F487156
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 972 | 446 | 942 | 490 |
Family's Representative Sequence
| Representative Sequence | 3300035695|Ga0373927_0031545|Ga0373927_0031545_458_2074 |
| Length | 538 |
| Sequence | MLREFAEIVAEFGPFRGMHSATSAGQLCENGRTRYETGNHGRPQPQQGDMDTQPNAKKFLKGATGDWEVVIGMEVHAQVTSRSKLFSGASTEFGGAPNSHVSLVDAAMPGMLPVINEECVRQAIRTGLGLKARINLKSVFDRKNYFYPDLPQGYQISQYKSPVVGEGVVTVDLEGGDSVTVGIERLHLEQDAGKSIHDRSPVNSYVDLNRSGVALMEIVSKPDLRSADEAKAFITKLRSILRYLGTCDGDMEKGSLRADVNVSVRRPGEPLGTRCEIKNVNSIRFIGQAVEHEARRQIEIIEEGGSIDQETRLFDATRGETRSMRSKEEAHDYRYFPDPDLLPLEFDAAYVEELKKNLPELPDEKKMRFMREFSLSAYDAGVLVAERETAEYFEGVAKGRDAKAAANWVINELFGRLNKEGKDIGSSPVSAGQLGTMLDLIADGTISGKIAKDLFEVVWQEGGDPRAVVEQRGMKQVTDIGAIEKVVDDIIARNPDKVADAKSNPKAIGWFVGQAMKASGGKASPQAVNDVLKRKLGL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501114 | Microvirga lotononidis WSM3557 | Isolate | Nodule |
| 2 | 2513237087 | Azorhizobium doebereinerae UFLA1-100 | Isolate | Nodule |
| 3 | 2522572158 | Azospirillum halopraeferens DSM 3675 | Isolate | Unclassified |
| 4 | 2523231067 | Pleomorphomonas oryzae DSM 16300 | Isolate | Unclassified |
| 5 | 2595698237 | Methylobacterium sp. UNCCL125 | Isolate | Unclassified |
| 6 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 7 | 2643221629 | Devosia sp. Root105 | Isolate | Unclassified |
| 8 | 2643221662 | Devosia sp. Root413D1 | Isolate | Unclassified |
| 9 | 2643221733 | Bosea sp. Root381 | Isolate | Unclassified |
| 10 | 2643221734 | Bosea sp. Root670 | Isolate | Unclassified |
| 11 | 2738543031 | Pleomorphomonas sp. CF100 | Isolate | Unclassified |
| 12 | 2773857925 | Microvirga vignae BR3299 | Isolate | Unclassified |
| 13 | 2775506901 | Microvirga ossetica V5/3m | Isolate | Unclassified |
| 14 | 2818991467 | Bosea vestrisii 3192 | Isolate | Unclassified |
| 15 | 2828305725 | Xanthobacter tagetidis DSM 11105 | Isolate | Unclassified |
| 16 | 2835312727 | Microvirga calopogonii CCBAU 65841 | Isolate | Nodule |
| 17 | 2874139085 | Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 | Isolate | Nodule |
| 18 | 2882456835 | Microvirga sp. KLBC 81 | Isolate | Unclassified |
| 19 | 2884298095 | Microvirga thermotolerans HR1 | Isolate | Rhizosphere |
| 20 | 2889306138 | Methylobacterium sp. PvR107 | Isolate | Rhizosphere |
| 21 | 2894232714 | Microvirga tunisiensis Lmie10 | Isolate | Nodule |
| 22 | 2902330777 | Methylobacterium sp. 2A | Isolate | Unclassified |
| 23 | 2902405164 | Methylobacterium sp. P1-11 | Isolate | Unclassified |
| 24 | 2917554339 | Chthonobacter rhizosphaerae yh7-1 | Isolate | Rhizosphere |
| 25 | 2917699015 | Bosea sp. F3-2 | Isolate | Rhizosphere |
| 26 | 2919450847 | Ancylobacter sp. 3268 | Isolate | Rhizosphere |
| 27 | 2924718760 | Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 | Isolate | Nodule |
| 28 | 2928125067 | Methylobacterium sp. 1973 | Isolate | Unclassified |
| 29 | 2939669807 | Kaistia defluvii 3207 | Isolate | Rhizosphere |
| 30 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 31 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 32 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 33 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 34 | 3300001430 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 | Metagenome | Rhizosphere |
| 35 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 36 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 37 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 38 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 39 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 40 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 41 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 42 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 43 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 44 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 45 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 46 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 47 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 48 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 49 | 3300005277 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) | Metagenome | Rhizosphere |
| 50 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 51 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 52 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 53 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 57 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 60 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 62 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 63 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 64 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 66 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 68 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 76 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 81 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 84 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 87 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 88 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 89 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 90 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 91 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 93 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 94 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 95 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 96 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 98 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 102 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 103 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 105 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 106 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 107 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 108 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 109 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 110 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 111 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 112 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 113 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 114 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 115 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 116 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 117 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 118 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 119 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 120 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 121 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 122 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 123 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 124 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 125 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 126 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 127 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 128 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 129 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 130 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 131 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 132 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 133 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 134 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 135 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 136 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 137 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 139 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 140 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 149 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 150 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 151 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 152 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 153 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 154 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 155 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 167 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 168 | 3300015684 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 | Metagenome | Unclassified |
| 169 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 170 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 171 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 173 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 175 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 176 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 177 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 178 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 179 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 247 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 248 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 251 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 252 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 253 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 254 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 255 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 256 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 257 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 258 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 259 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 260 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 261 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 262 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 263 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 264 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 265 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 266 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 267 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 268 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 269 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 270 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 271 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 272 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 273 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 274 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 275 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 276 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 277 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 278 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 279 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 280 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 281 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 282 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 283 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 284 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 285 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 286 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 287 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 288 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 289 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 290 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 291 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 292 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 293 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 294 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 295 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 296 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 297 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 298 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 299 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 300 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 301 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 302 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 303 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 304 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 305 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 306 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 307 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 308 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 309 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 310 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 311 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 312 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 313 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 314 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 315 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 316 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 317 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 318 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 319 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 320 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 321 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 367 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 368 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 369 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 370 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 371 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 372 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 373 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 374 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 375 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 376 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 377 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 378 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 379 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 380 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 381 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 382 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 383 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 384 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 385 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 386 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 387 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 388 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 389 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 390 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 391 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 392 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 393 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 394 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 395 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 396 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 397 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 398 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 399 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 400 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 401 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 402 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 403 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 404 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 405 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 406 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 407 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 408 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 409 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 410 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 411 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 412 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 413 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 414 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 415 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 416 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 417 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 418 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 419 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 420 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 421 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 422 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 423 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 424 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 425 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 426 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 429 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 432 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 433 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 434 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 435 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 436 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 437 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 438 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 439 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 440 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 441 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 442 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 443 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 444 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 445 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 446 | 8005658619 | Rhizobium terrae CC-HIH110 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.91 |
| Metatranscriptomes | 0 |
| Isolates | 3.09 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.53 |
| Nodule | 0.62 |
| Rhizoplane | 5.45 |
| Rhizosphere | 85.8 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.6 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | ARcpr5oldR_c000183 | 3300000041 | Bacteria | 10873 |
| 2 | ARSoilYngRDRAFT_c00120 | 3300000042 | Bacteria | 13387 |
| 3 | ARSoilOldRDRAFT_c000093 | 3300000044 | Bacteria | 16766 |
| 4 | ARCol0yngRDRAFT_1000124 | 3300000652 | Bacteria | 13864 |
| 5 | JGI24032J14994_100448 | 3300001430 | Bacteria | 2145 |
| 6 | JGI24746J21847_1000166 | 3300001977 | Bacteria | 8589 |
| 7 | JGI24747J21853_1001343 | 3300001978 | Bacteria | 1823 |
| 8 | JGI24739J22299_10000057 | 3300001989 | Bacteria | 31581 |
| 9 | JGI24737J22298_10000391 | 3300001990 | Bacteria | 14950 |
| 10 | JGI24737J22298_10005396 | 3300001990 | Bacteria | 4416 |
| 11 | JGI24750J21931_1000122 | 3300002070 | Bacteria | 12437 |
| 12 | JGI24745J21846_1000450 | 3300002073 | Bacteria | 3647 |
| 13 | JGI24738J21930_10000767 | 3300002075 | Bacteria | 9204 |
| 14 | JGI24744J21845_10000821 | 3300002077 | Bacteria | 5848 |
| 15 | JGI24034J26672_10000108 | 3300002239 | Bacteria | 13522 |
| 16 | JGI24742J22300_10000111 | 3300002244 | Bacteria | 11743 |
| 17 | JGI25153J46596_10006736 | 3300003215 | Bacteria | 5763 |
| 18 | Ga0055526_1000371 | 3300003771 | Bacteria | 36363 |
| 19 | Ga0055526_1002296 | 3300003771 | Bacteria | 13046 |
| 20 | Ga0055524_1000515 | 3300003775 | Bacteria | 29812 |
| 21 | JGI25405J52794_10005801 | 3300003911 | Bacteria | 2240 |
| 22 | Ga0065716_1001884 | 3300005277 | Bacteria | 2870 |
| 23 | Ga0065712_10008453 | 3300005290 | Bacteria | 3947 |
| 24 | Ga0065712_10073118 | 3300005290 | Bacteria | 4499 |
| 25 | Ga0065712_10088883 | 3300005290 | Bacteria | 2498 |
| 26 | Ga0065715_10000602 | 3300005293 | Bacteria | 13727 |
| 27 | Ga0065715_10090236 | 3300005293 | Bacteria | 7366 |
| 28 | Ga0065715_10090398 | 3300005293 | Bacteria | 7088 |
| 29 | Ga0065715_10154420 | 3300005293 | Bacteria | 1625 |
| 30 | Ga0065707_10111560 | 3300005295 | Bacteria | 2391 |
| 31 | Ga0070658_10011629 | 3300005327 | Bacteria | 7060 |
| 32 | Ga0070658_10024663 | 3300005327 | Bacteria | 4822 |
| 33 | Ga0070658_10043077 | 3300005327 | Bacteria | 3647 |
| 34 | Ga0070676_10000170 | 3300005328 | Bacteria | 26484 |
| 35 | Ga0070683_100003392 | 3300005329 | Bacteria | 12912 |
| 36 | Ga0070683_100036634 | 3300005329 | Bacteria | 4489 |
| 37 | Ga0070683_100044223 | 3300005329 | Bacteria | 4106 |
| 38 | Ga0070683_100137493 | 3300005329 | Bacteria | 2314 |
| 39 | Ga0070690_100022059 | 3300005330 | Bacteria | 3893 |
| 40 | Ga0070670_100009376 | 3300005331 | Bacteria | 8355 |
| 41 | Ga0070670_100073114 | 3300005331 | Bacteria | 2945 |
| 42 | Ga0070677_10000320 | 3300005333 | Bacteria | 16762 |
| 43 | Ga0068869_100000181 | 3300005334 | Bacteria | 32256 |
| 44 | Ga0070666_10021102 | 3300005335 | Bacteria | 4219 |
| 45 | Ga0070680_100002750 | 3300005336 | Bacteria | 13050 |
| 46 | Ga0070680_100006873 | 3300005336 | Bacteria | 8675 |
| 47 | Ga0070680_100015843 | 3300005336 | Bacteria | 5918 |
| 48 | Ga0070680_100066923 | 3300005336 | Bacteria | 2946 |
| 49 | Ga0070682_100000903 | 3300005337 | Bacteria | 17347 |
| 50 | Ga0070682_100005746 | 3300005337 | Bacteria | 6920 |
| 51 | Ga0070682_100006850 | 3300005337 | Bacteria | 6399 |
| 52 | Ga0068868_100000590 | 3300005338 | Bacteria | 24437 |
| 53 | Ga0068868_100113449 | 3300005338 | Bacteria | 2204 |
| 54 | Ga0070660_100005053 | 3300005339 | Bacteria | 9115 |
| 55 | Ga0070660_100007288 | 3300005339 | Bacteria | 7706 |
| 56 | Ga0070660_100014065 | 3300005339 | Bacteria | 5760 |
| 57 | Ga0070660_100035443 | 3300005339 | Bacteria | 3777 |
| 58 | Ga0070660_100063970 | 3300005339 | Bacteria | 2861 |
| 59 | Ga0070689_100001256 | 3300005340 | Bacteria | 16143 |
| 60 | Ga0070689_100017219 | 3300005340 | Bacteria | 5304 |
| 61 | Ga0070689_100046718 | 3300005340 | Bacteria | 3337 |
| 62 | Ga0070689_100103986 | 3300005340 | Bacteria | 2251 |
| 63 | Ga0070691_10000085 | 3300005341 | Bacteria | 26262 |
| 64 | Ga0070691_10002362 | 3300005341 | Bacteria | 8376 |
| 65 | Ga0070691_10030620 | 3300005341 | Bacteria | 2521 |
| 66 | Ga0070687_100000037 | 3300005343 | Bacteria | 42337 |
| 67 | Ga0070687_100014057 | 3300005343 | Bacteria | 3586 |
| 68 | Ga0070661_100001893 | 3300005344 | Bacteria | 14501 |
| 69 | Ga0070661_100016055 | 3300005344 | Bacteria | 5285 |
| 70 | Ga0070692_10000038 | 3300005345 | Bacteria | 25433 |
| 71 | Ga0070668_100022013 | 3300005347 | Bacteria | 4817 |
| 72 | Ga0070668_100131362 | 3300005347 | Bacteria | 2010 |
| 73 | Ga0070669_100000866 | 3300005353 | Bacteria | 22010 |
| 74 | Ga0070669_100010295 | 3300005353 | Bacteria | 6643 |
| 75 | Ga0070675_100030722 | 3300005354 | Bacteria | 4338 |
| 76 | Ga0070671_100015170 | 3300005355 | Bacteria | 6223 |
| 77 | Ga0070671_100082757 | 3300005355 | Bacteria | 2684 |
| 78 | Ga0070673_100000191 | 3300005364 | Bacteria | 30135 |
| 79 | Ga0070673_100023201 | 3300005364 | Bacteria | 4531 |
| 80 | Ga0070688_100002000 | 3300005365 | Bacteria | 10271 |
| 81 | Ga0070688_100053028 | 3300005365 | Bacteria | 2535 |
| 82 | Ga0070659_100001044 | 3300005366 | Bacteria | 20232 |
| 83 | Ga0070659_100001504 | 3300005366 | Bacteria | 16803 |
| 84 | Ga0070659_100007451 | 3300005366 | Bacteria | 7954 |
| 85 | Ga0070659_100022400 | 3300005366 | Bacteria | 4823 |
| 86 | Ga0070659_100036035 | 3300005366 | Bacteria | 3855 |
| 87 | Ga0070667_100223132 | 3300005367 | Bacteria | 1678 |
| 88 | Ga0070709_10011101 | 3300005434 | Bacteria | 5008 |
| 89 | Ga0070709_10027134 | 3300005434 | Bacteria | 3403 |
| 90 | Ga0070714_100001757 | 3300005435 | Bacteria | 15802 |
| 91 | Ga0070714_100053323 | 3300005435 | Bacteria | 3451 |
| 92 | Ga0070710_10007147 | 3300005437 | Bacteria | 5395 |
| 93 | Ga0070711_100043669 | 3300005439 | Bacteria | 3037 |
| 94 | Ga0070711_100045371 | 3300005439 | Bacteria | 2989 |
| 95 | Ga0070711_100058618 | 3300005439 | Bacteria | 2670 |
| 96 | Ga0070711_100079750 | 3300005439 | Bacteria | 2329 |
| 97 | Ga0070705_100076531 | 3300005440 | Bacteria | 2041 |
| 98 | Ga0070700_100001181 | 3300005441 | Bacteria | 12914 |
| 99 | Ga0070700_100019478 | 3300005441 | Bacteria | 3916 |
| 100 | Ga0070663_100001352 | 3300005455 | Bacteria | 13397 |
| 101 | Ga0070663_100011143 | 3300005455 | Bacteria | 5630 |
| 102 | Ga0070662_100001810 | 3300005457 | Bacteria | 13141 |
| 103 | Ga0070681_10002441 | 3300005458 | Bacteria | 17015 |
| 104 | Ga0070681_10007687 | 3300005458 | Bacteria | 10539 |
| 105 | Ga0070681_10022976 | 3300005458 | Bacteria | 6267 |
| 106 | Ga0070681_10025879 | 3300005458 | Bacteria | 5899 |
| 107 | Ga0070681_10045202 | 3300005458 | Bacteria | 4406 |
| 108 | Ga0068867_100021411 | 3300005459 | Bacteria | 4614 |
| 109 | Ga0068867_100061652 | 3300005459 | Bacteria | 2785 |
| 110 | Ga0070685_10012192 | 3300005466 | Bacteria | 4511 |
| 111 | Ga0070685_10071605 | 3300005466 | Bacteria | 2056 |
| 112 | Ga0070706_100125858 | 3300005467 | Bacteria | 2389 |
| 113 | Ga0070698_100000560 | 3300005471 | Bacteria | 39881 |
| 114 | Ga0070699_100003377 | 3300005518 | Bacteria | 14120 |
| 115 | Ga0070679_100004705 | 3300005530 | Bacteria | 12586 |
| 116 | Ga0070679_100006190 | 3300005530 | Bacteria | 11142 |
| 117 | Ga0070679_100011510 | 3300005530 | Bacteria | 8433 |
| 118 | Ga0070679_100011599 | 3300005530 | Bacteria | 8398 |
| 119 | Ga0070679_100046442 | 3300005530 | Bacteria | 4329 |
| 120 | Ga0070679_100058272 | 3300005530 | Bacteria | 3848 |
| 121 | Ga0070679_100082872 | 3300005530 | Bacteria | 3196 |
| 122 | Ga0070679_100092614 | 3300005530 | Bacteria | 3010 |
| 123 | Ga0070679_100094353 | 3300005530 | Bacteria | 2979 |
| 124 | Ga0070684_100001355 | 3300005535 | Bacteria | 17557 |
| 125 | Ga0070684_100009822 | 3300005535 | Bacteria | 7557 |
| 126 | Ga0070684_100070557 | 3300005535 | Bacteria | 3074 |
| 127 | Ga0070684_100084523 | 3300005535 | Bacteria | 2813 |
| 128 | Ga0070697_100002324 | 3300005536 | Bacteria | 14612 |
| 129 | Ga0068853_100001361 | 3300005539 | Bacteria | 17623 |
| 130 | Ga0068853_100009731 | 3300005539 | Bacteria | 7754 |
| 131 | Ga0068853_100013478 | 3300005539 | Bacteria | 6675 |
| 132 | Ga0068853_100024539 | 3300005539 | Bacteria | 5056 |
| 133 | Ga0068853_100043602 | 3300005539 | Bacteria | 3837 |
| 134 | Ga0068853_100077567 | 3300005539 | Bacteria | 2902 |
| 135 | Ga0070672_100001052 | 3300005543 | Bacteria | 16850 |
| 136 | Ga0070672_100035461 | 3300005543 | Bacteria | 3792 |
| 137 | Ga0070695_100005457 | 3300005545 | Bacteria | 7482 |
| 138 | Ga0070695_100055937 | 3300005545 | Bacteria | 2544 |
| 139 | Ga0070696_100009183 | 3300005546 | Bacteria | 6619 |
| 140 | Ga0070696_100011129 | 3300005546 | Bacteria | 6021 |
| 141 | Ga0070693_100004467 | 3300005547 | Bacteria | 6619 |
| 142 | Ga0070693_100040290 | 3300005547 | Bacteria | 2622 |
| 143 | Ga0070665_100129217 | 3300005548 | Bacteria | 2529 |
| 144 | Ga0070704_100023644 | 3300005549 | Bacteria | 4019 |
| 145 | Ga0068855_100001281 | 3300005563 | Bacteria | 31161 |
| 146 | Ga0068855_100006064 | 3300005563 | Bacteria | 14735 |
| 147 | Ga0068855_100008638 | 3300005563 | Bacteria | 12309 |
| 148 | Ga0068855_100028140 | 3300005563 | Bacteria | 6722 |
| 149 | Ga0068855_100109780 | 3300005563 | Bacteria | 3167 |
| 150 | Ga0068855_100139847 | 3300005563 | Bacteria | 2761 |
| 151 | Ga0068855_100157921 | 3300005563 | Bacteria | 2576 |
| 152 | Ga0068855_100188515 | 3300005563 | Bacteria | 2328 |
| 153 | Ga0068855_100233537 | 3300005563 | Bacteria | 2058 |
| 154 | Ga0068855_100272619 | 3300005563 | Bacteria | 1881 |
| 155 | Ga0070664_100023848 | 3300005564 | Bacteria | 5054 |
| 156 | Ga0070664_100031759 | 3300005564 | Bacteria | 4415 |
| 157 | Ga0068857_100001561 | 3300005577 | Bacteria | 18370 |
| 158 | Ga0068857_100033314 | 3300005577 | Bacteria | 4556 |
| 159 | Ga0068857_100075433 | 3300005577 | Bacteria | 3007 |
| 160 | Ga0068857_100105596 | 3300005577 | Bacteria | 2529 |
| 161 | Ga0068857_100157882 | 3300005577 | Bacteria | 2057 |
| 162 | Ga0068854_100037477 | 3300005578 | Bacteria | 3404 |
| 163 | Ga0068856_100003452 | 3300005614 | Bacteria | 15977 |
| 164 | Ga0070702_100000796 | 3300005615 | Bacteria | 12029 |
| 165 | Ga0068852_100001221 | 3300005616 | Bacteria | 17094 |
| 166 | Ga0068852_100041996 | 3300005616 | Bacteria | 3869 |
| 167 | Ga0068852_100050139 | 3300005616 | Bacteria | 3575 |
| 168 | Ga0068852_100078213 | 3300005616 | Bacteria | 2926 |
| 169 | Ga0068852_100176443 | 3300005616 | Bacteria | 2006 |
| 170 | Ga0068859_100002321 | 3300005617 | Bacteria | 19328 |
| 171 | Ga0068859_100011971 | 3300005617 | Bacteria | 8714 |
| 172 | Ga0068859_100015169 | 3300005617 | Bacteria | 7734 |
| 173 | Ga0068859_100224909 | 3300005617 | Bacteria | 1965 |
| 174 | Ga0068864_100002090 | 3300005618 | Bacteria | 16498 |
| 175 | Ga0068864_100046583 | 3300005618 | Bacteria | 3721 |
| 176 | Ga0068866_10001918 | 3300005718 | Bacteria | 8688 |
| 177 | Ga0068861_100001910 | 3300005719 | Bacteria | 13413 |
| 178 | Ga0068861_100086031 | 3300005719 | Bacteria | 2470 |
| 179 | Ga0068851_10013316 | 3300005834 | Bacteria | 3892 |
| 180 | Ga0068870_10000063 | 3300005840 | Bacteria | 33368 |
| 181 | Ga0068863_100036320 | 3300005841 | Bacteria | 4694 |
| 182 | Ga0068858_100071697 | 3300005842 | Bacteria | 3213 |
| 183 | Ga0068858_100137589 | 3300005842 | Bacteria | 2292 |
| 184 | Ga0068860_100001852 | 3300005843 | Bacteria | 22494 |
| 185 | Ga0068860_100003358 | 3300005843 | Bacteria | 16477 |
| 186 | Ga0068860_100016648 | 3300005843 | Bacteria | 7171 |
| 187 | Ga0068860_100123487 | 3300005843 | Bacteria | 2481 |
| 188 | Ga0068860_100137572 | 3300005843 | Bacteria | 2346 |
| 189 | Ga0068862_100026829 | 3300005844 | Bacteria | 4845 |
| 190 | Ga0068862_100074613 | 3300005844 | Bacteria | 2932 |
| 191 | Ga0081455_10000009 | 3300005937 | Bacteria | 249885 |
| 192 | Ga0081455_10003187 | 3300005937 | Bacteria | 19036 |
| 193 | Ga0081455_10009936 | 3300005937 | Bacteria | 9733 |
| 194 | Ga0081455_10013060 | 3300005937 | Bacteria | 8232 |
| 195 | Ga0081538_10001621 | 3300005981 | Bacteria | 23067 |
| 196 | Ga0081538_10035138 | 3300005981 | Bacteria | 3298 |
| 197 | Ga0081540_1000078 | 3300005983 | Bacteria | 105731 |
| 198 | Ga0081539_10025143 | 3300005985 | Bacteria | 3844 |
| 199 | Ga0081539_10046979 | 3300005985 | Bacteria | 2470 |
| 200 | Ga0070717_10016597 | 3300006028 | Bacteria | 5712 |
| 201 | Ga0070717_10089870 | 3300006028 | Bacteria | 2591 |
| 202 | Ga0075365_10019551 | 3300006038 | Bacteria | 4183 |
| 203 | Ga0070715_10005429 | 3300006163 | Bacteria | 4249 |
| 204 | Ga0070712_100004132 | 3300006175 | Bacteria | 8923 |
| 205 | Ga0075367_10009286 | 3300006178 | Bacteria | 5133 |
| 206 | Ga0068871_100036365 | 3300006358 | Bacteria | 3920 |
| 207 | Ga0068871_100082132 | 3300006358 | Bacteria | 2671 |
| 208 | Ga0075428_100059498 | 3300006844 | Bacteria | 4183 |
| 209 | Ga0075430_100002515 | 3300006846 | Bacteria | 15282 |
| 210 | Ga0075431_100002222 | 3300006847 | Bacteria | 18595 |
| 211 | Ga0075431_100005375 | 3300006847 | Bacteria | 12641 |
| 212 | Ga0075433_10010775 | 3300006852 | Bacteria | 7351 |
| 213 | Ga0075434_100006580 | 3300006871 | Bacteria | 10659 |
| 214 | Ga0075434_100053122 | 3300006871 | Bacteria | 4026 |
| 215 | Ga0075434_100099923 | 3300006871 | Bacteria | 2907 |
| 216 | Ga0075429_100005002 | 3300006880 | Bacteria | 11413 |
| 217 | Ga0068865_100000244 | 3300006881 | Bacteria | 30343 |
| 218 | Ga0068865_100005990 | 3300006881 | Bacteria | 7408 |
| 219 | Ga0075436_100010259 | 3300006914 | Bacteria | 6412 |
| 220 | Ga0075436_100020494 | 3300006914 | Bacteria | 4537 |
| 221 | Ga0097620_100002321 | 3300006931 | Bacteria | 19328 |
| 222 | Ga0097620_100011971 | 3300006931 | Bacteria | 8714 |
| 223 | Ga0097620_100015168 | 3300006931 | Bacteria | 7734 |
| 224 | Ga0097620_100224917 | 3300006931 | Bacteria | 1965 |
| 225 | Ga0075435_100018953 | 3300007076 | Bacteria | 5245 |
| 226 | Ga0075435_100094630 | 3300007076 | Bacteria | 2470 |
| 227 | Ga0099795_10004155 | 3300007788 | Bacteria | 3699 |
| 228 | Ga0099795_10008200 | 3300007788 | Bacteria | 2965 |
| 229 | Ga0105244_10018886 | 3300009036 | Bacteria | 3860 |
| 230 | Ga0105240_10000798 | 3300009093 | Bacteria | 57073 |
| 231 | Ga0105240_10000938 | 3300009093 | Bacteria | 51767 |
| 232 | Ga0111539_10003401 | 3300009094 | Bacteria | 20957 |
| 233 | Ga0111539_10032147 | 3300009094 | Bacteria | 6374 |
| 234 | Ga0111539_10115740 | 3300009094 | Bacteria | 3144 |
| 235 | Ga0105245_10007297 | 3300009098 | Bacteria | 9681 |
| 236 | Ga0105245_10022284 | 3300009098 | Bacteria | 5560 |
| 237 | Ga0105245_10031383 | 3300009098 | Bacteria | 4701 |
| 238 | Ga0105247_10014767 | 3300009101 | Bacteria | 4681 |
| 239 | Ga0114129_10006095 | 3300009147 | Bacteria | 17097 |
| 240 | Ga0114129_10090309 | 3300009147 | Bacteria | 4247 |
| 241 | Ga0114129_10152174 | 3300009147 | Bacteria | 3165 |
| 242 | Ga0105243_10009225 | 3300009148 | Bacteria | 7532 |
| 243 | Ga0105241_10014140 | 3300009174 | Bacteria | 5849 |
| 244 | Ga0105242_10040800 | 3300009176 | Bacteria | 3740 |
| 245 | Ga0105242_10075407 | 3300009176 | Bacteria | 2808 |
| 246 | Ga0105242_10078422 | 3300009176 | Bacteria | 2757 |
| 247 | Ga0105248_10000635 | 3300009177 | Bacteria | 39916 |
| 248 | Ga0105248_10023392 | 3300009177 | Bacteria | 6864 |
| 249 | Ga0105248_10104103 | 3300009177 | Bacteria | 3199 |
| 250 | Ga0105248_10140148 | 3300009177 | Bacteria | 2728 |
| 251 | Ga0105248_10247572 | 3300009177 | Bacteria | 2006 |
| 252 | Ga0105237_10019840 | 3300009545 | Bacteria | 6940 |
| 253 | Ga0105237_10194952 | 3300009545 | Bacteria | 2025 |
| 254 | Ga0105238_10000739 | 3300009551 | Bacteria | 34142 |
| 255 | Ga0105238_10004540 | 3300009551 | Bacteria | 13740 |
| 256 | Ga0105238_10037849 | 3300009551 | Bacteria | 4902 |
| 257 | Ga0105249_10001033 | 3300009553 | Bacteria | 24619 |
| 258 | Ga0105249_10015027 | 3300009553 | Bacteria | 6849 |
| 259 | Ga0105249_10239728 | 3300009553 | Bacteria | 1792 |
| 260 | Ga0105239_10001295 | 3300010375 | Bacteria | 33721 |
| 261 | Ga0105239_10019241 | 3300010375 | Bacteria | 7541 |
| 262 | Ga0105239_10035447 | 3300010375 | Bacteria | 5479 |
| 263 | Ga0105246_10001800 | 3300011119 | Bacteria | 12824 |
| 264 | Ga0105246_10104965 | 3300011119 | Bacteria | 2064 |
| 265 | Ga0105246_10107844 | 3300011119 | Bacteria | 2040 |
| 266 | Ga0157373_10000266 | 3300013100 | Bacteria | 42156 |
| 267 | Ga0157373_10000699 | 3300013100 | Bacteria | 26275 |
| 268 | Ga0157373_10000704 | 3300013100 | Bacteria | 26230 |
| 269 | Ga0157373_10021255 | 3300013100 | Bacteria | 4712 |
| 270 | Ga0157373_10021471 | 3300013100 | Bacteria | 4689 |
| 271 | Ga0157373_10022131 | 3300013100 | Bacteria | 4612 |
| 272 | Ga0157373_10025753 | 3300013100 | Bacteria | 4252 |
| 273 | Ga0157371_10000451 | 3300013102 | Bacteria | 50405 |
| 274 | Ga0157371_10000725 | 3300013102 | Bacteria | 38633 |
| 275 | Ga0157371_10002225 | 3300013102 | Bacteria | 18778 |
| 276 | Ga0157371_10010582 | 3300013102 | Bacteria | 7168 |
| 277 | Ga0157371_10026845 | 3300013102 | Bacteria | 4181 |
| 278 | Ga0157371_10033114 | 3300013102 | Bacteria | 3715 |
| 279 | Ga0157371_10098706 | 3300013102 | Bacteria | 2071 |
| 280 | Ga0157370_10002951 | 3300013104 | Bacteria | 20249 |
| 281 | Ga0157370_10004287 | 3300013104 | Bacteria | 16429 |
| 282 | Ga0157370_10092288 | 3300013104 | Bacteria | 2842 |
| 283 | Ga0157370_10280971 | 3300013104 | Bacteria | 1538 |
| 284 | Ga0157369_10006077 | 3300013105 | Bacteria | 14011 |
| 285 | Ga0157369_10015265 | 3300013105 | Bacteria | 8665 |
| 286 | Ga0157369_10072248 | 3300013105 | Bacteria | 3703 |
| 287 | Ga0157374_10003001 | 3300013296 | Bacteria | 14126 |
| 288 | Ga0157374_10009715 | 3300013296 | Bacteria | 8260 |
| 289 | Ga0157374_10138796 | 3300013296 | Bacteria | 2358 |
| 290 | Ga0157378_10002181 | 3300013297 | Bacteria | 17356 |
| 291 | Ga0163162_10003401 | 3300013306 | Bacteria | 15185 |
| 292 | Ga0163162_10194359 | 3300013306 | Bacteria | 2157 |
| 293 | Ga0157372_10004429 | 3300013307 | Bacteria | 14982 |
| 294 | Ga0157372_10010976 | 3300013307 | Bacteria | 9642 |
| 295 | Ga0157372_10015970 | 3300013307 | Bacteria | 8053 |
| 296 | Ga0157372_10023648 | 3300013307 | Bacteria | 6665 |
| 297 | Ga0157372_10025943 | 3300013307 | Bacteria | 6375 |
| 298 | Ga0157372_10042371 | 3300013307 | Bacteria | 5035 |
| 299 | Ga0157372_10049520 | 3300013307 | Bacteria | 4671 |
| 300 | Ga0157372_10082719 | 3300013307 | Unclassified | 3635 |
| 301 | Ga0157372_10111837 | 3300013307 | Bacteria | 3129 |
| 302 | Ga0157375_10003806 | 3300013308 | Bacteria | 13080 |
| 303 | Ga0157375_10020942 | 3300013308 | Bacteria | 5984 |
| 304 | Ga0163163_10005155 | 3300014325 | Bacteria | 11267 |
| 305 | Ga0157380_10001301 | 3300014326 | Bacteria | 16225 |
| 306 | Ga0157380_10226933 | 3300014326 | Bacteria | 1674 |
| 307 | Ga0157379_10000275 | 3300014968 | Bacteria | 40524 |
| 308 | Ga0157379_10016877 | 3300014968 | Bacteria | 6425 |
| 309 | Ga0157379_10220374 | 3300014968 | Bacteria | 1719 |
| 310 | Ga0157376_10000115 | 3300014969 | Bacteria | 57170 |
| 311 | Ga0183365_10003 | 3300015684 | Bacteria | 414944 |
| 312 | Ga0163161_10078244 | 3300017792 | Bacteria | 2430 |
| 313 | Ga0163161_10147380 | 3300017792 | Bacteria | 1786 |
| 314 | Ga0213876_10000414 | 3300021384 | Bacteria | 35795 |
| 315 | Ga0207666_1000050 | 3300025271 | Bacteria | 22802 |
| 316 | Ga0209673_1017079 | 3300025273 | Bacteria | 2686 |
| 317 | Ga0207673_1000083 | 3300025290 | Bacteria | 8317 |
| 318 | Ga0209675_1000514 | 3300025291 | Bacteria | 28599 |
| 319 | Ga0209025_1000016 | 3300025294 | Bacteria | 770739 |
| 320 | Ga0209564_1000023 | 3300025295 | Bacteria | 555102 |
| 321 | Ga0209564_1000035 | 3300025295 | Bacteria | 442446 |
| 322 | Ga0209758_1003674 | 3300025297 | Bacteria | 13647 |
| 323 | Ga0209758_1039438 | 3300025297 | Bacteria | 1796 |
| 324 | Ga0209256_1000025 | 3300025299 | Bacteria | 442449 |
| 325 | Ga0209256_1000584 | 3300025299 | Bacteria | 51121 |
| 326 | Ga0207697_10003427 | 3300025315 | Bacteria | 7854 |
| 327 | Ga0207697_10014069 | 3300025315 | Bacteria | 3330 |
| 328 | Ga0207653_10011359 | 3300025885 | Bacteria | 2778 |
| 329 | Ga0207682_10000695 | 3300025893 | Bacteria | 15627 |
| 330 | Ga0207692_10034918 | 3300025898 | Bacteria | 2438 |
| 331 | Ga0207692_10091923 | 3300025898 | Bacteria | 1647 |
| 332 | Ga0207642_10001013 | 3300025899 | Bacteria | 8804 |
| 333 | Ga0207710_10020800 | 3300025900 | Bacteria | 2807 |
| 334 | Ga0207710_10063248 | 3300025900 | Bacteria | 1683 |
| 335 | Ga0207688_10001691 | 3300025901 | Bacteria | 11690 |
| 336 | Ga0207647_10007711 | 3300025904 | Bacteria | 7748 |
| 337 | Ga0207647_10129576 | 3300025904 | Bacteria | 1483 |
| 338 | Ga0207685_10002459 | 3300025905 | Bacteria | 4254 |
| 339 | Ga0207685_10025208 | 3300025905 | Bacteria | 2050 |
| 340 | Ga0207699_10034165 | 3300025906 | Bacteria | 2881 |
| 341 | Ga0207645_10000114 | 3300025907 | Bacteria | 60880 |
| 342 | Ga0207643_10000134 | 3300025908 | Bacteria | 50474 |
| 343 | Ga0207705_10000826 | 3300025909 | Bacteria | 25319 |
| 344 | Ga0207705_10014114 | 3300025909 | Bacteria | 5755 |
| 345 | Ga0207705_10023982 | 3300025909 | Bacteria | 4354 |
| 346 | Ga0207705_10088026 | 3300025909 | Bacteria | 2271 |
| 347 | Ga0207654_10003477 | 3300025911 | Bacteria | 7966 |
| 348 | Ga0207654_10005659 | 3300025911 | Bacteria | 6317 |
| 349 | Ga0207654_10022181 | 3300025911 | Bacteria | 3385 |
| 350 | Ga0207707_10001147 | 3300025912 | Bacteria | 25092 |
| 351 | Ga0207707_10008171 | 3300025912 | Bacteria | 9080 |
| 352 | Ga0207707_10049328 | 3300025912 | Bacteria | 3667 |
| 353 | Ga0207707_10120576 | 3300025912 | Bacteria | 2293 |
| 354 | Ga0207707_10129488 | 3300025912 | Bacteria | 2207 |
| 355 | Ga0207695_10000086 | 3300025913 | Bacteria | 278055 |
| 356 | Ga0207695_10059284 | 3300025913 | Bacteria | 3970 |
| 357 | Ga0207695_10136559 | 3300025913 | Bacteria | 2405 |
| 358 | Ga0207671_10018213 | 3300025914 | Bacteria | 5395 |
| 359 | Ga0207693_10002351 | 3300025915 | Bacteria | 16428 |
| 360 | Ga0207693_10042576 | 3300025915 | Bacteria | 3574 |
| 361 | Ga0207663_10062764 | 3300025916 | Bacteria | 2363 |
| 362 | Ga0207663_10070342 | 3300025916 | Bacteria | 2254 |
| 363 | Ga0207660_10000034 | 3300025917 | Bacteria | 65783 |
| 364 | Ga0207660_10028719 | 3300025917 | Bacteria | 3807 |
| 365 | Ga0207660_10031763 | 3300025917 | Bacteria | 3640 |
| 366 | Ga0207660_10043080 | 3300025917 | Bacteria | 3171 |
| 367 | Ga0207660_10043658 | 3300025917 | Bacteria | 3150 |
| 368 | Ga0207660_10059999 | 3300025917 | Bacteria | 2732 |
| 369 | Ga0207660_10096160 | 3300025917 | Bacteria | 2205 |
| 370 | Ga0207662_10003783 | 3300025918 | Bacteria | 7854 |
| 371 | Ga0207662_10005820 | 3300025918 | Bacteria | 6605 |
| 372 | Ga0207662_10012857 | 3300025918 | Bacteria | 4670 |
| 373 | Ga0207657_10002202 | 3300025919 | Bacteria | 21126 |
| 374 | Ga0207657_10002232 | 3300025919 | Bacteria | 21006 |
| 375 | Ga0207657_10005404 | 3300025919 | Bacteria | 13354 |
| 376 | Ga0207657_10014577 | 3300025919 | Bacteria | 7661 |
| 377 | Ga0207657_10028202 | 3300025919 | Bacteria | 5126 |
| 378 | Ga0207657_10052181 | 3300025919 | Bacteria | 3551 |
| 379 | Ga0207657_10081124 | 3300025919 | Bacteria | 2726 |
| 380 | Ga0207649_10000142 | 3300025920 | Bacteria | 60023 |
| 381 | Ga0207649_10048579 | 3300025920 | Bacteria | 2617 |
| 382 | Ga0207652_10000159 | 3300025921 | Bacteria | 73101 |
| 383 | Ga0207652_10000819 | 3300025921 | Bacteria | 29643 |
| 384 | Ga0207652_10002021 | 3300025921 | Bacteria | 17491 |
| 385 | Ga0207652_10003248 | 3300025921 | Bacteria | 13486 |
| 386 | Ga0207652_10028137 | 3300025921 | Bacteria | 4688 |
| 387 | Ga0207652_10032953 | 3300025921 | Bacteria | 4361 |
| 388 | Ga0207652_10050967 | 3300025921 | Bacteria | 3547 |
| 389 | Ga0207652_10070953 | 3300025921 | Bacteria | 3026 |
| 390 | Ga0207652_10097116 | 3300025921 | Bacteria | 2596 |
| 391 | Ga0207681_10000065 | 3300025923 | Bacteria | 98832 |
| 392 | Ga0207681_10049749 | 3300025923 | Bacteria | 2834 |
| 393 | Ga0207694_10001748 | 3300025924 | Bacteria | 18228 |
| 394 | Ga0207694_10050623 | 3300025924 | Bacteria | 3218 |
| 395 | Ga0207694_10101264 | 3300025924 | Bacteria | 2283 |
| 396 | Ga0207650_10002366 | 3300025925 | Bacteria | 13121 |
| 397 | Ga0207650_10003910 | 3300025925 | Bacteria | 10188 |
| 398 | Ga0207659_10000078 | 3300025926 | Bacteria | 61403 |
| 399 | Ga0207659_10002782 | 3300025926 | Bacteria | 10432 |
| 400 | Ga0207687_10117143 | 3300025927 | Bacteria | 1987 |
| 401 | Ga0207700_10010746 | 3300025928 | Bacteria | 5798 |
| 402 | Ga0207700_10136691 | 3300025928 | Bacteria | 2009 |
| 403 | Ga0207664_10002328 | 3300025929 | Bacteria | 12549 |
| 404 | Ga0207664_10004658 | 3300025929 | Bacteria | 9303 |
| 405 | Ga0207690_10002633 | 3300025932 | Bacteria | 10810 |
| 406 | Ga0207690_10038328 | 3300025932 | Bacteria | 3118 |
| 407 | Ga0207690_10043012 | 3300025932 | Bacteria | 2970 |
| 408 | Ga0207690_10066700 | 3300025932 | Bacteria | 2466 |
| 409 | Ga0207690_10091209 | 3300025932 | Bacteria | 2153 |
| 410 | Ga0207706_10010585 | 3300025933 | Bacteria | 8423 |
| 411 | Ga0207706_10017442 | 3300025933 | Bacteria | 6468 |
| 412 | Ga0207686_10007002 | 3300025934 | Bacteria | 6068 |
| 413 | Ga0207686_10078427 | 3300025934 | Bacteria | 2148 |
| 414 | Ga0207709_10000183 | 3300025935 | Bacteria | 83374 |
| 415 | Ga0207670_10017591 | 3300025936 | Bacteria | 4323 |
| 416 | Ga0207670_10035097 | 3300025936 | Bacteria | 3249 |
| 417 | Ga0207670_10038388 | 3300025936 | Bacteria | 3127 |
| 418 | Ga0207669_10001025 | 3300025937 | Bacteria | 11929 |
| 419 | Ga0207704_10000719 | 3300025938 | Bacteria | 14567 |
| 420 | Ga0207665_10021032 | 3300025939 | Bacteria | 4288 |
| 421 | Ga0207691_10013386 | 3300025940 | Bacteria | 7854 |
| 422 | Ga0207691_10023625 | 3300025940 | Bacteria | 5789 |
| 423 | Ga0207711_10000482 | 3300025941 | Bacteria | 41192 |
| 424 | Ga0207711_10002506 | 3300025941 | Bacteria | 16369 |
| 425 | Ga0207689_10000144 | 3300025942 | Bacteria | 61402 |
| 426 | Ga0207661_10001264 | 3300025944 | Bacteria | 16911 |
| 427 | Ga0207661_10024363 | 3300025944 | Bacteria | 4586 |
| 428 | Ga0207661_10118426 | 3300025944 | Bacteria | 2251 |
| 429 | Ga0207679_10000064 | 3300025945 | Bacteria | 98118 |
| 430 | Ga0207679_10008326 | 3300025945 | Bacteria | 6605 |
| 431 | Ga0207679_10017293 | 3300025945 | Bacteria | 4807 |
| 432 | Ga0207667_10000697 | 3300025949 | Bacteria | 43571 |
| 433 | Ga0207667_10011900 | 3300025949 | Bacteria | 10077 |
| 434 | Ga0207667_10031553 | 3300025949 | Bacteria | 5718 |
| 435 | Ga0207667_10039772 | 3300025949 | Bacteria | 5008 |
| 436 | Ga0207667_10041705 | 3300025949 | Bacteria | 4880 |
| 437 | Ga0207667_10115177 | 3300025949 | Bacteria | 2771 |
| 438 | Ga0207667_10284192 | 3300025949 | Unclassified | 1691 |
| 439 | Ga0207651_10000420 | 3300025960 | Bacteria | 18070 |
| 440 | Ga0207651_10127362 | 3300025960 | Bacteria | 1942 |
| 441 | Ga0207712_10001661 | 3300025961 | Bacteria | 14931 |
| 442 | Ga0207668_10000965 | 3300025972 | Bacteria | 17301 |
| 443 | Ga0207668_10112221 | 3300025972 | Bacteria | 2047 |
| 444 | Ga0207640_10001755 | 3300025981 | Bacteria | 11643 |
| 445 | Ga0207640_10030817 | 3300025981 | Bacteria | 3308 |
| 446 | Ga0207658_10006976 | 3300025986 | Bacteria | 7690 |
| 447 | Ga0207658_10061502 | 3300025986 | Bacteria | 2806 |
| 448 | Ga0207677_10003997 | 3300026023 | Bacteria | 7866 |
| 449 | Ga0207703_10010897 | 3300026035 | Bacteria | 7087 |
| 450 | Ga0207703_10116932 | 3300026035 | Bacteria | 2284 |
| 451 | Ga0207639_10001895 | 3300026041 | Bacteria | 14044 |
| 452 | Ga0207639_10036628 | 3300026041 | Bacteria | 3637 |
| 453 | Ga0207678_10000034 | 3300026067 | Bacteria | 104888 |
| 454 | Ga0207678_10003913 | 3300026067 | Bacteria | 13396 |
| 455 | Ga0207678_10047670 | 3300026067 | Bacteria | 3705 |
| 456 | Ga0207708_10007970 | 3300026075 | Bacteria | 7848 |
| 457 | Ga0207708_10035965 | 3300026075 | Bacteria | 3768 |
| 458 | Ga0207702_10003767 | 3300026078 | Bacteria | 13697 |
| 459 | Ga0207702_10033401 | 3300026078 | Bacteria | 4297 |
| 460 | Ga0207641_10001821 | 3300026088 | Bacteria | 20519 |
| 461 | Ga0207641_10018585 | 3300026088 | Bacteria | 5698 |
| 462 | Ga0207648_10012750 | 3300026089 | Bacteria | 7854 |
| 463 | Ga0207648_10032101 | 3300026089 | Bacteria | 4639 |
| 464 | Ga0207676_10000079 | 3300026095 | Bacteria | 94811 |
| 465 | Ga0207676_10079269 | 3300026095 | Bacteria | 2663 |
| 466 | Ga0207676_10244276 | 3300026095 | Bacteria | 1612 |
| 467 | Ga0207674_10000323 | 3300026116 | Bacteria | 61026 |
| 468 | Ga0207674_10008053 | 3300026116 | Bacteria | 12218 |
| 469 | Ga0207674_10029820 | 3300026116 | Bacteria | 5740 |
| 470 | Ga0207674_10079124 | 3300026116 | Bacteria | 3292 |
| 471 | Ga0207674_10131759 | 3300026116 | Bacteria | 2463 |
| 472 | Ga0207674_10176184 | 3300026116 | Bacteria | 2091 |
| 473 | Ga0207675_100012401 | 3300026118 | Bacteria | 7961 |
| 474 | Ga0207675_100054943 | 3300026118 | Bacteria | 3715 |
| 475 | Ga0207683_10000037 | 3300026121 | Bacteria | 100920 |
| 476 | Ga0207683_10012300 | 3300026121 | Bacteria | 7305 |
| 477 | Ga0207683_10026581 | 3300026121 | Bacteria | 4996 |
| 478 | Ga0207698_10085676 | 3300026142 | Bacteria | 2559 |
| 479 | Ga0207698_10090902 | 3300026142 | Bacteria | 2497 |
| 480 | Ga0207698_10124096 | 3300026142 | Bacteria | 2192 |
| 481 | Ga0210002_1000055 | 3300027617 | Bacteria | 17399 |
| 482 | Ga0209971_1010411 | 3300027682 | Bacteria | 2202 |
| 483 | Ga0209966_1001951 | 3300027695 | Bacteria | 3456 |
| 484 | Ga0209998_10007236 | 3300027717 | Bacteria | 2300 |
| 485 | Ga0209813_10005443 | 3300027866 | Bacteria | 3090 |
| 486 | Ga0207428_10000216 | 3300027907 | Bacteria | 79777 |
| 487 | Ga0207428_10000947 | 3300027907 | Bacteria | 32277 |
| 488 | Ga0207428_10009986 | 3300027907 | Bacteria | 8496 |
| 489 | Ga0268265_10001593 | 3300028380 | Bacteria | 18775 |
| 490 | Ga0268264_10002487 | 3300028381 | Bacteria | 16198 |
| 491 | Ga0268264_10011787 | 3300028381 | Bacteria | 7207 |
| 492 | Ga0268264_10045578 | 3300028381 | Bacteria | 3641 |
| 493 | Ga0265337_1000455 | 3300028556 | Bacteria | 21685 |
| 494 | Ga0307515_10114786 | 3300028794 | Bacteria | 3109 |
| 495 | Ga0265338_10014181 | 3300028800 | Bacteria | 8902 |
| 496 | Ga0265338_10028844 | 3300028800 | Bacteria | 5522 |
| 497 | Ga0265338_10032973 | 3300028800 | Bacteria | 5039 |
| 498 | Ga0265330_10017507 | 3300031235 | Bacteria | 3298 |
| 499 | Ga0265332_10004885 | 3300031238 | Bacteria | 6233 |
| 500 | Ga0265328_10000625 | 3300031239 | Bacteria | 16392 |
| 501 | Ga0265320_10004008 | 3300031240 | Bacteria | 9691 |
| 502 | Ga0265325_10000104 | 3300031241 | Bacteria | 59692 |
| 503 | Ga0265325_10003165 | 3300031241 | Bacteria | 10826 |
| 504 | Ga0265325_10008799 | 3300031241 | Bacteria | 5932 |
| 505 | Ga0265325_10028145 | 3300031241 | Bacteria | 3032 |
| 506 | Ga0265339_10008839 | 3300031249 | Bacteria | 6378 |
| 507 | Ga0265339_10032395 | 3300031249 | Bacteria | 2947 |
| 508 | Ga0265339_10051603 | 3300031249 | Bacteria | 2243 |
| 509 | Ga0265331_10002586 | 3300031250 | Bacteria | 12165 |
| 510 | Ga0265331_10007020 | 3300031250 | Bacteria | 6571 |
| 511 | Ga0265327_10025523 | 3300031251 | Bacteria | 3443 |
| 512 | Ga0265316_10007468 | 3300031344 | Bacteria | 10300 |
| 513 | Ga0307513_10000162 | 3300031456 | Bacteria | 96000 |
| 514 | Ga0265313_10000438 | 3300031595 | Bacteria | 44285 |
| 515 | Ga0265313_10008202 | 3300031595 | Bacteria | 6979 |
| 516 | Ga0265313_10031332 | 3300031595 | Bacteria | 2727 |
| 517 | Ga0265313_10036346 | 3300031595 | Bacteria | 2473 |
| 518 | Ga0316579_10014439 | 3300031691 | Bacteria | 3414 |
| 519 | Ga0265314_10007477 | 3300031711 | Bacteria | 9472 |
| 520 | Ga0265342_10000807 | 3300031712 | Bacteria | 31481 |
| 521 | Ga0265342_10037987 | 3300031712 | Bacteria | 2934 |
| 522 | Ga0265342_10050235 | 3300031712 | Bacteria | 2492 |
| 523 | Ga0316576_10066005 | 3300031727 | Bacteria | 2661 |
| 524 | Ga0307405_10085098 | 3300031731 | Bacteria | 2078 |
| 525 | Ga0307413_10078391 | 3300031824 | Bacteria | 2108 |
| 526 | Ga0307410_10077889 | 3300031852 | Bacteria | 2319 |
| 527 | Ga0307409_100044432 | 3300031995 | Bacteria | 3346 |
| 528 | Ga0307416_100021418 | 3300032002 | Bacteria | 4640 |
| 529 | Ga0307415_100042778 | 3300032126 | Bacteria | 3017 |
| 530 | Ga0316583_10009090 | 3300032133 | Bacteria | 3584 |
| 531 | Ga0307510_10038206 | 3300033180 | Bacteria | 5311 |
| 532 | Ga0373930_0010010 | 3300034816 | Bacteria | 1685 |
| 533 | Ga0373958_0009669 | 3300034819 | Bacteria | 1591 |
| 534 | Ga0373938_0000060 | 3300034957 | Bacteria | 13928 |
| 535 | Ga0373929_0000687 | 3300035085 | Bacteria | 6541 |
| 536 | Ga0373934_0015852 | 3300035086 | Bacteria | 2863 |
| 537 | Ga0373940_0000468 | 3300035088 | Bacteria | 6225 |
| 538 | Ga0373936_0038511 | 3300035113 | Bacteria | 1911 |
| 539 | Ga0373939_0000354 | 3300035114 | Bacteria | 11613 |
| 540 | Ga0373941_0000073 | 3300035115 | Bacteria | 16016 |
| 541 | Ga0373945_0032939 | 3300035116 | Bacteria | 1838 |
| 542 | Ga0373956_0031854 | 3300035119 | Bacteria | 2312 |
| 543 | Ga0373960_0000114 | 3300035121 | Bacteria | 12986 |
| 544 | Ga0373946_0004481 | 3300035171 | Bacteria | 5001 |
| 545 | Ga0373955_0060695 | 3300035172 | Bacteria | 2086 |
| 546 | Ga0373942_0003137 | 3300035207 | Bacteria | 3911 |
| 547 | Ga0373961_0003513 | 3300035241 | Bacteria | 3871 |
| 548 | Ga0373962_0002966 | 3300035242 | Bacteria | 4070 |
| 549 | Ga0316574_0071387 | 3300035398 | Bacteria | 2193 |
| 550 | Ga0373924_0023750 | 3300035410 | Bacteria | 2409 |
| 551 | Ga0373931_0067262 | 3300035691 | Bacteria | 1946 |
| 552 | Ga0373935_0026091 | 3300035692 | Bacteria | 3604 |
| 553 | Ga0373927_0002642 | 3300035695 | Bacteria | 13053 |
| 554 | Ga0373927_0027210 | 3300035695 | Bacteria | 3734 |
| 555 | Ga0373927_0031545 | 3300035695 | Bacteria | 3453 |
| 556 | Ga0373933_0030523 | 3300035724 | Bacteria | 3121 |
| 557 | Ga0373937_0015230 | 3300036401 | Bacteria | 6798 |
| 558 | Ga0373937_0024244 | 3300036401 | Bacteria | 5469 |
| 559 | Ga0373937_0052194 | 3300036401 | Bacteria | 3748 |
| 560 | Ga0373937_0131703 | 3300036401 | Bacteria | 2335 |
| 561 | Ga0373925_0000507 | 3300037068 | Bacteria | 39351 |
| 562 | Ga0373925_0015686 | 3300037068 | Bacteria | 5483 |
| 563 | Ga0373925_0047063 | 3300037068 | Bacteria | 3209 |
| 564 | Ga0373925_0054236 | 3300037068 | Bacteria | 2998 |
| 565 | Ga0395899_0000105 | 3300037312 | Bacteria | 146163 |
| 566 | Ga0395899_0000913 | 3300037312 | Bacteria | 27769 |
| 567 | Ga0395899_0002674 | 3300037312 | Bacteria | 14372 |
| 568 | Ga0395899_0008998 | 3300037312 | Bacteria | 7679 |
| 569 | Ga0395899_0015255 | 3300037312 | Bacteria | 5856 |
| 570 | Ga0395899_0015289 | 3300037312 | Bacteria | 5848 |
| 571 | Ga0395899_0027856 | 3300037312 | Bacteria | 4256 |
| 572 | Ga0395900_0002396 | 3300037418 | Bacteria | 20678 |
| 573 | Ga0395900_0003116 | 3300037418 | Bacteria | 18005 |
| 574 | Ga0395900_0003303 | 3300037418 | Bacteria | 17453 |
| 575 | Ga0395900_0008085 | 3300037418 | Bacteria | 10829 |
| 576 | Ga0395900_0027215 | 3300037418 | Bacteria | 5856 |
| 577 | Ga0395900_0136050 | 3300037418 | Bacteria | 2517 |
| 578 | Ga0395900_0223283 | 3300037418 | Bacteria | 1898 |
| 579 | Ga0395898_0000730 | 3300037466 | Bacteria | 57720 |
| 580 | Ga0395898_0006986 | 3300037466 | Bacteria | 12000 |
| 581 | Ga0395898_0008249 | 3300037466 | Bacteria | 11015 |
| 582 | Ga0395898_0017166 | 3300037466 | Bacteria | 7393 |
| 583 | Ga0395898_0023966 | 3300037466 | Bacteria | 6158 |
| 584 | Ga0395898_0029520 | 3300037466 | Bacteria | 5492 |
| 585 | Ga0395898_0032856 | 3300037466 | Bacteria | 5180 |
| 586 | Ga0395898_0040919 | 3300037466 | Bacteria | 4580 |
| 587 | Ga0395898_0110402 | 3300037466 | Bacteria | 2636 |
| 588 | Ga0395898_0119170 | 3300037466 | Bacteria | 2528 |
| 589 | Ga0395905_0000346 | 3300037471 | Bacteria | 65961 |
| 590 | Ga0395905_0008421 | 3300037471 | Bacteria | 10170 |
| 591 | Ga0395901_0002140 | 3300038443 | Bacteria | 20188 |
| 592 | Ga0395901_0030404 | 3300038443 | Bacteria | 5564 |
| 593 | Ga0395901_0033872 | 3300038443 | Bacteria | 5275 |
| 594 | Ga0395901_0034665 | 3300038443 | Bacteria | 5213 |
| 595 | Ga0395901_0044442 | 3300038443 | Bacteria | 4607 |
| 596 | Ga0395901_0049828 | 3300038443 | Bacteria | 4352 |
| 597 | Ga0395901_0053699 | 3300038443 | Bacteria | 4187 |
| 598 | Ga0395901_0178453 | 3300038443 | Bacteria | 2227 |
| 599 | Ga0395901_0285206 | 3300038443 | Bacteria | 1715 |
| 600 | Ga0400489_02163 | 3300039093 | Bacteria | 4021 |
| 601 | Ga0436365_0440714 | 3300039437 | Bacteria | 2098 |
| 602 | Ga0436365_0459838 | 3300039437 | Bacteria | 2925 |
| 603 | Ga0436365_0676365 | 3300039437 | Bacteria | 1934 |
| 604 | Ga0436365_0883229 | 3300039437 | Bacteria | 3065 |
| 605 | Ga0436365_1653706 | 3300039437 | Bacteria | 4794 |
| 606 | Ga0436365_1830840 | 3300039437 | Bacteria | 45078 |
| 607 | Ga0436361_0196619 | 3300039447 | Bacteria | 31824 |
| 608 | Ga0436361_0846399 | 3300039447 | Bacteria | 4964 |
| 609 | Ga0436361_1032931 | 3300039447 | Bacteria | 2458 |
| 610 | Ga0439439_0006575 | 3300041406 | Bacteria | 2692 |
| 611 | Ga0439448_0032448 | 3300042005 | Bacteria | 1662 |
| 612 | Ga0466969_0001388 | 3300044656 | Bacteria | 13070 |
| 613 | Ga0466965_0036373 | 3300044683 | Bacteria | 2416 |
| 614 | Ga0466966_0000050 | 3300044684 | Bacteria | 88948 |
| 615 | Ga0466961_0113469 | 3300044693 | Bacteria | 1704 |
| 616 | Ga0453684_0190899 | 3300044712 | Bacteria | 2397 |
| 617 | Ga0453684_0220580 | 3300044712 | Bacteria | 2197 |
| 618 | Ga0466957_0000161 | 3300044842 | Bacteria | 29452 |
| 619 | Ga0466957_0006712 | 3300044842 | Bacteria | 6507 |
| 620 | Ga0466957_0130715 | 3300044842 | Bacteria | 1608 |
| 621 | Ga0466959_0000121 | 3300045049 | Bacteria | 50252 |
| 622 | Ga0466959_0138879 | 3300045049 | Bacteria | 1719 |
| 623 | Ga0451576_0052847 | 3300045051 | Bacteria | 4257 |
| 624 | Ga0466958_0002157 | 3300045836 | Bacteria | 9799 |
| 625 | Ga0466967_0030498 | 3300045976 | Bacteria | 4526 |
| 626 | Ga0495592_0045783 | 3300046454 | Bacteria | 3263 |
| 627 | Ga0495603_0044127 | 3300046455 | Bacteria | 2660 |
| 628 | Ga0495629_0001773 | 3300046459 | Bacteria | 16935 |
| 629 | Ga0495629_0031784 | 3300046459 | Bacteria | 3737 |
| 630 | Ga0495641_0012339 | 3300046461 | Bacteria | 4788 |
| 631 | Ga0495641_0034862 | 3300046461 | Bacteria | 2376 |
| 632 | Ga0495651_0008470 | 3300046462 | Bacteria | 7880 |
| 633 | Ga0495651_0097345 | 3300046462 | Bacteria | 2197 |
| 634 | Ga0495580_0016611 | 3300046472 | Bacteria | 5520 |
| 635 | Ga0495580_0056438 | 3300046472 | Bacteria | 2765 |
| 636 | Ga0495582_0006472 | 3300046473 | Bacteria | 6502 |
| 637 | Ga0495582_0025590 | 3300046473 | Bacteria | 3232 |
| 638 | Ga0495582_0049348 | 3300046473 | Bacteria | 2317 |
| 639 | Ga0495639_0006653 | 3300046475 | Bacteria | 4971 |
| 640 | Ga0495662_0066041 | 3300046476 | Bacteria | 1749 |
| 641 | Ga0495664_0024189 | 3300046477 | Bacteria | 3528 |
| 642 | Ga0495584_0006769 | 3300046491 | Bacteria | 5989 |
| 643 | Ga0495608_0012886 | 3300046511 | Bacteria | 5802 |
| 644 | Ga0495608_0031701 | 3300046511 | Bacteria | 3572 |
| 645 | Ga0495628_0010385 | 3300046516 | Bacteria | 7911 |
| 646 | Ga0495628_0138095 | 3300046516 | Bacteria | 1861 |
| 647 | Ga0495630_0071206 | 3300046517 | Bacteria | 2616 |
| 648 | Ga0495637_0057360 | 3300046520 | Bacteria | 1609 |
| 649 | Ga0495644_0001471 | 3300046523 | Bacteria | 9606 |
| 650 | Ga0495652_0054862 | 3300046529 | Bacteria | 3392 |
| 651 | Ga0495652_0066151 | 3300046529 | Bacteria | 3035 |
| 652 | Ga0495652_0105580 | 3300046529 | Bacteria | 2276 |
| 653 | Ga0495652_0127499 | 3300046529 | Bacteria | 2019 |
| 654 | Ga0495665_0040136 | 3300046531 | Bacteria | 2492 |
| 655 | Ga0495665_0051062 | 3300046531 | Bacteria | 2191 |
| 656 | Ga0495640_0037401 | 3300046533 | Bacteria | 3423 |
| 657 | Ga0495640_0045414 | 3300046533 | Bacteria | 3048 |
| 658 | Ga0495586_0024634 | 3300046535 | Bacteria | 3219 |
| 659 | Ga0495586_0043180 | 3300046535 | Bacteria | 2429 |
| 660 | Ga0495609_0041404 | 3300046538 | Bacteria | 2071 |
| 661 | Ga0495645_0054503 | 3300046543 | Bacteria | 2905 |
| 662 | Ga0495633_0005211 | 3300046558 | Bacteria | 8021 |
| 663 | Ga0495667_0003339 | 3300046559 | Bacteria | 10747 |
| 664 | Ga0495667_0057610 | 3300046559 | Bacteria | 2553 |
| 665 | Ga0495634_0038057 | 3300046642 | Bacteria | 3281 |
| 666 | Ga0495635_0021945 | 3300046663 | Bacteria | 4449 |
| 667 | Ga0495588_0019049 | 3300046674 | Bacteria | 3357 |
| 668 | Ga0495599_0018367 | 3300046678 | Bacteria | 4358 |
| 669 | Ga0495599_0066980 | 3300046678 | Bacteria | 2243 |
| 670 | Ga0495646_0008798 | 3300046680 | Bacteria | 6411 |
| 671 | Ga0495646_0017575 | 3300046680 | Bacteria | 4533 |
| 672 | Ga0495647_0006874 | 3300046681 | Bacteria | 3787 |
| 673 | Ga0495658_0015235 | 3300046683 | Bacteria | 3942 |
| 674 | Ga0495613_0048284 | 3300046689 | Bacteria | 3143 |
| 675 | Ga0495624_0086706 | 3300046690 | Bacteria | 1933 |
| 676 | Ga0495670_0002981 | 3300046691 | Bacteria | 8344 |
| 677 | Ga0495600_0017400 | 3300046809 | Bacteria | 4572 |
| 678 | Ga0495600_0035571 | 3300046809 | Bacteria | 3235 |
| 679 | Ga0495600_0122294 | 3300046809 | Bacteria | 1693 |
| 680 | Ga0495581_0005972 | 3300047315 | Bacteria | 7056 |
| 681 | Ga0495581_0062463 | 3300047315 | Bacteria | 2152 |
| 682 | Ga0495604_0030237 | 3300047317 | Bacteria | 4303 |
| 683 | Ga0495604_0046732 | 3300047317 | Bacteria | 3375 |
| 684 | Ga0495604_0104209 | 3300047317 | Bacteria | 2079 |
| 685 | Ga0495674_0035150 | 3300047319 | Bacteria | 4523 |
| 686 | Ga0495674_0079888 | 3300047319 | Bacteria | 2807 |
| 687 | Ga0495672_0003063 | 3300047320 | Bacteria | 14627 |
| 688 | Ga0495672_0045572 | 3300047320 | Bacteria | 2623 |
| 689 | Ga0495680_0020932 | 3300047322 | Bacteria | 5486 |
| 690 | Ga0495680_0042627 | 3300047322 | Bacteria | 3599 |
| 691 | Ga0495680_0056380 | 3300047322 | Bacteria | 3042 |
| 692 | Ga0495680_0075633 | 3300047322 | Bacteria | 2555 |
| 693 | Ga0495684_0002658 | 3300047471 | Bacteria | 14168 |
| 694 | Ga0495684_0056598 | 3300047471 | Bacteria | 2989 |
| 695 | Ga0495684_0078674 | 3300047471 | Bacteria | 2503 |
| 696 | Ga0495686_0000007 | 3300047472 | Bacteria | 732622 |
| 697 | Ga0495593_0040071 | 3300047673 | Bacteria | 2523 |
| 698 | Ga0495593_0055703 | 3300047673 | Bacteria | 2080 |
| 699 | Ga0495602_0139582 | 3300048088 | Bacteria | 1920 |
| 700 | Ga0495614_0014751 | 3300048089 | Bacteria | 3418 |
| 701 | Ga0496100_0001418 | 3300048903 | Bacteria | 11725 |
| 702 | Ga0496100_0014815 | 3300048903 | Bacteria | 4537 |
| 703 | Ga0496100_0081205 | 3300048903 | Bacteria | 2190 |
| 704 | Ga0496101_0051688 | 3300048904 | Bacteria | 2961 |
| 705 | Ga0496101_0183312 | 3300048904 | Bacteria | 1613 |
| 706 | Ga0496102_0000857 | 3300048905 | Bacteria | 29213 |
| 707 | Ga0496102_0041108 | 3300048905 | Bacteria | 4186 |
| 708 | Ga0496102_0098215 | 3300048905 | Bacteria | 2717 |
| 709 | Ga0496103_0001402 | 3300048906 | Bacteria | 16210 |
| 710 | Ga0496103_0005864 | 3300048906 | Bacteria | 7338 |
| 711 | Ga0496103_0057007 | 3300048906 | Bacteria | 2425 |
| 712 | Ga0496103_0075564 | 3300048906 | Bacteria | 2113 |
| 713 | Ga0496104_0046190 | 3300048907 | Bacteria | 4100 |
| 714 | Ga0496104_0155688 | 3300048907 | Bacteria | 2193 |
| 715 | Ga0496105_0021990 | 3300048908 | Bacteria | 5164 |
| 716 | Ga0496105_0060368 | 3300048908 | Bacteria | 3129 |
| 717 | Ga0496105_0073183 | 3300048908 | Bacteria | 2831 |
| 718 | Ga0496105_0185754 | 3300048908 | Bacteria | 1701 |
| 719 | Ga0496106_0001911 | 3300048909 | Bacteria | 15609 |
| 720 | Ga0496106_0004194 | 3300048909 | Bacteria | 10742 |
| 721 | Ga0496106_0033306 | 3300048909 | Bacteria | 3845 |
| 722 | Ga0496106_0078639 | 3300048909 | Bacteria | 2531 |
| 723 | Ga0496106_0111535 | 3300048909 | Bacteria | 2130 |
| 724 | Ga0496106_0124446 | 3300048909 | Bacteria | 2018 |
| 725 | Ga0496107_0001131 | 3300048910 | Bacteria | 16108 |
| 726 | Ga0496107_0002765 | 3300048910 | Bacteria | 11554 |
| 727 | Ga0496107_0021589 | 3300048910 | Bacteria | 4551 |
| 728 | Ga0496107_0119531 | 3300048910 | Bacteria | 1941 |
| 729 | Ga0496108_0003866 | 3300048911 | Bacteria | 12025 |
| 730 | Ga0496108_0043752 | 3300048911 | Bacteria | 3740 |
| 731 | Ga0496108_0082444 | 3300048911 | Bacteria | 2727 |
| 732 | Ga0496109_0005368 | 3300048912 | Bacteria | 10715 |
| 733 | Ga0496109_0280482 | 3300048912 | Bacteria | 1570 |
| 734 | Ga0496110_0023567 | 3300048913 | Bacteria | 5237 |
| 735 | Ga0496110_0026617 | 3300048913 | Bacteria | 4952 |
| 736 | Ga0496110_0065551 | 3300048913 | Bacteria | 3211 |
| 737 | Ga0496110_0212132 | 3300048913 | Bacteria | 1760 |
| 738 | Ga0496111_0014062 | 3300048914 | Bacteria | 5459 |
| 739 | Ga0496112_0004182 | 3300048915 | Bacteria | 12158 |
| 740 | Ga0496112_0012681 | 3300048915 | Bacteria | 7751 |
| 741 | Ga0496112_0046860 | 3300048915 | Bacteria | 4241 |
| 742 | Ga0496112_0136703 | 3300048915 | Bacteria | 2421 |
| 743 | Ga0496113_0013896 | 3300048916 | Bacteria | 5472 |
| 744 | Ga0496113_0035238 | 3300048916 | Bacteria | 3659 |
| 745 | Ga0496114_0004563 | 3300048917 | Bacteria | 10757 |
| 746 | Ga0496114_0019579 | 3300048917 | Bacteria | 5484 |
| 747 | Ga0496114_0052437 | 3300048917 | Bacteria | 3399 |
| 748 | Ga0496115_0001705 | 3300048918 | Bacteria | 15763 |
| 749 | Ga0496115_0001749 | 3300048918 | Bacteria | 15583 |
| 750 | Ga0496115_0003668 | 3300048918 | Bacteria | 11050 |
| 751 | Ga0496115_0030609 | 3300048918 | Bacteria | 4235 |
| 752 | Ga0496115_0086573 | 3300048918 | Bacteria | 2556 |
| 753 | Ga0496115_0234433 | 3300048918 | Bacteria | 1513 |
| 754 | Ga0496117_0072620 | 3300048920 | Bacteria | 2299 |
| 755 | Ga0496119_0000289 | 3300048922 | Bacteria | 70660 |
| 756 | Ga0496121_0001676 | 3300048924 | Bacteria | 36412 |
| 757 | Ga0496122_0002313 | 3300048925 | Bacteria | 27497 |
| 758 | Ga0496123_0001408 | 3300048926 | Bacteria | 33627 |
| 759 | Ga0501032_0000011 | 3300049569 | Bacteria | 198158 |
| 760 | Ga0501032_0001847 | 3300049569 | Bacteria | 16751 |
| 761 | Ga0501032_0011006 | 3300049569 | Bacteria | 6504 |
| 762 | Ga0501032_0013582 | 3300049569 | Bacteria | 5787 |
| 763 | Ga0501032_0083527 | 3300049569 | Bacteria | 2124 |
| 764 | Ga0501032_0087584 | 3300049569 | Bacteria | 2068 |
| 765 | Ga0501032_0116277 | 3300049569 | Bacteria | 1768 |
| 766 | Ga0501033_0000011 | 3300049570 | Bacteria | 259130 |
| 767 | Ga0501033_0007756 | 3300049570 | Bacteria | 8317 |
| 768 | Ga0501033_0029355 | 3300049570 | Bacteria | 4133 |
| 769 | Ga0501033_0046182 | 3300049570 | Bacteria | 3238 |
| 770 | Ga0501033_0115397 | 3300049570 | Bacteria | 1951 |
| 771 | Ga0501034_0000001 | 3300049571 | Bacteria | 2184493 |
| 772 | Ga0501034_0000171 | 3300049571 | Bacteria | 120801 |
| 773 | Ga0501034_0000211 | 3300049571 | Bacteria | 110858 |
| 774 | Ga0501034_0000391 | 3300049571 | Bacteria | 74631 |
| 775 | Ga0501034_0005441 | 3300049571 | Bacteria | 13914 |
| 776 | Ga0501034_0042214 | 3300049571 | Bacteria | 4617 |
| 777 | Ga0501034_0045163 | 3300049571 | Bacteria | 4452 |
| 778 | Ga0501034_0055154 | 3300049571 | Bacteria | 4000 |
| 779 | Ga0501034_0071345 | 3300049571 | Bacteria | 3483 |
| 780 | Ga0501034_0084550 | 3300049571 | Bacteria | 3175 |
| 781 | Ga0501034_0089856 | 3300049571 | Bacteria | 3069 |
| 782 | Ga0501034_0093880 | 3300049571 | Bacteria | 2997 |
| 783 | Ga0501034_0095958 | 3300049571 | Bacteria | 2961 |
| 784 | Ga0501034_0161604 | 3300049571 | Bacteria | 2210 |
| 785 | Ga0501034_0183249 | 3300049571 | Bacteria | 2058 |
| 786 | Ga0501036_0011376 | 3300049572 | Bacteria | 7364 |
| 787 | Ga0501036_0026696 | 3300049572 | Bacteria | 4878 |
| 788 | Ga0501036_0030447 | 3300049572 | Bacteria | 4558 |
| 789 | Ga0501036_0030820 | 3300049572 | Bacteria | 4532 |
| 790 | Ga0501036_0053157 | 3300049572 | Bacteria | 3431 |
| 791 | Ga0501036_0057170 | 3300049572 | Bacteria | 3304 |
| 792 | Ga0501037_0004808 | 3300049573 | Bacteria | 9818 |
| 793 | Ga0501037_0023203 | 3300049573 | Bacteria | 4588 |
| 794 | Ga0501037_0034647 | 3300049573 | Bacteria | 3724 |
| 795 | Ga0501037_0065072 | 3300049573 | Bacteria | 2656 |
| 796 | Ga0501038_0000009 | 3300049574 | Bacteria | 190794 |
| 797 | Ga0501038_0022074 | 3300049574 | Bacteria | 5707 |
| 798 | Ga0501038_0034931 | 3300049574 | Bacteria | 4418 |
| 799 | Ga0501039_0000243 | 3300049575 | Bacteria | 39697 |
| 800 | Ga0501039_0018425 | 3300049575 | Bacteria | 5358 |
| 801 | Ga0501039_0050420 | 3300049575 | Bacteria | 3220 |
| 802 | Ga0501039_0066057 | 3300049575 | Bacteria | 2807 |
| 803 | Ga0501039_0137131 | 3300049575 | Bacteria | 1921 |
| 804 | Ga0501042_0078125 | 3300049578 | Bacteria | 2370 |
| 805 | Ga0501043_0015700 | 3300049579 | Bacteria | 5937 |
| 806 | Ga0501043_0024066 | 3300049579 | Bacteria | 4778 |
| 807 | Ga0501043_0025652 | 3300049579 | Bacteria | 4624 |
| 808 | Ga0501043_0046828 | 3300049579 | Bacteria | 3400 |
| 809 | Ga0501043_0048152 | 3300049579 | Bacteria | 3351 |
| 810 | Ga0501043_0099831 | 3300049579 | Bacteria | 2282 |
| 811 | Ga0501043_0129997 | 3300049579 | Bacteria | 1973 |
| 812 | Ga0501046_0022137 | 3300049580 | Bacteria | 5238 |
| 813 | Ga0501046_0025627 | 3300049580 | Bacteria | 4825 |
| 814 | Ga0501046_0044209 | 3300049580 | Bacteria | 3543 |
| 815 | Ga0501047_0000218 | 3300049581 | Bacteria | 68952 |
| 816 | Ga0501047_0000719 | 3300049581 | Bacteria | 34423 |
| 817 | Ga0501047_0005238 | 3300049581 | Bacteria | 12176 |
| 818 | Ga0501047_0007054 | 3300049581 | Bacteria | 10551 |
| 819 | Ga0501047_0011235 | 3300049581 | Bacteria | 8474 |
| 820 | Ga0501047_0053286 | 3300049581 | Bacteria | 3911 |
| 821 | Ga0501047_0085022 | 3300049581 | Bacteria | 3040 |
| 822 | Ga0501047_0164519 | 3300049581 | Bacteria | 2089 |
| 823 | Ga0501048_0000762 | 3300049582 | Bacteria | 23616 |
| 824 | Ga0501067_0000058 | 3300049583 | Bacteria | 64397 |
| 825 | Ga0501067_0011018 | 3300049583 | Bacteria | 5005 |
| 826 | Ga0501067_0077123 | 3300049583 | Bacteria | 1846 |
| 827 | Ga0501068_0015380 | 3300049584 | Bacteria | 4392 |
| 828 | Ga0501068_0022741 | 3300049584 | Bacteria | 3669 |
| 829 | Ga0501070_0011908 | 3300049586 | Bacteria | 7346 |
| 830 | Ga0501070_0042124 | 3300049586 | Bacteria | 3802 |
| 831 | Ga0501070_0147020 | 3300049586 | Bacteria | 1945 |
| 832 | Ga0501071_0014032 | 3300049587 | Bacteria | 5473 |
| 833 | Ga0501071_0045045 | 3300049587 | Bacteria | 3166 |
| 834 | Ga0501072_0126151 | 3300049588 | Bacteria | 2039 |
| 835 | Ga0501073_0000154 | 3300049589 | Bacteria | 45306 |
| 836 | Ga0501073_0016647 | 3300049589 | Bacteria | 5327 |
| 837 | Ga0501073_0103208 | 3300049589 | Bacteria | 1980 |
| 838 | Ga0501074_0006835 | 3300049590 | Bacteria | 8244 |
| 839 | Ga0501074_0053607 | 3300049590 | Bacteria | 2908 |
| 840 | Ga0501077_0000148 | 3300049593 | Bacteria | 38929 |
| 841 | Ga0501079_0033063 | 3300049741 | Bacteria | 3977 |
| 842 | Ga0501080_0000028 | 3300049742 | Bacteria | 88948 |
| 843 | Ga0501080_0000489 | 3300049742 | Bacteria | 30879 |
| 844 | Ga0501080_0004383 | 3300049742 | Bacteria | 12535 |
| 845 | Ga0501080_0024037 | 3300049742 | Bacteria | 5649 |
| 846 | Ga0501080_0075222 | 3300049742 | Bacteria | 3141 |
| 847 | Ga0501080_0085988 | 3300049742 | Bacteria | 2921 |
| 848 | Ga0501080_0100781 | 3300049742 | Bacteria | 2679 |
| 849 | Ga0501081_0065853 | 3300049743 | Bacteria | 2519 |
| 850 | Ga0501083_0001945 | 3300049744 | Bacteria | 14214 |
| 851 | Ga0501083_0018125 | 3300049744 | Bacteria | 4907 |
| 852 | Ga0501083_0053032 | 3300049744 | Bacteria | 2723 |
| 853 | Ga0501083_0077574 | 3300049744 | Bacteria | 2204 |
| 854 | Ga0501083_0113966 | 3300049744 | Bacteria | 1776 |
| 855 | Ga0501035_0000020 | 3300049822 | Bacteria | 221605 |
| 856 | Ga0501035_0026411 | 3300049822 | Bacteria | 5312 |
| 857 | Ga0501035_0035310 | 3300049822 | Bacteria | 4537 |
| 858 | Ga0501035_0050714 | 3300049822 | Bacteria | 3718 |
| 859 | Ga0501035_0065534 | 3300049822 | Bacteria | 3225 |
| 860 | Ga0501035_0243221 | 3300049822 | Bacteria | 1530 |
| 861 | Ga0501044_0000007 | 3300049823 | Bacteria | 283429 |
| 862 | Ga0501044_0000177 | 3300049823 | Bacteria | 78892 |
| 863 | Ga0501044_0000822 | 3300049823 | Bacteria | 37410 |
| 864 | Ga0501044_0000931 | 3300049823 | Bacteria | 35180 |
| 865 | Ga0501044_0001454 | 3300049823 | Bacteria | 27833 |
| 866 | Ga0501044_0026378 | 3300049823 | Bacteria | 6150 |
| 867 | Ga0501044_0034897 | 3300049823 | Bacteria | 5270 |
| 868 | Ga0501044_0054761 | 3300049823 | Bacteria | 4099 |
| 869 | Ga0501044_0068612 | 3300049823 | Bacteria | 3611 |
| 870 | Ga0501044_0069002 | 3300049823 | Bacteria | 3600 |
| 871 | Ga0501044_0107099 | 3300049823 | Bacteria | 2807 |
| 872 | Ga0501045_0000052 | 3300049824 | Bacteria | 51519 |
| 873 | Ga0501045_0009778 | 3300049824 | Bacteria | 6708 |
| 874 | nmdc:mga0yw44_78231_c1 | 3300050492 | Bacteria | 2068 |
| 875 | nmdc:mga06z11_3604_c1 | 3300050494 | Bacteria | 6005 |
| 876 | nmdc:mga04h51_376_c1 | 3300050495 | Bacteria | 10902 |
| 877 | nmdc:mga05p37_136517_c1 | 3300050507 | Bacteria | 3007 |
| 878 | nmdc:mga05p37_96871_c1 | 3300050507 | Bacteria | 3635 |
| 879 | nmdc:mga05p37_9895_c1 | 3300050507 | Bacteria | 11314 |
| 880 | nmdc:mga09592_1920_c1 | 3300050508 | Bacteria | 16707 |
| 881 | nmdc:mga0qj67_170_c1 | 3300050509 | Bacteria | 43684 |
| 882 | nmdc:mga06r32_5477_c1 | 3300050510 | Bacteria | 11430 |
| 883 | nmdc:mga08y16_3365_c1 | 3300050511 | Bacteria | 16572 |
| 884 | nmdc:mga08y16_77112_c1 | 3300050511 | Bacteria | 3475 |
| 885 | nmdc:mga0n895_148235_c1 | 3300050512 | Bacteria | 2376 |
| 886 | nmdc:mga0n895_6097_c1 | 3300050512 | Bacteria | 10177 |
| 887 | nmdc:mga0n895_62267_c1 | 3300050512 | Bacteria | 3687 |
| 888 | nmdc:mga0n895_79771_c1 | 3300050512 | Bacteria | 3260 |
| 889 | nmdc:mga0n895_80865_c1 | 3300050512 | Bacteria | 3238 |
| 890 | nmdc:mga0rr50_52137_c1 | 3300050513 | Bacteria | 3038 |
| 891 | nmdc:mga08x19_14_c1 | 3300050514 | Bacteria | 365567 |
| 892 | nmdc:mga08x19_29622_c1 | 3300050514 | Bacteria | 3434 |
| 893 | nmdc:mga0a205_2212_c1 | 3300050515 | Bacteria | 6635 |
| 894 | Ga0495601_0001731 | 3300053077 | Bacteria | 12068 |
| 895 | Ga0495601_0002237 | 3300053077 | Bacteria | 10901 |
| 896 | Ga0495601_0008863 | 3300053077 | Bacteria | 5937 |
| 897 | Ga0495601_0026287 | 3300053077 | Bacteria | 3593 |
| 898 | Ga0495601_0112276 | 3300053077 | Bacteria | 1765 |
| 899 | Ga0495612_0000795 | 3300053078 | Bacteria | 12832 |
| 900 | Ga0495612_0043062 | 3300053078 | Bacteria | 1843 |
| 901 | Ga0500635_0011818 | 3300053080 | Bacteria | 2491 |
| 902 | Ga0495595_0003051 | 3300053084 | Bacteria | 6620 |
| 903 | Ga0495595_0003260 | 3300053084 | Bacteria | 6448 |
| 904 | Ga0495595_0026835 | 3300053084 | Bacteria | 2561 |
| 905 | Ga0495619_0000043 | 3300053085 | Bacteria | 109865 |
| 906 | Ga0495619_0003586 | 3300053085 | Bacteria | 10006 |
| 907 | Ga0495619_0010551 | 3300053085 | Bacteria | 5812 |
| 908 | Ga0495619_0012705 | 3300053085 | Bacteria | 5300 |
| 909 | Ga0495619_0019129 | 3300053085 | Bacteria | 4352 |
| 910 | Ga0495619_0065301 | 3300053085 | Bacteria | 2428 |
| 911 | Ga0500643_000298 | 3300053087 | Bacteria | 41754 |
| 912 | Ga0500643_001914 | 3300053087 | Bacteria | 11311 |
| 913 | Ga0500643_004945 | 3300053087 | Bacteria | 5860 |
| 914 | Ga0500643_025178 | 3300053087 | Bacteria | 1879 |
| 915 | Ga0500646_0006610 | 3300053090 | Bacteria | 2951 |
| 916 | Ga0500641_0000515 | 3300053096 | Bacteria | 13894 |
| 917 | Ga0500641_0002953 | 3300053096 | Bacteria | 6019 |
| 918 | Ga0500641_0008875 | 3300053096 | Bacteria | 3602 |
| 919 | Ga0500556_0000009 | 3300053104 | Bacteria | 288111 |
| 920 | Ga0500556_0002346 | 3300053104 | Bacteria | 6163 |
| 921 | Ga0500556_0011251 | 3300053104 | Bacteria | 2647 |
| 922 | Ga0500593_000068 | 3300053117 | Bacteria | 38366 |
| 923 | Ga0500595_000002 | 3300053119 | Bacteria | 1074388 |
| 924 | Ga0500608_000278 | 3300053122 | Bacteria | 19784 |
| 925 | Ga0500652_019680 | 3300053131 | Bacteria | 2512 |
| 926 | Ga0500616_0000002 | 3300053153 | Bacteria | 1611257 |
| 927 | Ga0500616_0021501 | 3300053153 | Bacteria | 3616 |
| 928 | Ga0500616_0045860 | 3300053153 | Bacteria | 2326 |
| 929 | Ga0500622_0014531 | 3300053156 | Bacteria | 4226 |
| 930 | Ga0500636_0014409 | 3300053177 | Bacteria | 4650 |
| 931 | Ga0500636_0069800 | 3300053177 | Bacteria | 2039 |
| 932 | Ga0500645_000410 | 3300053730 | Bacteria | 30009 |
| 933 | Ga0500645_000851 | 3300053730 | Bacteria | 17875 |
| 934 | Ga0500645_003590 | 3300053730 | Bacteria | 6227 |
| 935 | Ga0501084_0002576 | 3300054114 | Bacteria | 14608 |
| 936 | Ga0501082_0005691 | 3300060353 | Bacteria | 10812 |
| 937 | Ga0501082_0006366 | 3300060353 | Bacteria | 10246 |
| 938 | Ga0501082_0034806 | 3300060353 | Bacteria | 4341 |
| 939 | Ga0501082_0085475 | 3300060353 | Bacteria | 2721 |
| 940 | Ga0501082_0096172 | 3300060353 | Bacteria | 2560 |
| 941 | Ga0530510_0026181 | 3300061734 | Bacteria | 4173 |
| 942 | Ga0530510_0048393 | 3300061734 | Bacteria | 3073 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048907 | Ga0496104_0155688 | Ga0496104_0155688_940_2154 | 399 |
| 2 | iso_pu_bacteria | 2924718760 | 2924726378 | 422 |
| 3 | 3300039437 | Ga0436365_0676365 | Ga0436365_0676365_19_1323 | 430 |
| 4 | 3300060353 | Ga0501082_0034806 | Ga0501082_0034806_2994_4292 | 430 |
| 5 | 3300046520 | Ga0495637_0057360 | Ga0495637_0057360_228_1523 | 431 |
| 6 | 3300049822 | Ga0501035_0243221 | Ga0501035_0243221_10_1320 | 431 |
| 7 | 3300013306 | Ga0163162_10194359 | Ga0163162_101943592 | 435 |
| 8 | 3300014326 | Ga0157380_10226933 | Ga0157380_102269331 | 441 |
| 9 | 3300005844 | Ga0068862_100026829 | Ga0068862_1000268293 | 451 |
| 10 | 3300005347 | Ga0070668_100022013 | Ga0070668_1000220134 | 453 |
| 11 | 3300005459 | Ga0068867_100021411 | Ga0068867_1000214112 | 453 |
| 12 | 3300005843 | Ga0068860_100123487 | Ga0068860_1001234872 | 453 |
| 13 | 3300009176 | Ga0105242_10075407 | Ga0105242_100754072 | 453 |
| 14 | 3300009177 | Ga0105248_10104103 | Ga0105248_101041032 | 453 |
| 15 | 3300009553 | Ga0105249_10239728 | Ga0105249_102397282 | 453 |
| 16 | 3300017792 | Ga0163161_10147380 | Ga0163161_101473801 | 453 |
| 17 | 3300025934 | Ga0207686_10078427 | Ga0207686_100784272 | 453 |
| 18 | 3300026089 | Ga0207648_10032101 | Ga0207648_100321013 | 453 |
| 19 | 3300049571 | Ga0501034_0055154 | Ga0501034_0055154_2338_3786 | 453 |
| 20 | 3300005535 | Ga0070684_100070557 | Ga0070684_1000705572 | 454 |
| 21 | 3300011119 | Ga0105246_10107844 | Ga0105246_101078442 | 454 |
| 22 | 3300048908 | Ga0496105_0185754 | Ga0496105_0185754_10_1392 | 454 |
| 23 | 3300048909 | Ga0496106_0124446 | Ga0496106_0124446_641_2005 | 454 |
| 24 | 3300044712 | Ga0453684_0220580 | Ga0453684_0220580_173_1621 | 461 |
| 25 | 3300005327 | Ga0070658_10043077 | Ga0070658_100430772 | 463 |
| 26 | 3300005329 | Ga0070683_100036634 | Ga0070683_1000366344 | 463 |
| 27 | 3300005564 | Ga0070664_100031759 | Ga0070664_1000317592 | 463 |
| 28 | 3300005618 | Ga0068864_100046583 | Ga0068864_1000465832 | 463 |
| 29 | 3300013307 | Ga0157372_10025943 | Ga0157372_100259434 | 463 |
| 30 | 3300025904 | Ga0207647_10129576 | Ga0207647_101295761 | 463 |
| 31 | 3300025909 | Ga0207705_10023982 | Ga0207705_100239824 | 463 |
| 32 | 3300025932 | Ga0207690_10038328 | Ga0207690_100383282 | 463 |
| 33 | 3300025944 | Ga0207661_10024363 | Ga0207661_100243632 | 463 |
| 34 | 3300025945 | Ga0207679_10008326 | Ga0207679_100083262 | 463 |
| 35 | 3300048911 | Ga0496108_0043752 | Ga0496108_0043752_133_1593 | 463 |
| 36 | 3300048915 | Ga0496112_0012681 | Ga0496112_0012681_666_2126 | 463 |
| 37 | 3300049569 | Ga0501032_0011006 | Ga0501032_0011006_335_1837 | 464 |
| 38 | 3300046533 | Ga0495640_0045414 | Ga0495640_0045414_68_1522 | 465 |
| 39 | 3300047317 | Ga0495604_0104209 | Ga0495604_0104209_559_2013 | 465 |
| 40 | 3300047319 | Ga0495674_0035150 | Ga0495674_0035150_2453_3907 | 465 |
| 41 | 3300005329 | Ga0070683_100044223 | Ga0070683_1000442234 | 466 |
| 42 | 3300009098 | Ga0105245_10022284 | Ga0105245_100222845 | 466 |
| 43 | 3300009176 | Ga0105242_10040800 | Ga0105242_100408002 | 466 |
| 44 | 3300025944 | Ga0207661_10118426 | Ga0207661_101184262 | 466 |
| 45 | 3300035086 | Ga0373934_0015852 | Ga0373934_0015852_1442_2842 | 466 |
| 46 | 3300035116 | Ga0373945_0032939 | Ga0373945_0032939_397_1797 | 466 |
| 47 | 3300048906 | Ga0496103_0075564 | Ga0496103_0075564_654_2054 | 466 |
| 48 | 3300048918 | Ga0496115_0234433 | Ga0496115_0234433_12_1412 | 466 |
| 49 | 3300005341 | Ga0070691_10002362 | Ga0070691_100023622 | 467 |
| 50 | 3300005471 | Ga0070698_100000560 | Ga0070698_10000056015 | 467 |
| 51 | 3300031238 | Ga0265332_10004885 | Ga0265332_100048853 | 467 |
| 52 | 3300041406 | Ga0439439_0006575 | Ga0439439_0006575_408_1829 | 467 |
| 53 | 3300048910 | Ga0496107_0119531 | Ga0496107_0119531_374_1792 | 467 |
| 54 | 3300049569 | Ga0501032_0013582 | Ga0501032_0013582_2623_4128 | 467 |
| 55 | 3300049570 | Ga0501033_0000011 | Ga0501033_0000011_94314_95819 | 467 |
| 56 | 3300049571 | Ga0501034_0000171 | Ga0501034_0000171_7295_8800 | 467 |
| 57 | 3300049572 | Ga0501036_0011376 | Ga0501036_0011376_454_1959 | 467 |
| 58 | 3300049573 | Ga0501037_0004808 | Ga0501037_0004808_352_1857 | 467 |
| 59 | 3300049575 | Ga0501039_0066057 | Ga0501039_0066057_477_1982 | 467 |
| 60 | 3300049579 | Ga0501043_0015700 | Ga0501043_0015700_2659_4164 | 467 |
| 61 | 3300049823 | Ga0501044_0000177 | Ga0501044_0000177_38236_39741 | 467 |
| 62 | 3300049824 | Ga0501045_0000052 | Ga0501045_0000052_27678_29183 | 467 |
| 63 | 3300025909 | Ga0207705_10088026 | Ga0207705_100880262 | 468 |
| 64 | 3300037312 | Ga0395899_0000913 | Ga0395899_0000913_19986_21458 | 470 |
| 65 | 3300037418 | Ga0395900_0002396 | Ga0395900_0002396_9505_10977 | 470 |
| 66 | 3300037466 | Ga0395898_0000730 | Ga0395898_0000730_26872_28344 | 470 |
| 67 | 3300036401 | Ga0373937_0015230 | Ga0373937_0015230_2300_3766 | 471 |
| 68 | 3300005459 | Ga0068867_100061652 | Ga0068867_1000616522 | 472 |
| 69 | 3300048917 | Ga0496114_0004563 | Ga0496114_0004563_105_1523 | 472 |
| 70 | 3300049742 | Ga0501080_0075222 | Ga0501080_0075222_1270_2730 | 472 |
| 71 | 3300005293 | Ga0065715_10154420 | Ga0065715_101544201 | 473 |
| 72 | 3300005336 | Ga0070680_100006873 | Ga0070680_1000068735 | 473 |
| 73 | 3300005337 | Ga0070682_100005746 | Ga0070682_1000057463 | 473 |
| 74 | 3300005458 | Ga0070681_10025879 | Ga0070681_100258795 | 473 |
| 75 | 3300005530 | Ga0070679_100046442 | Ga0070679_1000464422 | 473 |
| 76 | 3300005539 | Ga0068853_100013478 | Ga0068853_1000134784 | 473 |
| 77 | 3300005547 | Ga0070693_100040290 | Ga0070693_1000402903 | 473 |
| 78 | 3300005564 | Ga0070664_100023848 | Ga0070664_1000238484 | 473 |
| 79 | 3300006871 | Ga0075434_100099923 | Ga0075434_1000999233 | 473 |
| 80 | 3300006914 | Ga0075436_100020494 | Ga0075436_1000204943 | 473 |
| 81 | 3300009098 | Ga0105245_10007297 | Ga0105245_1000729711 | 473 |
| 82 | 3300013102 | Ga0157371_10026845 | Ga0157371_100268452 | 473 |
| 83 | 3300013104 | Ga0157370_10004287 | Ga0157370_1000428716 | 473 |
| 84 | 3300013104 | Ga0157370_10092288 | Ga0157370_100922882 | 473 |
| 85 | 3300013307 | Ga0157372_10004429 | Ga0157372_100044294 | 473 |
| 86 | 3300025917 | Ga0207660_10043658 | Ga0207660_100436582 | 473 |
| 87 | 3300025921 | Ga0207652_10032953 | Ga0207652_100329532 | 473 |
| 88 | 3300025945 | Ga0207679_10017293 | Ga0207679_100172933 | 473 |
| 89 | 3300025949 | Ga0207667_10041705 | Ga0207667_100417053 | 473 |
| 90 | 3300025949 | Ga0207667_10115177 | Ga0207667_101151772 | 473 |
| 91 | 3300026116 | Ga0207674_10079124 | Ga0207674_100791242 | 473 |
| 92 | 3300031731 | Ga0307405_10085098 | Ga0307405_100850981 | 473 |
| 93 | 3300042005 | Ga0439448_0032448 | Ga0439448_0032448_175_1641 | 473 |
| 94 | 3300046529 | Ga0495652_0054862 | Ga0495652_0054862_546_2000 | 473 |
| 95 | 3300046543 | Ga0495645_0054503 | Ga0495645_0054503_812_2266 | 473 |
| 96 | 3300046678 | Ga0495599_0018367 | Ga0495599_0018367_1310_2764 | 473 |
| 97 | 3300050514 | nmdc:mga08x19_29622_c1 | nmdc:mga08x19_29622_c1_1584_3032 | 473 |
| 98 | 3300005327 | Ga0070658_10024663 | Ga0070658_100246632 | 475 |
| 99 | 3300005329 | Ga0070683_100137493 | Ga0070683_1001374932 | 475 |
| 100 | 3300005339 | Ga0070660_100005053 | Ga0070660_1000050535 | 475 |
| 101 | 3300005339 | Ga0070660_100014065 | Ga0070660_1000140653 | 475 |
| 102 | 3300005339 | Ga0070660_100063970 | Ga0070660_1000639703 | 475 |
| 103 | 3300005366 | Ga0070659_100022400 | Ga0070659_1000224003 | 475 |
| 104 | 3300005366 | Ga0070659_100036035 | Ga0070659_1000360353 | 475 |
| 105 | 3300005530 | Ga0070679_100004705 | Ga0070679_1000047053 | 475 |
| 106 | 3300005530 | Ga0070679_100011599 | Ga0070679_1000115998 | 475 |
| 107 | 3300005530 | Ga0070679_100058272 | Ga0070679_1000582723 | 475 |
| 108 | 3300005530 | Ga0070679_100092614 | Ga0070679_1000926143 | 475 |
| 109 | 3300005539 | Ga0068853_100024539 | Ga0068853_1000245394 | 475 |
| 110 | 3300005563 | Ga0068855_100001281 | Ga0068855_10000128126 | 475 |
| 111 | 3300005563 | Ga0068855_100006064 | Ga0068855_1000060647 | 475 |
| 112 | 3300005563 | Ga0068855_100109780 | Ga0068855_1001097802 | 475 |
| 113 | 3300005563 | Ga0068855_100188515 | Ga0068855_1001885153 | 475 |
| 114 | 3300005563 | Ga0068855_100272619 | Ga0068855_1002726192 | 475 |
| 115 | 3300005577 | Ga0068857_100033314 | Ga0068857_1000333144 | 475 |
| 116 | 3300005614 | Ga0068856_100003452 | Ga0068856_10000345211 | 475 |
| 117 | 3300005616 | Ga0068852_100001221 | Ga0068852_1000012213 | 475 |
| 118 | 3300005616 | Ga0068852_100078213 | Ga0068852_1000782132 | 475 |
| 119 | 3300005843 | Ga0068860_100137572 | Ga0068860_1001375722 | 475 |
| 120 | 3300013100 | Ga0157373_10000699 | Ga0157373_1000069927 | 475 |
| 121 | 3300013100 | Ga0157373_10021471 | Ga0157373_100214714 | 475 |
| 122 | 3300013100 | Ga0157373_10022131 | Ga0157373_100221316 | 475 |
| 123 | 3300013100 | Ga0157373_10025753 | Ga0157373_100257534 | 475 |
| 124 | 3300013102 | Ga0157371_10000451 | Ga0157371_1000045116 | 475 |
| 125 | 3300013102 | Ga0157371_10000725 | Ga0157371_1000072533 | 475 |
| 126 | 3300013102 | Ga0157371_10002225 | Ga0157371_100022254 | 475 |
| 127 | 3300013102 | Ga0157371_10010582 | Ga0157371_100105827 | 475 |
| 128 | 3300013102 | Ga0157371_10033114 | Ga0157371_100331144 | 475 |
| 129 | 3300013102 | Ga0157371_10098706 | Ga0157371_100987061 | 475 |
| 130 | 3300013104 | Ga0157370_10002951 | Ga0157370_1000295120 | 475 |
| 131 | 3300013104 | Ga0157370_10280971 | Ga0157370_102809711 | 475 |
| 132 | 3300013105 | Ga0157369_10006077 | Ga0157369_1000607712 | 475 |
| 133 | 3300013105 | Ga0157369_10015265 | Ga0157369_100152657 | 475 |
| 134 | 3300013105 | Ga0157369_10072248 | Ga0157369_100722483 | 475 |
| 135 | 3300013307 | Ga0157372_10010976 | Ga0157372_100109769 | 475 |
| 136 | 3300013307 | Ga0157372_10015970 | Ga0157372_100159707 | 475 |
| 137 | 3300013307 | Ga0157372_10023648 | Ga0157372_100236482 | 475 |
| 138 | 3300013307 | Ga0157372_10042371 | Ga0157372_100423715 | 475 |
| 139 | 3300013307 | Ga0157372_10082719 | Ga0157372_100827192 | 475 |
| 140 | 3300013307 | Ga0157372_10111837 | Ga0157372_101118372 | 475 |
| 141 | 3300025909 | Ga0207705_10014114 | Ga0207705_100141142 | 475 |
| 142 | 3300025917 | Ga0207660_10028719 | Ga0207660_100287191 | 475 |
| 143 | 3300025917 | Ga0207660_10059999 | Ga0207660_100599993 | 475 |
| 144 | 3300025919 | Ga0207657_10002202 | Ga0207657_1000220213 | 475 |
| 145 | 3300025919 | Ga0207657_10028202 | Ga0207657_100282026 | 475 |
| 146 | 3300025919 | Ga0207657_10081124 | Ga0207657_100811243 | 475 |
| 147 | 3300025921 | Ga0207652_10000159 | Ga0207652_100001592 | 475 |
| 148 | 3300025921 | Ga0207652_10000819 | Ga0207652_1000081917 | 475 |
| 149 | 3300025921 | Ga0207652_10003248 | Ga0207652_100032483 | 475 |
| 150 | 3300025921 | Ga0207652_10070953 | Ga0207652_100709533 | 475 |
| 151 | 3300025921 | Ga0207652_10097116 | Ga0207652_100971162 | 475 |
| 152 | 3300025925 | Ga0207650_10003910 | Ga0207650_100039105 | 475 |
| 153 | 3300025932 | Ga0207690_10043012 | Ga0207690_100430122 | 475 |
| 154 | 3300025949 | Ga0207667_10000697 | Ga0207667_1000069733 | 475 |
| 155 | 3300025949 | Ga0207667_10039772 | Ga0207667_100397725 | 475 |
| 156 | 3300025949 | Ga0207667_10284192 | Ga0207667_102841922 | 475 |
| 157 | 3300026067 | Ga0207678_10047670 | Ga0207678_100476704 | 475 |
| 158 | 3300026078 | Ga0207702_10033401 | Ga0207702_100334012 | 475 |
| 159 | 3300026095 | Ga0207676_10244276 | Ga0207676_102442761 | 475 |
| 160 | 3300026116 | Ga0207674_10029820 | Ga0207674_100298203 | 475 |
| 161 | 3300037312 | Ga0395899_0008998 | Ga0395899_0008998_1250_2722 | 475 |
| 162 | 3300037312 | Ga0395899_0015289 | Ga0395899_0015289_2203_3675 | 475 |
| 163 | 3300037312 | Ga0395899_0027856 | Ga0395899_0027856_1244_2716 | 475 |
| 164 | 3300037418 | Ga0395900_0003116 | Ga0395900_0003116_11802_13274 | 475 |
| 165 | 3300037418 | Ga0395900_0008085 | Ga0395900_0008085_3173_4645 | 475 |
| 166 | 3300037466 | Ga0395898_0023966 | Ga0395898_0023966_1759_3231 | 475 |
| 167 | 3300037466 | Ga0395898_0029520 | Ga0395898_0029520_2644_4092 | 475 |
| 168 | 3300037471 | Ga0395905_0008421 | Ga0395905_0008421_3319_4791 | 475 |
| 169 | 3300038443 | Ga0395901_0002140 | Ga0395901_0002140_10728_12200 | 475 |
| 170 | 3300038443 | Ga0395901_0044442 | Ga0395901_0044442_933_2405 | 475 |
| 171 | 3300038443 | Ga0395901_0049828 | Ga0395901_0049828_1679_3151 | 475 |
| 172 | 3300038443 | Ga0395901_0053699 | Ga0395901_0053699_1322_2794 | 475 |
| 173 | 3300005290 | Ga0065712_10088883 | Ga0065712_100888832 | 477 |
| 174 | 3300005331 | Ga0070670_100073114 | Ga0070670_1000731142 | 477 |
| 175 | 3300005340 | Ga0070689_100017219 | Ga0070689_1000172196 | 477 |
| 176 | 3300005353 | Ga0070669_100000866 | Ga0070669_1000008666 | 477 |
| 177 | 3300005354 | Ga0070675_100030722 | Ga0070675_1000307222 | 477 |
| 178 | 3300005355 | Ga0070671_100015170 | Ga0070671_1000151706 | 477 |
| 179 | 3300005364 | Ga0070673_100023201 | Ga0070673_1000232014 | 477 |
| 180 | 3300005466 | Ga0070685_10012192 | Ga0070685_100121921 | 477 |
| 181 | 3300005535 | Ga0070684_100009822 | Ga0070684_1000098222 | 477 |
| 182 | 3300005543 | Ga0070672_100035461 | Ga0070672_1000354612 | 477 |
| 183 | 3300005577 | Ga0068857_100105596 | Ga0068857_1001055962 | 477 |
| 184 | 3300005617 | Ga0068859_100002321 | Ga0068859_1000023212 | 477 |
| 185 | 3300006028 | Ga0070717_10089870 | Ga0070717_100898702 | 477 |
| 186 | 3300006931 | Ga0097620_100002321 | Ga0097620_1000023212 | 477 |
| 187 | 3300013296 | Ga0157374_10138796 | Ga0157374_101387962 | 477 |
| 188 | 3300013308 | Ga0157375_10020942 | Ga0157375_100209426 | 477 |
| 189 | 3300025918 | Ga0207662_10005820 | Ga0207662_100058202 | 477 |
| 190 | 3300025926 | Ga0207659_10002782 | Ga0207659_100027822 | 477 |
| 191 | 3300025936 | Ga0207670_10017591 | Ga0207670_100175915 | 477 |
| 192 | 3300025940 | Ga0207691_10023625 | Ga0207691_100236254 | 477 |
| 193 | 3300025960 | Ga0207651_10127362 | Ga0207651_101273622 | 477 |
| 194 | 3300026116 | Ga0207674_10008053 | Ga0207674_1000805311 | 477 |
| 195 | 3300031852 | Ga0307410_10077889 | Ga0307410_100778892 | 477 |
| 196 | 3300031995 | Ga0307409_100044432 | Ga0307409_1000444322 | 477 |
| 197 | 3300032002 | Ga0307416_100021418 | Ga0307416_1000214183 | 477 |
| 198 | 3300032126 | Ga0307415_100042778 | Ga0307415_1000427782 | 477 |
| 199 | 3300039437 | Ga0436365_0459838 | Ga0436365_0459838_168_1628 | 477 |
| 200 | 3300048908 | Ga0496105_0060368 | Ga0496105_0060368_184_1644 | 477 |
| 201 | 3300048909 | Ga0496106_0111535 | Ga0496106_0111535_45_1505 | 477 |
| 202 | 3300048915 | Ga0496112_0136703 | Ga0496112_0136703_654_2114 | 477 |
| 203 | 3300049742 | Ga0501080_0024037 | Ga0501080_0024037_4011_5495 | 477 |
| 204 | 3300049744 | Ga0501083_0001945 | Ga0501083_0001945_10025_11509 | 477 |
| 205 | 3300031241 | Ga0265325_10028145 | Ga0265325_100281452 | 478 |
| 206 | 3300049571 | Ga0501034_0000211 | Ga0501034_0000211_550_1986 | 478 |
| 207 | iso_pu_bacteria | 2522572158 | 2523102476 | 478 |
| 208 | 3300005455 | Ga0070663_100011143 | Ga0070663_1000111434 | 479 |
| 209 | 3300005617 | Ga0068859_100224909 | Ga0068859_1002249092 | 479 |
| 210 | 3300006358 | Ga0068871_100036365 | Ga0068871_1000363652 | 479 |
| 211 | 3300006931 | Ga0097620_100224917 | Ga0097620_1002249172 | 479 |
| 212 | 3300009093 | Ga0105240_10000938 | Ga0105240_1000093820 | 479 |
| 213 | 3300009177 | Ga0105248_10000635 | Ga0105248_1000063527 | 479 |
| 214 | 3300009551 | Ga0105238_10000739 | Ga0105238_100007397 | 479 |
| 215 | 3300010375 | Ga0105239_10001295 | Ga0105239_100012958 | 479 |
| 216 | 3300013296 | Ga0157374_10003001 | Ga0157374_100030015 | 479 |
| 217 | 3300025911 | Ga0207654_10003477 | Ga0207654_1000347711 | 479 |
| 218 | 3300025913 | Ga0207695_10000086 | Ga0207695_1000008632 | 479 |
| 219 | 3300025924 | Ga0207694_10001748 | Ga0207694_1000174814 | 479 |
| 220 | 3300025941 | Ga0207711_10002506 | Ga0207711_100025066 | 479 |
| 221 | 3300044842 | Ga0466957_0000161 | Ga0466957_0000161_18926_20404 | 479 |
| 222 | 3300049579 | Ga0501043_0046828 | Ga0501043_0046828_1739_3208 | 479 |
| 223 | iso_pu_bacteria | 2643221547 | 2643756570 | 481 |
| 224 | 3300007788 | Ga0099795_10008200 | Ga0099795_100082002 | 482 |
| 225 | 3300039437 | Ga0436365_1653706 | Ga0436365_1653706_2441_3889 | 482 |
| 226 | 3300049569 | Ga0501032_0000011 | Ga0501032_0000011_161453_162904 | 482 |
| 227 | 3300049571 | Ga0501034_0000001 | Ga0501034_0000001_1497472_1498923 | 482 |
| 228 | 3300049571 | Ga0501034_0071345 | Ga0501034_0071345_374_1825 | 482 |
| 229 | 3300049575 | Ga0501039_0000243 | Ga0501039_0000243_3467_4918 | 482 |
| 230 | 3300005518 | Ga0070699_100003377 | Ga0070699_1000033775 | 483 |
| 231 | 3300005563 | Ga0068855_100157921 | Ga0068855_1001579212 | 483 |
| 232 | 3300031240 | Ga0265320_10004008 | Ga0265320_100040088 | 483 |
| 233 | 3300038443 | Ga0395901_0030404 | Ga0395901_0030404_786_2243 | 483 |
| 234 | 3300039437 | Ga0436365_0883229 | Ga0436365_0883229_165_1619 | 483 |
| 235 | 3300049571 | Ga0501034_0093880 | Ga0501034_0093880_1147_2607 | 483 |
| 236 | 3300049574 | Ga0501038_0000009 | Ga0501038_0000009_108156_109610 | 483 |
| 237 | 3300003911 | JGI25405J52794_10005801 | JGI25405J52794_100058012 | 484 |
| 238 | 3300005340 | Ga0070689_100046718 | Ga0070689_1000467182 | 484 |
| 239 | 3300005437 | Ga0070710_10007147 | Ga0070710_100071472 | 484 |
| 240 | 3300005439 | Ga0070711_100058618 | Ga0070711_1000586182 | 484 |
| 241 | 3300005467 | Ga0070706_100125858 | Ga0070706_1001258582 | 484 |
| 242 | 3300005937 | Ga0081455_10003187 | Ga0081455_1000318722 | 484 |
| 243 | 3300006028 | Ga0070717_10016597 | Ga0070717_100165974 | 484 |
| 244 | 3300006163 | Ga0070715_10005429 | Ga0070715_100054292 | 484 |
| 245 | 3300025898 | Ga0207692_10034918 | Ga0207692_100349182 | 484 |
| 246 | 3300025905 | Ga0207685_10002459 | Ga0207685_100024591 | 484 |
| 247 | 3300025916 | Ga0207663_10062764 | Ga0207663_100627642 | 484 |
| 248 | 3300025928 | Ga0207700_10010746 | Ga0207700_100107465 | 484 |
| 249 | 3300025929 | Ga0207664_10004658 | Ga0207664_100046584 | 484 |
| 250 | 3300025939 | Ga0207665_10021032 | Ga0207665_100210323 | 484 |
| 251 | 3300028800 | Ga0265338_10032973 | Ga0265338_100329734 | 484 |
| 252 | 3300031241 | Ga0265325_10008799 | Ga0265325_100087993 | 484 |
| 253 | 3300031249 | Ga0265339_10032395 | Ga0265339_100323951 | 484 |
| 254 | 3300031595 | Ga0265313_10008202 | Ga0265313_100082025 | 484 |
| 255 | 3300037466 | Ga0395898_0040919 | Ga0395898_0040919_3102_4562 | 484 |
| 256 | 3300039447 | Ga0436361_0846399 | Ga0436361_0846399_3282_4736 | 484 |
| 257 | 3300048924 | Ga0496121_0001676 | Ga0496121_0001676_23485_25014 | 484 |
| 258 | 3300049569 | Ga0501032_0083527 | Ga0501032_0083527_249_1766 | 484 |
| 259 | 3300049570 | Ga0501033_0029355 | Ga0501033_0029355_506_1969 | 484 |
| 260 | 3300049570 | Ga0501033_0115397 | Ga0501033_0115397_185_1714 | 484 |
| 261 | 3300049571 | Ga0501034_0161604 | Ga0501034_0161604_460_1923 | 484 |
| 262 | 3300049573 | Ga0501037_0065072 | Ga0501037_0065072_672_2135 | 484 |
| 263 | 3300049574 | Ga0501038_0022074 | Ga0501038_0022074_3711_5174 | 484 |
| 264 | 3300049575 | Ga0501039_0137131 | Ga0501039_0137131_172_1635 | 484 |
| 265 | 3300049583 | Ga0501067_0011018 | Ga0501067_0011018_375_1835 | 484 |
| 266 | 3300049586 | Ga0501070_0147020 | Ga0501070_0147020_461_1924 | 484 |
| 267 | 3300049587 | Ga0501071_0045045 | Ga0501071_0045045_1144_2622 | 484 |
| 268 | 3300049588 | Ga0501072_0126151 | Ga0501072_0126151_409_1887 | 484 |
| 269 | 3300049590 | Ga0501074_0053607 | Ga0501074_0053607_288_1751 | 484 |
| 270 | 3300049742 | Ga0501080_0085988 | Ga0501080_0085988_925_2388 | 484 |
| 271 | 3300049742 | Ga0501080_0100781 | Ga0501080_0100781_196_1674 | 484 |
| 272 | 3300053077 | Ga0495601_0026287 | Ga0495601_0026287_1004_2479 | 484 |
| 273 | 3300053084 | Ga0495595_0003260 | Ga0495595_0003260_2038_3513 | 484 |
| 274 | 3300053085 | Ga0495619_0012705 | Ga0495619_0012705_2936_4411 | 484 |
| 275 | 3300054114 | Ga0501084_0002576 | Ga0501084_0002576_13076_14554 | 484 |
| 276 | 3300060353 | Ga0501082_0006366 | Ga0501082_0006366_5302_6780 | 484 |
| 277 | 3300061734 | Ga0530510_0048393 | Ga0530510_0048393_1539_3017 | 484 |
| 278 | iso_pu_bacteria | 2508501114 | 2509078795 | 484 |
| 279 | iso_pu_bacteria | 2523231067 | 2523468262 | 484 |
| 280 | iso_pu_bacteria | 2595698237 | 2596371562 | 484 |
| 281 | iso_pu_bacteria | 2643221629 | 2644166055 | 484 |
| 282 | iso_pu_bacteria | 2643221662 | 2644346939 | 484 |
| 283 | iso_pu_bacteria | 2738543031 | 2739348066 | 484 |
| 284 | iso_pu_bacteria | 2773857925 | 2774872602 | 484 |
| 285 | iso_pu_bacteria | 2775506901 | 2776259616 | 484 |
| 286 | iso_pu_bacteria | 2835312727 | 2835317290 | 484 |
| 287 | iso_pu_bacteria | 2874139085 | 2874141340 | 484 |
| 288 | iso_pu_bacteria | 2882456835 | 2882458198 | 484 |
| 289 | iso_pu_bacteria | 2884298095 | 2884299817 | 484 |
| 290 | iso_pu_bacteria | 2889306138 | 2889307302 | 484 |
| 291 | iso_pu_bacteria | 2894232714 | 2894239657 | 484 |
| 292 | iso_pu_bacteria | 2902330777 | 2902331990 | 484 |
| 293 | iso_pu_bacteria | 2902405164 | 2902410301 | 484 |
| 294 | iso_pu_bacteria | 2919450847 | 2919450954 | 484 |
| 295 | iso_pu_bacteria | 2928125067 | 2928127818 | 484 |
| 296 | iso_pu_bacteria | 8005658619 | 8005659782 | 484 |
| 297 | 3300005338 | Ga0068868_100113449 | Ga0068868_1001134492 | 485 |
| 298 | 3300005539 | Ga0068853_100043602 | Ga0068853_1000436025 | 485 |
| 299 | 3300006847 | Ga0075431_100005375 | Ga0075431_1000053753 | 485 |
| 300 | 3300028800 | Ga0265338_10014181 | Ga0265338_100141816 | 485 |
| 301 | 3300031595 | Ga0265313_10000438 | Ga0265313_1000043844 | 485 |
| 302 | 3300044656 | Ga0466969_0001388 | Ga0466969_0001388_58_1545 | 485 |
| 303 | 3300044684 | Ga0466966_0000050 | Ga0466966_0000050_61787_63274 | 485 |
| 304 | 3300044842 | Ga0466957_0006712 | Ga0466957_0006712_3138_4625 | 485 |
| 305 | 3300045049 | Ga0466959_0000121 | Ga0466959_0000121_39832_41319 | 485 |
| 306 | 3300045836 | Ga0466958_0002157 | Ga0466958_0002157_127_1614 | 485 |
| 307 | 3300049579 | Ga0501043_0099831 | Ga0501043_0099831_64_1536 | 485 |
| 308 | 3300049581 | Ga0501047_0005238 | Ga0501047_0005238_2946_4403 | 485 |
| 309 | 3300049583 | Ga0501067_0077123 | Ga0501067_0077123_197_1666 | 485 |
| 310 | 3300049823 | Ga0501044_0069002 | Ga0501044_0069002_1923_3383 | 485 |
| 311 | 3300053177 | Ga0500636_0069800 | Ga0500636_0069800_522_1985 | 485 |
| 312 | iso_pu_bacteria | 2513237087 | 2513591768 | 485 |
| 313 | iso_pu_bacteria | 2643221733 | 2644731172 | 485 |
| 314 | iso_pu_bacteria | 2643221734 | 2644733133 | 485 |
| 315 | iso_pu_bacteria | 2818991467 | 2819717962 | 485 |
| 316 | iso_pu_bacteria | 2828305725 | 2828309520 | 485 |
| 317 | iso_pu_bacteria | 2917554339 | 2917557566 | 485 |
| 318 | iso_pu_bacteria | 2917699015 | 2917700576 | 485 |
| 319 | iso_pu_bacteria | 2939669807 | 2939671295 | 485 |
| 320 | 3300005336 | Ga0070680_100015843 | Ga0070680_1000158436 | 486 |
| 321 | 3300005366 | Ga0070659_100001044 | Ga0070659_10000104421 | 486 |
| 322 | 3300005616 | Ga0068852_100176443 | Ga0068852_1001764431 | 486 |
| 323 | 3300005841 | Ga0068863_100036320 | Ga0068863_1000363205 | 486 |
| 324 | 3300005843 | Ga0068860_100001852 | Ga0068860_10000185218 | 486 |
| 325 | 3300005843 | Ga0068860_100016648 | Ga0068860_1000166483 | 486 |
| 326 | 3300005985 | Ga0081539_10025143 | Ga0081539_100251433 | 486 |
| 327 | 3300009177 | Ga0105248_10140148 | Ga0105248_101401482 | 486 |
| 328 | 3300013100 | Ga0157373_10000266 | Ga0157373_1000026639 | 486 |
| 329 | 3300025913 | Ga0207695_10059284 | Ga0207695_100592841 | 486 |
| 330 | 3300025913 | Ga0207695_10136559 | Ga0207695_101365592 | 486 |
| 331 | 3300025917 | Ga0207660_10043080 | Ga0207660_100430801 | 486 |
| 332 | 3300025941 | Ga0207711_10000482 | Ga0207711_1000048214 | 486 |
| 333 | 3300025949 | Ga0207667_10031553 | Ga0207667_100315533 | 486 |
| 334 | 3300025972 | Ga0207668_10112221 | Ga0207668_101122212 | 486 |
| 335 | 3300025986 | Ga0207658_10006976 | Ga0207658_1000697610 | 486 |
| 336 | 3300026088 | Ga0207641_10018585 | Ga0207641_100185856 | 486 |
| 337 | 3300028381 | Ga0268264_10011787 | Ga0268264_100117873 | 486 |
| 338 | 3300028381 | Ga0268264_10045578 | Ga0268264_100455785 | 486 |
| 339 | 3300028800 | Ga0265338_10028844 | Ga0265338_100288443 | 486 |
| 340 | 3300031456 | Ga0307513_10000162 | Ga0307513_1000016289 | 486 |
| 341 | 3300031711 | Ga0265314_10007477 | Ga0265314_100074777 | 486 |
| 342 | 3300033180 | Ga0307510_10038206 | Ga0307510_100382064 | 486 |
| 343 | 3300037068 | Ga0373925_0000507 | Ga0373925_0000507_4110_5570 | 486 |
| 344 | 3300037068 | Ga0373925_0054236 | Ga0373925_0054236_667_2145 | 486 |
| 345 | 3300037312 | Ga0395899_0002674 | Ga0395899_0002674_7679_9139 | 486 |
| 346 | 3300037418 | Ga0395900_0003303 | Ga0395900_0003303_13406_14866 | 486 |
| 347 | 3300037418 | Ga0395900_0136050 | Ga0395900_0136050_468_1928 | 486 |
| 348 | 3300037466 | Ga0395898_0006986 | Ga0395898_0006986_7328_8788 | 486 |
| 349 | 3300037466 | Ga0395898_0008249 | Ga0395898_0008249_4441_5901 | 486 |
| 350 | 3300037466 | Ga0395898_0110402 | Ga0395898_0110402_740_2200 | 486 |
| 351 | 3300037471 | Ga0395905_0000346 | Ga0395905_0000346_28509_29999 | 486 |
| 352 | 3300038443 | Ga0395901_0033872 | Ga0395901_0033872_3379_4839 | 486 |
| 353 | 3300038443 | Ga0395901_0178453 | Ga0395901_0178453_501_1961 | 486 |
| 354 | 3300044683 | Ga0466965_0036373 | Ga0466965_0036373_760_2256 | 486 |
| 355 | 3300044693 | Ga0466961_0113469 | Ga0466961_0113469_151_1647 | 486 |
| 356 | 3300044842 | Ga0466957_0130715 | Ga0466957_0130715_99_1559 | 486 |
| 357 | 3300047320 | Ga0495672_0003063 | Ga0495672_0003063_7700_9187 | 486 |
| 358 | 3300048904 | Ga0496101_0183312 | Ga0496101_0183312_86_1579 | 486 |
| 359 | 3300048913 | Ga0496110_0026617 | Ga0496110_0026617_2210_3676 | 486 |
| 360 | 3300048915 | Ga0496112_0046860 | Ga0496112_0046860_2015_3481 | 486 |
| 361 | 3300048918 | Ga0496115_0001705 | Ga0496115_0001705_13696_15204 | 486 |
| 362 | 3300049570 | Ga0501033_0046182 | Ga0501033_0046182_1153_2622 | 486 |
| 363 | 3300049571 | Ga0501034_0005441 | Ga0501034_0005441_9553_11022 | 486 |
| 364 | 3300049571 | Ga0501034_0045163 | Ga0501034_0045163_451_1920 | 486 |
| 365 | 3300049572 | Ga0501036_0026696 | Ga0501036_0026696_2495_3964 | 486 |
| 366 | 3300049572 | Ga0501036_0030447 | Ga0501036_0030447_343_1812 | 486 |
| 367 | 3300049573 | Ga0501037_0023203 | Ga0501037_0023203_2275_3744 | 486 |
| 368 | 3300049573 | Ga0501037_0034647 | Ga0501037_0034647_1800_3269 | 486 |
| 369 | 3300049575 | Ga0501039_0018425 | Ga0501039_0018425_534_2003 | 486 |
| 370 | 3300049579 | Ga0501043_0024066 | Ga0501043_0024066_407_1876 | 486 |
| 371 | 3300049579 | Ga0501043_0129997 | Ga0501043_0129997_404_1873 | 486 |
| 372 | 3300049580 | Ga0501046_0022137 | Ga0501046_0022137_3453_4922 | 486 |
| 373 | 3300049580 | Ga0501046_0044209 | Ga0501046_0044209_156_1625 | 486 |
| 374 | 3300049581 | Ga0501047_0000218 | Ga0501047_0000218_26400_27869 | 486 |
| 375 | 3300049581 | Ga0501047_0011235 | Ga0501047_0011235_289_1770 | 486 |
| 376 | 3300049582 | Ga0501048_0000762 | Ga0501048_0000762_19189_20658 | 486 |
| 377 | 3300049584 | Ga0501068_0015380 | Ga0501068_0015380_2652_4121 | 486 |
| 378 | 3300049586 | Ga0501070_0011908 | Ga0501070_0011908_3153_4622 | 486 |
| 379 | 3300049586 | Ga0501070_0042124 | Ga0501070_0042124_2258_3727 | 486 |
| 380 | 3300049587 | Ga0501071_0014032 | Ga0501071_0014032_456_1925 | 486 |
| 381 | 3300049589 | Ga0501073_0103208 | Ga0501073_0103208_135_1619 | 486 |
| 382 | 3300049741 | Ga0501079_0033063 | Ga0501079_0033063_2108_3577 | 486 |
| 383 | 3300049742 | Ga0501080_0000489 | Ga0501080_0000489_26503_27972 | 486 |
| 384 | 3300049744 | Ga0501083_0018125 | Ga0501083_0018125_10_1494 | 486 |
| 385 | 3300049823 | Ga0501044_0000931 | Ga0501044_0000931_23112_24581 | 486 |
| 386 | 3300049823 | Ga0501044_0034897 | Ga0501044_0034897_3386_4855 | 486 |
| 387 | 3300053087 | Ga0500643_000298 | Ga0500643_000298_29501_31006 | 486 |
| 388 | 3300053087 | Ga0500643_025178 | Ga0500643_025178_35_1543 | 486 |
| 389 | 3300053090 | Ga0500646_0006610 | Ga0500646_0006610_771_2255 | 486 |
| 390 | 3300053096 | Ga0500641_0000515 | Ga0500641_0000515_11678_13183 | 486 |
| 391 | 3300053104 | Ga0500556_0002346 | Ga0500556_0002346_1376_2878 | 486 |
| 392 | 3300053104 | Ga0500556_0011251 | Ga0500556_0011251_106_1611 | 486 |
| 393 | 3300053153 | Ga0500616_0045860 | Ga0500616_0045860_406_1908 | 486 |
| 394 | 3300053730 | Ga0500645_000851 | Ga0500645_000851_10749_12254 | 486 |
| 395 | 3300053730 | Ga0500645_003590 | Ga0500645_003590_1613_3115 | 486 |
| 396 | 3300060353 | Ga0501082_0096172 | Ga0501082_0096172_72_1556 | 486 |
| 397 | 3300005335 | Ga0070666_10021102 | Ga0070666_100211025 | 487 |
| 398 | 3300005440 | Ga0070705_100076531 | Ga0070705_1000765312 | 487 |
| 399 | 3300005549 | Ga0070704_100023644 | Ga0070704_1000236441 | 487 |
| 400 | 3300006178 | Ga0075367_10009286 | Ga0075367_100092862 | 487 |
| 401 | 3300006846 | Ga0075430_100002515 | Ga0075430_1000025155 | 487 |
| 402 | 3300006871 | Ga0075434_100053122 | Ga0075434_1000531224 | 487 |
| 403 | 3300009093 | Ga0105240_10000798 | Ga0105240_1000079862 | 487 |
| 404 | 3300009147 | Ga0114129_10090309 | Ga0114129_100903095 | 487 |
| 405 | 3300009553 | Ga0105249_10015027 | Ga0105249_100150271 | 487 |
| 406 | 3300013100 | Ga0157373_10000704 | Ga0157373_100007045 | 487 |
| 407 | 3300021384 | Ga0213876_10000414 | Ga0213876_1000041410 | 487 |
| 408 | 3300025924 | Ga0207694_10101264 | Ga0207694_101012642 | 487 |
| 409 | 3300025927 | Ga0207687_10117143 | Ga0207687_101171431 | 487 |
| 410 | 3300027866 | Ga0209813_10005443 | Ga0209813_100054432 | 487 |
| 411 | 3300031824 | Ga0307413_10078391 | Ga0307413_100783912 | 487 |
| 412 | 3300037312 | Ga0395899_0000105 | Ga0395899_0000105_30050_31516 | 487 |
| 413 | 3300039437 | Ga0436365_0440714 | Ga0436365_0440714_564_2030 | 487 |
| 414 | 3300039437 | Ga0436365_1830840 | Ga0436365_1830840_8157_9623 | 487 |
| 415 | 3300039447 | Ga0436361_0196619 | Ga0436361_0196619_5170_6636 | 487 |
| 416 | 3300045976 | Ga0466967_0030498 | Ga0466967_0030498_3050_4513 | 487 |
| 417 | 3300047472 | Ga0495686_0000007 | Ga0495686_0000007_11599_13116 | 487 |
| 418 | 3300049569 | Ga0501032_0001847 | Ga0501032_0001847_6728_8245 | 487 |
| 419 | 3300049569 | Ga0501032_0087584 | Ga0501032_0087584_202_1731 | 487 |
| 420 | 3300049570 | Ga0501033_0007756 | Ga0501033_0007756_4089_5570 | 487 |
| 421 | 3300049572 | Ga0501036_0053157 | Ga0501036_0053157_1861_3378 | 487 |
| 422 | 3300049581 | Ga0501047_0053286 | Ga0501047_0053286_584_2056 | 487 |
| 423 | 3300049583 | Ga0501067_0000058 | Ga0501067_0000058_45823_47340 | 487 |
| 424 | 3300049584 | Ga0501068_0022741 | Ga0501068_0022741_906_2423 | 487 |
| 425 | 3300049589 | Ga0501073_0000154 | Ga0501073_0000154_6858_8375 | 487 |
| 426 | 3300049593 | Ga0501077_0000148 | Ga0501077_0000148_16388_17905 | 487 |
| 427 | 3300049742 | Ga0501080_0004383 | Ga0501080_0004383_7606_9123 | 487 |
| 428 | 3300049744 | Ga0501083_0053032 | Ga0501083_0053032_1156_2673 | 487 |
| 429 | 3300049823 | Ga0501044_0001454 | Ga0501044_0001454_4493_5956 | 487 |
| 430 | 3300049823 | Ga0501044_0068612 | Ga0501044_0068612_1788_3269 | 487 |
| 431 | 3300050494 | nmdc:mga06z11_3604_c1 | nmdc:mga06z11_3604_c1_3196_4716 | 487 |
| 432 | 3300050495 | nmdc:mga04h51_376_c1 | nmdc:mga04h51_376_c1_1275_2795 | 487 |
| 433 | 3300050507 | nmdc:mga05p37_136517_c1 | nmdc:mga05p37_136517_c1_136_1599 | 487 |
| 434 | 3300050509 | nmdc:mga0qj67_170_c1 | nmdc:mga0qj67_170_c1_10155_11624 | 487 |
| 435 | 3300050512 | nmdc:mga0n895_148235_c1 | nmdc:mga0n895_148235_c1_188_1657 | 487 |
| 436 | 3300053096 | Ga0500641_0002953 | Ga0500641_0002953_43_1551 | 487 |
| 437 | 3300053104 | Ga0500556_0000009 | Ga0500556_0000009_66070_67542 | 487 |
| 438 | 3300053156 | Ga0500622_0014531 | Ga0500622_0014531_2161_3627 | 487 |
| 439 | 3300060353 | Ga0501082_0085475 | Ga0501082_0085475_930_2447 | 487 |
| 440 | 3300005337 | Ga0070682_100006850 | Ga0070682_1000068508 | 488 |
| 441 | 3300005341 | Ga0070691_10030620 | Ga0070691_100306204 | 488 |
| 442 | 3300005355 | Ga0070671_100082757 | Ga0070671_1000827573 | 488 |
| 443 | 3300005367 | Ga0070667_100223132 | Ga0070667_1002231321 | 488 |
| 444 | 3300005455 | Ga0070663_100001352 | Ga0070663_1000013526 | 488 |
| 445 | 3300005530 | Ga0070679_100094353 | Ga0070679_1000943534 | 488 |
| 446 | 3300005536 | Ga0070697_100002324 | Ga0070697_1000023244 | 488 |
| 447 | 3300005545 | Ga0070695_100005457 | Ga0070695_1000054579 | 488 |
| 448 | 3300005563 | Ga0068855_100139847 | Ga0068855_1001398474 | 488 |
| 449 | 3300005563 | Ga0068855_100233537 | Ga0068855_1002335372 | 488 |
| 450 | 3300005577 | Ga0068857_100157882 | Ga0068857_1001578822 | 488 |
| 451 | 3300005981 | Ga0081538_10001621 | Ga0081538_1000162119 | 488 |
| 452 | 3300005981 | Ga0081538_10035138 | Ga0081538_100351381 | 488 |
| 453 | 3300006914 | Ga0075436_100010259 | Ga0075436_1000102597 | 488 |
| 454 | 3300009094 | Ga0111539_10115740 | Ga0111539_101157402 | 488 |
| 455 | 3300009098 | Ga0105245_10031383 | Ga0105245_100313833 | 488 |
| 456 | 3300009174 | Ga0105241_10014140 | Ga0105241_100141404 | 488 |
| 457 | 3300009551 | Ga0105238_10004540 | Ga0105238_100045408 | 488 |
| 458 | 3300014968 | Ga0157379_10016877 | Ga0157379_100168772 | 488 |
| 459 | 3300025919 | Ga0207657_10014577 | Ga0207657_100145778 | 488 |
| 460 | 3300025921 | Ga0207652_10050967 | Ga0207652_100509673 | 488 |
| 461 | 3300025924 | Ga0207694_10050623 | Ga0207694_100506231 | 488 |
| 462 | 3300026035 | Ga0207703_10116932 | Ga0207703_101169324 | 488 |
| 463 | 3300026067 | Ga0207678_10000034 | Ga0207678_1000003438 | 488 |
| 464 | 3300026095 | Ga0207676_10079269 | Ga0207676_100792692 | 488 |
| 465 | 3300026116 | Ga0207674_10176184 | Ga0207674_101761842 | 488 |
| 466 | 3300031239 | Ga0265328_10000625 | Ga0265328_1000062510 | 488 |
| 467 | 3300031250 | Ga0265331_10002586 | Ga0265331_100025868 | 488 |
| 468 | 3300031344 | Ga0265316_10007468 | Ga0265316_100074688 | 488 |
| 469 | 3300031727 | Ga0316576_10066005 | Ga0316576_100660052 | 488 |
| 470 | 3300035398 | Ga0316574_0071387 | Ga0316574_0071387_104_1585 | 488 |
| 471 | 3300037068 | Ga0373925_0015686 | Ga0373925_0015686_966_2447 | 488 |
| 472 | 3300037418 | Ga0395900_0027215 | Ga0395900_0027215_2139_3608 | 488 |
| 473 | 3300037418 | Ga0395900_0223283 | Ga0395900_0223283_285_1757 | 488 |
| 474 | 3300037466 | Ga0395898_0119170 | Ga0395898_0119170_888_2360 | 488 |
| 475 | 3300038443 | Ga0395901_0285206 | Ga0395901_0285206_192_1673 | 488 |
| 476 | 3300039093 | Ga0400489_02163 | Ga0400489_02163_2067_3548 | 488 |
| 477 | 3300039447 | Ga0436361_1032931 | Ga0436361_1032931_391_1878 | 488 |
| 478 | 3300045049 | Ga0466959_0138879 | Ga0466959_0138879_93_1568 | 488 |
| 479 | 3300046533 | Ga0495640_0037401 | Ga0495640_0037401_1547_3028 | 488 |
| 480 | 3300047320 | Ga0495672_0045572 | Ga0495672_0045572_447_1925 | 488 |
| 481 | 3300048903 | Ga0496100_0014815 | Ga0496100_0014815_1547_3028 | 488 |
| 482 | 3300048903 | Ga0496100_0081205 | Ga0496100_0081205_218_1699 | 488 |
| 483 | 3300048906 | Ga0496103_0005864 | Ga0496103_0005864_331_1812 | 488 |
| 484 | 3300048909 | Ga0496106_0001911 | Ga0496106_0001911_12204_13685 | 488 |
| 485 | 3300048910 | Ga0496107_0001131 | Ga0496107_0001131_4989_6470 | 488 |
| 486 | 3300048917 | Ga0496114_0052437 | Ga0496114_0052437_431_1912 | 488 |
| 487 | 3300048918 | Ga0496115_0001749 | Ga0496115_0001749_3759_5240 | 488 |
| 488 | 3300049571 | Ga0501034_0000391 | Ga0501034_0000391_14652_16151 | 488 |
| 489 | 3300049571 | Ga0501034_0042214 | Ga0501034_0042214_1434_2921 | 488 |
| 490 | 3300049571 | Ga0501034_0183249 | Ga0501034_0183249_64_1545 | 488 |
| 491 | 3300049572 | Ga0501036_0030820 | Ga0501036_0030820_2039_3523 | 488 |
| 492 | 3300049572 | Ga0501036_0057170 | Ga0501036_0057170_144_1619 | 488 |
| 493 | 3300049578 | Ga0501042_0078125 | Ga0501042_0078125_694_2166 | 488 |
| 494 | 3300049579 | Ga0501043_0025652 | Ga0501043_0025652_511_1995 | 488 |
| 495 | 3300049579 | Ga0501043_0048152 | Ga0501043_0048152_407_1882 | 488 |
| 496 | 3300049580 | Ga0501046_0025627 | Ga0501046_0025627_1848_3329 | 488 |
| 497 | 3300049581 | Ga0501047_0000719 | Ga0501047_0000719_14322_15821 | 488 |
| 498 | 3300049581 | Ga0501047_0085022 | Ga0501047_0085022_955_2439 | 488 |
| 499 | 3300049581 | Ga0501047_0164519 | Ga0501047_0164519_145_1620 | 488 |
| 500 | 3300049742 | Ga0501080_0000028 | Ga0501080_0000028_77840_79339 | 488 |
| 501 | 3300049743 | Ga0501081_0065853 | Ga0501081_0065853_415_1887 | 488 |
| 502 | 3300049744 | Ga0501083_0113966 | Ga0501083_0113966_85_1551 | 488 |
| 503 | 3300049822 | Ga0501035_0000020 | Ga0501035_0000020_17226_18725 | 488 |
| 504 | 3300049822 | Ga0501035_0026411 | Ga0501035_0026411_307_1782 | 488 |
| 505 | 3300049822 | Ga0501035_0050714 | Ga0501035_0050714_1261_2757 | 488 |
| 506 | 3300049823 | Ga0501044_0000007 | Ga0501044_0000007_162842_164341 | 488 |
| 507 | 3300049824 | Ga0501045_0009778 | Ga0501045_0009778_3603_5075 | 488 |
| 508 | 3300050492 | nmdc:mga0yw44_78231_c1 | nmdc:mga0yw44_78231_c1_131_1606 | 488 |
| 509 | 3300050507 | nmdc:mga05p37_96871_c1 | nmdc:mga05p37_96871_c1_1859_3328 | 488 |
| 510 | 3300050514 | nmdc:mga08x19_14_c1 | nmdc:mga08x19_14_c1_17687_19156 | 488 |
| 511 | 3300053087 | Ga0500643_004945 | Ga0500643_004945_4271_5743 | 488 |
| 512 | 3300053117 | Ga0500593_000068 | Ga0500593_000068_8226_9704 | 488 |
| 513 | 3300053153 | Ga0500616_0021501 | Ga0500616_0021501_78_1577 | 488 |
| 514 | 3300060353 | Ga0501082_0005691 | Ga0501082_0005691_3078_4577 | 488 |
| 515 | 3300061734 | Ga0530510_0026181 | Ga0530510_0026181_200_1669 | 488 |
| 516 | 3300000041 | ARcpr5oldR_c000183 | ARcpr5oldR_0001837 | 489 |
| 517 | 3300000042 | ARSoilYngRDRAFT_c00120 | ARSoilYngRDRAFT_001209 | 489 |
| 518 | 3300000044 | ARSoilOldRDRAFT_c000093 | ARSoilOldRDRAFT_0000939 | 489 |
| 519 | 3300000652 | ARCol0yngRDRAFT_1000124 | ARCol0yngRDRAFT_100012413 | 489 |
| 520 | 3300001430 | JGI24032J14994_100448 | JGI24032J14994_1004482 | 489 |
| 521 | 3300001977 | JGI24746J21847_1000166 | JGI24746J21847_10001662 | 489 |
| 522 | 3300001978 | JGI24747J21853_1001343 | JGI24747J21853_10013431 | 489 |
| 523 | 3300001989 | JGI24739J22299_10000057 | JGI24739J22299_1000005727 | 489 |
| 524 | 3300001990 | JGI24737J22298_10000391 | JGI24737J22298_1000039110 | 489 |
| 525 | 3300001990 | JGI24737J22298_10005396 | JGI24737J22298_100053962 | 489 |
| 526 | 3300002070 | JGI24750J21931_1000122 | JGI24750J21931_10001228 | 489 |
| 527 | 3300002073 | JGI24745J21846_1000450 | JGI24745J21846_10004503 | 489 |
| 528 | 3300002075 | JGI24738J21930_10000767 | JGI24738J21930_100007675 | 489 |
| 529 | 3300002077 | JGI24744J21845_10000821 | JGI24744J21845_100008216 | 489 |
| 530 | 3300002239 | JGI24034J26672_10000108 | JGI24034J26672_1000010810 | 489 |
| 531 | 3300002244 | JGI24742J22300_10000111 | JGI24742J22300_100001119 | 489 |
| 532 | 3300003215 | JGI25153J46596_10006736 | JGI25153J46596_100067362 | 489 |
| 533 | 3300003771 | Ga0055526_1000371 | Ga0055526_100037124 | 489 |
| 534 | 3300003771 | Ga0055526_1002296 | Ga0055526_100229617 | 489 |
| 535 | 3300003775 | Ga0055524_1000515 | Ga0055524_10005156 | 489 |
| 536 | 3300005277 | Ga0065716_1001884 | Ga0065716_10018841 | 489 |
| 537 | 3300005290 | Ga0065712_10008453 | Ga0065712_100084533 | 489 |
| 538 | 3300005290 | Ga0065712_10073118 | Ga0065712_100731185 | 489 |
| 539 | 3300005293 | Ga0065715_10000602 | Ga0065715_1000060215 | 489 |
| 540 | 3300005293 | Ga0065715_10090236 | Ga0065715_100902362 | 489 |
| 541 | 3300005293 | Ga0065715_10090398 | Ga0065715_100903981 | 489 |
| 542 | 3300005295 | Ga0065707_10111560 | Ga0065707_101115601 | 489 |
| 543 | 3300005327 | Ga0070658_10011629 | Ga0070658_100116294 | 489 |
| 544 | 3300005328 | Ga0070676_10000170 | Ga0070676_1000017023 | 489 |
| 545 | 3300005329 | Ga0070683_100003392 | Ga0070683_1000033929 | 489 |
| 546 | 3300005330 | Ga0070690_100022059 | Ga0070690_1000220593 | 489 |
| 547 | 3300005331 | Ga0070670_100009376 | Ga0070670_1000093761 | 489 |
| 548 | 3300005333 | Ga0070677_10000320 | Ga0070677_1000032014 | 489 |
| 549 | 3300005334 | Ga0068869_100000181 | Ga0068869_10000018116 | 489 |
| 550 | 3300005336 | Ga0070680_100002750 | Ga0070680_1000027509 | 489 |
| 551 | 3300005336 | Ga0070680_100066923 | Ga0070680_1000669232 | 489 |
| 552 | 3300005337 | Ga0070682_100000903 | Ga0070682_10000090313 | 489 |
| 553 | 3300005338 | Ga0068868_100000590 | Ga0068868_10000059017 | 489 |
| 554 | 3300005339 | Ga0070660_100007288 | Ga0070660_10000728810 | 489 |
| 555 | 3300005339 | Ga0070660_100035443 | Ga0070660_1000354433 | 489 |
| 556 | 3300005340 | Ga0070689_100001256 | Ga0070689_1000012566 | 489 |
| 557 | 3300005340 | Ga0070689_100103986 | Ga0070689_1001039861 | 489 |
| 558 | 3300005341 | Ga0070691_10000085 | Ga0070691_1000008512 | 489 |
| 559 | 3300005343 | Ga0070687_100000037 | Ga0070687_10000003737 | 489 |
| 560 | 3300005343 | Ga0070687_100014057 | Ga0070687_1000140571 | 489 |
| 561 | 3300005344 | Ga0070661_100001893 | Ga0070661_10000189312 | 489 |
| 562 | 3300005344 | Ga0070661_100016055 | Ga0070661_1000160556 | 489 |
| 563 | 3300005345 | Ga0070692_10000038 | Ga0070692_1000003818 | 489 |
| 564 | 3300005347 | Ga0070668_100131362 | Ga0070668_1001313621 | 489 |
| 565 | 3300005353 | Ga0070669_100010295 | Ga0070669_1000102957 | 489 |
| 566 | 3300005364 | Ga0070673_100000191 | Ga0070673_10000019111 | 489 |
| 567 | 3300005365 | Ga0070688_100002000 | Ga0070688_10000200013 | 489 |
| 568 | 3300005365 | Ga0070688_100053028 | Ga0070688_1000530283 | 489 |
| 569 | 3300005366 | Ga0070659_100001504 | Ga0070659_1000015049 | 489 |
| 570 | 3300005366 | Ga0070659_100007451 | Ga0070659_10000745111 | 489 |
| 571 | 3300005434 | Ga0070709_10011101 | Ga0070709_100111017 | 489 |
| 572 | 3300005434 | Ga0070709_10027134 | Ga0070709_100271344 | 489 |
| 573 | 3300005435 | Ga0070714_100001757 | Ga0070714_1000017577 | 489 |
| 574 | 3300005435 | Ga0070714_100053323 | Ga0070714_1000533234 | 489 |
| 575 | 3300005439 | Ga0070711_100043669 | Ga0070711_1000436693 | 489 |
| 576 | 3300005439 | Ga0070711_100045371 | Ga0070711_1000453711 | 489 |
| 577 | 3300005439 | Ga0070711_100079750 | Ga0070711_1000797503 | 489 |
| 578 | 3300005441 | Ga0070700_100001181 | Ga0070700_1000011813 | 489 |
| 579 | 3300005441 | Ga0070700_100019478 | Ga0070700_1000194781 | 489 |
| 580 | 3300005457 | Ga0070662_100001810 | Ga0070662_10000181012 | 489 |
| 581 | 3300005458 | Ga0070681_10002441 | Ga0070681_1000244110 | 489 |
| 582 | 3300005458 | Ga0070681_10007687 | Ga0070681_100076878 | 489 |
| 583 | 3300005458 | Ga0070681_10022976 | Ga0070681_100229763 | 489 |
| 584 | 3300005458 | Ga0070681_10045202 | Ga0070681_100452022 | 489 |
| 585 | 3300005466 | Ga0070685_10071605 | Ga0070685_100716051 | 489 |
| 586 | 3300005530 | Ga0070679_100006190 | Ga0070679_10000619010 | 489 |
| 587 | 3300005530 | Ga0070679_100011510 | Ga0070679_1000115104 | 489 |
| 588 | 3300005530 | Ga0070679_100082872 | Ga0070679_1000828721 | 489 |
| 589 | 3300005535 | Ga0070684_100001355 | Ga0070684_10000135511 | 489 |
| 590 | 3300005535 | Ga0070684_100084523 | Ga0070684_1000845232 | 489 |
| 591 | 3300005539 | Ga0068853_100001361 | Ga0068853_1000013619 | 489 |
| 592 | 3300005539 | Ga0068853_100009731 | Ga0068853_1000097319 | 489 |
| 593 | 3300005539 | Ga0068853_100077567 | Ga0068853_1000775671 | 489 |
| 594 | 3300005543 | Ga0070672_100001052 | Ga0070672_10000105211 | 489 |
| 595 | 3300005545 | Ga0070695_100055937 | Ga0070695_1000559371 | 489 |
| 596 | 3300005546 | Ga0070696_100009183 | Ga0070696_1000091837 | 489 |
| 597 | 3300005546 | Ga0070696_100011129 | Ga0070696_1000111292 | 489 |
| 598 | 3300005547 | Ga0070693_100004467 | Ga0070693_1000044677 | 489 |
| 599 | 3300005548 | Ga0070665_100129217 | Ga0070665_1001292172 | 489 |
| 600 | 3300005563 | Ga0068855_100008638 | Ga0068855_1000086387 | 489 |
| 601 | 3300005563 | Ga0068855_100028140 | Ga0068855_1000281401 | 489 |
| 602 | 3300005577 | Ga0068857_100001561 | Ga0068857_10000156114 | 489 |
| 603 | 3300005577 | Ga0068857_100075433 | Ga0068857_1000754332 | 489 |
| 604 | 3300005578 | Ga0068854_100037477 | Ga0068854_1000374774 | 489 |
| 605 | 3300005615 | Ga0070702_100000796 | Ga0070702_10000079611 | 489 |
| 606 | 3300005616 | Ga0068852_100041996 | Ga0068852_1000419963 | 489 |
| 607 | 3300005616 | Ga0068852_100050139 | Ga0068852_1000501393 | 489 |
| 608 | 3300005617 | Ga0068859_100011971 | Ga0068859_10001197112 | 489 |
| 609 | 3300005617 | Ga0068859_100015169 | Ga0068859_1000151699 | 489 |
| 610 | 3300005618 | Ga0068864_100002090 | Ga0068864_10000209013 | 489 |
| 611 | 3300005718 | Ga0068866_10001918 | Ga0068866_100019184 | 489 |
| 612 | 3300005719 | Ga0068861_100001910 | Ga0068861_10000191015 | 489 |
| 613 | 3300005719 | Ga0068861_100086031 | Ga0068861_1000860312 | 489 |
| 614 | 3300005834 | Ga0068851_10013316 | Ga0068851_100133164 | 489 |
| 615 | 3300005840 | Ga0068870_10000063 | Ga0068870_1000006337 | 489 |
| 616 | 3300005842 | Ga0068858_100071697 | Ga0068858_1000716971 | 489 |
| 617 | 3300005842 | Ga0068858_100137589 | Ga0068858_1001375891 | 489 |
| 618 | 3300005843 | Ga0068860_100003358 | Ga0068860_10000335812 | 489 |
| 619 | 3300005844 | Ga0068862_100074613 | Ga0068862_1000746133 | 489 |
| 620 | 3300005937 | Ga0081455_10000009 | Ga0081455_10000009247 | 489 |
| 621 | 3300005937 | Ga0081455_10009936 | Ga0081455_100099367 | 489 |
| 622 | 3300005937 | Ga0081455_10013060 | Ga0081455_100130605 | 489 |
| 623 | 3300005983 | Ga0081540_1000078 | Ga0081540_100007842 | 489 |
| 624 | 3300005985 | Ga0081539_10046979 | Ga0081539_100469792 | 489 |
| 625 | 3300006038 | Ga0075365_10019551 | Ga0075365_100195511 | 489 |
| 626 | 3300006175 | Ga0070712_100004132 | Ga0070712_1000041324 | 489 |
| 627 | 3300006358 | Ga0068871_100082132 | Ga0068871_1000821321 | 489 |
| 628 | 3300006844 | Ga0075428_100059498 | Ga0075428_1000594988 | 489 |
| 629 | 3300006847 | Ga0075431_100002222 | Ga0075431_1000022228 | 489 |
| 630 | 3300006852 | Ga0075433_10010775 | Ga0075433_100107757 | 489 |
| 631 | 3300006871 | Ga0075434_100006580 | Ga0075434_1000065803 | 489 |
| 632 | 3300006880 | Ga0075429_100005002 | Ga0075429_10000500212 | 489 |
| 633 | 3300006881 | Ga0068865_100000244 | Ga0068865_10000024433 | 489 |
| 634 | 3300006881 | Ga0068865_100005990 | Ga0068865_1000059903 | 489 |
| 635 | 3300006931 | Ga0097620_100011971 | Ga0097620_1000119712 | 489 |
| 636 | 3300006931 | Ga0097620_100015168 | Ga0097620_1000151689 | 489 |
| 637 | 3300007076 | Ga0075435_100018953 | Ga0075435_1000189531 | 489 |
| 638 | 3300007076 | Ga0075435_100094630 | Ga0075435_1000946303 | 489 |
| 639 | 3300007788 | Ga0099795_10004155 | Ga0099795_100041551 | 489 |
| 640 | 3300009036 | Ga0105244_10018886 | Ga0105244_100188863 | 489 |
| 641 | 3300009094 | Ga0111539_10003401 | Ga0111539_100034011 | 489 |
| 642 | 3300009094 | Ga0111539_10032147 | Ga0111539_100321472 | 489 |
| 643 | 3300009101 | Ga0105247_10014767 | Ga0105247_100147676 | 489 |
| 644 | 3300009147 | Ga0114129_10006095 | Ga0114129_1000609522 | 489 |
| 645 | 3300009147 | Ga0114129_10152174 | Ga0114129_101521743 | 489 |
| 646 | 3300009148 | Ga0105243_10009225 | Ga0105243_100092259 | 489 |
| 647 | 3300009176 | Ga0105242_10078422 | Ga0105242_100784221 | 489 |
| 648 | 3300009177 | Ga0105248_10023392 | Ga0105248_100233928 | 489 |
| 649 | 3300009177 | Ga0105248_10247572 | Ga0105248_102475722 | 489 |
| 650 | 3300009545 | Ga0105237_10019840 | Ga0105237_100198401 | 489 |
| 651 | 3300009545 | Ga0105237_10194952 | Ga0105237_101949521 | 489 |
| 652 | 3300009551 | Ga0105238_10037849 | Ga0105238_100378493 | 489 |
| 653 | 3300009553 | Ga0105249_10001033 | Ga0105249_1000103310 | 489 |
| 654 | 3300010375 | Ga0105239_10019241 | Ga0105239_100192412 | 489 |
| 655 | 3300010375 | Ga0105239_10035447 | Ga0105239_100354475 | 489 |
| 656 | 3300011119 | Ga0105246_10001800 | Ga0105246_100018004 | 489 |
| 657 | 3300011119 | Ga0105246_10104965 | Ga0105246_101049651 | 489 |
| 658 | 3300013100 | Ga0157373_10021255 | Ga0157373_100212553 | 489 |
| 659 | 3300013296 | Ga0157374_10009715 | Ga0157374_100097156 | 489 |
| 660 | 3300013297 | Ga0157378_10002181 | Ga0157378_1000218112 | 489 |
| 661 | 3300013306 | Ga0163162_10003401 | Ga0163162_100034011 | 489 |
| 662 | 3300013307 | Ga0157372_10049520 | Ga0157372_100495206 | 489 |
| 663 | 3300013308 | Ga0157375_10003806 | Ga0157375_1000380611 | 489 |
| 664 | 3300014325 | Ga0163163_10005155 | Ga0163163_1000515514 | 489 |
| 665 | 3300014326 | Ga0157380_10001301 | Ga0157380_1000130110 | 489 |
| 666 | 3300014968 | Ga0157379_10000275 | Ga0157379_1000027528 | 489 |
| 667 | 3300014968 | Ga0157379_10220374 | Ga0157379_102203742 | 489 |
| 668 | 3300014969 | Ga0157376_10000115 | Ga0157376_1000011551 | 489 |
| 669 | 3300015684 | Ga0183365_10003 | Ga0183365_10003252 | 489 |
| 670 | 3300017792 | Ga0163161_10078244 | Ga0163161_100782443 | 489 |
| 671 | 3300025271 | Ga0207666_1000050 | Ga0207666_10000503 | 489 |
| 672 | 3300025273 | Ga0209673_1017079 | Ga0209673_10170792 | 489 |
| 673 | 3300025290 | Ga0207673_1000083 | Ga0207673_10000832 | 489 |
| 674 | 3300025291 | Ga0209675_1000514 | Ga0209675_100051429 | 489 |
| 675 | 3300025294 | Ga0209025_1000016 | Ga0209025_100001650 | 489 |
| 676 | 3300025295 | Ga0209564_1000023 | Ga0209564_100002324 | 489 |
| 677 | 3300025295 | Ga0209564_1000035 | Ga0209564_1000035419 | 489 |
| 678 | 3300025297 | Ga0209758_1003674 | Ga0209758_10036741 | 489 |
| 679 | 3300025297 | Ga0209758_1039438 | Ga0209758_10394382 | 489 |
| 680 | 3300025299 | Ga0209256_1000025 | Ga0209256_100002527 | 489 |
| 681 | 3300025299 | Ga0209256_1000584 | Ga0209256_100058415 | 489 |
| 682 | 3300025315 | Ga0207697_10003427 | Ga0207697_100034279 | 489 |
| 683 | 3300025315 | Ga0207697_10014069 | Ga0207697_100140691 | 489 |
| 684 | 3300025885 | Ga0207653_10011359 | Ga0207653_100113591 | 489 |
| 685 | 3300025893 | Ga0207682_10000695 | Ga0207682_1000069515 | 489 |
| 686 | 3300025898 | Ga0207692_10091923 | Ga0207692_100919231 | 489 |
| 687 | 3300025899 | Ga0207642_10001013 | Ga0207642_1000101311 | 489 |
| 688 | 3300025900 | Ga0207710_10020800 | Ga0207710_100208003 | 489 |
| 689 | 3300025900 | Ga0207710_10063248 | Ga0207710_100632481 | 489 |
| 690 | 3300025901 | Ga0207688_10001691 | Ga0207688_100016916 | 489 |
| 691 | 3300025904 | Ga0207647_10007711 | Ga0207647_100077119 | 489 |
| 692 | 3300025905 | Ga0207685_10025208 | Ga0207685_100252082 | 489 |
| 693 | 3300025906 | Ga0207699_10034165 | Ga0207699_100341651 | 489 |
| 694 | 3300025907 | Ga0207645_10000114 | Ga0207645_1000011452 | 489 |
| 695 | 3300025908 | Ga0207643_10000134 | Ga0207643_100001343 | 489 |
| 696 | 3300025909 | Ga0207705_10000826 | Ga0207705_1000082613 | 489 |
| 697 | 3300025911 | Ga0207654_10005659 | Ga0207654_100056597 | 489 |
| 698 | 3300025911 | Ga0207654_10022181 | Ga0207654_100221813 | 489 |
| 699 | 3300025912 | Ga0207707_10001147 | Ga0207707_100011472 | 489 |
| 700 | 3300025912 | Ga0207707_10008171 | Ga0207707_1000817110 | 489 |
| 701 | 3300025912 | Ga0207707_10049328 | Ga0207707_100493281 | 489 |
| 702 | 3300025912 | Ga0207707_10120576 | Ga0207707_101205761 | 489 |
| 703 | 3300025912 | Ga0207707_10129488 | Ga0207707_101294882 | 489 |
| 704 | 3300025914 | Ga0207671_10018213 | Ga0207671_100182136 | 489 |
| 705 | 3300025915 | Ga0207693_10002351 | Ga0207693_1000235112 | 489 |
| 706 | 3300025915 | Ga0207693_10042576 | Ga0207693_100425763 | 489 |
| 707 | 3300025916 | Ga0207663_10070342 | Ga0207663_100703422 | 489 |
| 708 | 3300025917 | Ga0207660_10000034 | Ga0207660_1000003459 | 489 |
| 709 | 3300025917 | Ga0207660_10031763 | Ga0207660_100317632 | 489 |
| 710 | 3300025917 | Ga0207660_10096160 | Ga0207660_100961601 | 489 |
| 711 | 3300025918 | Ga0207662_10003783 | Ga0207662_100037839 | 489 |
| 712 | 3300025918 | Ga0207662_10012857 | Ga0207662_100128571 | 489 |
| 713 | 3300025919 | Ga0207657_10002232 | Ga0207657_1000223211 | 489 |
| 714 | 3300025919 | Ga0207657_10005404 | Ga0207657_1000540410 | 489 |
| 715 | 3300025919 | Ga0207657_10052181 | Ga0207657_100521813 | 489 |
| 716 | 3300025920 | Ga0207649_10000142 | Ga0207649_1000014248 | 489 |
| 717 | 3300025920 | Ga0207649_10048579 | Ga0207649_100485794 | 489 |
| 718 | 3300025921 | Ga0207652_10002021 | Ga0207652_1000202115 | 489 |
| 719 | 3300025921 | Ga0207652_10028137 | Ga0207652_100281375 | 489 |
| 720 | 3300025923 | Ga0207681_10000065 | Ga0207681_100000657 | 489 |
| 721 | 3300025923 | Ga0207681_10049749 | Ga0207681_100497493 | 489 |
| 722 | 3300025925 | Ga0207650_10002366 | Ga0207650_100023661 | 489 |
| 723 | 3300025926 | Ga0207659_10000078 | Ga0207659_1000007813 | 489 |
| 724 | 3300025928 | Ga0207700_10136691 | Ga0207700_101366911 | 489 |
| 725 | 3300025929 | Ga0207664_10002328 | Ga0207664_100023282 | 489 |
| 726 | 3300025932 | Ga0207690_10002633 | Ga0207690_100026331 | 489 |
| 727 | 3300025932 | Ga0207690_10066700 | Ga0207690_100667002 | 489 |
| 728 | 3300025932 | Ga0207690_10091209 | Ga0207690_100912091 | 489 |
| 729 | 3300025933 | Ga0207706_10010585 | Ga0207706_1001058510 | 489 |
| 730 | 3300025933 | Ga0207706_10017442 | Ga0207706_100174423 | 489 |
| 731 | 3300025934 | Ga0207686_10007002 | Ga0207686_100070025 | 489 |
| 732 | 3300025935 | Ga0207709_10000183 | Ga0207709_1000018378 | 489 |
| 733 | 3300025936 | Ga0207670_10035097 | Ga0207670_100350973 | 489 |
| 734 | 3300025936 | Ga0207670_10038388 | Ga0207670_100383881 | 489 |
| 735 | 3300025937 | Ga0207669_10001025 | Ga0207669_1000102513 | 489 |
| 736 | 3300025938 | Ga0207704_10000719 | Ga0207704_1000071910 | 489 |
| 737 | 3300025940 | Ga0207691_10013386 | Ga0207691_100133862 | 489 |
| 738 | 3300025942 | Ga0207689_10000144 | Ga0207689_100001443 | 489 |
| 739 | 3300025944 | Ga0207661_10001264 | Ga0207661_1000126413 | 489 |
| 740 | 3300025945 | Ga0207679_10000064 | Ga0207679_1000006493 | 489 |
| 741 | 3300025949 | Ga0207667_10011900 | Ga0207667_100119002 | 489 |
| 742 | 3300025960 | Ga0207651_10000420 | Ga0207651_1000042010 | 489 |
| 743 | 3300025961 | Ga0207712_10001661 | Ga0207712_100016616 | 489 |
| 744 | 3300025972 | Ga0207668_10000965 | Ga0207668_100009654 | 489 |
| 745 | 3300025981 | Ga0207640_10001755 | Ga0207640_100017553 | 489 |
| 746 | 3300025981 | Ga0207640_10030817 | Ga0207640_100308172 | 489 |
| 747 | 3300025986 | Ga0207658_10061502 | Ga0207658_100615022 | 489 |
| 748 | 3300026023 | Ga0207677_10003997 | Ga0207677_100039972 | 489 |
| 749 | 3300026035 | Ga0207703_10010897 | Ga0207703_100108977 | 489 |
| 750 | 3300026041 | Ga0207639_10001895 | Ga0207639_100018953 | 489 |
| 751 | 3300026041 | Ga0207639_10036628 | Ga0207639_100366283 | 489 |
| 752 | 3300026067 | Ga0207678_10003913 | Ga0207678_100039139 | 489 |
| 753 | 3300026075 | Ga0207708_10007970 | Ga0207708_100079709 | 489 |
| 754 | 3300026075 | Ga0207708_10035965 | Ga0207708_100359653 | 489 |
| 755 | 3300026078 | Ga0207702_10003767 | Ga0207702_1000376714 | 489 |
| 756 | 3300026088 | Ga0207641_10001821 | Ga0207641_1000182113 | 489 |
| 757 | 3300026089 | Ga0207648_10012750 | Ga0207648_100127509 | 489 |
| 758 | 3300026095 | Ga0207676_10000079 | Ga0207676_1000007987 | 489 |
| 759 | 3300026116 | Ga0207674_10000323 | Ga0207674_1000032351 | 489 |
| 760 | 3300026116 | Ga0207674_10131759 | Ga0207674_101317593 | 489 |
| 761 | 3300026118 | Ga0207675_100012401 | Ga0207675_1000124019 | 489 |
| 762 | 3300026118 | Ga0207675_100054943 | Ga0207675_1000549431 | 489 |
| 763 | 3300026121 | Ga0207683_10000037 | Ga0207683_1000003713 | 489 |
| 764 | 3300026121 | Ga0207683_10012300 | Ga0207683_100123005 | 489 |
| 765 | 3300026121 | Ga0207683_10026581 | Ga0207683_100265813 | 489 |
| 766 | 3300026142 | Ga0207698_10085676 | Ga0207698_100856761 | 489 |
| 767 | 3300026142 | Ga0207698_10090902 | Ga0207698_100909023 | 489 |
| 768 | 3300026142 | Ga0207698_10124096 | Ga0207698_101240963 | 489 |
| 769 | 3300027617 | Ga0210002_1000055 | Ga0210002_10000555 | 489 |
| 770 | 3300027682 | Ga0209971_1010411 | Ga0209971_10104113 | 489 |
| 771 | 3300027695 | Ga0209966_1001951 | Ga0209966_10019513 | 489 |
| 772 | 3300027717 | Ga0209998_10007236 | Ga0209998_100072361 | 489 |
| 773 | 3300027907 | Ga0207428_10000216 | Ga0207428_100002167 | 489 |
| 774 | 3300027907 | Ga0207428_10000947 | Ga0207428_1000094727 | 489 |
| 775 | 3300027907 | Ga0207428_10009986 | Ga0207428_100099863 | 489 |
| 776 | 3300028380 | Ga0268265_10001593 | Ga0268265_1000159313 | 489 |
| 777 | 3300028381 | Ga0268264_10002487 | Ga0268264_1000248713 | 489 |
| 778 | 3300028556 | Ga0265337_1000455 | Ga0265337_10004554 | 489 |
| 779 | 3300028794 | Ga0307515_10114786 | Ga0307515_101147865 | 489 |
| 780 | 3300031235 | Ga0265330_10017507 | Ga0265330_100175073 | 489 |
| 781 | 3300031241 | Ga0265325_10000104 | Ga0265325_1000010429 | 489 |
| 782 | 3300031241 | Ga0265325_10003165 | Ga0265325_100031653 | 489 |
| 783 | 3300031249 | Ga0265339_10008839 | Ga0265339_100088394 | 489 |
| 784 | 3300031249 | Ga0265339_10051603 | Ga0265339_100516032 | 489 |
| 785 | 3300031250 | Ga0265331_10007020 | Ga0265331_100070207 | 489 |
| 786 | 3300031251 | Ga0265327_10025523 | Ga0265327_100255233 | 489 |
| 787 | 3300031595 | Ga0265313_10031332 | Ga0265313_100313322 | 489 |
| 788 | 3300031595 | Ga0265313_10036346 | Ga0265313_100363462 | 489 |
| 789 | 3300031691 | Ga0316579_10014439 | Ga0316579_100144395 | 489 |
| 790 | 3300031712 | Ga0265342_10000807 | Ga0265342_1000080716 | 489 |
| 791 | 3300031712 | Ga0265342_10037987 | Ga0265342_100379872 | 489 |
| 792 | 3300031712 | Ga0265342_10050235 | Ga0265342_100502351 | 489 |
| 793 | 3300032133 | Ga0316583_10009090 | Ga0316583_100090903 | 489 |
| 794 | 3300034816 | Ga0373930_0010010 | Ga0373930_0010010_35_1516 | 489 |
| 795 | 3300034819 | Ga0373958_0009669 | Ga0373958_0009669_94_1563 | 489 |
| 796 | 3300034957 | Ga0373938_0000060 | Ga0373938_0000060_6134_7615 | 489 |
| 797 | 3300035085 | Ga0373929_0000687 | Ga0373929_0000687_1774_3255 | 489 |
| 798 | 3300035088 | Ga0373940_0000468 | Ga0373940_0000468_3810_5291 | 489 |
| 799 | 3300035113 | Ga0373936_0038511 | Ga0373936_0038511_74_1543 | 489 |
| 800 | 3300035114 | Ga0373939_0000354 | Ga0373939_0000354_6450_7931 | 489 |
| 801 | 3300035115 | Ga0373941_0000073 | Ga0373941_0000073_660_2141 | 489 |
| 802 | 3300035119 | Ga0373956_0031854 | Ga0373956_0031854_179_1648 | 489 |
| 803 | 3300035121 | Ga0373960_0000114 | Ga0373960_0000114_6467_7948 | 489 |
| 804 | 3300035171 | Ga0373946_0004481 | Ga0373946_0004481_1424_2893 | 489 |
| 805 | 3300035172 | Ga0373955_0060695 | Ga0373955_0060695_47_1516 | 489 |
| 806 | 3300035207 | Ga0373942_0003137 | Ga0373942_0003137_1722_3203 | 489 |
| 807 | 3300035241 | Ga0373961_0003513 | Ga0373961_0003513_1624_3105 | 489 |
| 808 | 3300035242 | Ga0373962_0002966 | Ga0373962_0002966_759_2240 | 489 |
| 809 | 3300035410 | Ga0373924_0023750 | Ga0373924_0023750_47_1516 | 489 |
| 810 | 3300035691 | Ga0373931_0067262 | Ga0373931_0067262_246_1715 | 489 |
| 811 | 3300035692 | Ga0373935_0026091 | Ga0373935_0026091_2057_3526 | 489 |
| 812 | 3300035695 | Ga0373927_0002642 | Ga0373927_0002642_1919_3397 | 489 |
| 813 | 3300035695 | Ga0373927_0027210 | Ga0373927_0027210_722_2191 | 489 |
| 814 | 3300035695 | Ga0373927_0031545 | Ga0373927_0031545_458_2074 | 489 |
| 815 | 3300035724 | Ga0373933_0030523 | Ga0373933_0030523_1026_2495 | 489 |
| 816 | 3300036401 | Ga0373937_0024244 | Ga0373937_0024244_2033_3502 | 489 |
| 817 | 3300036401 | Ga0373937_0052194 | Ga0373937_0052194_236_1705 | 489 |
| 818 | 3300036401 | Ga0373937_0131703 | Ga0373937_0131703_453_1922 | 489 |
| 819 | 3300037068 | Ga0373925_0047063 | Ga0373925_0047063_934_2403 | 489 |
| 820 | 3300037312 | Ga0395899_0015255 | Ga0395899_0015255_4350_5831 | 489 |
| 821 | 3300037466 | Ga0395898_0017166 | Ga0395898_0017166_3537_5018 | 489 |
| 822 | 3300037466 | Ga0395898_0032856 | Ga0395898_0032856_3675_5153 | 489 |
| 823 | 3300038443 | Ga0395901_0034665 | Ga0395901_0034665_3519_5000 | 489 |
| 824 | 3300044712 | Ga0453684_0190899 | Ga0453684_0190899_887_2356 | 489 |
| 825 | 3300045051 | Ga0451576_0052847 | Ga0451576_0052847_2048_3517 | 489 |
| 826 | 3300046454 | Ga0495592_0045783 | Ga0495592_0045783_853_2337 | 489 |
| 827 | 3300046455 | Ga0495603_0044127 | Ga0495603_0044127_808_2277 | 489 |
| 828 | 3300046459 | Ga0495629_0001773 | Ga0495629_0001773_6371_7840 | 489 |
| 829 | 3300046459 | Ga0495629_0031784 | Ga0495629_0031784_1550_3166 | 489 |
| 830 | 3300046461 | Ga0495641_0012339 | Ga0495641_0012339_3107_4576 | 489 |
| 831 | 3300046461 | Ga0495641_0034862 | Ga0495641_0034862_464_1933 | 489 |
| 832 | 3300046462 | Ga0495651_0008470 | Ga0495651_0008470_2638_4107 | 489 |
| 833 | 3300046462 | Ga0495651_0097345 | Ga0495651_0097345_638_2107 | 489 |
| 834 | 3300046472 | Ga0495580_0016611 | Ga0495580_0016611_2857_4326 | 489 |
| 835 | 3300046472 | Ga0495580_0056438 | Ga0495580_0056438_313_1929 | 489 |
| 836 | 3300046473 | Ga0495582_0006472 | Ga0495582_0006472_1468_2937 | 489 |
| 837 | 3300046473 | Ga0495582_0025590 | Ga0495582_0025590_586_2055 | 489 |
| 838 | 3300046473 | Ga0495582_0049348 | Ga0495582_0049348_777_2246 | 489 |
| 839 | 3300046475 | Ga0495639_0006653 | Ga0495639_0006653_2332_3801 | 489 |
| 840 | 3300046476 | Ga0495662_0066041 | Ga0495662_0066041_119_1735 | 489 |
| 841 | 3300046477 | Ga0495664_0024189 | Ga0495664_0024189_1852_3468 | 489 |
| 842 | 3300046491 | Ga0495584_0006769 | Ga0495584_0006769_824_2293 | 489 |
| 843 | 3300046511 | Ga0495608_0012886 | Ga0495608_0012886_3502_4971 | 489 |
| 844 | 3300046511 | Ga0495608_0031701 | Ga0495608_0031701_123_1592 | 489 |
| 845 | 3300046516 | Ga0495628_0010385 | Ga0495628_0010385_870_2354 | 489 |
| 846 | 3300046516 | Ga0495628_0138095 | Ga0495628_0138095_327_1796 | 489 |
| 847 | 3300046517 | Ga0495630_0071206 | Ga0495630_0071206_175_1791 | 489 |
| 848 | 3300046523 | Ga0495644_0001471 | Ga0495644_0001471_2505_3974 | 489 |
| 849 | 3300046529 | Ga0495652_0066151 | Ga0495652_0066151_814_2283 | 489 |
| 850 | 3300046529 | Ga0495652_0105580 | Ga0495652_0105580_638_2107 | 489 |
| 851 | 3300046529 | Ga0495652_0127499 | Ga0495652_0127499_137_1606 | 489 |
| 852 | 3300046531 | Ga0495665_0040136 | Ga0495665_0040136_115_1584 | 489 |
| 853 | 3300046531 | Ga0495665_0051062 | Ga0495665_0051062_356_1972 | 489 |
| 854 | 3300046535 | Ga0495586_0024634 | Ga0495586_0024634_112_1581 | 489 |
| 855 | 3300046535 | Ga0495586_0043180 | Ga0495586_0043180_174_1643 | 489 |
| 856 | 3300046538 | Ga0495609_0041404 | Ga0495609_0041404_110_1579 | 489 |
| 857 | 3300046558 | Ga0495633_0005211 | Ga0495633_0005211_3876_5345 | 489 |
| 858 | 3300046559 | Ga0495667_0003339 | Ga0495667_0003339_321_1790 | 489 |
| 859 | 3300046559 | Ga0495667_0057610 | Ga0495667_0057610_453_1922 | 489 |
| 860 | 3300046642 | Ga0495634_0038057 | Ga0495634_0038057_819_2288 | 489 |
| 861 | 3300046663 | Ga0495635_0021945 | Ga0495635_0021945_2903_4372 | 489 |
| 862 | 3300046674 | Ga0495588_0019049 | Ga0495588_0019049_1209_2678 | 489 |
| 863 | 3300046678 | Ga0495599_0066980 | Ga0495599_0066980_751_2220 | 489 |
| 864 | 3300046680 | Ga0495646_0008798 | Ga0495646_0008798_3746_5215 | 489 |
| 865 | 3300046680 | Ga0495646_0017575 | Ga0495646_0017575_2248_3717 | 489 |
| 866 | 3300046681 | Ga0495647_0006874 | Ga0495647_0006874_808_2277 | 489 |
| 867 | 3300046683 | Ga0495658_0015235 | Ga0495658_0015235_1963_3432 | 489 |
| 868 | 3300046689 | Ga0495613_0048284 | Ga0495613_0048284_438_1907 | 489 |
| 869 | 3300046690 | Ga0495624_0086706 | Ga0495624_0086706_207_1676 | 489 |
| 870 | 3300046691 | Ga0495670_0002981 | Ga0495670_0002981_6384_7853 | 489 |
| 871 | 3300046809 | Ga0495600_0017400 | Ga0495600_0017400_1037_2506 | 489 |
| 872 | 3300046809 | Ga0495600_0035571 | Ga0495600_0035571_388_1872 | 489 |
| 873 | 3300046809 | Ga0495600_0122294 | Ga0495600_0122294_127_1596 | 489 |
| 874 | 3300047315 | Ga0495581_0005972 | Ga0495581_0005972_1752_3221 | 489 |
| 875 | 3300047315 | Ga0495581_0062463 | Ga0495581_0062463_552_2021 | 489 |
| 876 | 3300047317 | Ga0495604_0030237 | Ga0495604_0030237_1224_2693 | 489 |
| 877 | 3300047317 | Ga0495604_0046732 | Ga0495604_0046732_434_1918 | 489 |
| 878 | 3300047319 | Ga0495674_0079888 | Ga0495674_0079888_487_2103 | 489 |
| 879 | 3300047322 | Ga0495680_0020932 | Ga0495680_0020932_3373_4842 | 489 |
| 880 | 3300047322 | Ga0495680_0042627 | Ga0495680_0042627_1206_2675 | 489 |
| 881 | 3300047322 | Ga0495680_0056380 | Ga0495680_0056380_733_2349 | 489 |
| 882 | 3300047322 | Ga0495680_0075633 | Ga0495680_0075633_814_2283 | 489 |
| 883 | 3300047471 | Ga0495684_0002658 | Ga0495684_0002658_3856_5325 | 489 |
| 884 | 3300047471 | Ga0495684_0056598 | Ga0495684_0056598_568_2184 | 489 |
| 885 | 3300047471 | Ga0495684_0078674 | Ga0495684_0078674_793_2262 | 489 |
| 886 | 3300047673 | Ga0495593_0040071 | Ga0495593_0040071_390_1859 | 489 |
| 887 | 3300047673 | Ga0495593_0055703 | Ga0495593_0055703_245_1714 | 489 |
| 888 | 3300048088 | Ga0495602_0139582 | Ga0495602_0139582_297_1766 | 489 |
| 889 | 3300048089 | Ga0495614_0014751 | Ga0495614_0014751_561_2030 | 489 |
| 890 | 3300048903 | Ga0496100_0001418 | Ga0496100_0001418_8975_10444 | 489 |
| 891 | 3300048904 | Ga0496101_0051688 | Ga0496101_0051688_28_1497 | 489 |
| 892 | 3300048905 | Ga0496102_0000857 | Ga0496102_0000857_5533_7002 | 489 |
| 893 | 3300048905 | Ga0496102_0041108 | Ga0496102_0041108_2183_3652 | 489 |
| 894 | 3300048905 | Ga0496102_0098215 | Ga0496102_0098215_525_2006 | 489 |
| 895 | 3300048906 | Ga0496103_0001402 | Ga0496103_0001402_5419_6888 | 489 |
| 896 | 3300048906 | Ga0496103_0057007 | Ga0496103_0057007_156_1625 | 489 |
| 897 | 3300048907 | Ga0496104_0046190 | Ga0496104_0046190_84_1553 | 489 |
| 898 | 3300048908 | Ga0496105_0021990 | Ga0496105_0021990_1648_3132 | 489 |
| 899 | 3300048908 | Ga0496105_0073183 | Ga0496105_0073183_738_2207 | 489 |
| 900 | 3300048909 | Ga0496106_0004194 | Ga0496106_0004194_7665_9134 | 489 |
| 901 | 3300048909 | Ga0496106_0033306 | Ga0496106_0033306_523_2004 | 489 |
| 902 | 3300048909 | Ga0496106_0078639 | Ga0496106_0078639_261_1730 | 489 |
| 903 | 3300048910 | Ga0496107_0002765 | Ga0496107_0002765_8605_10074 | 489 |
| 904 | 3300048910 | Ga0496107_0021589 | Ga0496107_0021589_2299_3780 | 489 |
| 905 | 3300048911 | Ga0496108_0003866 | Ga0496108_0003866_3128_4597 | 489 |
| 906 | 3300048911 | Ga0496108_0082444 | Ga0496108_0082444_19_1488 | 489 |
| 907 | 3300048912 | Ga0496109_0005368 | Ga0496109_0005368_9091_10560 | 489 |
| 908 | 3300048912 | Ga0496109_0280482 | Ga0496109_0280482_32_1501 | 489 |
| 909 | 3300048913 | Ga0496110_0023567 | Ga0496110_0023567_309_1778 | 489 |
| 910 | 3300048913 | Ga0496110_0065551 | Ga0496110_0065551_1133_2647 | 489 |
| 911 | 3300048913 | Ga0496110_0212132 | Ga0496110_0212132_127_1608 | 489 |
| 912 | 3300048914 | Ga0496111_0014062 | Ga0496111_0014062_2873_4342 | 489 |
| 913 | 3300048915 | Ga0496112_0004182 | Ga0496112_0004182_4472_5941 | 489 |
| 914 | 3300048916 | Ga0496113_0013896 | Ga0496113_0013896_282_1751 | 489 |
| 915 | 3300048916 | Ga0496113_0035238 | Ga0496113_0035238_2150_3619 | 489 |
| 916 | 3300048917 | Ga0496114_0019579 | Ga0496114_0019579_1274_2743 | 489 |
| 917 | 3300048918 | Ga0496115_0003668 | Ga0496115_0003668_1782_3251 | 489 |
| 918 | 3300048918 | Ga0496115_0030609 | Ga0496115_0030609_2084_3553 | 489 |
| 919 | 3300048918 | Ga0496115_0086573 | Ga0496115_0086573_881_2350 | 489 |
| 920 | 3300048920 | Ga0496117_0072620 | Ga0496117_0072620_421_1902 | 489 |
| 921 | 3300048922 | Ga0496119_0000289 | Ga0496119_0000289_50597_52075 | 489 |
| 922 | 3300048925 | Ga0496122_0002313 | Ga0496122_0002313_12004_13482 | 489 |
| 923 | 3300048926 | Ga0496123_0001408 | Ga0496123_0001408_5476_6954 | 489 |
| 924 | 3300049569 | Ga0501032_0116277 | Ga0501032_0116277_71_1552 | 489 |
| 925 | 3300049571 | Ga0501034_0084550 | Ga0501034_0084550_576_2078 | 489 |
| 926 | 3300049571 | Ga0501034_0089856 | Ga0501034_0089856_463_2040 | 489 |
| 927 | 3300049571 | Ga0501034_0095958 | Ga0501034_0095958_213_1682 | 489 |
| 928 | 3300049574 | Ga0501038_0034931 | Ga0501038_0034931_1283_2764 | 489 |
| 929 | 3300049575 | Ga0501039_0050420 | Ga0501039_0050420_54_1631 | 489 |
| 930 | 3300049581 | Ga0501047_0007054 | Ga0501047_0007054_4168_5640 | 489 |
| 931 | 3300049589 | Ga0501073_0016647 | Ga0501073_0016647_329_1798 | 489 |
| 932 | 3300049590 | Ga0501074_0006835 | Ga0501074_0006835_4758_6239 | 489 |
| 933 | 3300049744 | Ga0501083_0077574 | Ga0501083_0077574_686_2155 | 489 |
| 934 | 3300049822 | Ga0501035_0035310 | Ga0501035_0035310_478_2055 | 489 |
| 935 | 3300049822 | Ga0501035_0065534 | Ga0501035_0065534_1172_2671 | 489 |
| 936 | 3300049823 | Ga0501044_0000822 | Ga0501044_0000822_30437_31906 | 489 |
| 937 | 3300049823 | Ga0501044_0026378 | Ga0501044_0026378_1362_2939 | 489 |
| 938 | 3300049823 | Ga0501044_0054761 | Ga0501044_0054761_2225_3694 | 489 |
| 939 | 3300049823 | Ga0501044_0107099 | Ga0501044_0107099_78_1571 | 489 |
| 940 | 3300050507 | nmdc:mga05p37_9895_c1 | nmdc:mga05p37_9895_c1_1331_2809 | 489 |
| 941 | 3300050508 | nmdc:mga09592_1920_c1 | nmdc:mga09592_1920_c1_12763_14241 | 489 |
| 942 | 3300050510 | nmdc:mga06r32_5477_c1 | nmdc:mga06r32_5477_c1_2636_4114 | 489 |
| 943 | 3300050511 | nmdc:mga08y16_3365_c1 | nmdc:mga08y16_3365_c1_12969_14447 | 489 |
| 944 | 3300050511 | nmdc:mga08y16_77112_c1 | nmdc:mga08y16_77112_c1_1996_3465 | 489 |
| 945 | 3300050512 | nmdc:mga0n895_6097_c1 | nmdc:mga0n895_6097_c1_7240_8709 | 489 |
| 946 | 3300050512 | nmdc:mga0n895_62267_c1 | nmdc:mga0n895_62267_c1_2167_3636 | 489 |
| 947 | 3300050512 | nmdc:mga0n895_79771_c1 | nmdc:mga0n895_79771_c1_1403_2872 | 489 |
| 948 | 3300050512 | nmdc:mga0n895_80865_c1 | nmdc:mga0n895_80865_c1_174_1643 | 489 |
| 949 | 3300050513 | nmdc:mga0rr50_52137_c1 | nmdc:mga0rr50_52137_c1_729_2198 | 489 |
| 950 | 3300050515 | nmdc:mga0a205_2212_c1 | nmdc:mga0a205_2212_c1_3430_4899 | 489 |
| 951 | 3300053077 | Ga0495601_0001731 | Ga0495601_0001731_9826_11295 | 489 |
| 952 | 3300053077 | Ga0495601_0002237 | Ga0495601_0002237_8234_9718 | 489 |
| 953 | 3300053077 | Ga0495601_0008863 | Ga0495601_0008863_3658_5127 | 489 |
| 954 | 3300053077 | Ga0495601_0112276 | Ga0495601_0112276_167_1636 | 489 |
| 955 | 3300053078 | Ga0495612_0000795 | Ga0495612_0000795_314_1798 | 489 |
| 956 | 3300053078 | Ga0495612_0043062 | Ga0495612_0043062_295_1764 | 489 |
| 957 | 3300053080 | Ga0500635_0011818 | Ga0500635_0011818_825_2381 | 489 |
| 958 | 3300053084 | Ga0495595_0003051 | Ga0495595_0003051_2857_4326 | 489 |
| 959 | 3300053084 | Ga0495595_0026835 | Ga0495595_0026835_271_1740 | 489 |
| 960 | 3300053085 | Ga0495619_0000043 | Ga0495619_0000043_99495_100964 | 489 |
| 961 | 3300053085 | Ga0495619_0003586 | Ga0495619_0003586_7671_9155 | 489 |
| 962 | 3300053085 | Ga0495619_0010551 | Ga0495619_0010551_4055_5524 | 489 |
| 963 | 3300053085 | Ga0495619_0019129 | Ga0495619_0019129_366_1835 | 489 |
| 964 | 3300053085 | Ga0495619_0065301 | Ga0495619_0065301_109_1578 | 489 |
| 965 | 3300053087 | Ga0500643_001914 | Ga0500643_001914_825_2294 | 489 |
| 966 | 3300053096 | Ga0500641_0008875 | Ga0500641_0008875_1638_3107 | 489 |
| 967 | 3300053119 | Ga0500595_000002 | Ga0500595_000002_335290_336759 | 489 |
| 968 | 3300053122 | Ga0500608_000278 | Ga0500608_000278_1426_3021 | 489 |
| 969 | 3300053131 | Ga0500652_019680 | Ga0500652_019680_191_1663 | 489 |
| 970 | 3300053153 | Ga0500616_0000002 | Ga0500616_0000002_409138_410610 | 489 |
| 971 | 3300053177 | Ga0500636_0014409 | Ga0500636_0014409_448_1929 | 489 |
| 972 | 3300053730 | Ga0500645_000410 | Ga0500645_000410_18296_19768 | 489 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4wj3-assembly2.cif.gz_H | crystal structure of the asparagine transamidosome from pseudomonas aeruginosa | 0.9473 | 18 | 414 |
| 3h0l-assembly2.cif.gz_E | structure of trna-dependent amidotransferase gatcab from aquifex aeolicus | 0.9098 | 18 | 422 |
| 2g5h-assembly1.cif.gz_B | structure of trna-dependent amidotransferase gatcab | 0.9082 | 19 | 409 |
| 3h0l-assembly2.cif.gz_E | structure of trna-dependent amidotransferase gatcab from aquifex aeolicus | 0.8973 | 18 | 422 |
| 4n0i-assembly1.cif.gz_B | crystal structure of s. cerevisiae mitochondrial gatfab in complex with glutamine | 0.895 | 19 | 313 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I1KQC8_485_546_1.10.10.410 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A; | 0.968 | 428 | 487 | 1.10.10.410 |
| af_M0R4L6_495_556_1.10.10.410 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A; | 0.965 | 428 | 487 | 1.10.10.410 |
| af_Q2FWZ0_412_475_1.10.10.410 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A; | 0.9616 | 428 | 488 | 1.10.10.410 |
| af_Q99JT1_495_556_1.10.10.410 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A; | 0.9585 | 428 | 487 | 1.10.10.410 |
| af_O75879_495_556_1.10.10.410 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A; | 0.9581 | 428 | 487 | 1.10.10.410 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6A7GDB6-F1-model_v4 | Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase GatCAB subunit B | 0.9666 | 63 | 487 |
GO:0005524
GO:0006412 GO:0016740 GO:0050567 GO:0070681 |
| AF-A0A7C5SBX2-F1-model_v4 | Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatB | 0.9654 | 6 | 251 |
GO:0005524
GO:0006412 GO:0050567 GO:0070681 |
| AF-A0A7Y5VUE2-F1-model_v4 | deleted | 0.9652 | 374 | 489 |
|
| AF-A0A7C1U5C9-F1-model_v4 | Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase GatCAB subunit B (EC 6.3.5.-) | 0.9649 | 10 | 243 |
GO:0005524
GO:0006412 GO:0050567 GO:0070681 |
| AF-D1KEA0-F1-model_v4 | Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B (Asp/Glu-ADT subunit B) (EC 6.3.5.-) | 0.9641 | 18 | 412 |
GO:0005524
GO:0006412 GO:0016740 GO:0050566 GO:0050567 GO:0070681 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar