F487156

General Info

Members Datasets Scaffolds Average Seq Length
972 446 942 490

Family's Representative Sequence

Representative Sequence 3300035695|Ga0373927_0031545|Ga0373927_0031545_458_2074
Length 538
Sequence MLREFAEIVAEFGPFRGMHSATSAGQLCENGRTRYETGNHGRPQPQQGDMDTQPNAKKFLKGATGDWEVVIGMEVHAQVTSRSKLFSGASTEFGGAPNSHVSLVDAAMPGMLPVINEECVRQAIRTGLGLKARINLKSVFDRKNYFYPDLPQGYQISQYKSPVVGEGVVTVDLEGGDSVTVGIERLHLEQDAGKSIHDRSPVNSYVDLNRSGVALMEIVSKPDLRSADEAKAFITKLRSILRYLGTCDGDMEKGSLRADVNVSVRRPGEPLGTRCEIKNVNSIRFIGQAVEHEARRQIEIIEEGGSIDQETRLFDATRGETRSMRSKEEAHDYRYFPDPDLLPLEFDAAYVEELKKNLPELPDEKKMRFMREFSLSAYDAGVLVAERETAEYFEGVAKGRDAKAAANWVINELFGRLNKEGKDIGSSPVSAGQLGTMLDLIADGTISGKIAKDLFEVVWQEGGDPRAVVEQRGMKQVTDIGAIEKVVDDIIARNPDKVADAKSNPKAIGWFVGQAMKASGGKASPQAVNDVLKRKLGL

Samples

Sample ID Description Type Environment
1 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
2 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
3 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
4 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
5 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
6 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
7 2643221629 Devosia sp. Root105 Isolate Unclassified
8 2643221662 Devosia sp. Root413D1 Isolate Unclassified
9 2643221733 Bosea sp. Root381 Isolate Unclassified
10 2643221734 Bosea sp. Root670 Isolate Unclassified
11 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
12 2773857925 Microvirga vignae BR3299 Isolate Unclassified
13 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
14 2818991467 Bosea vestrisii 3192 Isolate Unclassified
15 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
16 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
17 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
18 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
19 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere
20 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
21 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
22 2902330777 Methylobacterium sp. 2A Isolate Unclassified
23 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
24 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
25 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
26 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
27 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
28 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
29 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
30 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
31 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
32 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
33 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
34 3300001430 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 Metagenome Rhizosphere
35 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
36 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
37 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
38 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
39 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
40 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
41 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
42 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
43 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
44 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
45 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
46 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
47 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
48 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
50 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
51 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
52 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
53 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
54 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
55 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
56 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
57 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
58 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
59 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
60 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
61 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
62 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
63 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
64 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
65 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
66 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
67 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
68 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
69 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
70 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
71 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
72 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
73 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
74 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
75 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
76 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
77 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
78 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
79 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
80 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
81 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
82 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
83 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
84 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
85 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
86 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
87 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
88 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
89 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
90 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
91 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
92 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
93 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
94 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
95 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
96 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
97 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
98 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
99 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
100 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
101 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
102 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
103 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
104 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
105 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
106 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
107 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
108 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
109 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
110 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
111 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
112 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
113 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
114 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
115 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
116 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
117 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
118 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
119 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
120 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
121 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
122 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
123 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
124 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
125 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
126 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
127 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
128 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
129 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
130 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
131 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
132 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
133 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
134 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
135 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
136 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
137 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
138 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
139 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
140 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
141 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
142 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
143 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
144 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
145 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
146 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
147 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
148 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
149 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
150 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
151 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
152 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
153 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
154 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
155 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
156 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
157 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
158 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
159 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
160 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
161 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
162 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
163 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
164 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
165 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
166 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
167 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
168 3300015684 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 Metagenome Unclassified
169 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
170 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
171 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
173 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
174 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
175 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
176 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
177 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
178 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
179 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
243 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
244 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
245 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
246 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
247 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
248 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
251 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
252 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
253 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
254 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
255 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
256 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
257 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
258 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
259 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
260 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
261 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
262 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
263 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
264 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
265 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
266 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
267 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
268 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
269 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
270 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
271 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
272 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
273 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
274 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
275 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
276 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
277 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
278 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
279 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
280 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
281 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
282 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
283 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
284 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
285 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
286 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
287 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
288 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
289 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
290 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
291 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
292 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
293 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
294 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
295 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
296 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
297 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
298 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
299 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
300 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
301 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
302 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
303 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
304 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
305 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
306 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
307 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
308 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
309 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
310 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
311 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
312 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
313 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
314 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
315 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
316 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
317 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
318 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
319 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
320 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
321 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
322 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
323 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
324 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
325 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
326 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
327 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
328 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
329 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
330 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
331 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
332 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
333 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
334 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
335 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
336 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
337 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
338 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
339 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
340 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
341 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
342 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
343 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
344 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
345 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
346 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
347 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
348 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
349 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
350 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
351 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
352 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
353 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
354 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
355 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
356 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
357 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
358 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
359 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
360 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
361 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
362 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
363 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
364 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
365 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
366 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
367 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
368 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
369 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
370 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
371 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
372 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
373 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
374 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
375 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
376 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
377 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
378 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
379 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
380 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
381 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
382 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
383 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
384 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
385 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
386 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
387 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
388 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
389 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
390 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
391 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
392 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
393 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
394 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
395 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
396 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
397 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
398 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
399 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
400 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
401 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
402 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
403 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
404 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
405 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
406 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
407 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
408 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
409 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
410 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
411 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
412 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
413 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
414 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
415 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
416 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
417 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
418 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
419 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
420 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
421 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
422 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
423 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
424 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
425 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
426 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
427 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
428 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
429 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
430 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
431 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
432 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
433 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
434 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
435 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
436 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
437 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
438 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
439 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
440 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
441 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
442 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
443 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
444 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
445 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
446 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.91
Metatranscriptomes 0
Isolates 3.09

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.53
Nodule 0.62
Rhizoplane 5.45
Rhizosphere 85.8
Stem 0
Stem Tuber 0
Unclassified 3.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 ARcpr5oldR_c000183 3300000041 Bacteria 10873
2 ARSoilYngRDRAFT_c00120 3300000042 Bacteria 13387
3 ARSoilOldRDRAFT_c000093 3300000044 Bacteria 16766
4 ARCol0yngRDRAFT_1000124 3300000652 Bacteria 13864
5 JGI24032J14994_100448 3300001430 Bacteria 2145
6 JGI24746J21847_1000166 3300001977 Bacteria 8589
7 JGI24747J21853_1001343 3300001978 Bacteria 1823
8 JGI24739J22299_10000057 3300001989 Bacteria 31581
9 JGI24737J22298_10000391 3300001990 Bacteria 14950
10 JGI24737J22298_10005396 3300001990 Bacteria 4416
11 JGI24750J21931_1000122 3300002070 Bacteria 12437
12 JGI24745J21846_1000450 3300002073 Bacteria 3647
13 JGI24738J21930_10000767 3300002075 Bacteria 9204
14 JGI24744J21845_10000821 3300002077 Bacteria 5848
15 JGI24034J26672_10000108 3300002239 Bacteria 13522
16 JGI24742J22300_10000111 3300002244 Bacteria 11743
17 JGI25153J46596_10006736 3300003215 Bacteria 5763
18 Ga0055526_1000371 3300003771 Bacteria 36363
19 Ga0055526_1002296 3300003771 Bacteria 13046
20 Ga0055524_1000515 3300003775 Bacteria 29812
21 JGI25405J52794_10005801 3300003911 Bacteria 2240
22 Ga0065716_1001884 3300005277 Bacteria 2870
23 Ga0065712_10008453 3300005290 Bacteria 3947
24 Ga0065712_10073118 3300005290 Bacteria 4499
25 Ga0065712_10088883 3300005290 Bacteria 2498
26 Ga0065715_10000602 3300005293 Bacteria 13727
27 Ga0065715_10090236 3300005293 Bacteria 7366
28 Ga0065715_10090398 3300005293 Bacteria 7088
29 Ga0065715_10154420 3300005293 Bacteria 1625
30 Ga0065707_10111560 3300005295 Bacteria 2391
31 Ga0070658_10011629 3300005327 Bacteria 7060
32 Ga0070658_10024663 3300005327 Bacteria 4822
33 Ga0070658_10043077 3300005327 Bacteria 3647
34 Ga0070676_10000170 3300005328 Bacteria 26484
35 Ga0070683_100003392 3300005329 Bacteria 12912
36 Ga0070683_100036634 3300005329 Bacteria 4489
37 Ga0070683_100044223 3300005329 Bacteria 4106
38 Ga0070683_100137493 3300005329 Bacteria 2314
39 Ga0070690_100022059 3300005330 Bacteria 3893
40 Ga0070670_100009376 3300005331 Bacteria 8355
41 Ga0070670_100073114 3300005331 Bacteria 2945
42 Ga0070677_10000320 3300005333 Bacteria 16762
43 Ga0068869_100000181 3300005334 Bacteria 32256
44 Ga0070666_10021102 3300005335 Bacteria 4219
45 Ga0070680_100002750 3300005336 Bacteria 13050
46 Ga0070680_100006873 3300005336 Bacteria 8675
47 Ga0070680_100015843 3300005336 Bacteria 5918
48 Ga0070680_100066923 3300005336 Bacteria 2946
49 Ga0070682_100000903 3300005337 Bacteria 17347
50 Ga0070682_100005746 3300005337 Bacteria 6920
51 Ga0070682_100006850 3300005337 Bacteria 6399
52 Ga0068868_100000590 3300005338 Bacteria 24437
53 Ga0068868_100113449 3300005338 Bacteria 2204
54 Ga0070660_100005053 3300005339 Bacteria 9115
55 Ga0070660_100007288 3300005339 Bacteria 7706
56 Ga0070660_100014065 3300005339 Bacteria 5760
57 Ga0070660_100035443 3300005339 Bacteria 3777
58 Ga0070660_100063970 3300005339 Bacteria 2861
59 Ga0070689_100001256 3300005340 Bacteria 16143
60 Ga0070689_100017219 3300005340 Bacteria 5304
61 Ga0070689_100046718 3300005340 Bacteria 3337
62 Ga0070689_100103986 3300005340 Bacteria 2251
63 Ga0070691_10000085 3300005341 Bacteria 26262
64 Ga0070691_10002362 3300005341 Bacteria 8376
65 Ga0070691_10030620 3300005341 Bacteria 2521
66 Ga0070687_100000037 3300005343 Bacteria 42337
67 Ga0070687_100014057 3300005343 Bacteria 3586
68 Ga0070661_100001893 3300005344 Bacteria 14501
69 Ga0070661_100016055 3300005344 Bacteria 5285
70 Ga0070692_10000038 3300005345 Bacteria 25433
71 Ga0070668_100022013 3300005347 Bacteria 4817
72 Ga0070668_100131362 3300005347 Bacteria 2010
73 Ga0070669_100000866 3300005353 Bacteria 22010
74 Ga0070669_100010295 3300005353 Bacteria 6643
75 Ga0070675_100030722 3300005354 Bacteria 4338
76 Ga0070671_100015170 3300005355 Bacteria 6223
77 Ga0070671_100082757 3300005355 Bacteria 2684
78 Ga0070673_100000191 3300005364 Bacteria 30135
79 Ga0070673_100023201 3300005364 Bacteria 4531
80 Ga0070688_100002000 3300005365 Bacteria 10271
81 Ga0070688_100053028 3300005365 Bacteria 2535
82 Ga0070659_100001044 3300005366 Bacteria 20232
83 Ga0070659_100001504 3300005366 Bacteria 16803
84 Ga0070659_100007451 3300005366 Bacteria 7954
85 Ga0070659_100022400 3300005366 Bacteria 4823
86 Ga0070659_100036035 3300005366 Bacteria 3855
87 Ga0070667_100223132 3300005367 Bacteria 1678
88 Ga0070709_10011101 3300005434 Bacteria 5008
89 Ga0070709_10027134 3300005434 Bacteria 3403
90 Ga0070714_100001757 3300005435 Bacteria 15802
91 Ga0070714_100053323 3300005435 Bacteria 3451
92 Ga0070710_10007147 3300005437 Bacteria 5395
93 Ga0070711_100043669 3300005439 Bacteria 3037
94 Ga0070711_100045371 3300005439 Bacteria 2989
95 Ga0070711_100058618 3300005439 Bacteria 2670
96 Ga0070711_100079750 3300005439 Bacteria 2329
97 Ga0070705_100076531 3300005440 Bacteria 2041
98 Ga0070700_100001181 3300005441 Bacteria 12914
99 Ga0070700_100019478 3300005441 Bacteria 3916
100 Ga0070663_100001352 3300005455 Bacteria 13397
101 Ga0070663_100011143 3300005455 Bacteria 5630
102 Ga0070662_100001810 3300005457 Bacteria 13141
103 Ga0070681_10002441 3300005458 Bacteria 17015
104 Ga0070681_10007687 3300005458 Bacteria 10539
105 Ga0070681_10022976 3300005458 Bacteria 6267
106 Ga0070681_10025879 3300005458 Bacteria 5899
107 Ga0070681_10045202 3300005458 Bacteria 4406
108 Ga0068867_100021411 3300005459 Bacteria 4614
109 Ga0068867_100061652 3300005459 Bacteria 2785
110 Ga0070685_10012192 3300005466 Bacteria 4511
111 Ga0070685_10071605 3300005466 Bacteria 2056
112 Ga0070706_100125858 3300005467 Bacteria 2389
113 Ga0070698_100000560 3300005471 Bacteria 39881
114 Ga0070699_100003377 3300005518 Bacteria 14120
115 Ga0070679_100004705 3300005530 Bacteria 12586
116 Ga0070679_100006190 3300005530 Bacteria 11142
117 Ga0070679_100011510 3300005530 Bacteria 8433
118 Ga0070679_100011599 3300005530 Bacteria 8398
119 Ga0070679_100046442 3300005530 Bacteria 4329
120 Ga0070679_100058272 3300005530 Bacteria 3848
121 Ga0070679_100082872 3300005530 Bacteria 3196
122 Ga0070679_100092614 3300005530 Bacteria 3010
123 Ga0070679_100094353 3300005530 Bacteria 2979
124 Ga0070684_100001355 3300005535 Bacteria 17557
125 Ga0070684_100009822 3300005535 Bacteria 7557
126 Ga0070684_100070557 3300005535 Bacteria 3074
127 Ga0070684_100084523 3300005535 Bacteria 2813
128 Ga0070697_100002324 3300005536 Bacteria 14612
129 Ga0068853_100001361 3300005539 Bacteria 17623
130 Ga0068853_100009731 3300005539 Bacteria 7754
131 Ga0068853_100013478 3300005539 Bacteria 6675
132 Ga0068853_100024539 3300005539 Bacteria 5056
133 Ga0068853_100043602 3300005539 Bacteria 3837
134 Ga0068853_100077567 3300005539 Bacteria 2902
135 Ga0070672_100001052 3300005543 Bacteria 16850
136 Ga0070672_100035461 3300005543 Bacteria 3792
137 Ga0070695_100005457 3300005545 Bacteria 7482
138 Ga0070695_100055937 3300005545 Bacteria 2544
139 Ga0070696_100009183 3300005546 Bacteria 6619
140 Ga0070696_100011129 3300005546 Bacteria 6021
141 Ga0070693_100004467 3300005547 Bacteria 6619
142 Ga0070693_100040290 3300005547 Bacteria 2622
143 Ga0070665_100129217 3300005548 Bacteria 2529
144 Ga0070704_100023644 3300005549 Bacteria 4019
145 Ga0068855_100001281 3300005563 Bacteria 31161
146 Ga0068855_100006064 3300005563 Bacteria 14735
147 Ga0068855_100008638 3300005563 Bacteria 12309
148 Ga0068855_100028140 3300005563 Bacteria 6722
149 Ga0068855_100109780 3300005563 Bacteria 3167
150 Ga0068855_100139847 3300005563 Bacteria 2761
151 Ga0068855_100157921 3300005563 Bacteria 2576
152 Ga0068855_100188515 3300005563 Bacteria 2328
153 Ga0068855_100233537 3300005563 Bacteria 2058
154 Ga0068855_100272619 3300005563 Bacteria 1881
155 Ga0070664_100023848 3300005564 Bacteria 5054
156 Ga0070664_100031759 3300005564 Bacteria 4415
157 Ga0068857_100001561 3300005577 Bacteria 18370
158 Ga0068857_100033314 3300005577 Bacteria 4556
159 Ga0068857_100075433 3300005577 Bacteria 3007
160 Ga0068857_100105596 3300005577 Bacteria 2529
161 Ga0068857_100157882 3300005577 Bacteria 2057
162 Ga0068854_100037477 3300005578 Bacteria 3404
163 Ga0068856_100003452 3300005614 Bacteria 15977
164 Ga0070702_100000796 3300005615 Bacteria 12029
165 Ga0068852_100001221 3300005616 Bacteria 17094
166 Ga0068852_100041996 3300005616 Bacteria 3869
167 Ga0068852_100050139 3300005616 Bacteria 3575
168 Ga0068852_100078213 3300005616 Bacteria 2926
169 Ga0068852_100176443 3300005616 Bacteria 2006
170 Ga0068859_100002321 3300005617 Bacteria 19328
171 Ga0068859_100011971 3300005617 Bacteria 8714
172 Ga0068859_100015169 3300005617 Bacteria 7734
173 Ga0068859_100224909 3300005617 Bacteria 1965
174 Ga0068864_100002090 3300005618 Bacteria 16498
175 Ga0068864_100046583 3300005618 Bacteria 3721
176 Ga0068866_10001918 3300005718 Bacteria 8688
177 Ga0068861_100001910 3300005719 Bacteria 13413
178 Ga0068861_100086031 3300005719 Bacteria 2470
179 Ga0068851_10013316 3300005834 Bacteria 3892
180 Ga0068870_10000063 3300005840 Bacteria 33368
181 Ga0068863_100036320 3300005841 Bacteria 4694
182 Ga0068858_100071697 3300005842 Bacteria 3213
183 Ga0068858_100137589 3300005842 Bacteria 2292
184 Ga0068860_100001852 3300005843 Bacteria 22494
185 Ga0068860_100003358 3300005843 Bacteria 16477
186 Ga0068860_100016648 3300005843 Bacteria 7171
187 Ga0068860_100123487 3300005843 Bacteria 2481
188 Ga0068860_100137572 3300005843 Bacteria 2346
189 Ga0068862_100026829 3300005844 Bacteria 4845
190 Ga0068862_100074613 3300005844 Bacteria 2932
191 Ga0081455_10000009 3300005937 Bacteria 249885
192 Ga0081455_10003187 3300005937 Bacteria 19036
193 Ga0081455_10009936 3300005937 Bacteria 9733
194 Ga0081455_10013060 3300005937 Bacteria 8232
195 Ga0081538_10001621 3300005981 Bacteria 23067
196 Ga0081538_10035138 3300005981 Bacteria 3298
197 Ga0081540_1000078 3300005983 Bacteria 105731
198 Ga0081539_10025143 3300005985 Bacteria 3844
199 Ga0081539_10046979 3300005985 Bacteria 2470
200 Ga0070717_10016597 3300006028 Bacteria 5712
201 Ga0070717_10089870 3300006028 Bacteria 2591
202 Ga0075365_10019551 3300006038 Bacteria 4183
203 Ga0070715_10005429 3300006163 Bacteria 4249
204 Ga0070712_100004132 3300006175 Bacteria 8923
205 Ga0075367_10009286 3300006178 Bacteria 5133
206 Ga0068871_100036365 3300006358 Bacteria 3920
207 Ga0068871_100082132 3300006358 Bacteria 2671
208 Ga0075428_100059498 3300006844 Bacteria 4183
209 Ga0075430_100002515 3300006846 Bacteria 15282
210 Ga0075431_100002222 3300006847 Bacteria 18595
211 Ga0075431_100005375 3300006847 Bacteria 12641
212 Ga0075433_10010775 3300006852 Bacteria 7351
213 Ga0075434_100006580 3300006871 Bacteria 10659
214 Ga0075434_100053122 3300006871 Bacteria 4026
215 Ga0075434_100099923 3300006871 Bacteria 2907
216 Ga0075429_100005002 3300006880 Bacteria 11413
217 Ga0068865_100000244 3300006881 Bacteria 30343
218 Ga0068865_100005990 3300006881 Bacteria 7408
219 Ga0075436_100010259 3300006914 Bacteria 6412
220 Ga0075436_100020494 3300006914 Bacteria 4537
221 Ga0097620_100002321 3300006931 Bacteria 19328
222 Ga0097620_100011971 3300006931 Bacteria 8714
223 Ga0097620_100015168 3300006931 Bacteria 7734
224 Ga0097620_100224917 3300006931 Bacteria 1965
225 Ga0075435_100018953 3300007076 Bacteria 5245
226 Ga0075435_100094630 3300007076 Bacteria 2470
227 Ga0099795_10004155 3300007788 Bacteria 3699
228 Ga0099795_10008200 3300007788 Bacteria 2965
229 Ga0105244_10018886 3300009036 Bacteria 3860
230 Ga0105240_10000798 3300009093 Bacteria 57073
231 Ga0105240_10000938 3300009093 Bacteria 51767
232 Ga0111539_10003401 3300009094 Bacteria 20957
233 Ga0111539_10032147 3300009094 Bacteria 6374
234 Ga0111539_10115740 3300009094 Bacteria 3144
235 Ga0105245_10007297 3300009098 Bacteria 9681
236 Ga0105245_10022284 3300009098 Bacteria 5560
237 Ga0105245_10031383 3300009098 Bacteria 4701
238 Ga0105247_10014767 3300009101 Bacteria 4681
239 Ga0114129_10006095 3300009147 Bacteria 17097
240 Ga0114129_10090309 3300009147 Bacteria 4247
241 Ga0114129_10152174 3300009147 Bacteria 3165
242 Ga0105243_10009225 3300009148 Bacteria 7532
243 Ga0105241_10014140 3300009174 Bacteria 5849
244 Ga0105242_10040800 3300009176 Bacteria 3740
245 Ga0105242_10075407 3300009176 Bacteria 2808
246 Ga0105242_10078422 3300009176 Bacteria 2757
247 Ga0105248_10000635 3300009177 Bacteria 39916
248 Ga0105248_10023392 3300009177 Bacteria 6864
249 Ga0105248_10104103 3300009177 Bacteria 3199
250 Ga0105248_10140148 3300009177 Bacteria 2728
251 Ga0105248_10247572 3300009177 Bacteria 2006
252 Ga0105237_10019840 3300009545 Bacteria 6940
253 Ga0105237_10194952 3300009545 Bacteria 2025
254 Ga0105238_10000739 3300009551 Bacteria 34142
255 Ga0105238_10004540 3300009551 Bacteria 13740
256 Ga0105238_10037849 3300009551 Bacteria 4902
257 Ga0105249_10001033 3300009553 Bacteria 24619
258 Ga0105249_10015027 3300009553 Bacteria 6849
259 Ga0105249_10239728 3300009553 Bacteria 1792
260 Ga0105239_10001295 3300010375 Bacteria 33721
261 Ga0105239_10019241 3300010375 Bacteria 7541
262 Ga0105239_10035447 3300010375 Bacteria 5479
263 Ga0105246_10001800 3300011119 Bacteria 12824
264 Ga0105246_10104965 3300011119 Bacteria 2064
265 Ga0105246_10107844 3300011119 Bacteria 2040
266 Ga0157373_10000266 3300013100 Bacteria 42156
267 Ga0157373_10000699 3300013100 Bacteria 26275
268 Ga0157373_10000704 3300013100 Bacteria 26230
269 Ga0157373_10021255 3300013100 Bacteria 4712
270 Ga0157373_10021471 3300013100 Bacteria 4689
271 Ga0157373_10022131 3300013100 Bacteria 4612
272 Ga0157373_10025753 3300013100 Bacteria 4252
273 Ga0157371_10000451 3300013102 Bacteria 50405
274 Ga0157371_10000725 3300013102 Bacteria 38633
275 Ga0157371_10002225 3300013102 Bacteria 18778
276 Ga0157371_10010582 3300013102 Bacteria 7168
277 Ga0157371_10026845 3300013102 Bacteria 4181
278 Ga0157371_10033114 3300013102 Bacteria 3715
279 Ga0157371_10098706 3300013102 Bacteria 2071
280 Ga0157370_10002951 3300013104 Bacteria 20249
281 Ga0157370_10004287 3300013104 Bacteria 16429
282 Ga0157370_10092288 3300013104 Bacteria 2842
283 Ga0157370_10280971 3300013104 Bacteria 1538
284 Ga0157369_10006077 3300013105 Bacteria 14011
285 Ga0157369_10015265 3300013105 Bacteria 8665
286 Ga0157369_10072248 3300013105 Bacteria 3703
287 Ga0157374_10003001 3300013296 Bacteria 14126
288 Ga0157374_10009715 3300013296 Bacteria 8260
289 Ga0157374_10138796 3300013296 Bacteria 2358
290 Ga0157378_10002181 3300013297 Bacteria 17356
291 Ga0163162_10003401 3300013306 Bacteria 15185
292 Ga0163162_10194359 3300013306 Bacteria 2157
293 Ga0157372_10004429 3300013307 Bacteria 14982
294 Ga0157372_10010976 3300013307 Bacteria 9642
295 Ga0157372_10015970 3300013307 Bacteria 8053
296 Ga0157372_10023648 3300013307 Bacteria 6665
297 Ga0157372_10025943 3300013307 Bacteria 6375
298 Ga0157372_10042371 3300013307 Bacteria 5035
299 Ga0157372_10049520 3300013307 Bacteria 4671
300 Ga0157372_10082719 3300013307 Unclassified 3635
301 Ga0157372_10111837 3300013307 Bacteria 3129
302 Ga0157375_10003806 3300013308 Bacteria 13080
303 Ga0157375_10020942 3300013308 Bacteria 5984
304 Ga0163163_10005155 3300014325 Bacteria 11267
305 Ga0157380_10001301 3300014326 Bacteria 16225
306 Ga0157380_10226933 3300014326 Bacteria 1674
307 Ga0157379_10000275 3300014968 Bacteria 40524
308 Ga0157379_10016877 3300014968 Bacteria 6425
309 Ga0157379_10220374 3300014968 Bacteria 1719
310 Ga0157376_10000115 3300014969 Bacteria 57170
311 Ga0183365_10003 3300015684 Bacteria 414944
312 Ga0163161_10078244 3300017792 Bacteria 2430
313 Ga0163161_10147380 3300017792 Bacteria 1786
314 Ga0213876_10000414 3300021384 Bacteria 35795
315 Ga0207666_1000050 3300025271 Bacteria 22802
316 Ga0209673_1017079 3300025273 Bacteria 2686
317 Ga0207673_1000083 3300025290 Bacteria 8317
318 Ga0209675_1000514 3300025291 Bacteria 28599
319 Ga0209025_1000016 3300025294 Bacteria 770739
320 Ga0209564_1000023 3300025295 Bacteria 555102
321 Ga0209564_1000035 3300025295 Bacteria 442446
322 Ga0209758_1003674 3300025297 Bacteria 13647
323 Ga0209758_1039438 3300025297 Bacteria 1796
324 Ga0209256_1000025 3300025299 Bacteria 442449
325 Ga0209256_1000584 3300025299 Bacteria 51121
326 Ga0207697_10003427 3300025315 Bacteria 7854
327 Ga0207697_10014069 3300025315 Bacteria 3330
328 Ga0207653_10011359 3300025885 Bacteria 2778
329 Ga0207682_10000695 3300025893 Bacteria 15627
330 Ga0207692_10034918 3300025898 Bacteria 2438
331 Ga0207692_10091923 3300025898 Bacteria 1647
332 Ga0207642_10001013 3300025899 Bacteria 8804
333 Ga0207710_10020800 3300025900 Bacteria 2807
334 Ga0207710_10063248 3300025900 Bacteria 1683
335 Ga0207688_10001691 3300025901 Bacteria 11690
336 Ga0207647_10007711 3300025904 Bacteria 7748
337 Ga0207647_10129576 3300025904 Bacteria 1483
338 Ga0207685_10002459 3300025905 Bacteria 4254
339 Ga0207685_10025208 3300025905 Bacteria 2050
340 Ga0207699_10034165 3300025906 Bacteria 2881
341 Ga0207645_10000114 3300025907 Bacteria 60880
342 Ga0207643_10000134 3300025908 Bacteria 50474
343 Ga0207705_10000826 3300025909 Bacteria 25319
344 Ga0207705_10014114 3300025909 Bacteria 5755
345 Ga0207705_10023982 3300025909 Bacteria 4354
346 Ga0207705_10088026 3300025909 Bacteria 2271
347 Ga0207654_10003477 3300025911 Bacteria 7966
348 Ga0207654_10005659 3300025911 Bacteria 6317
349 Ga0207654_10022181 3300025911 Bacteria 3385
350 Ga0207707_10001147 3300025912 Bacteria 25092
351 Ga0207707_10008171 3300025912 Bacteria 9080
352 Ga0207707_10049328 3300025912 Bacteria 3667
353 Ga0207707_10120576 3300025912 Bacteria 2293
354 Ga0207707_10129488 3300025912 Bacteria 2207
355 Ga0207695_10000086 3300025913 Bacteria 278055
356 Ga0207695_10059284 3300025913 Bacteria 3970
357 Ga0207695_10136559 3300025913 Bacteria 2405
358 Ga0207671_10018213 3300025914 Bacteria 5395
359 Ga0207693_10002351 3300025915 Bacteria 16428
360 Ga0207693_10042576 3300025915 Bacteria 3574
361 Ga0207663_10062764 3300025916 Bacteria 2363
362 Ga0207663_10070342 3300025916 Bacteria 2254
363 Ga0207660_10000034 3300025917 Bacteria 65783
364 Ga0207660_10028719 3300025917 Bacteria 3807
365 Ga0207660_10031763 3300025917 Bacteria 3640
366 Ga0207660_10043080 3300025917 Bacteria 3171
367 Ga0207660_10043658 3300025917 Bacteria 3150
368 Ga0207660_10059999 3300025917 Bacteria 2732
369 Ga0207660_10096160 3300025917 Bacteria 2205
370 Ga0207662_10003783 3300025918 Bacteria 7854
371 Ga0207662_10005820 3300025918 Bacteria 6605
372 Ga0207662_10012857 3300025918 Bacteria 4670
373 Ga0207657_10002202 3300025919 Bacteria 21126
374 Ga0207657_10002232 3300025919 Bacteria 21006
375 Ga0207657_10005404 3300025919 Bacteria 13354
376 Ga0207657_10014577 3300025919 Bacteria 7661
377 Ga0207657_10028202 3300025919 Bacteria 5126
378 Ga0207657_10052181 3300025919 Bacteria 3551
379 Ga0207657_10081124 3300025919 Bacteria 2726
380 Ga0207649_10000142 3300025920 Bacteria 60023
381 Ga0207649_10048579 3300025920 Bacteria 2617
382 Ga0207652_10000159 3300025921 Bacteria 73101
383 Ga0207652_10000819 3300025921 Bacteria 29643
384 Ga0207652_10002021 3300025921 Bacteria 17491
385 Ga0207652_10003248 3300025921 Bacteria 13486
386 Ga0207652_10028137 3300025921 Bacteria 4688
387 Ga0207652_10032953 3300025921 Bacteria 4361
388 Ga0207652_10050967 3300025921 Bacteria 3547
389 Ga0207652_10070953 3300025921 Bacteria 3026
390 Ga0207652_10097116 3300025921 Bacteria 2596
391 Ga0207681_10000065 3300025923 Bacteria 98832
392 Ga0207681_10049749 3300025923 Bacteria 2834
393 Ga0207694_10001748 3300025924 Bacteria 18228
394 Ga0207694_10050623 3300025924 Bacteria 3218
395 Ga0207694_10101264 3300025924 Bacteria 2283
396 Ga0207650_10002366 3300025925 Bacteria 13121
397 Ga0207650_10003910 3300025925 Bacteria 10188
398 Ga0207659_10000078 3300025926 Bacteria 61403
399 Ga0207659_10002782 3300025926 Bacteria 10432
400 Ga0207687_10117143 3300025927 Bacteria 1987
401 Ga0207700_10010746 3300025928 Bacteria 5798
402 Ga0207700_10136691 3300025928 Bacteria 2009
403 Ga0207664_10002328 3300025929 Bacteria 12549
404 Ga0207664_10004658 3300025929 Bacteria 9303
405 Ga0207690_10002633 3300025932 Bacteria 10810
406 Ga0207690_10038328 3300025932 Bacteria 3118
407 Ga0207690_10043012 3300025932 Bacteria 2970
408 Ga0207690_10066700 3300025932 Bacteria 2466
409 Ga0207690_10091209 3300025932 Bacteria 2153
410 Ga0207706_10010585 3300025933 Bacteria 8423
411 Ga0207706_10017442 3300025933 Bacteria 6468
412 Ga0207686_10007002 3300025934 Bacteria 6068
413 Ga0207686_10078427 3300025934 Bacteria 2148
414 Ga0207709_10000183 3300025935 Bacteria 83374
415 Ga0207670_10017591 3300025936 Bacteria 4323
416 Ga0207670_10035097 3300025936 Bacteria 3249
417 Ga0207670_10038388 3300025936 Bacteria 3127
418 Ga0207669_10001025 3300025937 Bacteria 11929
419 Ga0207704_10000719 3300025938 Bacteria 14567
420 Ga0207665_10021032 3300025939 Bacteria 4288
421 Ga0207691_10013386 3300025940 Bacteria 7854
422 Ga0207691_10023625 3300025940 Bacteria 5789
423 Ga0207711_10000482 3300025941 Bacteria 41192
424 Ga0207711_10002506 3300025941 Bacteria 16369
425 Ga0207689_10000144 3300025942 Bacteria 61402
426 Ga0207661_10001264 3300025944 Bacteria 16911
427 Ga0207661_10024363 3300025944 Bacteria 4586
428 Ga0207661_10118426 3300025944 Bacteria 2251
429 Ga0207679_10000064 3300025945 Bacteria 98118
430 Ga0207679_10008326 3300025945 Bacteria 6605
431 Ga0207679_10017293 3300025945 Bacteria 4807
432 Ga0207667_10000697 3300025949 Bacteria 43571
433 Ga0207667_10011900 3300025949 Bacteria 10077
434 Ga0207667_10031553 3300025949 Bacteria 5718
435 Ga0207667_10039772 3300025949 Bacteria 5008
436 Ga0207667_10041705 3300025949 Bacteria 4880
437 Ga0207667_10115177 3300025949 Bacteria 2771
438 Ga0207667_10284192 3300025949 Unclassified 1691
439 Ga0207651_10000420 3300025960 Bacteria 18070
440 Ga0207651_10127362 3300025960 Bacteria 1942
441 Ga0207712_10001661 3300025961 Bacteria 14931
442 Ga0207668_10000965 3300025972 Bacteria 17301
443 Ga0207668_10112221 3300025972 Bacteria 2047
444 Ga0207640_10001755 3300025981 Bacteria 11643
445 Ga0207640_10030817 3300025981 Bacteria 3308
446 Ga0207658_10006976 3300025986 Bacteria 7690
447 Ga0207658_10061502 3300025986 Bacteria 2806
448 Ga0207677_10003997 3300026023 Bacteria 7866
449 Ga0207703_10010897 3300026035 Bacteria 7087
450 Ga0207703_10116932 3300026035 Bacteria 2284
451 Ga0207639_10001895 3300026041 Bacteria 14044
452 Ga0207639_10036628 3300026041 Bacteria 3637
453 Ga0207678_10000034 3300026067 Bacteria 104888
454 Ga0207678_10003913 3300026067 Bacteria 13396
455 Ga0207678_10047670 3300026067 Bacteria 3705
456 Ga0207708_10007970 3300026075 Bacteria 7848
457 Ga0207708_10035965 3300026075 Bacteria 3768
458 Ga0207702_10003767 3300026078 Bacteria 13697
459 Ga0207702_10033401 3300026078 Bacteria 4297
460 Ga0207641_10001821 3300026088 Bacteria 20519
461 Ga0207641_10018585 3300026088 Bacteria 5698
462 Ga0207648_10012750 3300026089 Bacteria 7854
463 Ga0207648_10032101 3300026089 Bacteria 4639
464 Ga0207676_10000079 3300026095 Bacteria 94811
465 Ga0207676_10079269 3300026095 Bacteria 2663
466 Ga0207676_10244276 3300026095 Bacteria 1612
467 Ga0207674_10000323 3300026116 Bacteria 61026
468 Ga0207674_10008053 3300026116 Bacteria 12218
469 Ga0207674_10029820 3300026116 Bacteria 5740
470 Ga0207674_10079124 3300026116 Bacteria 3292
471 Ga0207674_10131759 3300026116 Bacteria 2463
472 Ga0207674_10176184 3300026116 Bacteria 2091
473 Ga0207675_100012401 3300026118 Bacteria 7961
474 Ga0207675_100054943 3300026118 Bacteria 3715
475 Ga0207683_10000037 3300026121 Bacteria 100920
476 Ga0207683_10012300 3300026121 Bacteria 7305
477 Ga0207683_10026581 3300026121 Bacteria 4996
478 Ga0207698_10085676 3300026142 Bacteria 2559
479 Ga0207698_10090902 3300026142 Bacteria 2497
480 Ga0207698_10124096 3300026142 Bacteria 2192
481 Ga0210002_1000055 3300027617 Bacteria 17399
482 Ga0209971_1010411 3300027682 Bacteria 2202
483 Ga0209966_1001951 3300027695 Bacteria 3456
484 Ga0209998_10007236 3300027717 Bacteria 2300
485 Ga0209813_10005443 3300027866 Bacteria 3090
486 Ga0207428_10000216 3300027907 Bacteria 79777
487 Ga0207428_10000947 3300027907 Bacteria 32277
488 Ga0207428_10009986 3300027907 Bacteria 8496
489 Ga0268265_10001593 3300028380 Bacteria 18775
490 Ga0268264_10002487 3300028381 Bacteria 16198
491 Ga0268264_10011787 3300028381 Bacteria 7207
492 Ga0268264_10045578 3300028381 Bacteria 3641
493 Ga0265337_1000455 3300028556 Bacteria 21685
494 Ga0307515_10114786 3300028794 Bacteria 3109
495 Ga0265338_10014181 3300028800 Bacteria 8902
496 Ga0265338_10028844 3300028800 Bacteria 5522
497 Ga0265338_10032973 3300028800 Bacteria 5039
498 Ga0265330_10017507 3300031235 Bacteria 3298
499 Ga0265332_10004885 3300031238 Bacteria 6233
500 Ga0265328_10000625 3300031239 Bacteria 16392
501 Ga0265320_10004008 3300031240 Bacteria 9691
502 Ga0265325_10000104 3300031241 Bacteria 59692
503 Ga0265325_10003165 3300031241 Bacteria 10826
504 Ga0265325_10008799 3300031241 Bacteria 5932
505 Ga0265325_10028145 3300031241 Bacteria 3032
506 Ga0265339_10008839 3300031249 Bacteria 6378
507 Ga0265339_10032395 3300031249 Bacteria 2947
508 Ga0265339_10051603 3300031249 Bacteria 2243
509 Ga0265331_10002586 3300031250 Bacteria 12165
510 Ga0265331_10007020 3300031250 Bacteria 6571
511 Ga0265327_10025523 3300031251 Bacteria 3443
512 Ga0265316_10007468 3300031344 Bacteria 10300
513 Ga0307513_10000162 3300031456 Bacteria 96000
514 Ga0265313_10000438 3300031595 Bacteria 44285
515 Ga0265313_10008202 3300031595 Bacteria 6979
516 Ga0265313_10031332 3300031595 Bacteria 2727
517 Ga0265313_10036346 3300031595 Bacteria 2473
518 Ga0316579_10014439 3300031691 Bacteria 3414
519 Ga0265314_10007477 3300031711 Bacteria 9472
520 Ga0265342_10000807 3300031712 Bacteria 31481
521 Ga0265342_10037987 3300031712 Bacteria 2934
522 Ga0265342_10050235 3300031712 Bacteria 2492
523 Ga0316576_10066005 3300031727 Bacteria 2661
524 Ga0307405_10085098 3300031731 Bacteria 2078
525 Ga0307413_10078391 3300031824 Bacteria 2108
526 Ga0307410_10077889 3300031852 Bacteria 2319
527 Ga0307409_100044432 3300031995 Bacteria 3346
528 Ga0307416_100021418 3300032002 Bacteria 4640
529 Ga0307415_100042778 3300032126 Bacteria 3017
530 Ga0316583_10009090 3300032133 Bacteria 3584
531 Ga0307510_10038206 3300033180 Bacteria 5311
532 Ga0373930_0010010 3300034816 Bacteria 1685
533 Ga0373958_0009669 3300034819 Bacteria 1591
534 Ga0373938_0000060 3300034957 Bacteria 13928
535 Ga0373929_0000687 3300035085 Bacteria 6541
536 Ga0373934_0015852 3300035086 Bacteria 2863
537 Ga0373940_0000468 3300035088 Bacteria 6225
538 Ga0373936_0038511 3300035113 Bacteria 1911
539 Ga0373939_0000354 3300035114 Bacteria 11613
540 Ga0373941_0000073 3300035115 Bacteria 16016
541 Ga0373945_0032939 3300035116 Bacteria 1838
542 Ga0373956_0031854 3300035119 Bacteria 2312
543 Ga0373960_0000114 3300035121 Bacteria 12986
544 Ga0373946_0004481 3300035171 Bacteria 5001
545 Ga0373955_0060695 3300035172 Bacteria 2086
546 Ga0373942_0003137 3300035207 Bacteria 3911
547 Ga0373961_0003513 3300035241 Bacteria 3871
548 Ga0373962_0002966 3300035242 Bacteria 4070
549 Ga0316574_0071387 3300035398 Bacteria 2193
550 Ga0373924_0023750 3300035410 Bacteria 2409
551 Ga0373931_0067262 3300035691 Bacteria 1946
552 Ga0373935_0026091 3300035692 Bacteria 3604
553 Ga0373927_0002642 3300035695 Bacteria 13053
554 Ga0373927_0027210 3300035695 Bacteria 3734
555 Ga0373927_0031545 3300035695 Bacteria 3453
556 Ga0373933_0030523 3300035724 Bacteria 3121
557 Ga0373937_0015230 3300036401 Bacteria 6798
558 Ga0373937_0024244 3300036401 Bacteria 5469
559 Ga0373937_0052194 3300036401 Bacteria 3748
560 Ga0373937_0131703 3300036401 Bacteria 2335
561 Ga0373925_0000507 3300037068 Bacteria 39351
562 Ga0373925_0015686 3300037068 Bacteria 5483
563 Ga0373925_0047063 3300037068 Bacteria 3209
564 Ga0373925_0054236 3300037068 Bacteria 2998
565 Ga0395899_0000105 3300037312 Bacteria 146163
566 Ga0395899_0000913 3300037312 Bacteria 27769
567 Ga0395899_0002674 3300037312 Bacteria 14372
568 Ga0395899_0008998 3300037312 Bacteria 7679
569 Ga0395899_0015255 3300037312 Bacteria 5856
570 Ga0395899_0015289 3300037312 Bacteria 5848
571 Ga0395899_0027856 3300037312 Bacteria 4256
572 Ga0395900_0002396 3300037418 Bacteria 20678
573 Ga0395900_0003116 3300037418 Bacteria 18005
574 Ga0395900_0003303 3300037418 Bacteria 17453
575 Ga0395900_0008085 3300037418 Bacteria 10829
576 Ga0395900_0027215 3300037418 Bacteria 5856
577 Ga0395900_0136050 3300037418 Bacteria 2517
578 Ga0395900_0223283 3300037418 Bacteria 1898
579 Ga0395898_0000730 3300037466 Bacteria 57720
580 Ga0395898_0006986 3300037466 Bacteria 12000
581 Ga0395898_0008249 3300037466 Bacteria 11015
582 Ga0395898_0017166 3300037466 Bacteria 7393
583 Ga0395898_0023966 3300037466 Bacteria 6158
584 Ga0395898_0029520 3300037466 Bacteria 5492
585 Ga0395898_0032856 3300037466 Bacteria 5180
586 Ga0395898_0040919 3300037466 Bacteria 4580
587 Ga0395898_0110402 3300037466 Bacteria 2636
588 Ga0395898_0119170 3300037466 Bacteria 2528
589 Ga0395905_0000346 3300037471 Bacteria 65961
590 Ga0395905_0008421 3300037471 Bacteria 10170
591 Ga0395901_0002140 3300038443 Bacteria 20188
592 Ga0395901_0030404 3300038443 Bacteria 5564
593 Ga0395901_0033872 3300038443 Bacteria 5275
594 Ga0395901_0034665 3300038443 Bacteria 5213
595 Ga0395901_0044442 3300038443 Bacteria 4607
596 Ga0395901_0049828 3300038443 Bacteria 4352
597 Ga0395901_0053699 3300038443 Bacteria 4187
598 Ga0395901_0178453 3300038443 Bacteria 2227
599 Ga0395901_0285206 3300038443 Bacteria 1715
600 Ga0400489_02163 3300039093 Bacteria 4021
601 Ga0436365_0440714 3300039437 Bacteria 2098
602 Ga0436365_0459838 3300039437 Bacteria 2925
603 Ga0436365_0676365 3300039437 Bacteria 1934
604 Ga0436365_0883229 3300039437 Bacteria 3065
605 Ga0436365_1653706 3300039437 Bacteria 4794
606 Ga0436365_1830840 3300039437 Bacteria 45078
607 Ga0436361_0196619 3300039447 Bacteria 31824
608 Ga0436361_0846399 3300039447 Bacteria 4964
609 Ga0436361_1032931 3300039447 Bacteria 2458
610 Ga0439439_0006575 3300041406 Bacteria 2692
611 Ga0439448_0032448 3300042005 Bacteria 1662
612 Ga0466969_0001388 3300044656 Bacteria 13070
613 Ga0466965_0036373 3300044683 Bacteria 2416
614 Ga0466966_0000050 3300044684 Bacteria 88948
615 Ga0466961_0113469 3300044693 Bacteria 1704
616 Ga0453684_0190899 3300044712 Bacteria 2397
617 Ga0453684_0220580 3300044712 Bacteria 2197
618 Ga0466957_0000161 3300044842 Bacteria 29452
619 Ga0466957_0006712 3300044842 Bacteria 6507
620 Ga0466957_0130715 3300044842 Bacteria 1608
621 Ga0466959_0000121 3300045049 Bacteria 50252
622 Ga0466959_0138879 3300045049 Bacteria 1719
623 Ga0451576_0052847 3300045051 Bacteria 4257
624 Ga0466958_0002157 3300045836 Bacteria 9799
625 Ga0466967_0030498 3300045976 Bacteria 4526
626 Ga0495592_0045783 3300046454 Bacteria 3263
627 Ga0495603_0044127 3300046455 Bacteria 2660
628 Ga0495629_0001773 3300046459 Bacteria 16935
629 Ga0495629_0031784 3300046459 Bacteria 3737
630 Ga0495641_0012339 3300046461 Bacteria 4788
631 Ga0495641_0034862 3300046461 Bacteria 2376
632 Ga0495651_0008470 3300046462 Bacteria 7880
633 Ga0495651_0097345 3300046462 Bacteria 2197
634 Ga0495580_0016611 3300046472 Bacteria 5520
635 Ga0495580_0056438 3300046472 Bacteria 2765
636 Ga0495582_0006472 3300046473 Bacteria 6502
637 Ga0495582_0025590 3300046473 Bacteria 3232
638 Ga0495582_0049348 3300046473 Bacteria 2317
639 Ga0495639_0006653 3300046475 Bacteria 4971
640 Ga0495662_0066041 3300046476 Bacteria 1749
641 Ga0495664_0024189 3300046477 Bacteria 3528
642 Ga0495584_0006769 3300046491 Bacteria 5989
643 Ga0495608_0012886 3300046511 Bacteria 5802
644 Ga0495608_0031701 3300046511 Bacteria 3572
645 Ga0495628_0010385 3300046516 Bacteria 7911
646 Ga0495628_0138095 3300046516 Bacteria 1861
647 Ga0495630_0071206 3300046517 Bacteria 2616
648 Ga0495637_0057360 3300046520 Bacteria 1609
649 Ga0495644_0001471 3300046523 Bacteria 9606
650 Ga0495652_0054862 3300046529 Bacteria 3392
651 Ga0495652_0066151 3300046529 Bacteria 3035
652 Ga0495652_0105580 3300046529 Bacteria 2276
653 Ga0495652_0127499 3300046529 Bacteria 2019
654 Ga0495665_0040136 3300046531 Bacteria 2492
655 Ga0495665_0051062 3300046531 Bacteria 2191
656 Ga0495640_0037401 3300046533 Bacteria 3423
657 Ga0495640_0045414 3300046533 Bacteria 3048
658 Ga0495586_0024634 3300046535 Bacteria 3219
659 Ga0495586_0043180 3300046535 Bacteria 2429
660 Ga0495609_0041404 3300046538 Bacteria 2071
661 Ga0495645_0054503 3300046543 Bacteria 2905
662 Ga0495633_0005211 3300046558 Bacteria 8021
663 Ga0495667_0003339 3300046559 Bacteria 10747
664 Ga0495667_0057610 3300046559 Bacteria 2553
665 Ga0495634_0038057 3300046642 Bacteria 3281
666 Ga0495635_0021945 3300046663 Bacteria 4449
667 Ga0495588_0019049 3300046674 Bacteria 3357
668 Ga0495599_0018367 3300046678 Bacteria 4358
669 Ga0495599_0066980 3300046678 Bacteria 2243
670 Ga0495646_0008798 3300046680 Bacteria 6411
671 Ga0495646_0017575 3300046680 Bacteria 4533
672 Ga0495647_0006874 3300046681 Bacteria 3787
673 Ga0495658_0015235 3300046683 Bacteria 3942
674 Ga0495613_0048284 3300046689 Bacteria 3143
675 Ga0495624_0086706 3300046690 Bacteria 1933
676 Ga0495670_0002981 3300046691 Bacteria 8344
677 Ga0495600_0017400 3300046809 Bacteria 4572
678 Ga0495600_0035571 3300046809 Bacteria 3235
679 Ga0495600_0122294 3300046809 Bacteria 1693
680 Ga0495581_0005972 3300047315 Bacteria 7056
681 Ga0495581_0062463 3300047315 Bacteria 2152
682 Ga0495604_0030237 3300047317 Bacteria 4303
683 Ga0495604_0046732 3300047317 Bacteria 3375
684 Ga0495604_0104209 3300047317 Bacteria 2079
685 Ga0495674_0035150 3300047319 Bacteria 4523
686 Ga0495674_0079888 3300047319 Bacteria 2807
687 Ga0495672_0003063 3300047320 Bacteria 14627
688 Ga0495672_0045572 3300047320 Bacteria 2623
689 Ga0495680_0020932 3300047322 Bacteria 5486
690 Ga0495680_0042627 3300047322 Bacteria 3599
691 Ga0495680_0056380 3300047322 Bacteria 3042
692 Ga0495680_0075633 3300047322 Bacteria 2555
693 Ga0495684_0002658 3300047471 Bacteria 14168
694 Ga0495684_0056598 3300047471 Bacteria 2989
695 Ga0495684_0078674 3300047471 Bacteria 2503
696 Ga0495686_0000007 3300047472 Bacteria 732622
697 Ga0495593_0040071 3300047673 Bacteria 2523
698 Ga0495593_0055703 3300047673 Bacteria 2080
699 Ga0495602_0139582 3300048088 Bacteria 1920
700 Ga0495614_0014751 3300048089 Bacteria 3418
701 Ga0496100_0001418 3300048903 Bacteria 11725
702 Ga0496100_0014815 3300048903 Bacteria 4537
703 Ga0496100_0081205 3300048903 Bacteria 2190
704 Ga0496101_0051688 3300048904 Bacteria 2961
705 Ga0496101_0183312 3300048904 Bacteria 1613
706 Ga0496102_0000857 3300048905 Bacteria 29213
707 Ga0496102_0041108 3300048905 Bacteria 4186
708 Ga0496102_0098215 3300048905 Bacteria 2717
709 Ga0496103_0001402 3300048906 Bacteria 16210
710 Ga0496103_0005864 3300048906 Bacteria 7338
711 Ga0496103_0057007 3300048906 Bacteria 2425
712 Ga0496103_0075564 3300048906 Bacteria 2113
713 Ga0496104_0046190 3300048907 Bacteria 4100
714 Ga0496104_0155688 3300048907 Bacteria 2193
715 Ga0496105_0021990 3300048908 Bacteria 5164
716 Ga0496105_0060368 3300048908 Bacteria 3129
717 Ga0496105_0073183 3300048908 Bacteria 2831
718 Ga0496105_0185754 3300048908 Bacteria 1701
719 Ga0496106_0001911 3300048909 Bacteria 15609
720 Ga0496106_0004194 3300048909 Bacteria 10742
721 Ga0496106_0033306 3300048909 Bacteria 3845
722 Ga0496106_0078639 3300048909 Bacteria 2531
723 Ga0496106_0111535 3300048909 Bacteria 2130
724 Ga0496106_0124446 3300048909 Bacteria 2018
725 Ga0496107_0001131 3300048910 Bacteria 16108
726 Ga0496107_0002765 3300048910 Bacteria 11554
727 Ga0496107_0021589 3300048910 Bacteria 4551
728 Ga0496107_0119531 3300048910 Bacteria 1941
729 Ga0496108_0003866 3300048911 Bacteria 12025
730 Ga0496108_0043752 3300048911 Bacteria 3740
731 Ga0496108_0082444 3300048911 Bacteria 2727
732 Ga0496109_0005368 3300048912 Bacteria 10715
733 Ga0496109_0280482 3300048912 Bacteria 1570
734 Ga0496110_0023567 3300048913 Bacteria 5237
735 Ga0496110_0026617 3300048913 Bacteria 4952
736 Ga0496110_0065551 3300048913 Bacteria 3211
737 Ga0496110_0212132 3300048913 Bacteria 1760
738 Ga0496111_0014062 3300048914 Bacteria 5459
739 Ga0496112_0004182 3300048915 Bacteria 12158
740 Ga0496112_0012681 3300048915 Bacteria 7751
741 Ga0496112_0046860 3300048915 Bacteria 4241
742 Ga0496112_0136703 3300048915 Bacteria 2421
743 Ga0496113_0013896 3300048916 Bacteria 5472
744 Ga0496113_0035238 3300048916 Bacteria 3659
745 Ga0496114_0004563 3300048917 Bacteria 10757
746 Ga0496114_0019579 3300048917 Bacteria 5484
747 Ga0496114_0052437 3300048917 Bacteria 3399
748 Ga0496115_0001705 3300048918 Bacteria 15763
749 Ga0496115_0001749 3300048918 Bacteria 15583
750 Ga0496115_0003668 3300048918 Bacteria 11050
751 Ga0496115_0030609 3300048918 Bacteria 4235
752 Ga0496115_0086573 3300048918 Bacteria 2556
753 Ga0496115_0234433 3300048918 Bacteria 1513
754 Ga0496117_0072620 3300048920 Bacteria 2299
755 Ga0496119_0000289 3300048922 Bacteria 70660
756 Ga0496121_0001676 3300048924 Bacteria 36412
757 Ga0496122_0002313 3300048925 Bacteria 27497
758 Ga0496123_0001408 3300048926 Bacteria 33627
759 Ga0501032_0000011 3300049569 Bacteria 198158
760 Ga0501032_0001847 3300049569 Bacteria 16751
761 Ga0501032_0011006 3300049569 Bacteria 6504
762 Ga0501032_0013582 3300049569 Bacteria 5787
763 Ga0501032_0083527 3300049569 Bacteria 2124
764 Ga0501032_0087584 3300049569 Bacteria 2068
765 Ga0501032_0116277 3300049569 Bacteria 1768
766 Ga0501033_0000011 3300049570 Bacteria 259130
767 Ga0501033_0007756 3300049570 Bacteria 8317
768 Ga0501033_0029355 3300049570 Bacteria 4133
769 Ga0501033_0046182 3300049570 Bacteria 3238
770 Ga0501033_0115397 3300049570 Bacteria 1951
771 Ga0501034_0000001 3300049571 Bacteria 2184493
772 Ga0501034_0000171 3300049571 Bacteria 120801
773 Ga0501034_0000211 3300049571 Bacteria 110858
774 Ga0501034_0000391 3300049571 Bacteria 74631
775 Ga0501034_0005441 3300049571 Bacteria 13914
776 Ga0501034_0042214 3300049571 Bacteria 4617
777 Ga0501034_0045163 3300049571 Bacteria 4452
778 Ga0501034_0055154 3300049571 Bacteria 4000
779 Ga0501034_0071345 3300049571 Bacteria 3483
780 Ga0501034_0084550 3300049571 Bacteria 3175
781 Ga0501034_0089856 3300049571 Bacteria 3069
782 Ga0501034_0093880 3300049571 Bacteria 2997
783 Ga0501034_0095958 3300049571 Bacteria 2961
784 Ga0501034_0161604 3300049571 Bacteria 2210
785 Ga0501034_0183249 3300049571 Bacteria 2058
786 Ga0501036_0011376 3300049572 Bacteria 7364
787 Ga0501036_0026696 3300049572 Bacteria 4878
788 Ga0501036_0030447 3300049572 Bacteria 4558
789 Ga0501036_0030820 3300049572 Bacteria 4532
790 Ga0501036_0053157 3300049572 Bacteria 3431
791 Ga0501036_0057170 3300049572 Bacteria 3304
792 Ga0501037_0004808 3300049573 Bacteria 9818
793 Ga0501037_0023203 3300049573 Bacteria 4588
794 Ga0501037_0034647 3300049573 Bacteria 3724
795 Ga0501037_0065072 3300049573 Bacteria 2656
796 Ga0501038_0000009 3300049574 Bacteria 190794
797 Ga0501038_0022074 3300049574 Bacteria 5707
798 Ga0501038_0034931 3300049574 Bacteria 4418
799 Ga0501039_0000243 3300049575 Bacteria 39697
800 Ga0501039_0018425 3300049575 Bacteria 5358
801 Ga0501039_0050420 3300049575 Bacteria 3220
802 Ga0501039_0066057 3300049575 Bacteria 2807
803 Ga0501039_0137131 3300049575 Bacteria 1921
804 Ga0501042_0078125 3300049578 Bacteria 2370
805 Ga0501043_0015700 3300049579 Bacteria 5937
806 Ga0501043_0024066 3300049579 Bacteria 4778
807 Ga0501043_0025652 3300049579 Bacteria 4624
808 Ga0501043_0046828 3300049579 Bacteria 3400
809 Ga0501043_0048152 3300049579 Bacteria 3351
810 Ga0501043_0099831 3300049579 Bacteria 2282
811 Ga0501043_0129997 3300049579 Bacteria 1973
812 Ga0501046_0022137 3300049580 Bacteria 5238
813 Ga0501046_0025627 3300049580 Bacteria 4825
814 Ga0501046_0044209 3300049580 Bacteria 3543
815 Ga0501047_0000218 3300049581 Bacteria 68952
816 Ga0501047_0000719 3300049581 Bacteria 34423
817 Ga0501047_0005238 3300049581 Bacteria 12176
818 Ga0501047_0007054 3300049581 Bacteria 10551
819 Ga0501047_0011235 3300049581 Bacteria 8474
820 Ga0501047_0053286 3300049581 Bacteria 3911
821 Ga0501047_0085022 3300049581 Bacteria 3040
822 Ga0501047_0164519 3300049581 Bacteria 2089
823 Ga0501048_0000762 3300049582 Bacteria 23616
824 Ga0501067_0000058 3300049583 Bacteria 64397
825 Ga0501067_0011018 3300049583 Bacteria 5005
826 Ga0501067_0077123 3300049583 Bacteria 1846
827 Ga0501068_0015380 3300049584 Bacteria 4392
828 Ga0501068_0022741 3300049584 Bacteria 3669
829 Ga0501070_0011908 3300049586 Bacteria 7346
830 Ga0501070_0042124 3300049586 Bacteria 3802
831 Ga0501070_0147020 3300049586 Bacteria 1945
832 Ga0501071_0014032 3300049587 Bacteria 5473
833 Ga0501071_0045045 3300049587 Bacteria 3166
834 Ga0501072_0126151 3300049588 Bacteria 2039
835 Ga0501073_0000154 3300049589 Bacteria 45306
836 Ga0501073_0016647 3300049589 Bacteria 5327
837 Ga0501073_0103208 3300049589 Bacteria 1980
838 Ga0501074_0006835 3300049590 Bacteria 8244
839 Ga0501074_0053607 3300049590 Bacteria 2908
840 Ga0501077_0000148 3300049593 Bacteria 38929
841 Ga0501079_0033063 3300049741 Bacteria 3977
842 Ga0501080_0000028 3300049742 Bacteria 88948
843 Ga0501080_0000489 3300049742 Bacteria 30879
844 Ga0501080_0004383 3300049742 Bacteria 12535
845 Ga0501080_0024037 3300049742 Bacteria 5649
846 Ga0501080_0075222 3300049742 Bacteria 3141
847 Ga0501080_0085988 3300049742 Bacteria 2921
848 Ga0501080_0100781 3300049742 Bacteria 2679
849 Ga0501081_0065853 3300049743 Bacteria 2519
850 Ga0501083_0001945 3300049744 Bacteria 14214
851 Ga0501083_0018125 3300049744 Bacteria 4907
852 Ga0501083_0053032 3300049744 Bacteria 2723
853 Ga0501083_0077574 3300049744 Bacteria 2204
854 Ga0501083_0113966 3300049744 Bacteria 1776
855 Ga0501035_0000020 3300049822 Bacteria 221605
856 Ga0501035_0026411 3300049822 Bacteria 5312
857 Ga0501035_0035310 3300049822 Bacteria 4537
858 Ga0501035_0050714 3300049822 Bacteria 3718
859 Ga0501035_0065534 3300049822 Bacteria 3225
860 Ga0501035_0243221 3300049822 Bacteria 1530
861 Ga0501044_0000007 3300049823 Bacteria 283429
862 Ga0501044_0000177 3300049823 Bacteria 78892
863 Ga0501044_0000822 3300049823 Bacteria 37410
864 Ga0501044_0000931 3300049823 Bacteria 35180
865 Ga0501044_0001454 3300049823 Bacteria 27833
866 Ga0501044_0026378 3300049823 Bacteria 6150
867 Ga0501044_0034897 3300049823 Bacteria 5270
868 Ga0501044_0054761 3300049823 Bacteria 4099
869 Ga0501044_0068612 3300049823 Bacteria 3611
870 Ga0501044_0069002 3300049823 Bacteria 3600
871 Ga0501044_0107099 3300049823 Bacteria 2807
872 Ga0501045_0000052 3300049824 Bacteria 51519
873 Ga0501045_0009778 3300049824 Bacteria 6708
874 nmdc:mga0yw44_78231_c1 3300050492 Bacteria 2068
875 nmdc:mga06z11_3604_c1 3300050494 Bacteria 6005
876 nmdc:mga04h51_376_c1 3300050495 Bacteria 10902
877 nmdc:mga05p37_136517_c1 3300050507 Bacteria 3007
878 nmdc:mga05p37_96871_c1 3300050507 Bacteria 3635
879 nmdc:mga05p37_9895_c1 3300050507 Bacteria 11314
880 nmdc:mga09592_1920_c1 3300050508 Bacteria 16707
881 nmdc:mga0qj67_170_c1 3300050509 Bacteria 43684
882 nmdc:mga06r32_5477_c1 3300050510 Bacteria 11430
883 nmdc:mga08y16_3365_c1 3300050511 Bacteria 16572
884 nmdc:mga08y16_77112_c1 3300050511 Bacteria 3475
885 nmdc:mga0n895_148235_c1 3300050512 Bacteria 2376
886 nmdc:mga0n895_6097_c1 3300050512 Bacteria 10177
887 nmdc:mga0n895_62267_c1 3300050512 Bacteria 3687
888 nmdc:mga0n895_79771_c1 3300050512 Bacteria 3260
889 nmdc:mga0n895_80865_c1 3300050512 Bacteria 3238
890 nmdc:mga0rr50_52137_c1 3300050513 Bacteria 3038
891 nmdc:mga08x19_14_c1 3300050514 Bacteria 365567
892 nmdc:mga08x19_29622_c1 3300050514 Bacteria 3434
893 nmdc:mga0a205_2212_c1 3300050515 Bacteria 6635
894 Ga0495601_0001731 3300053077 Bacteria 12068
895 Ga0495601_0002237 3300053077 Bacteria 10901
896 Ga0495601_0008863 3300053077 Bacteria 5937
897 Ga0495601_0026287 3300053077 Bacteria 3593
898 Ga0495601_0112276 3300053077 Bacteria 1765
899 Ga0495612_0000795 3300053078 Bacteria 12832
900 Ga0495612_0043062 3300053078 Bacteria 1843
901 Ga0500635_0011818 3300053080 Bacteria 2491
902 Ga0495595_0003051 3300053084 Bacteria 6620
903 Ga0495595_0003260 3300053084 Bacteria 6448
904 Ga0495595_0026835 3300053084 Bacteria 2561
905 Ga0495619_0000043 3300053085 Bacteria 109865
906 Ga0495619_0003586 3300053085 Bacteria 10006
907 Ga0495619_0010551 3300053085 Bacteria 5812
908 Ga0495619_0012705 3300053085 Bacteria 5300
909 Ga0495619_0019129 3300053085 Bacteria 4352
910 Ga0495619_0065301 3300053085 Bacteria 2428
911 Ga0500643_000298 3300053087 Bacteria 41754
912 Ga0500643_001914 3300053087 Bacteria 11311
913 Ga0500643_004945 3300053087 Bacteria 5860
914 Ga0500643_025178 3300053087 Bacteria 1879
915 Ga0500646_0006610 3300053090 Bacteria 2951
916 Ga0500641_0000515 3300053096 Bacteria 13894
917 Ga0500641_0002953 3300053096 Bacteria 6019
918 Ga0500641_0008875 3300053096 Bacteria 3602
919 Ga0500556_0000009 3300053104 Bacteria 288111
920 Ga0500556_0002346 3300053104 Bacteria 6163
921 Ga0500556_0011251 3300053104 Bacteria 2647
922 Ga0500593_000068 3300053117 Bacteria 38366
923 Ga0500595_000002 3300053119 Bacteria 1074388
924 Ga0500608_000278 3300053122 Bacteria 19784
925 Ga0500652_019680 3300053131 Bacteria 2512
926 Ga0500616_0000002 3300053153 Bacteria 1611257
927 Ga0500616_0021501 3300053153 Bacteria 3616
928 Ga0500616_0045860 3300053153 Bacteria 2326
929 Ga0500622_0014531 3300053156 Bacteria 4226
930 Ga0500636_0014409 3300053177 Bacteria 4650
931 Ga0500636_0069800 3300053177 Bacteria 2039
932 Ga0500645_000410 3300053730 Bacteria 30009
933 Ga0500645_000851 3300053730 Bacteria 17875
934 Ga0500645_003590 3300053730 Bacteria 6227
935 Ga0501084_0002576 3300054114 Bacteria 14608
936 Ga0501082_0005691 3300060353 Bacteria 10812
937 Ga0501082_0006366 3300060353 Bacteria 10246
938 Ga0501082_0034806 3300060353 Bacteria 4341
939 Ga0501082_0085475 3300060353 Bacteria 2721
940 Ga0501082_0096172 3300060353 Bacteria 2560
941 Ga0530510_0026181 3300061734 Bacteria 4173
942 Ga0530510_0048393 3300061734 Bacteria 3073

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048907 Ga0496104_0155688 Ga0496104_0155688_940_2154 399
2 iso_pu_bacteria 2924718760 2924726378 422
3 3300039437 Ga0436365_0676365 Ga0436365_0676365_19_1323 430
4 3300060353 Ga0501082_0034806 Ga0501082_0034806_2994_4292 430
5 3300046520 Ga0495637_0057360 Ga0495637_0057360_228_1523 431
6 3300049822 Ga0501035_0243221 Ga0501035_0243221_10_1320 431
7 3300013306 Ga0163162_10194359 Ga0163162_101943592 435
8 3300014326 Ga0157380_10226933 Ga0157380_102269331 441
9 3300005844 Ga0068862_100026829 Ga0068862_1000268293 451
10 3300005347 Ga0070668_100022013 Ga0070668_1000220134 453
11 3300005459 Ga0068867_100021411 Ga0068867_1000214112 453
12 3300005843 Ga0068860_100123487 Ga0068860_1001234872 453
13 3300009176 Ga0105242_10075407 Ga0105242_100754072 453
14 3300009177 Ga0105248_10104103 Ga0105248_101041032 453
15 3300009553 Ga0105249_10239728 Ga0105249_102397282 453
16 3300017792 Ga0163161_10147380 Ga0163161_101473801 453
17 3300025934 Ga0207686_10078427 Ga0207686_100784272 453
18 3300026089 Ga0207648_10032101 Ga0207648_100321013 453
19 3300049571 Ga0501034_0055154 Ga0501034_0055154_2338_3786 453
20 3300005535 Ga0070684_100070557 Ga0070684_1000705572 454
21 3300011119 Ga0105246_10107844 Ga0105246_101078442 454
22 3300048908 Ga0496105_0185754 Ga0496105_0185754_10_1392 454
23 3300048909 Ga0496106_0124446 Ga0496106_0124446_641_2005 454
24 3300044712 Ga0453684_0220580 Ga0453684_0220580_173_1621 461
25 3300005327 Ga0070658_10043077 Ga0070658_100430772 463
26 3300005329 Ga0070683_100036634 Ga0070683_1000366344 463
27 3300005564 Ga0070664_100031759 Ga0070664_1000317592 463
28 3300005618 Ga0068864_100046583 Ga0068864_1000465832 463
29 3300013307 Ga0157372_10025943 Ga0157372_100259434 463
30 3300025904 Ga0207647_10129576 Ga0207647_101295761 463
31 3300025909 Ga0207705_10023982 Ga0207705_100239824 463
32 3300025932 Ga0207690_10038328 Ga0207690_100383282 463
33 3300025944 Ga0207661_10024363 Ga0207661_100243632 463
34 3300025945 Ga0207679_10008326 Ga0207679_100083262 463
35 3300048911 Ga0496108_0043752 Ga0496108_0043752_133_1593 463
36 3300048915 Ga0496112_0012681 Ga0496112_0012681_666_2126 463
37 3300049569 Ga0501032_0011006 Ga0501032_0011006_335_1837 464
38 3300046533 Ga0495640_0045414 Ga0495640_0045414_68_1522 465
39 3300047317 Ga0495604_0104209 Ga0495604_0104209_559_2013 465
40 3300047319 Ga0495674_0035150 Ga0495674_0035150_2453_3907 465
41 3300005329 Ga0070683_100044223 Ga0070683_1000442234 466
42 3300009098 Ga0105245_10022284 Ga0105245_100222845 466
43 3300009176 Ga0105242_10040800 Ga0105242_100408002 466
44 3300025944 Ga0207661_10118426 Ga0207661_101184262 466
45 3300035086 Ga0373934_0015852 Ga0373934_0015852_1442_2842 466
46 3300035116 Ga0373945_0032939 Ga0373945_0032939_397_1797 466
47 3300048906 Ga0496103_0075564 Ga0496103_0075564_654_2054 466
48 3300048918 Ga0496115_0234433 Ga0496115_0234433_12_1412 466
49 3300005341 Ga0070691_10002362 Ga0070691_100023622 467
50 3300005471 Ga0070698_100000560 Ga0070698_10000056015 467
51 3300031238 Ga0265332_10004885 Ga0265332_100048853 467
52 3300041406 Ga0439439_0006575 Ga0439439_0006575_408_1829 467
53 3300048910 Ga0496107_0119531 Ga0496107_0119531_374_1792 467
54 3300049569 Ga0501032_0013582 Ga0501032_0013582_2623_4128 467
55 3300049570 Ga0501033_0000011 Ga0501033_0000011_94314_95819 467
56 3300049571 Ga0501034_0000171 Ga0501034_0000171_7295_8800 467
57 3300049572 Ga0501036_0011376 Ga0501036_0011376_454_1959 467
58 3300049573 Ga0501037_0004808 Ga0501037_0004808_352_1857 467
59 3300049575 Ga0501039_0066057 Ga0501039_0066057_477_1982 467
60 3300049579 Ga0501043_0015700 Ga0501043_0015700_2659_4164 467
61 3300049823 Ga0501044_0000177 Ga0501044_0000177_38236_39741 467
62 3300049824 Ga0501045_0000052 Ga0501045_0000052_27678_29183 467
63 3300025909 Ga0207705_10088026 Ga0207705_100880262 468
64 3300037312 Ga0395899_0000913 Ga0395899_0000913_19986_21458 470
65 3300037418 Ga0395900_0002396 Ga0395900_0002396_9505_10977 470
66 3300037466 Ga0395898_0000730 Ga0395898_0000730_26872_28344 470
67 3300036401 Ga0373937_0015230 Ga0373937_0015230_2300_3766 471
68 3300005459 Ga0068867_100061652 Ga0068867_1000616522 472
69 3300048917 Ga0496114_0004563 Ga0496114_0004563_105_1523 472
70 3300049742 Ga0501080_0075222 Ga0501080_0075222_1270_2730 472
71 3300005293 Ga0065715_10154420 Ga0065715_101544201 473
72 3300005336 Ga0070680_100006873 Ga0070680_1000068735 473
73 3300005337 Ga0070682_100005746 Ga0070682_1000057463 473
74 3300005458 Ga0070681_10025879 Ga0070681_100258795 473
75 3300005530 Ga0070679_100046442 Ga0070679_1000464422 473
76 3300005539 Ga0068853_100013478 Ga0068853_1000134784 473
77 3300005547 Ga0070693_100040290 Ga0070693_1000402903 473
78 3300005564 Ga0070664_100023848 Ga0070664_1000238484 473
79 3300006871 Ga0075434_100099923 Ga0075434_1000999233 473
80 3300006914 Ga0075436_100020494 Ga0075436_1000204943 473
81 3300009098 Ga0105245_10007297 Ga0105245_1000729711 473
82 3300013102 Ga0157371_10026845 Ga0157371_100268452 473
83 3300013104 Ga0157370_10004287 Ga0157370_1000428716 473
84 3300013104 Ga0157370_10092288 Ga0157370_100922882 473
85 3300013307 Ga0157372_10004429 Ga0157372_100044294 473
86 3300025917 Ga0207660_10043658 Ga0207660_100436582 473
87 3300025921 Ga0207652_10032953 Ga0207652_100329532 473
88 3300025945 Ga0207679_10017293 Ga0207679_100172933 473
89 3300025949 Ga0207667_10041705 Ga0207667_100417053 473
90 3300025949 Ga0207667_10115177 Ga0207667_101151772 473
91 3300026116 Ga0207674_10079124 Ga0207674_100791242 473
92 3300031731 Ga0307405_10085098 Ga0307405_100850981 473
93 3300042005 Ga0439448_0032448 Ga0439448_0032448_175_1641 473
94 3300046529 Ga0495652_0054862 Ga0495652_0054862_546_2000 473
95 3300046543 Ga0495645_0054503 Ga0495645_0054503_812_2266 473
96 3300046678 Ga0495599_0018367 Ga0495599_0018367_1310_2764 473
97 3300050514 nmdc:mga08x19_29622_c1 nmdc:mga08x19_29622_c1_1584_3032 473
98 3300005327 Ga0070658_10024663 Ga0070658_100246632 475
99 3300005329 Ga0070683_100137493 Ga0070683_1001374932 475
100 3300005339 Ga0070660_100005053 Ga0070660_1000050535 475
101 3300005339 Ga0070660_100014065 Ga0070660_1000140653 475
102 3300005339 Ga0070660_100063970 Ga0070660_1000639703 475
103 3300005366 Ga0070659_100022400 Ga0070659_1000224003 475
104 3300005366 Ga0070659_100036035 Ga0070659_1000360353 475
105 3300005530 Ga0070679_100004705 Ga0070679_1000047053 475
106 3300005530 Ga0070679_100011599 Ga0070679_1000115998 475
107 3300005530 Ga0070679_100058272 Ga0070679_1000582723 475
108 3300005530 Ga0070679_100092614 Ga0070679_1000926143 475
109 3300005539 Ga0068853_100024539 Ga0068853_1000245394 475
110 3300005563 Ga0068855_100001281 Ga0068855_10000128126 475
111 3300005563 Ga0068855_100006064 Ga0068855_1000060647 475
112 3300005563 Ga0068855_100109780 Ga0068855_1001097802 475
113 3300005563 Ga0068855_100188515 Ga0068855_1001885153 475
114 3300005563 Ga0068855_100272619 Ga0068855_1002726192 475
115 3300005577 Ga0068857_100033314 Ga0068857_1000333144 475
116 3300005614 Ga0068856_100003452 Ga0068856_10000345211 475
117 3300005616 Ga0068852_100001221 Ga0068852_1000012213 475
118 3300005616 Ga0068852_100078213 Ga0068852_1000782132 475
119 3300005843 Ga0068860_100137572 Ga0068860_1001375722 475
120 3300013100 Ga0157373_10000699 Ga0157373_1000069927 475
121 3300013100 Ga0157373_10021471 Ga0157373_100214714 475
122 3300013100 Ga0157373_10022131 Ga0157373_100221316 475
123 3300013100 Ga0157373_10025753 Ga0157373_100257534 475
124 3300013102 Ga0157371_10000451 Ga0157371_1000045116 475
125 3300013102 Ga0157371_10000725 Ga0157371_1000072533 475
126 3300013102 Ga0157371_10002225 Ga0157371_100022254 475
127 3300013102 Ga0157371_10010582 Ga0157371_100105827 475
128 3300013102 Ga0157371_10033114 Ga0157371_100331144 475
129 3300013102 Ga0157371_10098706 Ga0157371_100987061 475
130 3300013104 Ga0157370_10002951 Ga0157370_1000295120 475
131 3300013104 Ga0157370_10280971 Ga0157370_102809711 475
132 3300013105 Ga0157369_10006077 Ga0157369_1000607712 475
133 3300013105 Ga0157369_10015265 Ga0157369_100152657 475
134 3300013105 Ga0157369_10072248 Ga0157369_100722483 475
135 3300013307 Ga0157372_10010976 Ga0157372_100109769 475
136 3300013307 Ga0157372_10015970 Ga0157372_100159707 475
137 3300013307 Ga0157372_10023648 Ga0157372_100236482 475
138 3300013307 Ga0157372_10042371 Ga0157372_100423715 475
139 3300013307 Ga0157372_10082719 Ga0157372_100827192 475
140 3300013307 Ga0157372_10111837 Ga0157372_101118372 475
141 3300025909 Ga0207705_10014114 Ga0207705_100141142 475
142 3300025917 Ga0207660_10028719 Ga0207660_100287191 475
143 3300025917 Ga0207660_10059999 Ga0207660_100599993 475
144 3300025919 Ga0207657_10002202 Ga0207657_1000220213 475
145 3300025919 Ga0207657_10028202 Ga0207657_100282026 475
146 3300025919 Ga0207657_10081124 Ga0207657_100811243 475
147 3300025921 Ga0207652_10000159 Ga0207652_100001592 475
148 3300025921 Ga0207652_10000819 Ga0207652_1000081917 475
149 3300025921 Ga0207652_10003248 Ga0207652_100032483 475
150 3300025921 Ga0207652_10070953 Ga0207652_100709533 475
151 3300025921 Ga0207652_10097116 Ga0207652_100971162 475
152 3300025925 Ga0207650_10003910 Ga0207650_100039105 475
153 3300025932 Ga0207690_10043012 Ga0207690_100430122 475
154 3300025949 Ga0207667_10000697 Ga0207667_1000069733 475
155 3300025949 Ga0207667_10039772 Ga0207667_100397725 475
156 3300025949 Ga0207667_10284192 Ga0207667_102841922 475
157 3300026067 Ga0207678_10047670 Ga0207678_100476704 475
158 3300026078 Ga0207702_10033401 Ga0207702_100334012 475
159 3300026095 Ga0207676_10244276 Ga0207676_102442761 475
160 3300026116 Ga0207674_10029820 Ga0207674_100298203 475
161 3300037312 Ga0395899_0008998 Ga0395899_0008998_1250_2722 475
162 3300037312 Ga0395899_0015289 Ga0395899_0015289_2203_3675 475
163 3300037312 Ga0395899_0027856 Ga0395899_0027856_1244_2716 475
164 3300037418 Ga0395900_0003116 Ga0395900_0003116_11802_13274 475
165 3300037418 Ga0395900_0008085 Ga0395900_0008085_3173_4645 475
166 3300037466 Ga0395898_0023966 Ga0395898_0023966_1759_3231 475
167 3300037466 Ga0395898_0029520 Ga0395898_0029520_2644_4092 475
168 3300037471 Ga0395905_0008421 Ga0395905_0008421_3319_4791 475
169 3300038443 Ga0395901_0002140 Ga0395901_0002140_10728_12200 475
170 3300038443 Ga0395901_0044442 Ga0395901_0044442_933_2405 475
171 3300038443 Ga0395901_0049828 Ga0395901_0049828_1679_3151 475
172 3300038443 Ga0395901_0053699 Ga0395901_0053699_1322_2794 475
173 3300005290 Ga0065712_10088883 Ga0065712_100888832 477
174 3300005331 Ga0070670_100073114 Ga0070670_1000731142 477
175 3300005340 Ga0070689_100017219 Ga0070689_1000172196 477
176 3300005353 Ga0070669_100000866 Ga0070669_1000008666 477
177 3300005354 Ga0070675_100030722 Ga0070675_1000307222 477
178 3300005355 Ga0070671_100015170 Ga0070671_1000151706 477
179 3300005364 Ga0070673_100023201 Ga0070673_1000232014 477
180 3300005466 Ga0070685_10012192 Ga0070685_100121921 477
181 3300005535 Ga0070684_100009822 Ga0070684_1000098222 477
182 3300005543 Ga0070672_100035461 Ga0070672_1000354612 477
183 3300005577 Ga0068857_100105596 Ga0068857_1001055962 477
184 3300005617 Ga0068859_100002321 Ga0068859_1000023212 477
185 3300006028 Ga0070717_10089870 Ga0070717_100898702 477
186 3300006931 Ga0097620_100002321 Ga0097620_1000023212 477
187 3300013296 Ga0157374_10138796 Ga0157374_101387962 477
188 3300013308 Ga0157375_10020942 Ga0157375_100209426 477
189 3300025918 Ga0207662_10005820 Ga0207662_100058202 477
190 3300025926 Ga0207659_10002782 Ga0207659_100027822 477
191 3300025936 Ga0207670_10017591 Ga0207670_100175915 477
192 3300025940 Ga0207691_10023625 Ga0207691_100236254 477
193 3300025960 Ga0207651_10127362 Ga0207651_101273622 477
194 3300026116 Ga0207674_10008053 Ga0207674_1000805311 477
195 3300031852 Ga0307410_10077889 Ga0307410_100778892 477
196 3300031995 Ga0307409_100044432 Ga0307409_1000444322 477
197 3300032002 Ga0307416_100021418 Ga0307416_1000214183 477
198 3300032126 Ga0307415_100042778 Ga0307415_1000427782 477
199 3300039437 Ga0436365_0459838 Ga0436365_0459838_168_1628 477
200 3300048908 Ga0496105_0060368 Ga0496105_0060368_184_1644 477
201 3300048909 Ga0496106_0111535 Ga0496106_0111535_45_1505 477
202 3300048915 Ga0496112_0136703 Ga0496112_0136703_654_2114 477
203 3300049742 Ga0501080_0024037 Ga0501080_0024037_4011_5495 477
204 3300049744 Ga0501083_0001945 Ga0501083_0001945_10025_11509 477
205 3300031241 Ga0265325_10028145 Ga0265325_100281452 478
206 3300049571 Ga0501034_0000211 Ga0501034_0000211_550_1986 478
207 iso_pu_bacteria 2522572158 2523102476 478
208 3300005455 Ga0070663_100011143 Ga0070663_1000111434 479
209 3300005617 Ga0068859_100224909 Ga0068859_1002249092 479
210 3300006358 Ga0068871_100036365 Ga0068871_1000363652 479
211 3300006931 Ga0097620_100224917 Ga0097620_1002249172 479
212 3300009093 Ga0105240_10000938 Ga0105240_1000093820 479
213 3300009177 Ga0105248_10000635 Ga0105248_1000063527 479
214 3300009551 Ga0105238_10000739 Ga0105238_100007397 479
215 3300010375 Ga0105239_10001295 Ga0105239_100012958 479
216 3300013296 Ga0157374_10003001 Ga0157374_100030015 479
217 3300025911 Ga0207654_10003477 Ga0207654_1000347711 479
218 3300025913 Ga0207695_10000086 Ga0207695_1000008632 479
219 3300025924 Ga0207694_10001748 Ga0207694_1000174814 479
220 3300025941 Ga0207711_10002506 Ga0207711_100025066 479
221 3300044842 Ga0466957_0000161 Ga0466957_0000161_18926_20404 479
222 3300049579 Ga0501043_0046828 Ga0501043_0046828_1739_3208 479
223 iso_pu_bacteria 2643221547 2643756570 481
224 3300007788 Ga0099795_10008200 Ga0099795_100082002 482
225 3300039437 Ga0436365_1653706 Ga0436365_1653706_2441_3889 482
226 3300049569 Ga0501032_0000011 Ga0501032_0000011_161453_162904 482
227 3300049571 Ga0501034_0000001 Ga0501034_0000001_1497472_1498923 482
228 3300049571 Ga0501034_0071345 Ga0501034_0071345_374_1825 482
229 3300049575 Ga0501039_0000243 Ga0501039_0000243_3467_4918 482
230 3300005518 Ga0070699_100003377 Ga0070699_1000033775 483
231 3300005563 Ga0068855_100157921 Ga0068855_1001579212 483
232 3300031240 Ga0265320_10004008 Ga0265320_100040088 483
233 3300038443 Ga0395901_0030404 Ga0395901_0030404_786_2243 483
234 3300039437 Ga0436365_0883229 Ga0436365_0883229_165_1619 483
235 3300049571 Ga0501034_0093880 Ga0501034_0093880_1147_2607 483
236 3300049574 Ga0501038_0000009 Ga0501038_0000009_108156_109610 483
237 3300003911 JGI25405J52794_10005801 JGI25405J52794_100058012 484
238 3300005340 Ga0070689_100046718 Ga0070689_1000467182 484
239 3300005437 Ga0070710_10007147 Ga0070710_100071472 484
240 3300005439 Ga0070711_100058618 Ga0070711_1000586182 484
241 3300005467 Ga0070706_100125858 Ga0070706_1001258582 484
242 3300005937 Ga0081455_10003187 Ga0081455_1000318722 484
243 3300006028 Ga0070717_10016597 Ga0070717_100165974 484
244 3300006163 Ga0070715_10005429 Ga0070715_100054292 484
245 3300025898 Ga0207692_10034918 Ga0207692_100349182 484
246 3300025905 Ga0207685_10002459 Ga0207685_100024591 484
247 3300025916 Ga0207663_10062764 Ga0207663_100627642 484
248 3300025928 Ga0207700_10010746 Ga0207700_100107465 484
249 3300025929 Ga0207664_10004658 Ga0207664_100046584 484
250 3300025939 Ga0207665_10021032 Ga0207665_100210323 484
251 3300028800 Ga0265338_10032973 Ga0265338_100329734 484
252 3300031241 Ga0265325_10008799 Ga0265325_100087993 484
253 3300031249 Ga0265339_10032395 Ga0265339_100323951 484
254 3300031595 Ga0265313_10008202 Ga0265313_100082025 484
255 3300037466 Ga0395898_0040919 Ga0395898_0040919_3102_4562 484
256 3300039447 Ga0436361_0846399 Ga0436361_0846399_3282_4736 484
257 3300048924 Ga0496121_0001676 Ga0496121_0001676_23485_25014 484
258 3300049569 Ga0501032_0083527 Ga0501032_0083527_249_1766 484
259 3300049570 Ga0501033_0029355 Ga0501033_0029355_506_1969 484
260 3300049570 Ga0501033_0115397 Ga0501033_0115397_185_1714 484
261 3300049571 Ga0501034_0161604 Ga0501034_0161604_460_1923 484
262 3300049573 Ga0501037_0065072 Ga0501037_0065072_672_2135 484
263 3300049574 Ga0501038_0022074 Ga0501038_0022074_3711_5174 484
264 3300049575 Ga0501039_0137131 Ga0501039_0137131_172_1635 484
265 3300049583 Ga0501067_0011018 Ga0501067_0011018_375_1835 484
266 3300049586 Ga0501070_0147020 Ga0501070_0147020_461_1924 484
267 3300049587 Ga0501071_0045045 Ga0501071_0045045_1144_2622 484
268 3300049588 Ga0501072_0126151 Ga0501072_0126151_409_1887 484
269 3300049590 Ga0501074_0053607 Ga0501074_0053607_288_1751 484
270 3300049742 Ga0501080_0085988 Ga0501080_0085988_925_2388 484
271 3300049742 Ga0501080_0100781 Ga0501080_0100781_196_1674 484
272 3300053077 Ga0495601_0026287 Ga0495601_0026287_1004_2479 484
273 3300053084 Ga0495595_0003260 Ga0495595_0003260_2038_3513 484
274 3300053085 Ga0495619_0012705 Ga0495619_0012705_2936_4411 484
275 3300054114 Ga0501084_0002576 Ga0501084_0002576_13076_14554 484
276 3300060353 Ga0501082_0006366 Ga0501082_0006366_5302_6780 484
277 3300061734 Ga0530510_0048393 Ga0530510_0048393_1539_3017 484
278 iso_pu_bacteria 2508501114 2509078795 484
279 iso_pu_bacteria 2523231067 2523468262 484
280 iso_pu_bacteria 2595698237 2596371562 484
281 iso_pu_bacteria 2643221629 2644166055 484
282 iso_pu_bacteria 2643221662 2644346939 484
283 iso_pu_bacteria 2738543031 2739348066 484
284 iso_pu_bacteria 2773857925 2774872602 484
285 iso_pu_bacteria 2775506901 2776259616 484
286 iso_pu_bacteria 2835312727 2835317290 484
287 iso_pu_bacteria 2874139085 2874141340 484
288 iso_pu_bacteria 2882456835 2882458198 484
289 iso_pu_bacteria 2884298095 2884299817 484
290 iso_pu_bacteria 2889306138 2889307302 484
291 iso_pu_bacteria 2894232714 2894239657 484
292 iso_pu_bacteria 2902330777 2902331990 484
293 iso_pu_bacteria 2902405164 2902410301 484
294 iso_pu_bacteria 2919450847 2919450954 484
295 iso_pu_bacteria 2928125067 2928127818 484
296 iso_pu_bacteria 8005658619 8005659782 484
297 3300005338 Ga0068868_100113449 Ga0068868_1001134492 485
298 3300005539 Ga0068853_100043602 Ga0068853_1000436025 485
299 3300006847 Ga0075431_100005375 Ga0075431_1000053753 485
300 3300028800 Ga0265338_10014181 Ga0265338_100141816 485
301 3300031595 Ga0265313_10000438 Ga0265313_1000043844 485
302 3300044656 Ga0466969_0001388 Ga0466969_0001388_58_1545 485
303 3300044684 Ga0466966_0000050 Ga0466966_0000050_61787_63274 485
304 3300044842 Ga0466957_0006712 Ga0466957_0006712_3138_4625 485
305 3300045049 Ga0466959_0000121 Ga0466959_0000121_39832_41319 485
306 3300045836 Ga0466958_0002157 Ga0466958_0002157_127_1614 485
307 3300049579 Ga0501043_0099831 Ga0501043_0099831_64_1536 485
308 3300049581 Ga0501047_0005238 Ga0501047_0005238_2946_4403 485
309 3300049583 Ga0501067_0077123 Ga0501067_0077123_197_1666 485
310 3300049823 Ga0501044_0069002 Ga0501044_0069002_1923_3383 485
311 3300053177 Ga0500636_0069800 Ga0500636_0069800_522_1985 485
312 iso_pu_bacteria 2513237087 2513591768 485
313 iso_pu_bacteria 2643221733 2644731172 485
314 iso_pu_bacteria 2643221734 2644733133 485
315 iso_pu_bacteria 2818991467 2819717962 485
316 iso_pu_bacteria 2828305725 2828309520 485
317 iso_pu_bacteria 2917554339 2917557566 485
318 iso_pu_bacteria 2917699015 2917700576 485
319 iso_pu_bacteria 2939669807 2939671295 485
320 3300005336 Ga0070680_100015843 Ga0070680_1000158436 486
321 3300005366 Ga0070659_100001044 Ga0070659_10000104421 486
322 3300005616 Ga0068852_100176443 Ga0068852_1001764431 486
323 3300005841 Ga0068863_100036320 Ga0068863_1000363205 486
324 3300005843 Ga0068860_100001852 Ga0068860_10000185218 486
325 3300005843 Ga0068860_100016648 Ga0068860_1000166483 486
326 3300005985 Ga0081539_10025143 Ga0081539_100251433 486
327 3300009177 Ga0105248_10140148 Ga0105248_101401482 486
328 3300013100 Ga0157373_10000266 Ga0157373_1000026639 486
329 3300025913 Ga0207695_10059284 Ga0207695_100592841 486
330 3300025913 Ga0207695_10136559 Ga0207695_101365592 486
331 3300025917 Ga0207660_10043080 Ga0207660_100430801 486
332 3300025941 Ga0207711_10000482 Ga0207711_1000048214 486
333 3300025949 Ga0207667_10031553 Ga0207667_100315533 486
334 3300025972 Ga0207668_10112221 Ga0207668_101122212 486
335 3300025986 Ga0207658_10006976 Ga0207658_1000697610 486
336 3300026088 Ga0207641_10018585 Ga0207641_100185856 486
337 3300028381 Ga0268264_10011787 Ga0268264_100117873 486
338 3300028381 Ga0268264_10045578 Ga0268264_100455785 486
339 3300028800 Ga0265338_10028844 Ga0265338_100288443 486
340 3300031456 Ga0307513_10000162 Ga0307513_1000016289 486
341 3300031711 Ga0265314_10007477 Ga0265314_100074777 486
342 3300033180 Ga0307510_10038206 Ga0307510_100382064 486
343 3300037068 Ga0373925_0000507 Ga0373925_0000507_4110_5570 486
344 3300037068 Ga0373925_0054236 Ga0373925_0054236_667_2145 486
345 3300037312 Ga0395899_0002674 Ga0395899_0002674_7679_9139 486
346 3300037418 Ga0395900_0003303 Ga0395900_0003303_13406_14866 486
347 3300037418 Ga0395900_0136050 Ga0395900_0136050_468_1928 486
348 3300037466 Ga0395898_0006986 Ga0395898_0006986_7328_8788 486
349 3300037466 Ga0395898_0008249 Ga0395898_0008249_4441_5901 486
350 3300037466 Ga0395898_0110402 Ga0395898_0110402_740_2200 486
351 3300037471 Ga0395905_0000346 Ga0395905_0000346_28509_29999 486
352 3300038443 Ga0395901_0033872 Ga0395901_0033872_3379_4839 486
353 3300038443 Ga0395901_0178453 Ga0395901_0178453_501_1961 486
354 3300044683 Ga0466965_0036373 Ga0466965_0036373_760_2256 486
355 3300044693 Ga0466961_0113469 Ga0466961_0113469_151_1647 486
356 3300044842 Ga0466957_0130715 Ga0466957_0130715_99_1559 486
357 3300047320 Ga0495672_0003063 Ga0495672_0003063_7700_9187 486
358 3300048904 Ga0496101_0183312 Ga0496101_0183312_86_1579 486
359 3300048913 Ga0496110_0026617 Ga0496110_0026617_2210_3676 486
360 3300048915 Ga0496112_0046860 Ga0496112_0046860_2015_3481 486
361 3300048918 Ga0496115_0001705 Ga0496115_0001705_13696_15204 486
362 3300049570 Ga0501033_0046182 Ga0501033_0046182_1153_2622 486
363 3300049571 Ga0501034_0005441 Ga0501034_0005441_9553_11022 486
364 3300049571 Ga0501034_0045163 Ga0501034_0045163_451_1920 486
365 3300049572 Ga0501036_0026696 Ga0501036_0026696_2495_3964 486
366 3300049572 Ga0501036_0030447 Ga0501036_0030447_343_1812 486
367 3300049573 Ga0501037_0023203 Ga0501037_0023203_2275_3744 486
368 3300049573 Ga0501037_0034647 Ga0501037_0034647_1800_3269 486
369 3300049575 Ga0501039_0018425 Ga0501039_0018425_534_2003 486
370 3300049579 Ga0501043_0024066 Ga0501043_0024066_407_1876 486
371 3300049579 Ga0501043_0129997 Ga0501043_0129997_404_1873 486
372 3300049580 Ga0501046_0022137 Ga0501046_0022137_3453_4922 486
373 3300049580 Ga0501046_0044209 Ga0501046_0044209_156_1625 486
374 3300049581 Ga0501047_0000218 Ga0501047_0000218_26400_27869 486
375 3300049581 Ga0501047_0011235 Ga0501047_0011235_289_1770 486
376 3300049582 Ga0501048_0000762 Ga0501048_0000762_19189_20658 486
377 3300049584 Ga0501068_0015380 Ga0501068_0015380_2652_4121 486
378 3300049586 Ga0501070_0011908 Ga0501070_0011908_3153_4622 486
379 3300049586 Ga0501070_0042124 Ga0501070_0042124_2258_3727 486
380 3300049587 Ga0501071_0014032 Ga0501071_0014032_456_1925 486
381 3300049589 Ga0501073_0103208 Ga0501073_0103208_135_1619 486
382 3300049741 Ga0501079_0033063 Ga0501079_0033063_2108_3577 486
383 3300049742 Ga0501080_0000489 Ga0501080_0000489_26503_27972 486
384 3300049744 Ga0501083_0018125 Ga0501083_0018125_10_1494 486
385 3300049823 Ga0501044_0000931 Ga0501044_0000931_23112_24581 486
386 3300049823 Ga0501044_0034897 Ga0501044_0034897_3386_4855 486
387 3300053087 Ga0500643_000298 Ga0500643_000298_29501_31006 486
388 3300053087 Ga0500643_025178 Ga0500643_025178_35_1543 486
389 3300053090 Ga0500646_0006610 Ga0500646_0006610_771_2255 486
390 3300053096 Ga0500641_0000515 Ga0500641_0000515_11678_13183 486
391 3300053104 Ga0500556_0002346 Ga0500556_0002346_1376_2878 486
392 3300053104 Ga0500556_0011251 Ga0500556_0011251_106_1611 486
393 3300053153 Ga0500616_0045860 Ga0500616_0045860_406_1908 486
394 3300053730 Ga0500645_000851 Ga0500645_000851_10749_12254 486
395 3300053730 Ga0500645_003590 Ga0500645_003590_1613_3115 486
396 3300060353 Ga0501082_0096172 Ga0501082_0096172_72_1556 486
397 3300005335 Ga0070666_10021102 Ga0070666_100211025 487
398 3300005440 Ga0070705_100076531 Ga0070705_1000765312 487
399 3300005549 Ga0070704_100023644 Ga0070704_1000236441 487
400 3300006178 Ga0075367_10009286 Ga0075367_100092862 487
401 3300006846 Ga0075430_100002515 Ga0075430_1000025155 487
402 3300006871 Ga0075434_100053122 Ga0075434_1000531224 487
403 3300009093 Ga0105240_10000798 Ga0105240_1000079862 487
404 3300009147 Ga0114129_10090309 Ga0114129_100903095 487
405 3300009553 Ga0105249_10015027 Ga0105249_100150271 487
406 3300013100 Ga0157373_10000704 Ga0157373_100007045 487
407 3300021384 Ga0213876_10000414 Ga0213876_1000041410 487
408 3300025924 Ga0207694_10101264 Ga0207694_101012642 487
409 3300025927 Ga0207687_10117143 Ga0207687_101171431 487
410 3300027866 Ga0209813_10005443 Ga0209813_100054432 487
411 3300031824 Ga0307413_10078391 Ga0307413_100783912 487
412 3300037312 Ga0395899_0000105 Ga0395899_0000105_30050_31516 487
413 3300039437 Ga0436365_0440714 Ga0436365_0440714_564_2030 487
414 3300039437 Ga0436365_1830840 Ga0436365_1830840_8157_9623 487
415 3300039447 Ga0436361_0196619 Ga0436361_0196619_5170_6636 487
416 3300045976 Ga0466967_0030498 Ga0466967_0030498_3050_4513 487
417 3300047472 Ga0495686_0000007 Ga0495686_0000007_11599_13116 487
418 3300049569 Ga0501032_0001847 Ga0501032_0001847_6728_8245 487
419 3300049569 Ga0501032_0087584 Ga0501032_0087584_202_1731 487
420 3300049570 Ga0501033_0007756 Ga0501033_0007756_4089_5570 487
421 3300049572 Ga0501036_0053157 Ga0501036_0053157_1861_3378 487
422 3300049581 Ga0501047_0053286 Ga0501047_0053286_584_2056 487
423 3300049583 Ga0501067_0000058 Ga0501067_0000058_45823_47340 487
424 3300049584 Ga0501068_0022741 Ga0501068_0022741_906_2423 487
425 3300049589 Ga0501073_0000154 Ga0501073_0000154_6858_8375 487
426 3300049593 Ga0501077_0000148 Ga0501077_0000148_16388_17905 487
427 3300049742 Ga0501080_0004383 Ga0501080_0004383_7606_9123 487
428 3300049744 Ga0501083_0053032 Ga0501083_0053032_1156_2673 487
429 3300049823 Ga0501044_0001454 Ga0501044_0001454_4493_5956 487
430 3300049823 Ga0501044_0068612 Ga0501044_0068612_1788_3269 487
431 3300050494 nmdc:mga06z11_3604_c1 nmdc:mga06z11_3604_c1_3196_4716 487
432 3300050495 nmdc:mga04h51_376_c1 nmdc:mga04h51_376_c1_1275_2795 487
433 3300050507 nmdc:mga05p37_136517_c1 nmdc:mga05p37_136517_c1_136_1599 487
434 3300050509 nmdc:mga0qj67_170_c1 nmdc:mga0qj67_170_c1_10155_11624 487
435 3300050512 nmdc:mga0n895_148235_c1 nmdc:mga0n895_148235_c1_188_1657 487
436 3300053096 Ga0500641_0002953 Ga0500641_0002953_43_1551 487
437 3300053104 Ga0500556_0000009 Ga0500556_0000009_66070_67542 487
438 3300053156 Ga0500622_0014531 Ga0500622_0014531_2161_3627 487
439 3300060353 Ga0501082_0085475 Ga0501082_0085475_930_2447 487
440 3300005337 Ga0070682_100006850 Ga0070682_1000068508 488
441 3300005341 Ga0070691_10030620 Ga0070691_100306204 488
442 3300005355 Ga0070671_100082757 Ga0070671_1000827573 488
443 3300005367 Ga0070667_100223132 Ga0070667_1002231321 488
444 3300005455 Ga0070663_100001352 Ga0070663_1000013526 488
445 3300005530 Ga0070679_100094353 Ga0070679_1000943534 488
446 3300005536 Ga0070697_100002324 Ga0070697_1000023244 488
447 3300005545 Ga0070695_100005457 Ga0070695_1000054579 488
448 3300005563 Ga0068855_100139847 Ga0068855_1001398474 488
449 3300005563 Ga0068855_100233537 Ga0068855_1002335372 488
450 3300005577 Ga0068857_100157882 Ga0068857_1001578822 488
451 3300005981 Ga0081538_10001621 Ga0081538_1000162119 488
452 3300005981 Ga0081538_10035138 Ga0081538_100351381 488
453 3300006914 Ga0075436_100010259 Ga0075436_1000102597 488
454 3300009094 Ga0111539_10115740 Ga0111539_101157402 488
455 3300009098 Ga0105245_10031383 Ga0105245_100313833 488
456 3300009174 Ga0105241_10014140 Ga0105241_100141404 488
457 3300009551 Ga0105238_10004540 Ga0105238_100045408 488
458 3300014968 Ga0157379_10016877 Ga0157379_100168772 488
459 3300025919 Ga0207657_10014577 Ga0207657_100145778 488
460 3300025921 Ga0207652_10050967 Ga0207652_100509673 488
461 3300025924 Ga0207694_10050623 Ga0207694_100506231 488
462 3300026035 Ga0207703_10116932 Ga0207703_101169324 488
463 3300026067 Ga0207678_10000034 Ga0207678_1000003438 488
464 3300026095 Ga0207676_10079269 Ga0207676_100792692 488
465 3300026116 Ga0207674_10176184 Ga0207674_101761842 488
466 3300031239 Ga0265328_10000625 Ga0265328_1000062510 488
467 3300031250 Ga0265331_10002586 Ga0265331_100025868 488
468 3300031344 Ga0265316_10007468 Ga0265316_100074688 488
469 3300031727 Ga0316576_10066005 Ga0316576_100660052 488
470 3300035398 Ga0316574_0071387 Ga0316574_0071387_104_1585 488
471 3300037068 Ga0373925_0015686 Ga0373925_0015686_966_2447 488
472 3300037418 Ga0395900_0027215 Ga0395900_0027215_2139_3608 488
473 3300037418 Ga0395900_0223283 Ga0395900_0223283_285_1757 488
474 3300037466 Ga0395898_0119170 Ga0395898_0119170_888_2360 488
475 3300038443 Ga0395901_0285206 Ga0395901_0285206_192_1673 488
476 3300039093 Ga0400489_02163 Ga0400489_02163_2067_3548 488
477 3300039447 Ga0436361_1032931 Ga0436361_1032931_391_1878 488
478 3300045049 Ga0466959_0138879 Ga0466959_0138879_93_1568 488
479 3300046533 Ga0495640_0037401 Ga0495640_0037401_1547_3028 488
480 3300047320 Ga0495672_0045572 Ga0495672_0045572_447_1925 488
481 3300048903 Ga0496100_0014815 Ga0496100_0014815_1547_3028 488
482 3300048903 Ga0496100_0081205 Ga0496100_0081205_218_1699 488
483 3300048906 Ga0496103_0005864 Ga0496103_0005864_331_1812 488
484 3300048909 Ga0496106_0001911 Ga0496106_0001911_12204_13685 488
485 3300048910 Ga0496107_0001131 Ga0496107_0001131_4989_6470 488
486 3300048917 Ga0496114_0052437 Ga0496114_0052437_431_1912 488
487 3300048918 Ga0496115_0001749 Ga0496115_0001749_3759_5240 488
488 3300049571 Ga0501034_0000391 Ga0501034_0000391_14652_16151 488
489 3300049571 Ga0501034_0042214 Ga0501034_0042214_1434_2921 488
490 3300049571 Ga0501034_0183249 Ga0501034_0183249_64_1545 488
491 3300049572 Ga0501036_0030820 Ga0501036_0030820_2039_3523 488
492 3300049572 Ga0501036_0057170 Ga0501036_0057170_144_1619 488
493 3300049578 Ga0501042_0078125 Ga0501042_0078125_694_2166 488
494 3300049579 Ga0501043_0025652 Ga0501043_0025652_511_1995 488
495 3300049579 Ga0501043_0048152 Ga0501043_0048152_407_1882 488
496 3300049580 Ga0501046_0025627 Ga0501046_0025627_1848_3329 488
497 3300049581 Ga0501047_0000719 Ga0501047_0000719_14322_15821 488
498 3300049581 Ga0501047_0085022 Ga0501047_0085022_955_2439 488
499 3300049581 Ga0501047_0164519 Ga0501047_0164519_145_1620 488
500 3300049742 Ga0501080_0000028 Ga0501080_0000028_77840_79339 488
501 3300049743 Ga0501081_0065853 Ga0501081_0065853_415_1887 488
502 3300049744 Ga0501083_0113966 Ga0501083_0113966_85_1551 488
503 3300049822 Ga0501035_0000020 Ga0501035_0000020_17226_18725 488
504 3300049822 Ga0501035_0026411 Ga0501035_0026411_307_1782 488
505 3300049822 Ga0501035_0050714 Ga0501035_0050714_1261_2757 488
506 3300049823 Ga0501044_0000007 Ga0501044_0000007_162842_164341 488
507 3300049824 Ga0501045_0009778 Ga0501045_0009778_3603_5075 488
508 3300050492 nmdc:mga0yw44_78231_c1 nmdc:mga0yw44_78231_c1_131_1606 488
509 3300050507 nmdc:mga05p37_96871_c1 nmdc:mga05p37_96871_c1_1859_3328 488
510 3300050514 nmdc:mga08x19_14_c1 nmdc:mga08x19_14_c1_17687_19156 488
511 3300053087 Ga0500643_004945 Ga0500643_004945_4271_5743 488
512 3300053117 Ga0500593_000068 Ga0500593_000068_8226_9704 488
513 3300053153 Ga0500616_0021501 Ga0500616_0021501_78_1577 488
514 3300060353 Ga0501082_0005691 Ga0501082_0005691_3078_4577 488
515 3300061734 Ga0530510_0026181 Ga0530510_0026181_200_1669 488
516 3300000041 ARcpr5oldR_c000183 ARcpr5oldR_0001837 489
517 3300000042 ARSoilYngRDRAFT_c00120 ARSoilYngRDRAFT_001209 489
518 3300000044 ARSoilOldRDRAFT_c000093 ARSoilOldRDRAFT_0000939 489
519 3300000652 ARCol0yngRDRAFT_1000124 ARCol0yngRDRAFT_100012413 489
520 3300001430 JGI24032J14994_100448 JGI24032J14994_1004482 489
521 3300001977 JGI24746J21847_1000166 JGI24746J21847_10001662 489
522 3300001978 JGI24747J21853_1001343 JGI24747J21853_10013431 489
523 3300001989 JGI24739J22299_10000057 JGI24739J22299_1000005727 489
524 3300001990 JGI24737J22298_10000391 JGI24737J22298_1000039110 489
525 3300001990 JGI24737J22298_10005396 JGI24737J22298_100053962 489
526 3300002070 JGI24750J21931_1000122 JGI24750J21931_10001228 489
527 3300002073 JGI24745J21846_1000450 JGI24745J21846_10004503 489
528 3300002075 JGI24738J21930_10000767 JGI24738J21930_100007675 489
529 3300002077 JGI24744J21845_10000821 JGI24744J21845_100008216 489
530 3300002239 JGI24034J26672_10000108 JGI24034J26672_1000010810 489
531 3300002244 JGI24742J22300_10000111 JGI24742J22300_100001119 489
532 3300003215 JGI25153J46596_10006736 JGI25153J46596_100067362 489
533 3300003771 Ga0055526_1000371 Ga0055526_100037124 489
534 3300003771 Ga0055526_1002296 Ga0055526_100229617 489
535 3300003775 Ga0055524_1000515 Ga0055524_10005156 489
536 3300005277 Ga0065716_1001884 Ga0065716_10018841 489
537 3300005290 Ga0065712_10008453 Ga0065712_100084533 489
538 3300005290 Ga0065712_10073118 Ga0065712_100731185 489
539 3300005293 Ga0065715_10000602 Ga0065715_1000060215 489
540 3300005293 Ga0065715_10090236 Ga0065715_100902362 489
541 3300005293 Ga0065715_10090398 Ga0065715_100903981 489
542 3300005295 Ga0065707_10111560 Ga0065707_101115601 489
543 3300005327 Ga0070658_10011629 Ga0070658_100116294 489
544 3300005328 Ga0070676_10000170 Ga0070676_1000017023 489
545 3300005329 Ga0070683_100003392 Ga0070683_1000033929 489
546 3300005330 Ga0070690_100022059 Ga0070690_1000220593 489
547 3300005331 Ga0070670_100009376 Ga0070670_1000093761 489
548 3300005333 Ga0070677_10000320 Ga0070677_1000032014 489
549 3300005334 Ga0068869_100000181 Ga0068869_10000018116 489
550 3300005336 Ga0070680_100002750 Ga0070680_1000027509 489
551 3300005336 Ga0070680_100066923 Ga0070680_1000669232 489
552 3300005337 Ga0070682_100000903 Ga0070682_10000090313 489
553 3300005338 Ga0068868_100000590 Ga0068868_10000059017 489
554 3300005339 Ga0070660_100007288 Ga0070660_10000728810 489
555 3300005339 Ga0070660_100035443 Ga0070660_1000354433 489
556 3300005340 Ga0070689_100001256 Ga0070689_1000012566 489
557 3300005340 Ga0070689_100103986 Ga0070689_1001039861 489
558 3300005341 Ga0070691_10000085 Ga0070691_1000008512 489
559 3300005343 Ga0070687_100000037 Ga0070687_10000003737 489
560 3300005343 Ga0070687_100014057 Ga0070687_1000140571 489
561 3300005344 Ga0070661_100001893 Ga0070661_10000189312 489
562 3300005344 Ga0070661_100016055 Ga0070661_1000160556 489
563 3300005345 Ga0070692_10000038 Ga0070692_1000003818 489
564 3300005347 Ga0070668_100131362 Ga0070668_1001313621 489
565 3300005353 Ga0070669_100010295 Ga0070669_1000102957 489
566 3300005364 Ga0070673_100000191 Ga0070673_10000019111 489
567 3300005365 Ga0070688_100002000 Ga0070688_10000200013 489
568 3300005365 Ga0070688_100053028 Ga0070688_1000530283 489
569 3300005366 Ga0070659_100001504 Ga0070659_1000015049 489
570 3300005366 Ga0070659_100007451 Ga0070659_10000745111 489
571 3300005434 Ga0070709_10011101 Ga0070709_100111017 489
572 3300005434 Ga0070709_10027134 Ga0070709_100271344 489
573 3300005435 Ga0070714_100001757 Ga0070714_1000017577 489
574 3300005435 Ga0070714_100053323 Ga0070714_1000533234 489
575 3300005439 Ga0070711_100043669 Ga0070711_1000436693 489
576 3300005439 Ga0070711_100045371 Ga0070711_1000453711 489
577 3300005439 Ga0070711_100079750 Ga0070711_1000797503 489
578 3300005441 Ga0070700_100001181 Ga0070700_1000011813 489
579 3300005441 Ga0070700_100019478 Ga0070700_1000194781 489
580 3300005457 Ga0070662_100001810 Ga0070662_10000181012 489
581 3300005458 Ga0070681_10002441 Ga0070681_1000244110 489
582 3300005458 Ga0070681_10007687 Ga0070681_100076878 489
583 3300005458 Ga0070681_10022976 Ga0070681_100229763 489
584 3300005458 Ga0070681_10045202 Ga0070681_100452022 489
585 3300005466 Ga0070685_10071605 Ga0070685_100716051 489
586 3300005530 Ga0070679_100006190 Ga0070679_10000619010 489
587 3300005530 Ga0070679_100011510 Ga0070679_1000115104 489
588 3300005530 Ga0070679_100082872 Ga0070679_1000828721 489
589 3300005535 Ga0070684_100001355 Ga0070684_10000135511 489
590 3300005535 Ga0070684_100084523 Ga0070684_1000845232 489
591 3300005539 Ga0068853_100001361 Ga0068853_1000013619 489
592 3300005539 Ga0068853_100009731 Ga0068853_1000097319 489
593 3300005539 Ga0068853_100077567 Ga0068853_1000775671 489
594 3300005543 Ga0070672_100001052 Ga0070672_10000105211 489
595 3300005545 Ga0070695_100055937 Ga0070695_1000559371 489
596 3300005546 Ga0070696_100009183 Ga0070696_1000091837 489
597 3300005546 Ga0070696_100011129 Ga0070696_1000111292 489
598 3300005547 Ga0070693_100004467 Ga0070693_1000044677 489
599 3300005548 Ga0070665_100129217 Ga0070665_1001292172 489
600 3300005563 Ga0068855_100008638 Ga0068855_1000086387 489
601 3300005563 Ga0068855_100028140 Ga0068855_1000281401 489
602 3300005577 Ga0068857_100001561 Ga0068857_10000156114 489
603 3300005577 Ga0068857_100075433 Ga0068857_1000754332 489
604 3300005578 Ga0068854_100037477 Ga0068854_1000374774 489
605 3300005615 Ga0070702_100000796 Ga0070702_10000079611 489
606 3300005616 Ga0068852_100041996 Ga0068852_1000419963 489
607 3300005616 Ga0068852_100050139 Ga0068852_1000501393 489
608 3300005617 Ga0068859_100011971 Ga0068859_10001197112 489
609 3300005617 Ga0068859_100015169 Ga0068859_1000151699 489
610 3300005618 Ga0068864_100002090 Ga0068864_10000209013 489
611 3300005718 Ga0068866_10001918 Ga0068866_100019184 489
612 3300005719 Ga0068861_100001910 Ga0068861_10000191015 489
613 3300005719 Ga0068861_100086031 Ga0068861_1000860312 489
614 3300005834 Ga0068851_10013316 Ga0068851_100133164 489
615 3300005840 Ga0068870_10000063 Ga0068870_1000006337 489
616 3300005842 Ga0068858_100071697 Ga0068858_1000716971 489
617 3300005842 Ga0068858_100137589 Ga0068858_1001375891 489
618 3300005843 Ga0068860_100003358 Ga0068860_10000335812 489
619 3300005844 Ga0068862_100074613 Ga0068862_1000746133 489
620 3300005937 Ga0081455_10000009 Ga0081455_10000009247 489
621 3300005937 Ga0081455_10009936 Ga0081455_100099367 489
622 3300005937 Ga0081455_10013060 Ga0081455_100130605 489
623 3300005983 Ga0081540_1000078 Ga0081540_100007842 489
624 3300005985 Ga0081539_10046979 Ga0081539_100469792 489
625 3300006038 Ga0075365_10019551 Ga0075365_100195511 489
626 3300006175 Ga0070712_100004132 Ga0070712_1000041324 489
627 3300006358 Ga0068871_100082132 Ga0068871_1000821321 489
628 3300006844 Ga0075428_100059498 Ga0075428_1000594988 489
629 3300006847 Ga0075431_100002222 Ga0075431_1000022228 489
630 3300006852 Ga0075433_10010775 Ga0075433_100107757 489
631 3300006871 Ga0075434_100006580 Ga0075434_1000065803 489
632 3300006880 Ga0075429_100005002 Ga0075429_10000500212 489
633 3300006881 Ga0068865_100000244 Ga0068865_10000024433 489
634 3300006881 Ga0068865_100005990 Ga0068865_1000059903 489
635 3300006931 Ga0097620_100011971 Ga0097620_1000119712 489
636 3300006931 Ga0097620_100015168 Ga0097620_1000151689 489
637 3300007076 Ga0075435_100018953 Ga0075435_1000189531 489
638 3300007076 Ga0075435_100094630 Ga0075435_1000946303 489
639 3300007788 Ga0099795_10004155 Ga0099795_100041551 489
640 3300009036 Ga0105244_10018886 Ga0105244_100188863 489
641 3300009094 Ga0111539_10003401 Ga0111539_100034011 489
642 3300009094 Ga0111539_10032147 Ga0111539_100321472 489
643 3300009101 Ga0105247_10014767 Ga0105247_100147676 489
644 3300009147 Ga0114129_10006095 Ga0114129_1000609522 489
645 3300009147 Ga0114129_10152174 Ga0114129_101521743 489
646 3300009148 Ga0105243_10009225 Ga0105243_100092259 489
647 3300009176 Ga0105242_10078422 Ga0105242_100784221 489
648 3300009177 Ga0105248_10023392 Ga0105248_100233928 489
649 3300009177 Ga0105248_10247572 Ga0105248_102475722 489
650 3300009545 Ga0105237_10019840 Ga0105237_100198401 489
651 3300009545 Ga0105237_10194952 Ga0105237_101949521 489
652 3300009551 Ga0105238_10037849 Ga0105238_100378493 489
653 3300009553 Ga0105249_10001033 Ga0105249_1000103310 489
654 3300010375 Ga0105239_10019241 Ga0105239_100192412 489
655 3300010375 Ga0105239_10035447 Ga0105239_100354475 489
656 3300011119 Ga0105246_10001800 Ga0105246_100018004 489
657 3300011119 Ga0105246_10104965 Ga0105246_101049651 489
658 3300013100 Ga0157373_10021255 Ga0157373_100212553 489
659 3300013296 Ga0157374_10009715 Ga0157374_100097156 489
660 3300013297 Ga0157378_10002181 Ga0157378_1000218112 489
661 3300013306 Ga0163162_10003401 Ga0163162_100034011 489
662 3300013307 Ga0157372_10049520 Ga0157372_100495206 489
663 3300013308 Ga0157375_10003806 Ga0157375_1000380611 489
664 3300014325 Ga0163163_10005155 Ga0163163_1000515514 489
665 3300014326 Ga0157380_10001301 Ga0157380_1000130110 489
666 3300014968 Ga0157379_10000275 Ga0157379_1000027528 489
667 3300014968 Ga0157379_10220374 Ga0157379_102203742 489
668 3300014969 Ga0157376_10000115 Ga0157376_1000011551 489
669 3300015684 Ga0183365_10003 Ga0183365_10003252 489
670 3300017792 Ga0163161_10078244 Ga0163161_100782443 489
671 3300025271 Ga0207666_1000050 Ga0207666_10000503 489
672 3300025273 Ga0209673_1017079 Ga0209673_10170792 489
673 3300025290 Ga0207673_1000083 Ga0207673_10000832 489
674 3300025291 Ga0209675_1000514 Ga0209675_100051429 489
675 3300025294 Ga0209025_1000016 Ga0209025_100001650 489
676 3300025295 Ga0209564_1000023 Ga0209564_100002324 489
677 3300025295 Ga0209564_1000035 Ga0209564_1000035419 489
678 3300025297 Ga0209758_1003674 Ga0209758_10036741 489
679 3300025297 Ga0209758_1039438 Ga0209758_10394382 489
680 3300025299 Ga0209256_1000025 Ga0209256_100002527 489
681 3300025299 Ga0209256_1000584 Ga0209256_100058415 489
682 3300025315 Ga0207697_10003427 Ga0207697_100034279 489
683 3300025315 Ga0207697_10014069 Ga0207697_100140691 489
684 3300025885 Ga0207653_10011359 Ga0207653_100113591 489
685 3300025893 Ga0207682_10000695 Ga0207682_1000069515 489
686 3300025898 Ga0207692_10091923 Ga0207692_100919231 489
687 3300025899 Ga0207642_10001013 Ga0207642_1000101311 489
688 3300025900 Ga0207710_10020800 Ga0207710_100208003 489
689 3300025900 Ga0207710_10063248 Ga0207710_100632481 489
690 3300025901 Ga0207688_10001691 Ga0207688_100016916 489
691 3300025904 Ga0207647_10007711 Ga0207647_100077119 489
692 3300025905 Ga0207685_10025208 Ga0207685_100252082 489
693 3300025906 Ga0207699_10034165 Ga0207699_100341651 489
694 3300025907 Ga0207645_10000114 Ga0207645_1000011452 489
695 3300025908 Ga0207643_10000134 Ga0207643_100001343 489
696 3300025909 Ga0207705_10000826 Ga0207705_1000082613 489
697 3300025911 Ga0207654_10005659 Ga0207654_100056597 489
698 3300025911 Ga0207654_10022181 Ga0207654_100221813 489
699 3300025912 Ga0207707_10001147 Ga0207707_100011472 489
700 3300025912 Ga0207707_10008171 Ga0207707_1000817110 489
701 3300025912 Ga0207707_10049328 Ga0207707_100493281 489
702 3300025912 Ga0207707_10120576 Ga0207707_101205761 489
703 3300025912 Ga0207707_10129488 Ga0207707_101294882 489
704 3300025914 Ga0207671_10018213 Ga0207671_100182136 489
705 3300025915 Ga0207693_10002351 Ga0207693_1000235112 489
706 3300025915 Ga0207693_10042576 Ga0207693_100425763 489
707 3300025916 Ga0207663_10070342 Ga0207663_100703422 489
708 3300025917 Ga0207660_10000034 Ga0207660_1000003459 489
709 3300025917 Ga0207660_10031763 Ga0207660_100317632 489
710 3300025917 Ga0207660_10096160 Ga0207660_100961601 489
711 3300025918 Ga0207662_10003783 Ga0207662_100037839 489
712 3300025918 Ga0207662_10012857 Ga0207662_100128571 489
713 3300025919 Ga0207657_10002232 Ga0207657_1000223211 489
714 3300025919 Ga0207657_10005404 Ga0207657_1000540410 489
715 3300025919 Ga0207657_10052181 Ga0207657_100521813 489
716 3300025920 Ga0207649_10000142 Ga0207649_1000014248 489
717 3300025920 Ga0207649_10048579 Ga0207649_100485794 489
718 3300025921 Ga0207652_10002021 Ga0207652_1000202115 489
719 3300025921 Ga0207652_10028137 Ga0207652_100281375 489
720 3300025923 Ga0207681_10000065 Ga0207681_100000657 489
721 3300025923 Ga0207681_10049749 Ga0207681_100497493 489
722 3300025925 Ga0207650_10002366 Ga0207650_100023661 489
723 3300025926 Ga0207659_10000078 Ga0207659_1000007813 489
724 3300025928 Ga0207700_10136691 Ga0207700_101366911 489
725 3300025929 Ga0207664_10002328 Ga0207664_100023282 489
726 3300025932 Ga0207690_10002633 Ga0207690_100026331 489
727 3300025932 Ga0207690_10066700 Ga0207690_100667002 489
728 3300025932 Ga0207690_10091209 Ga0207690_100912091 489
729 3300025933 Ga0207706_10010585 Ga0207706_1001058510 489
730 3300025933 Ga0207706_10017442 Ga0207706_100174423 489
731 3300025934 Ga0207686_10007002 Ga0207686_100070025 489
732 3300025935 Ga0207709_10000183 Ga0207709_1000018378 489
733 3300025936 Ga0207670_10035097 Ga0207670_100350973 489
734 3300025936 Ga0207670_10038388 Ga0207670_100383881 489
735 3300025937 Ga0207669_10001025 Ga0207669_1000102513 489
736 3300025938 Ga0207704_10000719 Ga0207704_1000071910 489
737 3300025940 Ga0207691_10013386 Ga0207691_100133862 489
738 3300025942 Ga0207689_10000144 Ga0207689_100001443 489
739 3300025944 Ga0207661_10001264 Ga0207661_1000126413 489
740 3300025945 Ga0207679_10000064 Ga0207679_1000006493 489
741 3300025949 Ga0207667_10011900 Ga0207667_100119002 489
742 3300025960 Ga0207651_10000420 Ga0207651_1000042010 489
743 3300025961 Ga0207712_10001661 Ga0207712_100016616 489
744 3300025972 Ga0207668_10000965 Ga0207668_100009654 489
745 3300025981 Ga0207640_10001755 Ga0207640_100017553 489
746 3300025981 Ga0207640_10030817 Ga0207640_100308172 489
747 3300025986 Ga0207658_10061502 Ga0207658_100615022 489
748 3300026023 Ga0207677_10003997 Ga0207677_100039972 489
749 3300026035 Ga0207703_10010897 Ga0207703_100108977 489
750 3300026041 Ga0207639_10001895 Ga0207639_100018953 489
751 3300026041 Ga0207639_10036628 Ga0207639_100366283 489
752 3300026067 Ga0207678_10003913 Ga0207678_100039139 489
753 3300026075 Ga0207708_10007970 Ga0207708_100079709 489
754 3300026075 Ga0207708_10035965 Ga0207708_100359653 489
755 3300026078 Ga0207702_10003767 Ga0207702_1000376714 489
756 3300026088 Ga0207641_10001821 Ga0207641_1000182113 489
757 3300026089 Ga0207648_10012750 Ga0207648_100127509 489
758 3300026095 Ga0207676_10000079 Ga0207676_1000007987 489
759 3300026116 Ga0207674_10000323 Ga0207674_1000032351 489
760 3300026116 Ga0207674_10131759 Ga0207674_101317593 489
761 3300026118 Ga0207675_100012401 Ga0207675_1000124019 489
762 3300026118 Ga0207675_100054943 Ga0207675_1000549431 489
763 3300026121 Ga0207683_10000037 Ga0207683_1000003713 489
764 3300026121 Ga0207683_10012300 Ga0207683_100123005 489
765 3300026121 Ga0207683_10026581 Ga0207683_100265813 489
766 3300026142 Ga0207698_10085676 Ga0207698_100856761 489
767 3300026142 Ga0207698_10090902 Ga0207698_100909023 489
768 3300026142 Ga0207698_10124096 Ga0207698_101240963 489
769 3300027617 Ga0210002_1000055 Ga0210002_10000555 489
770 3300027682 Ga0209971_1010411 Ga0209971_10104113 489
771 3300027695 Ga0209966_1001951 Ga0209966_10019513 489
772 3300027717 Ga0209998_10007236 Ga0209998_100072361 489
773 3300027907 Ga0207428_10000216 Ga0207428_100002167 489
774 3300027907 Ga0207428_10000947 Ga0207428_1000094727 489
775 3300027907 Ga0207428_10009986 Ga0207428_100099863 489
776 3300028380 Ga0268265_10001593 Ga0268265_1000159313 489
777 3300028381 Ga0268264_10002487 Ga0268264_1000248713 489
778 3300028556 Ga0265337_1000455 Ga0265337_10004554 489
779 3300028794 Ga0307515_10114786 Ga0307515_101147865 489
780 3300031235 Ga0265330_10017507 Ga0265330_100175073 489
781 3300031241 Ga0265325_10000104 Ga0265325_1000010429 489
782 3300031241 Ga0265325_10003165 Ga0265325_100031653 489
783 3300031249 Ga0265339_10008839 Ga0265339_100088394 489
784 3300031249 Ga0265339_10051603 Ga0265339_100516032 489
785 3300031250 Ga0265331_10007020 Ga0265331_100070207 489
786 3300031251 Ga0265327_10025523 Ga0265327_100255233 489
787 3300031595 Ga0265313_10031332 Ga0265313_100313322 489
788 3300031595 Ga0265313_10036346 Ga0265313_100363462 489
789 3300031691 Ga0316579_10014439 Ga0316579_100144395 489
790 3300031712 Ga0265342_10000807 Ga0265342_1000080716 489
791 3300031712 Ga0265342_10037987 Ga0265342_100379872 489
792 3300031712 Ga0265342_10050235 Ga0265342_100502351 489
793 3300032133 Ga0316583_10009090 Ga0316583_100090903 489
794 3300034816 Ga0373930_0010010 Ga0373930_0010010_35_1516 489
795 3300034819 Ga0373958_0009669 Ga0373958_0009669_94_1563 489
796 3300034957 Ga0373938_0000060 Ga0373938_0000060_6134_7615 489
797 3300035085 Ga0373929_0000687 Ga0373929_0000687_1774_3255 489
798 3300035088 Ga0373940_0000468 Ga0373940_0000468_3810_5291 489
799 3300035113 Ga0373936_0038511 Ga0373936_0038511_74_1543 489
800 3300035114 Ga0373939_0000354 Ga0373939_0000354_6450_7931 489
801 3300035115 Ga0373941_0000073 Ga0373941_0000073_660_2141 489
802 3300035119 Ga0373956_0031854 Ga0373956_0031854_179_1648 489
803 3300035121 Ga0373960_0000114 Ga0373960_0000114_6467_7948 489
804 3300035171 Ga0373946_0004481 Ga0373946_0004481_1424_2893 489
805 3300035172 Ga0373955_0060695 Ga0373955_0060695_47_1516 489
806 3300035207 Ga0373942_0003137 Ga0373942_0003137_1722_3203 489
807 3300035241 Ga0373961_0003513 Ga0373961_0003513_1624_3105 489
808 3300035242 Ga0373962_0002966 Ga0373962_0002966_759_2240 489
809 3300035410 Ga0373924_0023750 Ga0373924_0023750_47_1516 489
810 3300035691 Ga0373931_0067262 Ga0373931_0067262_246_1715 489
811 3300035692 Ga0373935_0026091 Ga0373935_0026091_2057_3526 489
812 3300035695 Ga0373927_0002642 Ga0373927_0002642_1919_3397 489
813 3300035695 Ga0373927_0027210 Ga0373927_0027210_722_2191 489
814 3300035695 Ga0373927_0031545 Ga0373927_0031545_458_2074 489
815 3300035724 Ga0373933_0030523 Ga0373933_0030523_1026_2495 489
816 3300036401 Ga0373937_0024244 Ga0373937_0024244_2033_3502 489
817 3300036401 Ga0373937_0052194 Ga0373937_0052194_236_1705 489
818 3300036401 Ga0373937_0131703 Ga0373937_0131703_453_1922 489
819 3300037068 Ga0373925_0047063 Ga0373925_0047063_934_2403 489
820 3300037312 Ga0395899_0015255 Ga0395899_0015255_4350_5831 489
821 3300037466 Ga0395898_0017166 Ga0395898_0017166_3537_5018 489
822 3300037466 Ga0395898_0032856 Ga0395898_0032856_3675_5153 489
823 3300038443 Ga0395901_0034665 Ga0395901_0034665_3519_5000 489
824 3300044712 Ga0453684_0190899 Ga0453684_0190899_887_2356 489
825 3300045051 Ga0451576_0052847 Ga0451576_0052847_2048_3517 489
826 3300046454 Ga0495592_0045783 Ga0495592_0045783_853_2337 489
827 3300046455 Ga0495603_0044127 Ga0495603_0044127_808_2277 489
828 3300046459 Ga0495629_0001773 Ga0495629_0001773_6371_7840 489
829 3300046459 Ga0495629_0031784 Ga0495629_0031784_1550_3166 489
830 3300046461 Ga0495641_0012339 Ga0495641_0012339_3107_4576 489
831 3300046461 Ga0495641_0034862 Ga0495641_0034862_464_1933 489
832 3300046462 Ga0495651_0008470 Ga0495651_0008470_2638_4107 489
833 3300046462 Ga0495651_0097345 Ga0495651_0097345_638_2107 489
834 3300046472 Ga0495580_0016611 Ga0495580_0016611_2857_4326 489
835 3300046472 Ga0495580_0056438 Ga0495580_0056438_313_1929 489
836 3300046473 Ga0495582_0006472 Ga0495582_0006472_1468_2937 489
837 3300046473 Ga0495582_0025590 Ga0495582_0025590_586_2055 489
838 3300046473 Ga0495582_0049348 Ga0495582_0049348_777_2246 489
839 3300046475 Ga0495639_0006653 Ga0495639_0006653_2332_3801 489
840 3300046476 Ga0495662_0066041 Ga0495662_0066041_119_1735 489
841 3300046477 Ga0495664_0024189 Ga0495664_0024189_1852_3468 489
842 3300046491 Ga0495584_0006769 Ga0495584_0006769_824_2293 489
843 3300046511 Ga0495608_0012886 Ga0495608_0012886_3502_4971 489
844 3300046511 Ga0495608_0031701 Ga0495608_0031701_123_1592 489
845 3300046516 Ga0495628_0010385 Ga0495628_0010385_870_2354 489
846 3300046516 Ga0495628_0138095 Ga0495628_0138095_327_1796 489
847 3300046517 Ga0495630_0071206 Ga0495630_0071206_175_1791 489
848 3300046523 Ga0495644_0001471 Ga0495644_0001471_2505_3974 489
849 3300046529 Ga0495652_0066151 Ga0495652_0066151_814_2283 489
850 3300046529 Ga0495652_0105580 Ga0495652_0105580_638_2107 489
851 3300046529 Ga0495652_0127499 Ga0495652_0127499_137_1606 489
852 3300046531 Ga0495665_0040136 Ga0495665_0040136_115_1584 489
853 3300046531 Ga0495665_0051062 Ga0495665_0051062_356_1972 489
854 3300046535 Ga0495586_0024634 Ga0495586_0024634_112_1581 489
855 3300046535 Ga0495586_0043180 Ga0495586_0043180_174_1643 489
856 3300046538 Ga0495609_0041404 Ga0495609_0041404_110_1579 489
857 3300046558 Ga0495633_0005211 Ga0495633_0005211_3876_5345 489
858 3300046559 Ga0495667_0003339 Ga0495667_0003339_321_1790 489
859 3300046559 Ga0495667_0057610 Ga0495667_0057610_453_1922 489
860 3300046642 Ga0495634_0038057 Ga0495634_0038057_819_2288 489
861 3300046663 Ga0495635_0021945 Ga0495635_0021945_2903_4372 489
862 3300046674 Ga0495588_0019049 Ga0495588_0019049_1209_2678 489
863 3300046678 Ga0495599_0066980 Ga0495599_0066980_751_2220 489
864 3300046680 Ga0495646_0008798 Ga0495646_0008798_3746_5215 489
865 3300046680 Ga0495646_0017575 Ga0495646_0017575_2248_3717 489
866 3300046681 Ga0495647_0006874 Ga0495647_0006874_808_2277 489
867 3300046683 Ga0495658_0015235 Ga0495658_0015235_1963_3432 489
868 3300046689 Ga0495613_0048284 Ga0495613_0048284_438_1907 489
869 3300046690 Ga0495624_0086706 Ga0495624_0086706_207_1676 489
870 3300046691 Ga0495670_0002981 Ga0495670_0002981_6384_7853 489
871 3300046809 Ga0495600_0017400 Ga0495600_0017400_1037_2506 489
872 3300046809 Ga0495600_0035571 Ga0495600_0035571_388_1872 489
873 3300046809 Ga0495600_0122294 Ga0495600_0122294_127_1596 489
874 3300047315 Ga0495581_0005972 Ga0495581_0005972_1752_3221 489
875 3300047315 Ga0495581_0062463 Ga0495581_0062463_552_2021 489
876 3300047317 Ga0495604_0030237 Ga0495604_0030237_1224_2693 489
877 3300047317 Ga0495604_0046732 Ga0495604_0046732_434_1918 489
878 3300047319 Ga0495674_0079888 Ga0495674_0079888_487_2103 489
879 3300047322 Ga0495680_0020932 Ga0495680_0020932_3373_4842 489
880 3300047322 Ga0495680_0042627 Ga0495680_0042627_1206_2675 489
881 3300047322 Ga0495680_0056380 Ga0495680_0056380_733_2349 489
882 3300047322 Ga0495680_0075633 Ga0495680_0075633_814_2283 489
883 3300047471 Ga0495684_0002658 Ga0495684_0002658_3856_5325 489
884 3300047471 Ga0495684_0056598 Ga0495684_0056598_568_2184 489
885 3300047471 Ga0495684_0078674 Ga0495684_0078674_793_2262 489
886 3300047673 Ga0495593_0040071 Ga0495593_0040071_390_1859 489
887 3300047673 Ga0495593_0055703 Ga0495593_0055703_245_1714 489
888 3300048088 Ga0495602_0139582 Ga0495602_0139582_297_1766 489
889 3300048089 Ga0495614_0014751 Ga0495614_0014751_561_2030 489
890 3300048903 Ga0496100_0001418 Ga0496100_0001418_8975_10444 489
891 3300048904 Ga0496101_0051688 Ga0496101_0051688_28_1497 489
892 3300048905 Ga0496102_0000857 Ga0496102_0000857_5533_7002 489
893 3300048905 Ga0496102_0041108 Ga0496102_0041108_2183_3652 489
894 3300048905 Ga0496102_0098215 Ga0496102_0098215_525_2006 489
895 3300048906 Ga0496103_0001402 Ga0496103_0001402_5419_6888 489
896 3300048906 Ga0496103_0057007 Ga0496103_0057007_156_1625 489
897 3300048907 Ga0496104_0046190 Ga0496104_0046190_84_1553 489
898 3300048908 Ga0496105_0021990 Ga0496105_0021990_1648_3132 489
899 3300048908 Ga0496105_0073183 Ga0496105_0073183_738_2207 489
900 3300048909 Ga0496106_0004194 Ga0496106_0004194_7665_9134 489
901 3300048909 Ga0496106_0033306 Ga0496106_0033306_523_2004 489
902 3300048909 Ga0496106_0078639 Ga0496106_0078639_261_1730 489
903 3300048910 Ga0496107_0002765 Ga0496107_0002765_8605_10074 489
904 3300048910 Ga0496107_0021589 Ga0496107_0021589_2299_3780 489
905 3300048911 Ga0496108_0003866 Ga0496108_0003866_3128_4597 489
906 3300048911 Ga0496108_0082444 Ga0496108_0082444_19_1488 489
907 3300048912 Ga0496109_0005368 Ga0496109_0005368_9091_10560 489
908 3300048912 Ga0496109_0280482 Ga0496109_0280482_32_1501 489
909 3300048913 Ga0496110_0023567 Ga0496110_0023567_309_1778 489
910 3300048913 Ga0496110_0065551 Ga0496110_0065551_1133_2647 489
911 3300048913 Ga0496110_0212132 Ga0496110_0212132_127_1608 489
912 3300048914 Ga0496111_0014062 Ga0496111_0014062_2873_4342 489
913 3300048915 Ga0496112_0004182 Ga0496112_0004182_4472_5941 489
914 3300048916 Ga0496113_0013896 Ga0496113_0013896_282_1751 489
915 3300048916 Ga0496113_0035238 Ga0496113_0035238_2150_3619 489
916 3300048917 Ga0496114_0019579 Ga0496114_0019579_1274_2743 489
917 3300048918 Ga0496115_0003668 Ga0496115_0003668_1782_3251 489
918 3300048918 Ga0496115_0030609 Ga0496115_0030609_2084_3553 489
919 3300048918 Ga0496115_0086573 Ga0496115_0086573_881_2350 489
920 3300048920 Ga0496117_0072620 Ga0496117_0072620_421_1902 489
921 3300048922 Ga0496119_0000289 Ga0496119_0000289_50597_52075 489
922 3300048925 Ga0496122_0002313 Ga0496122_0002313_12004_13482 489
923 3300048926 Ga0496123_0001408 Ga0496123_0001408_5476_6954 489
924 3300049569 Ga0501032_0116277 Ga0501032_0116277_71_1552 489
925 3300049571 Ga0501034_0084550 Ga0501034_0084550_576_2078 489
926 3300049571 Ga0501034_0089856 Ga0501034_0089856_463_2040 489
927 3300049571 Ga0501034_0095958 Ga0501034_0095958_213_1682 489
928 3300049574 Ga0501038_0034931 Ga0501038_0034931_1283_2764 489
929 3300049575 Ga0501039_0050420 Ga0501039_0050420_54_1631 489
930 3300049581 Ga0501047_0007054 Ga0501047_0007054_4168_5640 489
931 3300049589 Ga0501073_0016647 Ga0501073_0016647_329_1798 489
932 3300049590 Ga0501074_0006835 Ga0501074_0006835_4758_6239 489
933 3300049744 Ga0501083_0077574 Ga0501083_0077574_686_2155 489
934 3300049822 Ga0501035_0035310 Ga0501035_0035310_478_2055 489
935 3300049822 Ga0501035_0065534 Ga0501035_0065534_1172_2671 489
936 3300049823 Ga0501044_0000822 Ga0501044_0000822_30437_31906 489
937 3300049823 Ga0501044_0026378 Ga0501044_0026378_1362_2939 489
938 3300049823 Ga0501044_0054761 Ga0501044_0054761_2225_3694 489
939 3300049823 Ga0501044_0107099 Ga0501044_0107099_78_1571 489
940 3300050507 nmdc:mga05p37_9895_c1 nmdc:mga05p37_9895_c1_1331_2809 489
941 3300050508 nmdc:mga09592_1920_c1 nmdc:mga09592_1920_c1_12763_14241 489
942 3300050510 nmdc:mga06r32_5477_c1 nmdc:mga06r32_5477_c1_2636_4114 489
943 3300050511 nmdc:mga08y16_3365_c1 nmdc:mga08y16_3365_c1_12969_14447 489
944 3300050511 nmdc:mga08y16_77112_c1 nmdc:mga08y16_77112_c1_1996_3465 489
945 3300050512 nmdc:mga0n895_6097_c1 nmdc:mga0n895_6097_c1_7240_8709 489
946 3300050512 nmdc:mga0n895_62267_c1 nmdc:mga0n895_62267_c1_2167_3636 489
947 3300050512 nmdc:mga0n895_79771_c1 nmdc:mga0n895_79771_c1_1403_2872 489
948 3300050512 nmdc:mga0n895_80865_c1 nmdc:mga0n895_80865_c1_174_1643 489
949 3300050513 nmdc:mga0rr50_52137_c1 nmdc:mga0rr50_52137_c1_729_2198 489
950 3300050515 nmdc:mga0a205_2212_c1 nmdc:mga0a205_2212_c1_3430_4899 489
951 3300053077 Ga0495601_0001731 Ga0495601_0001731_9826_11295 489
952 3300053077 Ga0495601_0002237 Ga0495601_0002237_8234_9718 489
953 3300053077 Ga0495601_0008863 Ga0495601_0008863_3658_5127 489
954 3300053077 Ga0495601_0112276 Ga0495601_0112276_167_1636 489
955 3300053078 Ga0495612_0000795 Ga0495612_0000795_314_1798 489
956 3300053078 Ga0495612_0043062 Ga0495612_0043062_295_1764 489
957 3300053080 Ga0500635_0011818 Ga0500635_0011818_825_2381 489
958 3300053084 Ga0495595_0003051 Ga0495595_0003051_2857_4326 489
959 3300053084 Ga0495595_0026835 Ga0495595_0026835_271_1740 489
960 3300053085 Ga0495619_0000043 Ga0495619_0000043_99495_100964 489
961 3300053085 Ga0495619_0003586 Ga0495619_0003586_7671_9155 489
962 3300053085 Ga0495619_0010551 Ga0495619_0010551_4055_5524 489
963 3300053085 Ga0495619_0019129 Ga0495619_0019129_366_1835 489
964 3300053085 Ga0495619_0065301 Ga0495619_0065301_109_1578 489
965 3300053087 Ga0500643_001914 Ga0500643_001914_825_2294 489
966 3300053096 Ga0500641_0008875 Ga0500641_0008875_1638_3107 489
967 3300053119 Ga0500595_000002 Ga0500595_000002_335290_336759 489
968 3300053122 Ga0500608_000278 Ga0500608_000278_1426_3021 489
969 3300053131 Ga0500652_019680 Ga0500652_019680_191_1663 489
970 3300053153 Ga0500616_0000002 Ga0500616_0000002_409138_410610 489
971 3300053177 Ga0500636_0014409 Ga0500636_0014409_448_1929 489
972 3300053730 Ga0500645_000410 Ga0500645_000410_18296_19768 489

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02637

GatB_Yqey

GatB domain

391

536

0.98

PF02934

GatB_N

GatB/GatE catalytic domain

69

352

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4wj3-assembly2.cif.gz_H crystal structure of the asparagine transamidosome from pseudomonas aeruginosa 0.9473 18 414
3h0l-assembly2.cif.gz_E structure of trna-dependent amidotransferase gatcab from aquifex aeolicus 0.9098 18 422
2g5h-assembly1.cif.gz_B structure of trna-dependent amidotransferase gatcab 0.9082 19 409
3h0l-assembly2.cif.gz_E structure of trna-dependent amidotransferase gatcab from aquifex aeolicus 0.8973 18 422
4n0i-assembly1.cif.gz_B crystal structure of s. cerevisiae mitochondrial gatfab in complex with glutamine 0.895 19 313
ID Description Score Start End Superfamily
af_I1KQC8_485_546_1.10.10.410 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A; 0.968 428 487 1.10.10.410
af_M0R4L6_495_556_1.10.10.410 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A; 0.965 428 487 1.10.10.410
af_Q2FWZ0_412_475_1.10.10.410 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A; 0.9616 428 488 1.10.10.410
af_Q99JT1_495_556_1.10.10.410 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A; 0.9585 428 487 1.10.10.410
af_O75879_495_556_1.10.10.410 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A; 0.9581 428 487 1.10.10.410
ID Description Score Start End GO Terms
AF-A0A6A7GDB6-F1-model_v4 Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase GatCAB subunit B 0.9666 63 487 GO:0005524
GO:0006412
GO:0016740
GO:0050567
GO:0070681
AF-A0A7C5SBX2-F1-model_v4 Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatB 0.9654 6 251 GO:0005524
GO:0006412
GO:0050567
GO:0070681
AF-A0A7Y5VUE2-F1-model_v4 deleted 0.9652 374 489
AF-A0A7C1U5C9-F1-model_v4 Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase GatCAB subunit B (EC 6.3.5.-) 0.9649 10 243 GO:0005524
GO:0006412
GO:0050567
GO:0070681
AF-D1KEA0-F1-model_v4 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B (Asp/Glu-ADT subunit B) (EC 6.3.5.-) 0.9641 18 412 GO:0005524
GO:0006412
GO:0016740
GO:0050566
GO:0050567
GO:0070681

Feature Viewer

pLDDT pTM Quality
91.25 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map