 1192
961 Ga0501082_0014056 3300060353 Bacteria 6885
962 Ga0501082_0031185 3300060353 Bacteria 4595
963 Ga0501082_0091084 3300060353 Bacteria 2633
964 Ga0501082_0240646 3300060353 Bacteria 1575
965 Ga0501082_0613535 3300060353 Bacteria 952
966 Ga0466962_0000909 3300061719 Bacteria 13428
967 Ga0466962_0145483 3300061719 Bacteria 1149
968 Ga0530510_0059141 3300061734 Bacteria 2772
969 Ga0530510_0221702 3300061734 Bacteria 1406
970 2522548016 2522125168 Bacteria 7376607
971 2730135315 2728369359 Bacteria 5621728
972 2739616828 2739367656 Bacteria 5152243
973 2875392641 2875391855 Bacteria 7600475
974 2904595484 2904595352 Bacteria 6124848
975 2939705239 2939702853 Bacteria 5139229
976 Ga0070706_100112996
977 rootH1_10077023
978 rootH2_10058891
979 rootL2_10318583
980 Ga0055536_1005846
981 Ga0055531_10000087
982 Ga0065165_1000396
983 Ga0065704_10282964
984 Ga0065712_10133099
985 Ga0070658_10161126
986 Ga0070658_10191294
987 Ga0070676_10446797
988 Ga0070683_100002001
989 Ga0070683_100029658
990 Ga0070683_100045091
991 Ga0070683_100066475
992 Ga0070690_100016725
993 Ga0070690_100062514
994 Ga0070690_100218685
995 Ga0070670_100000207
996 Ga0070670_100762691
997 Ga0068869_100146319
998 Ga0068869_100204435
999 Ga0068869_100549970
1000 Ga0068869_100637539
1001 Ga0070666_10003775
1002 Ga0070666_10056449
1003 Ga0070666_10104433
1004 Ga0070680_100000851
1005 Ga0070680_100101365
1006 Ga0070680_100537881
1007 Ga0070682_100428117
1008 Ga0068868_100000724
1009 Ga0068868_100075031
1010 Ga0068868_100155897
1011 Ga0068868_100367217
1012 Ga0070660_100011360
1013 Ga0070660_100024216
1014 Ga0070689_100139540
1015 Ga0070689_100162576
1016 Ga0070691_10282498
1017 Ga0070687_100038225
1018 Ga0070687_100419492
1019 Ga0070661_100012774
1020 Ga0070661_100015958
1021 Ga0070661_100044366
1022 Ga0070692_10001566
1023 Ga0070692_10013844
1024 Ga0070668_100062267
1025 Ga0070668_100156042
1026 Ga0070669_100075250
1027 Ga0070669_100111541
1028 Ga0070675_100038493
1029 Ga0070675_100045451
1030 Ga0070675_100165680
1031 Ga0070671_100034456
1032 Ga0070671_100066279
1033 Ga0070674_100076211
1034 Ga0070688_100001589
1035 Ga0070688_100119157
1036 Ga0070659_100001330
1037 Ga0070659_100033625
1038 Ga0070667_100050175
1039 Ga0070667_100050393
1040 Ga0070709_10200179
1041 Ga0070709_10226004
1042 Ga0070714_100000998
1043 Ga0070714_100021407
1044 Ga0070714_100439629
1045 Ga0070714_101126792
1046 Ga0070713_100001968
1047 Ga0070713_100023666
1048 Ga0070713_100104464
1049 Ga0070713_100121628
1050 Ga0070713_100164656
1051 Ga0070713_100360319
1052 Ga0070713_100424601
1053 Ga0070710_10035057
1054 Ga0070701_10062407
1055 Ga0070701_10089205
1056 Ga0070711_100129753
1057 Ga0070711_100160625
1058 Ga0070711_100177488
1059 Ga0070711_100266410
1060 Ga0070711_100715461
1061 Ga0070705_100042378
1062 Ga0070705_100234203
1063 Ga0070705_100857552
1064 Ga0070700_100006126
1065 Ga0070700_100109996
1066 Ga0070694_100064846
1067 Ga0070708_100002773
1068 Ga0070708_100897006
1069 Ga0070663_100003770
1070 Ga0070663_100670193
1071 Ga0070678_100043278
1072 Ga0070678_100054608
1073 Ga0070678_100297636
1074 Ga0070678_101219724
1075 Ga0070662_100002142
1076 Ga0070681_10000229
1077 Ga0070681_10006386
1078 Ga0070681_10107572
1079 Ga0070681_10169999
1080 Ga0070681_10238924
1081 Ga0068867_100022943
1082 Ga0068867_100078397
1083 Ga0068867_100521761
1084 Ga0070685_10001752
1085 Ga0070685_10113659
1086 Ga0070706_100002983
1087 Ga0070706_100039185
1088 Ga0070707_100002460
1089 Ga0070707_100479089
1090 Ga0070698_100004516
1091 Ga0070698_100014925
1092 Ga0070698_101021314
1093 Ga0070699_100012919
1094 Ga0070679_100000982
1095 Ga0070679_100001940
1096 Ga0070679_100028311
1097 Ga0070679_100036311
1098 Ga0070679_100159288
1099 Ga0070679_100220165
1100 Ga0070679_100274896
1101 Ga0070679_100989091
1102 Ga0070684_100004657
1103 Ga0070684_100024983
1104 Ga0070684_100165626
1105 Ga0070684_100384105
1106 Ga0070684_100393209
1107 Ga0070697_100019771
1108 Ga0070697_100051147
1109 Ga0070697_100079032
1110 Ga0068853_100011034
1111 Ga0068853_100738132
1112 Ga0068853_100782799
1113 Ga0070672_100002719
1114 Ga0070672_100013963
1115 Ga0070672_100064638
1116 Ga0070672_100462153
1117 Ga0070686_100008137
1118 Ga0070686_100019718
1119 Ga0070695_100004688
1120 Ga0070695_100317512
1121 Ga0070693_100018891
1122 Ga0070693_100064150
1123 Ga0070693_100165851
1124 Ga0070693_100346207
1125 Ga0070693_100478570
1126 Ga0070665_100006697
1127 Ga0070665_100207711
1128 Ga0070704_100176196
1129 Ga0070704_100206787
1130 Ga0068855_100001344
1131 Ga0068855_100016503
1132 Ga0070664_100001854
1133 Ga0070664_100028719
1134 Ga0070664_100125856
1135 Ga0070664_100152241
1136 Ga0070664_100158028
1137 Ga0070664_100700473
1138 Ga0068857_100039760
1139 Ga0068857_100103851
1140 Ga0068857_100110624
1141 Ga0068857_100195728
1142 Ga0068857_100218093
1143 Ga0068854_100020944
1144 Ga0068854_100123766
1145 Ga0068854_100524395
1146 Ga0068856_100000269
1147 Ga0068856_100001308
1148 Ga0068856_100008504
1149 Ga0068856_100088073
1150 Ga0068856_100091155
1151 Ga0068856_100174140
1152 Ga0068856_100655858
1153 Ga0068856_100732069
1154 Ga0068856_100793496
1155 Ga0070702_100024548
1156 Ga0068852_100011008
1157 Ga0068852_100025487
1158 Ga0068859_100003024
1159 Ga0068859_100110766
1160 Ga0068859_100111197
1161 Ga0068859_100211788
1162 Ga0068859_100383983
1163 Ga0068859_100956122
1164 Ga0068864_100011330
1165 Ga0068864_100029472
1166 Ga0068864_100040860
1167 Ga0068864_100089807
1168 Ga0068864_100805718
1169 Ga0068861_100015698
1170 Ga0068861_100896479
1171 Ga0068851_10175736
1172 Ga0068870_10354194
1173 Ga0068870_10606300
1174 Ga0068863_100014094
1175 Ga0068863_100041704
1176 Ga0068863_100216470
1177 Ga0068863_100333525
1178 Ga0068863_100446634
1179 Ga0068858_100019598
1180 Ga0068858_100044626
1181 Ga0068858_100102323
1182 Ga0068858_100102729
1183 Ga0068858_100247528
1184 Ga0068858_100511347
1185 Ga0068860_100043979
1186 Ga0068860_100758300
1187 Ga0068862_100056787
1188 Ga0068862_100249051
1189 Ga0068862_100251129
1190 Ga0068862_100622536
1191 Ga0081455_10008769
1192 Ga0081455_10038588
1193 Ga0081455_10098648
1194 Ga0081538_10001123
1195 Ga0081540_1000265
1196 Ga0081540_1002544
1197 Ga0081540_1157310
1198 Ga0070717_10003751
1199 Ga0070717_10019093
1200 Ga0070717_10404830
1201 Ga0070717_10687979
1202 Ga0075365_10017319
1203 Ga0075365_10033549
1204 Ga0075365_10102791
1205 Ga0075368_10022088
1206 Ga0075368_10051889
1207 Ga0075363_100046048
1208 Ga0075364_10009991
1209 Ga0070712_100153768
1210 Ga0070712_100393437
1211 Ga0075362_10011804
1212 Ga0075367_10001445
1213 Ga0075367_10072997
1214 Ga0075366_10000307
1215 Ga0075366_10176017
1216 Ga0075366_10274793
1217 Ga0097621_100001313
1218 Ga0097621_100012438
1219 Ga0097621_100051312
1220 Ga0097621_100057803
1221 Ga0097621_100220280
1222 Ga0075370_10039897
1223 Ga0068871_100000510
1224 Ga0068871_100004430
1225 Ga0068871_100077234
1226 Ga0068871_100244101
1227 Ga0068871_100252769
1228 Ga0068871_100402814
1229 Ga0075428_100004866
1230 Ga0075428_100017204
1231 Ga0075428_100039391
1232 Ga0075428_100196176
1233 Ga0075428_100511184
1234 Ga0075428_100747221
1235 Ga0075430_100002187
1236 Ga0075430_100093313
1237 Ga0075431_100001969
1238 Ga0075431_100028616
1239 Ga0075431_100043921
1240 Ga0075431_100056908
1241 Ga0075431_100320974
1242 Ga0075433_10050269
1243 Ga0075433_10057483
1244 Ga0075434_100014876
1245 Ga0075434_100101297
1246 Ga0075434_100242385
1247 Ga0075429_100005425
1248 Ga0075429_100061721
1249 Ga0075429_100106052
1250 Ga0075429_100259404
1251 Ga0075429_100515427
1252 Ga0068865_100000278
1253 Ga0068865_100054786
1254 Ga0068865_100394495
1255 Ga0075436_100133582
1256 Ga0097620_100003024
1257 Ga0097620_100110769
1258 Ga0097620_100111192
1259 Ga0097620_100211792
1260 Ga0097620_100383977
1261 Ga0097620_100956157
1262 Ga0075435_100042467
1263 Ga0075435_100075480
1264 Ga0105240_10024854
1265 Ga0105240_10046731
1266 Ga0105240_10071285
1267 Ga0105240_10072327
1268 Ga0105240_10474392
1269 Ga0111539_10001522
1270 Ga0111539_10004893
1271 Ga0111539_10020295
1272 Ga0111539_10124142
1273 Ga0111539_10131290
1274 Ga0111539_10237972
1275 Ga0105245_10001072
1276 Ga0105245_10006775
1277 Ga0105245_10257004
1278 Ga0105245_10767243
1279 Ga0105247_10255968
1280 Ga0114129_10018514
1281 Ga0114129_10020185
1282 Ga0114129_10075416
1283 Ga0114129_10127258
1284 Ga0114129_10128563
1285 Ga0114129_10313351
1286 Ga0114129_10390841
1287 Ga0105243_10003742
1288 Ga0105243_10009769
1289 Ga0105241_10092768
1290 Ga0105241_10261739
1291 Ga0105241_10391606
1292 Ga0105241_10446339
1293 Ga0105248_10000008
1294 Ga0105248_10004704
1295 Ga0105248_10093286
1296 Ga0105248_10267500
1297 Ga0105248_10819466
1298 Ga0105237_10008678
1299 Ga0105237_10038987
1300 Ga0105237_10471748
1301 Ga0105237_10871108
1302 Ga0105237_10963486
1303 Ga0105238_10000743
1304 Ga0105238_10143194
1305 Ga0105238_10172407
1306 Ga0105238_10216549
1307 Ga0105238_10263920
1308 Ga0105238_10501006
1309 Ga0105249_10067038
1310 Ga0105239_10162831
1311 Ga0105239_10265027
1312 Ga0105239_10284433
1313 Ga0105239_10720749
1314 Ga0105239_10766630
1315 Ga0105246_10080451
1316 Ga0105246_10146247
1317 Ga0105246_10399415
1318 Ga0157373_10001156
1319 Ga0157373_10005500
1320 Ga0157373_10019021
1321 Ga0157373_10391170
1322 Ga0157371_10007405
1323 Ga0157371_10048902
1324 Ga0157370_10017755
1325 Ga0157370_10330122
1326 Ga0157370_10585898
1327 Ga0157369_10003895
1328 Ga0157369_10005857
1329 Ga0157369_10006212
1330 Ga0157369_10142685
1331 Ga0157374_10000299
1332 Ga0157374_10000673
1333 Ga0157374_10117251
1334 Ga0157374_10317779
1335 Ga0157374_10399802
1336 Ga0157374_10661082
1337 Ga0157374_11129333
1338 Ga0157378_10001436
1339 Ga0157378_10062392
1340 Ga0157378_10094349
1341 Ga0157378_10825682
1342 Ga0163162_10002123
1343 Ga0163162_10150431
1344 Ga0163162_11102838
1345 Ga0157372_10001884
1346 Ga0157372_10006669
1347 Ga0157372_10012317
1348 Ga0157372_10019286
1349 Ga0157372_10135620
1350 Ga0157372_10243090
1351 Ga0157372_10269452
1352 Ga0157372_10746042
1353 Ga0157375_10010182
1354 Ga0157375_10281333
1355 Ga0163163_10008634
1356 Ga0157380_10057403
1357 Ga0157377_10078658
1358 Ga0157377_10082872
1359 Ga0157379_10149226
1360 Ga0157379_10275650
1361 Ga0157376_10042614
1362 Ga0157376_10097705
1363 Ga0157376_10343753
1364 Ga0157376_11091258
1365 Ga0206352_10810822
1366 Ga0206354_10638829
1367 Ga0206354_11335030
1368 Ga0206353_10828775
1369 Ga0206353_11254201
1370 Ga0206353_11575633
1371 Ga0213873_10057946
1372 Ga0213873_10108185
1373 Ga0213872_10010137
1374 Ga0213872_10186564
1375 Ga0213874_10006235
1376 Ga0213876_10035356
1377 Ga0213875_10245052
1378 Ga0224712_10085856
1379 Ga0209676_1000390
1380 Ga0209257_1000006
1381 Ga0207682_10059553
1382 Ga0207692_10109217
1383 Ga0207710_10000461
1384 Ga0207688_10038104
1385 Ga0207680_10006566
1386 Ga0207680_10019201
1387 Ga0207680_10344043
1388 Ga0207647_10360618
1389 Ga0207699_10128771
1390 Ga0207645_10527808
1391 Ga0207705_10030411
1392 Ga0207705_10238238
1393 Ga0207654_10291855
1394 Ga0207654_10432580
1395 Ga0207707_10014004
1396 Ga0207707_10024724
1397 Ga0207707_10040486
1398 Ga0207707_10128590
1399 Ga0207707_10202620
1400 Ga0207707_10385766
1401 Ga0207707_10584989
1402 Ga0207695_10028344
1403 Ga0207695_10041471
1404 Ga0207695_10055642
1405 Ga0207695_10409617
1406 Ga0207671_10017218
1407 Ga0207671_10021736
1408 Ga0207693_10057358
1409 Ga0207693_10228569
1410 Ga0207663_10017300
1411 Ga0207663_10038567
1412 Ga0207663_10097229
1413 Ga0207660_10062435
1414 Ga0207660_10063532
1415 Ga0207660_10091988
1416 Ga0207660_10292424
1417 Ga0207660_10432504
1418 Ga0207657_10001043
1419 Ga0207657_10006978
1420 Ga0207649_10005811
1421 Ga0207649_10026774
1422 Ga0207649_10107598
1423 Ga0207652_10000709
1424 Ga0207652_10003467
1425 Ga0207652_10023611
1426 Ga0207652_10027875
1427 Ga0207652_10091136
1428 Ga0207652_10219796
1429 Ga0207646_10004328
1430 Ga0207681_10134285
1431 Ga0207681_10143723
1432 Ga0207681_10383007
1433 Ga0207694_10002021
1434 Ga0207694_10119877
1435 Ga0207694_10304051
1436 Ga0207694_10354626
1437 Ga0207694_10390330
1438 Ga0207694_10900454
1439 Ga0207650_10002070
1440 Ga0207650_10167985
1441 Ga0207650_10280401
1442 Ga0207659_10005700
1443 Ga0207659_10218814
1444 Ga0207687_10000031
1445 Ga0207687_10005626
1446 Ga0207700_10003644
1447 Ga0207700_10076942
1448 Ga0207700_10144481
1449 Ga0207700_10344931
1450 Ga0207700_10458460
1451 Ga0207664_10128522
1452 Ga0207664_10159740
1453 Ga0207664_10270382
1454 Ga0207644_10007623
1455 Ga0207644_10077501
1456 Ga0207690_10011048
1457 Ga0207690_10039879
1458 Ga0207690_10139836
1459 Ga0207706_10006046
1460 Ga0207686_10050823
1461 Ga0207709_10009807
1462 Ga0207670_10015123
1463 Ga0207670_10053479
1464 Ga0207704_10000224
1465 Ga0207704_10012116
1466 Ga0207704_10500292
1467 Ga0207691_10014953
1468 Ga0207691_10034869
1469 Ga0207691_10291638
1470 Ga0207711_10000006
1471 Ga0207711_10003308
1472 Ga0207711_10013477
1473 Ga0207689_10192097
1474 Ga0207689_10366554
1475 Ga0207661_10009481
1476 Ga0207661_10012272
1477 Ga0207661_10035290
1478 Ga0207661_10064139
1479 Ga0207661_10344080
1480 Ga0207679_10021834
1481 Ga0207679_10157124
1482 Ga0207679_10387965
1483 Ga0207679_11079190
1484 Ga0207667_10008046
1485 Ga0207667_10027499
1486 Ga0207667_10054673
1487 Ga0207651_10078948
1488 Ga0207651_10261584
1489 Ga0207712_10033227
1490 Ga0207668_10026483
1491 Ga0207640_10248644
1492 Ga0207640_10655170
1493 Ga0207658_10105465
1494 Ga0207658_10558350
1495 Ga0207677_10000385
1496 Ga0207677_10002302
1497 Ga0207677_10090209
1498 Ga0207677_10136772
1499 Ga0207677_10393925
1500 Ga0207703_10075473
1501 Ga0207703_10091407
1502 Ga0207703_10108045
1503 Ga0207703_10313435
1504 Ga0207703_10600090
1505 Ga0207703_11170135
1506 Ga0207639_10027869
1507 Ga0207639_10163784
1508 Ga0207639_10370730
1509 Ga0207678_10000436
1510 Ga0207678_10009284
1511 Ga0207678_10034550
1512 Ga0207678_10885844
1513 Ga0207708_10002776
1514 Ga0207708_10194459
1515 Ga0207702_10000304
1516 Ga0207702_10004007
1517 Ga0207702_10033370
1518 Ga0207702_10034868
1519 Ga0207702_10066598
1520 Ga0207702_10194518
1521 Ga0207702_10205268
1522 Ga0207702_10701597
1523 Ga0207702_10836463
1524 Ga0207641_10013721
1525 Ga0207641_10058540
1526 Ga0207641_10200440
1527 Ga0207641_10340477
1528 Ga0207641_10358455
1529 Ga0207648_10001324
1530 Ga0207648_10909541
1531 Ga0207676_10017836
1532 Ga0207676_10137029
1533 Ga0207676_10350910
1534 Ga0207676_10987855
1535 Ga0207674_10023497
1536 Ga0207674_10027671
1537 Ga0207674_10088139
1538 Ga0207674_10141236
1539 Ga0207674_10160721
1540 Ga0207674_10193320
1541 Ga0207675_100008274
1542 Ga0207675_100194822
1543 Ga0207683_10051765
1544 Ga0207683_10333286
1545 Ga0207683_10467171
1546 Ga0207698_10020509
1547 Ga0207698_10248507
1548 Ga0209813_10008133
1549 Ga0209813_10126233
1550 Ga0207428_10000032
1551 Ga0207428_10147218
1552 Ga0207428_10155814
1553 Ga0207428_10195035
1554 Ga0268266_10000114
1555 Ga0268265_10046620
1556 Ga0268265_10120344
1557 Ga0268265_10389032
1558 Ga0268264_10039968
1559 Ga0268264_10056395
1560 Ga0307511_10137685
1561 Ga0307511_10280011
1562 Ga0265327_10003797
1563 Ga0307509_10043062
1564 Ga0307509_10259619
1565 Ga0307408_100088219
1566 Ga0307408_100222095
1567 Ga0307508_10041829
1568 Ga0307514_10059318
1569 Ga0316576_10015783
1570 Ga0316576_10072009
1571 Ga0316578_10002626
1572 Ga0316578_10006327
1573 Ga0307405_10150359
1574 Ga0307405_10265501
1575 Ga0316577_10001160
1576 Ga0316577_10017999
1577 Ga0307410_10035745
1578 Ga0307406_10403739
1579 Ga0307406_10896801
1580 Ga0307412_10930658
1581 Ga0307409_101011768
1582 Ga0307409_101076497
1583 Ga0307409_101494949
1584 Ga0307416_100013675
1585 Ga0307416_100077692
1586 Ga0307414_10000794
1587 Ga0307414_10297327
1588 Ga0307414_11454626
1589 Ga0307411_11277051
1590 Ga0307415_100007983
1591 Ga0307415_100699684
1592 Ga0316580_10012229
1593 Ga0307507_10000038
1594 Ga0373936_0002576
1595 Ga0373936_0015130
1596 Ga0373956_0354633
1597 Ga0373957_0012616
1598 Ga0373957_0319091
1599 Ga0373955_0077124
1600 Ga0316574_0006666
1601 Ga0316574_0096275
1602 Ga0316574_0103860
1603 Ga0373927_0167263
1604 Ga0373947_0027384
1605 Ga0373937_0006335
1606 Ga0373937_0047105
1607 Ga0373937_0070560
1608 Ga0310109_000028
1609 Ga0316582_0001621
1610 Ga0316582_0006238
1611 Ga0316582_0021318
1612 Ga0316582_0407055
1613 Ga0316584_0000394
1614 Ga0316584_0002381
1615 Ga0373925_0004880
1616 Ga0373925_0185478
1617 Ga0395898_0202186
1618 Ga0395898_0247849
1619 Ga0395905_0000147
1620 Ga0436364_0850190
1621 Ga0395901_0001140
1622 Ga0436365_0412417
1623 Ga0436365_0594896
1624 Ga0436365_1320901
1625 Ga0436360_0036559
1626 Ga0436360_1076493
1627 Ga0436361_0037487
1628 Ga0436361_0223467
1629 Ga0436363_0805533
1630 Ga0436363_1501310
1631 Ga0436362_0823064
1632 Ga0436362_0828385
1633 Ga0436362_1291930
1634 Ga0451797_1243763
1635 Ga0451802_0867806
1636 Ga0451849_1354144
1637 Ga0451855_0825867
1638 Ga0451853_1152909
1639 Ga0451853_2595326
1640 Ga0451577_0002721
1641 Ga0451577_0004444
1642 Ga0451577_0026279
1643 Ga0466969_0002360
1644 Ga0466969_0020644
1645 Ga0466969_0109521
1646 Ga0466966_0030263
1647 Ga0466966_0088634
1648 Ga0466966_0247844
1649 Ga0466961_0010893
1650 Ga0466961_0028311
1651 Ga0466961_0163205
1652 Ga0466963_0035075
1653 Ga0466963_0092858
1654 Ga0466963_0170263
1655 Ga0453684_0008872
1656 Ga0453684_0009766
1657 Ga0453684_0020745
1658 Ga0453684_0476512
1659 Ga0466971_0000154
1660 Ga0466971_0010789
1661 Ga0466971_0073475
1662 Ga0466957_0010209
1663 Ga0466957_0068108
1664 Ga0466957_0250875
1665 Ga0466960_0080621
1666 Ga0466959_0006560
1667 Ga0466959_0026879
1668 Ga0466959_0622582
1669 Ga0451576_0007064
1670 Ga0451576_0265807
1671 Ga0466958_0004946
1672 Ga0466967_0435595
1673 Ga0495592_0011617
1674 Ga0495592_0308563
1675 Ga0495629_0145363
1676 Ga0495638_0007463
1677 Ga0495651_0006018
1678 Ga0495580_0140279
1679 Ga0495582_0155162
1680 Ga0495639_0281018
1681 Ga0495664_0093820
1682 Ga0495584_0412390
1683 Ga0495608_0014836
1684 Ga0495618_0374164
1685 Ga0495628_0203930
1686 Ga0495628_0430483
1687 Ga0495630_0687006
1688 Ga0495652_0001107
1689 Ga0495621_0088620
1690 Ga0495645_0156182
1691 Ga0495667_0002634
1692 Ga0495656_0110278
1693 Ga0495634_0132612
1694 Ga0495635_0059579
1695 Ga0495588_0161338
1696 Ga0495657_0002235
1697 Ga0495599_0262802
1698 Ga0495623_0288585
1699 Ga0495646_0015096
1700 Ga0495647_0247522
1701 Ga0495658_0047886
1702 Ga0495613_0010774
1703 Ga0495613_0326137
1704 Ga0495600_0033115
1705 Ga0495600_0440679
1706 Ga0495674_0131414
1707 Ga0495674_0521780
1708 Ga0495676_0326088
1709 Ga0495680_0096004
1710 Ga0495675_0047311
1711 Ga0495675_0173012
1712 Ga0495677_0174206
1713 Ga0495684_0113314
1714 Ga0495602_0056089
1715 Ga0495602_0114003
1716 Ga0496100_0002656
1717 Ga0496100_0065121
1718 Ga0496100_0748985
1719 Ga0496101_0331298
1720 Ga0496102_0004755
1721 Ga0496102_0158676
1722 Ga0496103_0011593
1723 Ga0496103_0180384
1724 Ga0496103_0474459
1725 Ga0496104_0000004
1726 Ga0496104_0062014
1727 Ga0496105_0000001
1728 Ga0496105_0047865
1729 Ga0496107_0004422
1730 Ga0496108_0011228
1731 Ga0496108_0014324
1732 Ga0496109_0000115
1733 Ga0496109_0010805
1734 Ga0496109_0330696
1735 Ga0496109_0511940
1736 Ga0496109_0519282
1737 Ga0496110_0008225
1738 Ga0496112_0006052
1739 Ga0496112_0083212
1740 Ga0496114_0789523
1741 Ga0496115_0000012
1742 Ga0496115_0000017
1743 Ga0496116_0000360
1744 Ga0496116_0118744
1745 Ga0496116_0163150
1746 Ga0496117_0045326
1747 Ga0496118_0001416
1748 Ga0496118_0015490
1749 Ga0496118_0093331
1750 Ga0496118_0094965
1751 Ga0496119_0003375
1752 Ga0496119_0019417
1753 Ga0496119_0124658
1754 Ga0496119_0216138
1755 Ga0496120_0008036
1756 Ga0496120_0216837
1757 Ga0496121_0021569
1758 Ga0496121_0176915
1759 Ga0496124_0080587
1760 Ga0496124_0209001
1761 Ga0496125_0017162
1762 Ga0496125_0162238
1763 Ga0496126_0160626
1764 Ga0501031_0000672
1765 Ga0501031_0022901
1766 Ga0501031_0077876
1767 Ga0501031_0081159
1768 Ga0501031_0129227
1769 Ga0501031_0176225
1770 Ga0501032_0000408
1771 Ga0501032_0001581
1772 Ga0501032_0030727
1773 Ga0501032_0070393
1774 Ga0501032_0542727
1775 Ga0501033_0002830
1776 Ga0501033_0009823
1777 Ga0501034_0002858
1778 Ga0501034_0004186
1779 Ga0501034_0038297
1780 Ga0501034_0079277
1781 Ga0501034_0093021
1782 Ga0501034_0562069
1783 Ga0501036_0006356
1784 Ga0501036_0013492
1785 Ga0501036_0013729
1786 Ga0501036_0212006
1787 Ga0501037_0002310
1788 Ga0501037_0003119
1789 Ga0501037_0541080
1790 Ga0501037_0584544
1791 Ga0501038_0002847
1792 Ga0501038_0003709
1793 Ga0501038_0027683
1794 Ga0501038_0213155
1795 Ga0501039_0012900
1796 Ga0501040_0202598
1797 Ga0501041_0020677
1798 Ga0501041_0155983
1799 Ga0501042_0154913
1800 Ga0501043_0001699
1801 Ga0501043_0023253
1802 Ga0501046_0000914
1803 Ga0501046_0134605
1804 Ga0501046_0401799
1805 Ga0501047_0001308
1806 Ga0501047_0012908
1807 Ga0501047_0013835
1808 Ga0501047_0031159
1809 Ga0501047_0089254
1810 Ga0501047_0354987
1811 Ga0501048_0000126
1812 Ga0501048_0020915
1813 Ga0501048_0190486
1814 Ga0501048_0540764
1815 Ga0501048_0708063
1816 Ga0501067_0000587
1817 Ga0501067_0003173
1818 Ga0501068_0001780
1819 Ga0501068_0042478
1820 Ga0501069_0000824
1821 Ga0501069_0036206
1822 Ga0501069_0155096
1823 Ga0501070_0002563
1824 Ga0501070_0085405
1825 Ga0501070_0247057
1826 Ga0501071_0001042
1827 Ga0501071_0090453
1828 Ga0501071_0166152
1829 Ga0501072_0064051
1830 Ga0501072_0234297
1831 Ga0501072_0364895
1832 Ga0501073_0015155
1833 Ga0501073_0016821
1834 Ga0501073_0028840
1835 Ga0501073_0085973
1836 Ga0501074_0001349
1837 Ga0501074_0057911
1838 Ga0501074_0067643
1839 Ga0501074_0277971
1840 Ga0501075_0632972
1841 Ga0501076_0009291
1842 Ga0501076_0138681
1843 Ga0501076_0201820
1844 Ga0501076_0324659
1845 Ga0501077_0022038
1846 Ga0501077_0041532
1847 Ga0501249_069821
1848 Ga0501225_0051255
1849 Ga0501079_0003550
1850 Ga0501079_0309114
1851 Ga0501079_0377251
1852 Ga0501079_0506649
1853 Ga0501080_0000390
1854 Ga0501080_0010505
1855 Ga0501080_0035034
1856 Ga0501081_0681531
1857 Ga0501083_0014925
1858 Ga0501083_0026462
1859 Ga0501083_0027635
1860 Ga0501083_0058815
1861 Ga0501083_0096375
1862 Ga0501035_0001653
1863 Ga0501035_0010137
1864 Ga0501035_0064080
1865 Ga0501035_0194050
1866 Ga0501035_0808261
1867 Ga0501044_0003244
1868 Ga0501044_0006361
1869 Ga0501044_0185619
1870 Ga0501044_0616789
1871 Ga0501044_0647063
1872 Ga0501044_0673821
1873 Ga0501044_0693920
1874 Ga0501045_0012395
1875 Ga0501045_0016471
1876 Ga0501045_0044941
1877 Ga0501045_0189622
1878 nmdc:mga03683_44275_c1
1879 nmdc:mga00v17_489556_c1
1880 nmdc:mga00v17_8262_c1
1881 nmdc:mga0yw44_1545_c1
1882 nmdc:mga0yw44_33003_c1
1883 nmdc:mga0k408_1062_c1
1884 nmdc:mga0k408_188523_c1
1885 nmdc:mga06z11_1317_c1
1886 nmdc:mga04h51_3149_c1
1887 nmdc:mga07m45_26566_c1
1888 nmdc:mga05p37_116979_c1
1889 nmdc:mga05p37_23148_c1
1890 nmdc:mga05p37_3488_c1
1891 nmdc:mga05p37_359038_c1
1892 nmdc:mga05p37_38094_c1
1893 nmdc:mga05p37_61598_c1
1894 nmdc:mga09592_161874_c1
1895 nmdc:mga09592_20362_c1
1896 nmdc:mga09592_212835_c1
1897 nmdc:mga09592_47249_c1
1898 nmdc:mga09592_57007_c1
1899 nmdc:mga09592_71456_c1
1900 nmdc:mga0qj67_187989_c1
1901 nmdc:mga0qj67_8930_c1
1902 nmdc:mga06r32_1524_c1
1903 nmdc:mga06r32_690619_c1
1904 nmdc:mga08y16_133869_c1
1905 nmdc:mga08y16_144_c1
1906 nmdc:mga08y16_147890_c1
1907 nmdc:mga08y16_157527_c1
1908 nmdc:mga08y16_29841_c1
1909 nmdc:mga08y16_89758_c1
1910 nmdc:mga0n895_111492_c1
1911 nmdc:mga0n895_27653_c1
1912 nmdc:mga0n895_813980_c1
1913 nmdc:mga0rr50_32276_c1
1914 nmdc:mga0rr50_55280_c1
1915 nmdc:mga08x19_710179_c1
1916 nmdc:mga0a205_32741_c1
1917 nmdc:mga0a205_56771_c1
1918 nmdc:mga0a205_817910_c1
1919 nmdc:mga0a205_890755_c1
1920 nmdc:mga0a205_89306_c1
1921 nmdc:mga0sz30_98124_c1
1922 Ga0495601_0079115
1923 Ga0495601_0099111
1924 Ga0495612_0004589
1925 Ga0495619_0000037
1926 Ga0495619_0035313
1927 Ga0495619_0310845
1928 Ga0500566_0005610
1929 Ga0500566_0124061
1930 Ga0500595_026833
1931 Ga0501084_0000570
1932 Ga0501084_0012755
1933 Ga0501084_0150022
1934 Ga0501084_0376445
1935 Ga0501084_0381214
1936 Ga0501082_0014056
1937 Ga0501082_0031185
1938 Ga0501082_0091084
1939 Ga0501082_0240646
1940 Ga0501082_0613535
1941 Ga0466962_0000909
1942 Ga0466962_0145483
1943 Ga0530510_0059141
1944 Ga0530510_0221702
1945 2522548016
1946 2730135315
1947 2739616828
1948 2875392641
1949 2904595484
1950 2939705239

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00677

Lum_binding

Lumazine binding domain

123

209

0.93

PF00677

Lum_binding

Lumazine binding domain

27

110

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
4g6i-assembly1.cif.gz_B crystallographic structure of trimeric riboflavin synthase from brucella abortus in complex with roseoflavin 0.964 1 194
1pkv-assembly1.cif.gz_B the n-terminal domain of riboflavin synthase in complex with riboflavin 0.9593 1 85
4fxu-assembly1.cif.gz_A crystallographic structure of trimeric riboflavin synthase from brucella abortus 0.959 1 193
4gqn-assembly1.cif.gz_C crystallographic structure of trimeric riboflavin synthase from brucella abortus in complex with 5-nitro-6-(d-ribitylamino)-2,4(1h,3h) pyrimidinedione 0.9577 1 193
4g6i-assembly1.cif.gz_B crystallographic structure of trimeric riboflavin synthase from brucella abortus in complex with roseoflavin 0.9497 1 194
ID Description Score Start End Superfamily
af_Q2FXG0_1_88_2.40.30.20 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.9702 1 87 2.40.30.20
af_P9WK35_1_88_2.40.30.20 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.9688 1 86 2.40.30.20
af_P0AFU8_1_89_2.40.30.20 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.9686 1 87 2.40.30.20
af_Q2FXG0_1_88_2.40.30.20 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.9489 1 87 2.40.30.20
4fxuA01 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.9486 1 87 2.40.30.20
ID Description Score Start End GO Terms
AF-A0A5D0JIU0-F1-model_v4 Riboflavin synthase (EC 2.5.1.9) 0.9952 16 195 GO:0004746
GO:0009231
AF-A0A4R3AS50-F1-model_v4 Riboflavin synthase (EC 2.5.1.9) 0.9913 2 196 GO:0004746
GO:0009231
AF-A0A359CT85-F1-model_v4 Riboflavin synthase (EC 2.5.1.9) 0.99 1 195 GO:0004746
GO:0009231
AF-A0A1Z8UNC1-F1-model_v4 Riboflavin synthase (EC 2.5.1.9) 0.9896 1 176 GO:0004746
GO:0009231
AF-A3J2R8-F1-model_v4 Riboflavin synthase (EC 2.5.1.9) 0.989 1 196 GO:0004746
GO:0009231
GO:0016020

Map