F487143
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 972 | 374 | 959 | 131 |
Family's Representative Sequence
| Representative Sequence | 3300005841|Ga0068863_100033434|Ga0068863_1000334342 |
| Length | 156 |
| Sequence | MMGTAQSILGTDRGMPGVSHLKGRAMRRNETPEGKSVRLLRVGEQVRHALSDILSRGEVHDETLAEHMVSVTEVRMSPDLRHATVFVKPLLGADEEAVIKALRTNTAFLQSEVARRVNTKYAAKLKFLADESFDEGSHIDRLLRDPAIARDLGKDE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2512564014 | Sphingobium sp. AP49 | Isolate | Rhizosphere |
| 3 | 2643221541 | Sphingomonas sp. Root50 | Isolate | Unclassified |
| 4 | 2643221560 | Sphingopyxis sp. Root1497 | Isolate | Unclassified |
| 5 | 2643221605 | Sphingomonas sp. Root710 | Isolate | Unclassified |
| 6 | 2643221606 | Sphingomonas sp. Root720 | Isolate | Unclassified |
| 7 | 2643221671 | Sphingomonas sp. Root1294 | Isolate | Unclassified |
| 8 | 2818991466 | Sphingomonas trueperi 1152a | Isolate | Unclassified |
| 9 | 2852680915 | Sphingopyxis sp. JAI128 | Isolate | Rhizosphere |
| 10 | 2879163058 | Sphingomonas pokkalii L3B27 | Isolate | Rhizosphere |
| 11 | 2885427238 | Sphingomonas mesophila SYSUP0001 | Isolate | Stem Tuber |
| 12 | 2928526807 | Sphingomonas trueperi 1770 | Isolate | Rhizosphere |
| 13 | 2928968154 | Sphingomonas trueperi 1075 | Isolate | Unclassified |
| 14 | 2984564862 | Sphingomonas sp. SORGH_AS870 | Isolate | Aerial Root |
| 15 | 3300001426 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 | Metagenome | Rhizosphere |
| 16 | 3300001432 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 17 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 18 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 19 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 20 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 21 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 22 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 23 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 24 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 25 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 26 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 27 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 28 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 29 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 30 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 31 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 32 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 33 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 34 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 35 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 36 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 37 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 38 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 39 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 40 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 41 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 42 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 43 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 44 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 47 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 50 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 53 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 55 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 66 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 75 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 76 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 77 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 78 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 79 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 80 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 82 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 83 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 85 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 87 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 88 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 89 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 90 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 91 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 92 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 93 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 94 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 95 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 96 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 97 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 98 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 99 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 100 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 101 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 102 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 103 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 104 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 106 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 107 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 108 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300012475 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 | Metagenome | Rhizosphere |
| 123 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 124 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 136 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 140 | 3300016635 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 | Metagenome | Rhizosphere |
| 141 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 143 | 3300025223 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 147 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 151 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 213 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 217 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 218 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 219 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 220 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 221 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 222 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 223 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 224 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 225 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 226 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 227 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 228 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 229 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 230 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 231 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 232 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 233 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 234 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 235 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 236 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 237 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 238 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 239 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 240 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 241 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 242 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 243 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 244 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 245 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 246 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 247 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 248 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 249 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 250 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 251 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 290 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 291 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 292 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 293 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 294 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 295 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 296 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 297 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 298 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 299 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 300 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 301 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 302 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 303 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 304 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 305 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 306 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 307 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 308 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 309 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 310 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 311 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 312 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 313 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 314 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 315 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 316 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 317 | 3300049525 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F21_B_7_control | Metagenome | Rhizosphere |
| 318 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 319 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 322 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 326 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 327 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 330 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 331 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 333 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 334 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 335 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 336 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 337 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 338 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 339 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 340 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 341 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 342 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 343 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 344 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 345 | 3300049761 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control | Metagenome | Rhizosphere |
| 346 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 347 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 348 | 3300049777 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control | Metagenome | Rhizosphere |
| 349 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 350 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 353 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 354 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 355 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 356 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 357 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 358 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 359 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 360 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 361 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 362 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 363 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 364 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 365 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 366 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 367 | 3300053144 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere | Metagenome | Endosphere |
| 368 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 369 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 370 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 371 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 372 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 373 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 374 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.46 |
| Metatranscriptomes | 0.21 |
| Isolates | 1.34 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.1 |
| Bulb | 0 |
| Endosphere | 5.97 |
| Nodule | 0 |
| Rhizoplane | 2.37 |
| Rhizosphere | 86.93 |
| Stem | 0 |
| Stem Tuber | 0.1 |
| Unclassified | 4.53 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1847577 | 2162886007 | Bacteria | 1147 |
| 2 | JGI24030J14995_101362 | 3300001426 | Bacteria | 857 |
| 3 | JGI24034J14986_103069 | 3300001432 | Bacteria | 802 |
| 4 | JGI24741J21665_1005545 | 3300001915 | Bacteria | 2627 |
| 5 | JGI24752J21851_1000011 | 3300001976 | Bacteria | 20640 |
| 6 | JGI24752J21851_1000787 | 3300001976 | Bacteria | 4272 |
| 7 | JGI24752J21851_1048343 | 3300001976 | Bacteria | 576 |
| 8 | JGI24746J21847_1026031 | 3300001977 | Bacteria | 808 |
| 9 | JGI24740J21852_10008187 | 3300001979 | Bacteria | 4190 |
| 10 | JGI24740J21852_10020499 | 3300001979 | Bacteria | 2304 |
| 11 | JGI24740J21852_10050872 | 3300001979 | Bacteria | 1189 |
| 12 | JGI24740J21852_10084230 | 3300001979 | Bacteria | 828 |
| 13 | JGI24739J22299_10012359 | 3300001989 | Bacteria | 3136 |
| 14 | JGI24737J22298_10012282 | 3300001990 | Bacteria | 2791 |
| 15 | JGI24737J22298_10032459 | 3300001990 | Bacteria | 1626 |
| 16 | JGI24737J22298_10035296 | 3300001990 | Bacteria | 1547 |
| 17 | JGI24737J22298_10157564 | 3300001990 | Bacteria | 670 |
| 18 | JGI24737J22298_10162797 | 3300001990 | Bacteria | 659 |
| 19 | JGI24735J21928_10154245 | 3300002067 | Bacteria | 663 |
| 20 | JGI24750J21931_1000739 | 3300002070 | Bacteria | 4682 |
| 21 | JGI24748J21848_1000044 | 3300002074 | Bacteria | 59119 |
| 22 | JGI24749J21850_1000180 | 3300002076 | Bacteria | 10123 |
| 23 | JGI24749J21850_1004130 | 3300002076 | Bacteria | 2028 |
| 24 | JGI24749J21850_1012167 | 3300002076 | Bacteria | 1209 |
| 25 | JGI24034J26672_10000020 | 3300002239 | Bacteria | 122643 |
| 26 | JGI24034J26672_10035881 | 3300002239 | Bacteria | 821 |
| 27 | JGI24742J22300_10055040 | 3300002244 | Bacteria | 725 |
| 28 | JGI24751J29686_10000034 | 3300002459 | Bacteria | 86962 |
| 29 | JGI24751J29686_10013615 | 3300002459 | Bacteria | 1678 |
| 30 | JGI24751J29686_10027125 | 3300002459 | Bacteria | 1189 |
| 31 | JGI25153J46596_10000075 | 3300003215 | Bacteria | 114168 |
| 32 | Ga0055525_1000058 | 3300003759 | Bacteria | 210367 |
| 33 | Ga0055542_1000259 | 3300003762 | Bacteria | 59537 |
| 34 | Ga0055529_1000301 | 3300003763 | Bacteria | 56819 |
| 35 | Ga0055534_1007285 | 3300003784 | Bacteria | 2658 |
| 36 | Ga0055530_10000012 | 3300003791 | Bacteria | 164829 |
| 37 | Ga0055540_1000935 | 3300003792 | Bacteria | 19026 |
| 38 | Ga0055531_10004440 | 3300003794 | Bacteria | 8536 |
| 39 | Ga0055531_10010086 | 3300003794 | Bacteria | 4743 |
| 40 | Ga0065165_1014358 | 3300005262 | Bacteria | 3081 |
| 41 | Ga0065714_10260705 | 3300005288 | Bacteria | 757 |
| 42 | Ga0065704_10093266 | 3300005289 | Bacteria | 2607 |
| 43 | Ga0065712_10007663 | 3300005290 | Bacteria | 3117 |
| 44 | Ga0065712_10078419 | 3300005290 | Bacteria | 3349 |
| 45 | Ga0065715_10011341 | 3300005293 | Bacteria | 2357 |
| 46 | Ga0065715_10052118 | 3300005293 | Bacteria | 966 |
| 47 | Ga0065715_10413386 | 3300005293 | Bacteria | 867 |
| 48 | Ga0065715_10496833 | 3300005293 | Bacteria | 783 |
| 49 | Ga0065707_10026456 | 3300005295 | Bacteria | 1136 |
| 50 | Ga0065707_10097761 | 3300005295 | Bacteria | 3144 |
| 51 | Ga0065707_10181440 | 3300005295 | Bacteria | 1416 |
| 52 | Ga0070658_10028060 | 3300005327 | Bacteria | 4518 |
| 53 | Ga0070658_10097226 | 3300005327 | Bacteria | 2431 |
| 54 | Ga0070658_10103278 | 3300005327 | Bacteria | 2357 |
| 55 | Ga0070658_10108465 | 3300005327 | Bacteria | 2298 |
| 56 | Ga0070658_10134928 | 3300005327 | Bacteria | 2058 |
| 57 | Ga0070658_10218938 | 3300005327 | Bacteria | 1610 |
| 58 | Ga0070658_10315931 | 3300005327 | Bacteria | 1333 |
| 59 | Ga0070658_10933806 | 3300005327 | Bacteria | 754 |
| 60 | Ga0070658_11110562 | 3300005327 | Bacteria | 688 |
| 61 | Ga0070676_10079810 | 3300005328 | Bacteria | 1982 |
| 62 | Ga0070676_10450265 | 3300005328 | Bacteria | 905 |
| 63 | Ga0070690_100000181 | 3300005330 | Bacteria | 32447 |
| 64 | Ga0070670_100000033 | 3300005331 | Bacteria | 158509 |
| 65 | Ga0070670_100002658 | 3300005331 | Bacteria | 14775 |
| 66 | Ga0070670_100019396 | 3300005331 | Bacteria | 5836 |
| 67 | Ga0070670_100024157 | 3300005331 | Bacteria | 5229 |
| 68 | Ga0070670_100029945 | 3300005331 | Bacteria | 4687 |
| 69 | Ga0070670_100061850 | 3300005331 | Bacteria | 3214 |
| 70 | Ga0070670_100185225 | 3300005331 | Bacteria | 1808 |
| 71 | Ga0070670_100274388 | 3300005331 | Bacteria | 1472 |
| 72 | Ga0070677_10081804 | 3300005333 | Bacteria | 1383 |
| 73 | Ga0070677_10247580 | 3300005333 | Bacteria | 883 |
| 74 | Ga0068869_100351559 | 3300005334 | Bacteria | 1201 |
| 75 | Ga0068869_101200252 | 3300005334 | Bacteria | 667 |
| 76 | Ga0070666_10000027 | 3300005335 | Bacteria | 151010 |
| 77 | Ga0070666_10005298 | 3300005335 | Bacteria | 7902 |
| 78 | Ga0070666_10286186 | 3300005335 | Bacteria | 1172 |
| 79 | Ga0070666_10485366 | 3300005335 | Bacteria | 895 |
| 80 | Ga0070680_100567718 | 3300005336 | Bacteria | 973 |
| 81 | Ga0070680_101023284 | 3300005336 | Bacteria | 713 |
| 82 | Ga0068868_100890437 | 3300005338 | Bacteria | 808 |
| 83 | Ga0068868_101268816 | 3300005338 | Bacteria | 683 |
| 84 | Ga0070660_100001180 | 3300005339 | Bacteria | 17685 |
| 85 | Ga0070660_100012188 | 3300005339 | Bacteria | 6138 |
| 86 | Ga0070660_100013865 | 3300005339 | Bacteria | 5798 |
| 87 | Ga0070660_100043892 | 3300005339 | Bacteria | 3417 |
| 88 | Ga0070660_100077685 | 3300005339 | Bacteria | 2602 |
| 89 | Ga0070660_100421373 | 3300005339 | Bacteria | 1105 |
| 90 | Ga0070660_100583839 | 3300005339 | Bacteria | 933 |
| 91 | Ga0070689_100000953 | 3300005340 | Bacteria | 18027 |
| 92 | Ga0070691_10084779 | 3300005341 | Bacteria | 1556 |
| 93 | Ga0070687_100347145 | 3300005343 | Bacteria | 956 |
| 94 | Ga0070661_100003713 | 3300005344 | Bacteria | 10521 |
| 95 | Ga0070661_100065866 | 3300005344 | Bacteria | 2662 |
| 96 | Ga0070661_100498434 | 3300005344 | Bacteria | 974 |
| 97 | Ga0070692_10013089 | 3300005345 | Bacteria | 3860 |
| 98 | Ga0070668_100000003 | 3300005347 | Bacteria | 195738 |
| 99 | Ga0070668_100117911 | 3300005347 | Bacteria | 2119 |
| 100 | Ga0070668_100153324 | 3300005347 | Bacteria | 1865 |
| 101 | Ga0070669_100000099 | 3300005353 | Bacteria | 85328 |
| 102 | Ga0070669_100000550 | 3300005353 | Bacteria | 27867 |
| 103 | Ga0070669_100087151 | 3300005353 | Bacteria | 2334 |
| 104 | Ga0070669_100143248 | 3300005353 | Bacteria | 1844 |
| 105 | Ga0070669_100204177 | 3300005353 | Bacteria | 1556 |
| 106 | Ga0070669_100232753 | 3300005353 | Bacteria | 1461 |
| 107 | Ga0070669_100265429 | 3300005353 | Bacteria | 1371 |
| 108 | Ga0070669_100360596 | 3300005353 | Bacteria | 1182 |
| 109 | Ga0070675_100003988 | 3300005354 | Bacteria | 11199 |
| 110 | Ga0070675_100179961 | 3300005354 | Bacteria | 1828 |
| 111 | Ga0070671_100000639 | 3300005355 | Bacteria | 25051 |
| 112 | Ga0070671_100001942 | 3300005355 | Bacteria | 15851 |
| 113 | Ga0070671_100108548 | 3300005355 | Bacteria | 2330 |
| 114 | Ga0070671_100122949 | 3300005355 | Bacteria | 2184 |
| 115 | Ga0070671_100151675 | 3300005355 | Bacteria | 1957 |
| 116 | Ga0070671_100260332 | 3300005355 | Bacteria | 1474 |
| 117 | Ga0070671_100371700 | 3300005355 | Bacteria | 1221 |
| 118 | Ga0070671_100410641 | 3300005355 | Bacteria | 1159 |
| 119 | Ga0070671_100594184 | 3300005355 | Bacteria | 956 |
| 120 | Ga0070671_100984581 | 3300005355 | Bacteria | 738 |
| 121 | Ga0070674_100058426 | 3300005356 | Bacteria | 2681 |
| 122 | Ga0070674_100092464 | 3300005356 | Bacteria | 2187 |
| 123 | Ga0070673_100029821 | 3300005364 | Bacteria | 4073 |
| 124 | Ga0070673_100129447 | 3300005364 | Bacteria | 2115 |
| 125 | Ga0070673_100152150 | 3300005364 | Bacteria | 1960 |
| 126 | Ga0070688_100012042 | 3300005365 | Bacteria | 4832 |
| 127 | Ga0070688_100951444 | 3300005365 | Bacteria | 680 |
| 128 | Ga0070659_100010103 | 3300005366 | Bacteria | 6949 |
| 129 | Ga0070659_100075858 | 3300005366 | Bacteria | 2680 |
| 130 | Ga0070659_100133100 | 3300005366 | Bacteria | 2020 |
| 131 | Ga0070659_100198711 | 3300005366 | Bacteria | 1650 |
| 132 | Ga0070659_100442487 | 3300005366 | Bacteria | 1101 |
| 133 | Ga0070659_101190214 | 3300005366 | Bacteria | 674 |
| 134 | Ga0070667_100000035 | 3300005367 | Bacteria | 173461 |
| 135 | Ga0070667_100000509 | 3300005367 | Bacteria | 39258 |
| 136 | Ga0070667_100015419 | 3300005367 | Bacteria | 6318 |
| 137 | Ga0070667_100020105 | 3300005367 | Bacteria | 5543 |
| 138 | Ga0070667_100040433 | 3300005367 | Bacteria | 3911 |
| 139 | Ga0070667_100181031 | 3300005367 | Bacteria | 1864 |
| 140 | Ga0070667_100242231 | 3300005367 | Bacteria | 1610 |
| 141 | Ga0070667_100445799 | 3300005367 | Bacteria | 1182 |
| 142 | Ga0070667_100986147 | 3300005367 | Bacteria | 786 |
| 143 | Ga0070713_100033391 | 3300005436 | Bacteria | 4121 |
| 144 | Ga0070701_10037166 | 3300005438 | Bacteria | 2457 |
| 145 | Ga0070701_11157890 | 3300005438 | Bacteria | 547 |
| 146 | Ga0070700_100472007 | 3300005441 | Bacteria | 959 |
| 147 | Ga0070700_101974148 | 3300005441 | Bacteria | 506 |
| 148 | Ga0070663_100055977 | 3300005455 | Bacteria | 2825 |
| 149 | Ga0070663_100060393 | 3300005455 | Bacteria | 2727 |
| 150 | Ga0070663_100085279 | 3300005455 | Bacteria | 2330 |
| 151 | Ga0070663_100181265 | 3300005455 | Bacteria | 1634 |
| 152 | Ga0070663_100485545 | 3300005455 | Bacteria | 1023 |
| 153 | Ga0070678_100000997 | 3300005456 | Bacteria | 14672 |
| 154 | Ga0070678_100096872 | 3300005456 | Bacteria | 2277 |
| 155 | Ga0070678_100172839 | 3300005456 | Bacteria | 1761 |
| 156 | Ga0070662_100000679 | 3300005457 | Bacteria | 20773 |
| 157 | Ga0070662_100101062 | 3300005457 | Bacteria | 2182 |
| 158 | Ga0070662_100161403 | 3300005457 | Bacteria | 1753 |
| 159 | Ga0070662_100209328 | 3300005457 | Bacteria | 1551 |
| 160 | Ga0070662_100274360 | 3300005457 | Bacteria | 1362 |
| 161 | Ga0070662_100299832 | 3300005457 | Bacteria | 1305 |
| 162 | Ga0070681_10498477 | 3300005458 | Bacteria | 1131 |
| 163 | Ga0068867_100007156 | 3300005459 | Bacteria | 7885 |
| 164 | Ga0070685_10000040 | 3300005466 | Bacteria | 77295 |
| 165 | Ga0070685_10714771 | 3300005466 | Bacteria | 732 |
| 166 | Ga0070679_100168636 | 3300005530 | Bacteria | 2162 |
| 167 | Ga0070679_100251467 | 3300005530 | Bacteria | 1723 |
| 168 | Ga0070679_100383727 | 3300005530 | Bacteria | 1352 |
| 169 | Ga0070679_101376866 | 3300005530 | Bacteria | 652 |
| 170 | Ga0070679_101430792 | 3300005530 | Bacteria | 638 |
| 171 | Ga0070684_100916936 | 3300005535 | Bacteria | 821 |
| 172 | Ga0068853_100086702 | 3300005539 | Bacteria | 2746 |
| 173 | Ga0068853_100101653 | 3300005539 | Bacteria | 2542 |
| 174 | Ga0068853_100114920 | 3300005539 | Bacteria | 2394 |
| 175 | Ga0068853_100725374 | 3300005539 | Bacteria | 949 |
| 176 | Ga0068853_100910447 | 3300005539 | Bacteria | 845 |
| 177 | Ga0070672_100040513 | 3300005543 | Bacteria | 3574 |
| 178 | Ga0070672_100178963 | 3300005543 | Bacteria | 1766 |
| 179 | Ga0070672_100216640 | 3300005543 | Bacteria | 1605 |
| 180 | Ga0070686_100000010 | 3300005544 | Bacteria | 192116 |
| 181 | Ga0070695_101196000 | 3300005545 | Bacteria | 625 |
| 182 | Ga0070665_100000254 | 3300005548 | Bacteria | 88587 |
| 183 | Ga0070665_100005616 | 3300005548 | Bacteria | 12900 |
| 184 | Ga0070665_100057545 | 3300005548 | Bacteria | 3897 |
| 185 | Ga0070665_100301874 | 3300005548 | Bacteria | 1604 |
| 186 | Ga0068855_100000348 | 3300005563 | Bacteria | 57384 |
| 187 | Ga0068855_100002453 | 3300005563 | Bacteria | 22922 |
| 188 | Ga0068855_100600833 | 3300005563 | Bacteria | 1186 |
| 189 | Ga0068855_100744393 | 3300005563 | Bacteria | 1046 |
| 190 | Ga0068855_101279963 | 3300005563 | Bacteria | 760 |
| 191 | Ga0070664_100085729 | 3300005564 | Bacteria | 2721 |
| 192 | Ga0070664_100282630 | 3300005564 | Bacteria | 1497 |
| 193 | Ga0070664_100652007 | 3300005564 | Bacteria | 978 |
| 194 | Ga0070664_101180499 | 3300005564 | Bacteria | 722 |
| 195 | Ga0068857_100056493 | 3300005577 | Bacteria | 3483 |
| 196 | Ga0068857_100185348 | 3300005577 | Bacteria | 1894 |
| 197 | Ga0068857_100689418 | 3300005577 | Bacteria | 970 |
| 198 | Ga0068857_101052430 | 3300005577 | Bacteria | 784 |
| 199 | Ga0068857_101799232 | 3300005577 | Bacteria | 599 |
| 200 | Ga0068854_100032460 | 3300005578 | Bacteria | 3633 |
| 201 | Ga0068854_100034758 | 3300005578 | Bacteria | 3523 |
| 202 | Ga0068856_100293740 | 3300005614 | Bacteria | 1642 |
| 203 | Ga0068856_102258836 | 3300005614 | Bacteria | 552 |
| 204 | Ga0068852_100514330 | 3300005616 | Bacteria | 1194 |
| 205 | Ga0068852_100532963 | 3300005616 | Bacteria | 1173 |
| 206 | Ga0068852_100696265 | 3300005616 | Bacteria | 1026 |
| 207 | Ga0068852_102007250 | 3300005616 | Bacteria | 600 |
| 208 | Ga0068852_102565391 | 3300005616 | Bacteria | 529 |
| 209 | Ga0068859_100001213 | 3300005617 | Bacteria | 26290 |
| 210 | Ga0068859_100002941 | 3300005617 | Bacteria | 17280 |
| 211 | Ga0068859_100012656 | 3300005617 | Bacteria | 8481 |
| 212 | Ga0068859_100013746 | 3300005617 | Bacteria | 8116 |
| 213 | Ga0068859_100027021 | 3300005617 | Bacteria | 5757 |
| 214 | Ga0068859_100536646 | 3300005617 | Bacteria | 1264 |
| 215 | Ga0068859_100724386 | 3300005617 | Bacteria | 1084 |
| 216 | Ga0068859_102183913 | 3300005617 | Bacteria | 611 |
| 217 | Ga0068864_100000042 | 3300005618 | Bacteria | 162930 |
| 218 | Ga0068864_100010035 | 3300005618 | Bacteria | 7818 |
| 219 | Ga0068864_100019119 | 3300005618 | Bacteria | 5726 |
| 220 | Ga0068864_100055855 | 3300005618 | Bacteria | 3410 |
| 221 | Ga0068864_100181101 | 3300005618 | Bacteria | 1927 |
| 222 | Ga0068864_100711408 | 3300005618 | Bacteria | 982 |
| 223 | Ga0068866_10312721 | 3300005718 | Bacteria | 985 |
| 224 | Ga0068861_100007077 | 3300005719 | Bacteria | 7675 |
| 225 | Ga0068861_100018588 | 3300005719 | Bacteria | 4952 |
| 226 | Ga0068861_100018823 | 3300005719 | Bacteria | 4924 |
| 227 | Ga0068861_100021530 | 3300005719 | Bacteria | 4634 |
| 228 | Ga0068861_100037161 | 3300005719 | Bacteria | 3620 |
| 229 | Ga0068861_100449408 | 3300005719 | Bacteria | 1154 |
| 230 | Ga0068861_100666677 | 3300005719 | Bacteria | 963 |
| 231 | Ga0068861_101034052 | 3300005719 | Bacteria | 786 |
| 232 | Ga0068851_10168097 | 3300005834 | Bacteria | 1208 |
| 233 | Ga0068851_10387881 | 3300005834 | Bacteria | 819 |
| 234 | Ga0068863_100000083 | 3300005841 | Bacteria | 104757 |
| 235 | Ga0068863_100012480 | 3300005841 | Bacteria | 8202 |
| 236 | Ga0068863_100033434 | 3300005841 | Bacteria | 4899 |
| 237 | Ga0068863_100035622 | 3300005841 | Bacteria | 4739 |
| 238 | Ga0068863_100132562 | 3300005841 | Bacteria | 2379 |
| 239 | Ga0068858_100001162 | 3300005842 | Bacteria | 27292 |
| 240 | Ga0068858_100009853 | 3300005842 | Bacteria | 9081 |
| 241 | Ga0068858_100016027 | 3300005842 | Bacteria | 7040 |
| 242 | Ga0068858_100029286 | 3300005842 | Bacteria | 5112 |
| 243 | Ga0068858_101942137 | 3300005842 | Bacteria | 582 |
| 244 | Ga0068860_100000080 | 3300005843 | Bacteria | 170152 |
| 245 | Ga0068860_100000143 | 3300005843 | Bacteria | 116787 |
| 246 | Ga0068860_100026111 | 3300005843 | Bacteria | 5633 |
| 247 | Ga0068860_100026902 | 3300005843 | Bacteria | 5543 |
| 248 | Ga0068860_100067443 | 3300005843 | Bacteria | 3400 |
| 249 | Ga0068860_100084797 | 3300005843 | Bacteria | 3013 |
| 250 | Ga0068860_100759394 | 3300005843 | Bacteria | 982 |
| 251 | Ga0068862_100000005 | 3300005844 | Bacteria | 350713 |
| 252 | Ga0068862_100000115 | 3300005844 | Bacteria | 94951 |
| 253 | Ga0068862_100000168 | 3300005844 | Bacteria | 72749 |
| 254 | Ga0068862_100308568 | 3300005844 | Bacteria | 1458 |
| 255 | Ga0068862_100501247 | 3300005844 | Bacteria | 1152 |
| 256 | Ga0068862_100588523 | 3300005844 | Bacteria | 1067 |
| 257 | Ga0081455_10000294 | 3300005937 | Bacteria | 66269 |
| 258 | Ga0075363_100360428 | 3300006048 | Bacteria | 850 |
| 259 | Ga0075364_10218803 | 3300006051 | Bacteria | 1292 |
| 260 | Ga0075369_10102425 | 3300006186 | Bacteria | 1285 |
| 261 | Ga0075366_10045145 | 3300006195 | Bacteria | 2611 |
| 262 | Ga0075366_10166487 | 3300006195 | Bacteria | 1337 |
| 263 | Ga0097621_100196814 | 3300006237 | Bacteria | 1748 |
| 264 | Ga0075370_10983137 | 3300006353 | Bacteria | 517 |
| 265 | Ga0068871_100510299 | 3300006358 | Bacteria | 1085 |
| 266 | Ga0068871_101829113 | 3300006358 | Bacteria | 577 |
| 267 | Ga0075434_102190148 | 3300006871 | Bacteria | 557 |
| 268 | Ga0097620_100001213 | 3300006931 | Bacteria | 26290 |
| 269 | Ga0097620_100002941 | 3300006931 | Bacteria | 17280 |
| 270 | Ga0097620_100012657 | 3300006931 | Bacteria | 8481 |
| 271 | Ga0097620_100013744 | 3300006931 | Bacteria | 8116 |
| 272 | Ga0097620_100027021 | 3300006931 | Bacteria | 5757 |
| 273 | Ga0097620_100536633 | 3300006931 | Bacteria | 1264 |
| 274 | Ga0097620_100724412 | 3300006931 | Bacteria | 1084 |
| 275 | Ga0097620_102183347 | 3300006931 | Bacteria | 611 |
| 276 | Ga0105251_10005042 | 3300009011 | Bacteria | 8763 |
| 277 | Ga0105251_10155750 | 3300009011 | Bacteria | 1031 |
| 278 | Ga0105250_10012794 | 3300009092 | Bacteria | 3456 |
| 279 | Ga0105250_10138297 | 3300009092 | Bacteria | 1008 |
| 280 | Ga0105240_10022660 | 3300009093 | Bacteria | 8321 |
| 281 | Ga0105240_10061647 | 3300009093 | Bacteria | 4674 |
| 282 | Ga0105240_11506374 | 3300009093 | Bacteria | 705 |
| 283 | Ga0111539_10794666 | 3300009094 | Bacteria | 1101 |
| 284 | Ga0114129_10345493 | 3300009147 | Bacteria | 1972 |
| 285 | Ga0114129_12579388 | 3300009147 | Bacteria | 607 |
| 286 | Ga0105241_10184359 | 3300009174 | Bacteria | 1733 |
| 287 | Ga0105241_10197524 | 3300009174 | Bacteria | 1678 |
| 288 | Ga0105241_11828686 | 3300009174 | Bacteria | 593 |
| 289 | Ga0105242_10055407 | 3300009176 | Bacteria | 3243 |
| 290 | Ga0105242_11435441 | 3300009176 | Bacteria | 719 |
| 291 | Ga0105248_10000061 | 3300009177 | Bacteria | 125706 |
| 292 | Ga0105248_10016770 | 3300009177 | Bacteria | 8066 |
| 293 | Ga0105248_10274961 | 3300009177 | Bacteria | 1896 |
| 294 | Ga0105248_10313327 | 3300009177 | Bacteria | 1767 |
| 295 | Ga0105248_10388843 | 3300009177 | Bacteria | 1570 |
| 296 | Ga0105248_10860954 | 3300009177 | Bacteria | 1023 |
| 297 | Ga0105237_10179765 | 3300009545 | Bacteria | 2116 |
| 298 | Ga0105237_10394207 | 3300009545 | Bacteria | 1389 |
| 299 | Ga0105237_11489919 | 3300009545 | Bacteria | 683 |
| 300 | Ga0105237_12034482 | 3300009545 | Bacteria | 583 |
| 301 | Ga0105238_10053133 | 3300009551 | Bacteria | 4072 |
| 302 | Ga0105238_10397283 | 3300009551 | Bacteria | 1371 |
| 303 | Ga0105238_11170451 | 3300009551 | Bacteria | 793 |
| 304 | Ga0105238_12224347 | 3300009551 | Bacteria | 583 |
| 305 | Ga0105249_10000064 | 3300009553 | Bacteria | 151646 |
| 306 | Ga0105249_10000646 | 3300009553 | Bacteria | 31780 |
| 307 | Ga0105249_10021979 | 3300009553 | Bacteria | 5712 |
| 308 | Ga0105249_10145636 | 3300009553 | Bacteria | 2276 |
| 309 | Ga0105249_10277098 | 3300009553 | Bacteria | 1673 |
| 310 | Ga0105249_10367535 | 3300009553 | Bacteria | 1461 |
| 311 | Ga0105249_10728938 | 3300009553 | Bacteria | 1053 |
| 312 | Ga0105249_10886224 | 3300009553 | Bacteria | 959 |
| 313 | Ga0105239_10344257 | 3300010375 | Bacteria | 1683 |
| 314 | Ga0105246_10322581 | 3300011119 | Bacteria | 1256 |
| 315 | Ga0105246_10579673 | 3300011119 | Bacteria | 966 |
| 316 | Ga0105246_10964332 | 3300011119 | Bacteria | 769 |
| 317 | Ga0157317_1015382 | 3300012475 | Bacteria | 635 |
| 318 | Ga0157326_1000010 | 3300012513 | Bacteria | 16665 |
| 319 | Ga0157326_1004331 | 3300012513 | Bacteria | 1490 |
| 320 | Ga0157373_10279321 | 3300013100 | Bacteria | 1183 |
| 321 | Ga0157373_10367671 | 3300013100 | Bacteria | 1027 |
| 322 | Ga0157371_10000773 | 3300013102 | Bacteria | 36842 |
| 323 | Ga0157371_10013524 | 3300013102 | Bacteria | 6195 |
| 324 | Ga0157370_10199673 | 3300013104 | Bacteria | 1855 |
| 325 | Ga0157370_11415562 | 3300013104 | Bacteria | 626 |
| 326 | Ga0157369_10172233 | 3300013105 | Bacteria | 2280 |
| 327 | Ga0157369_10968858 | 3300013105 | Bacteria | 871 |
| 328 | Ga0157369_11378314 | 3300013105 | Bacteria | 718 |
| 329 | Ga0157369_11967960 | 3300013105 | Bacteria | 593 |
| 330 | Ga0157374_10844892 | 3300013296 | Bacteria | 932 |
| 331 | Ga0157374_12588274 | 3300013296 | Bacteria | 535 |
| 332 | Ga0157378_10096833 | 3300013297 | Bacteria | 2689 |
| 333 | Ga0157378_10432363 | 3300013297 | Bacteria | 1303 |
| 334 | Ga0157378_10817188 | 3300013297 | Bacteria | 959 |
| 335 | Ga0163162_10675067 | 3300013306 | Bacteria | 1156 |
| 336 | Ga0163162_11331001 | 3300013306 | Bacteria | 816 |
| 337 | Ga0157372_10009012 | 3300013307 | Bacteria | 10605 |
| 338 | Ga0157372_10203861 | 3300013307 | Bacteria | 2292 |
| 339 | Ga0157375_10191588 | 3300013308 | Bacteria | 2199 |
| 340 | Ga0157375_10779994 | 3300013308 | Bacteria | 1105 |
| 341 | Ga0157375_11435204 | 3300013308 | Bacteria | 813 |
| 342 | Ga0157375_13016466 | 3300013308 | Bacteria | 562 |
| 343 | Ga0163163_10052819 | 3300014325 | Bacteria | 4011 |
| 344 | Ga0163163_10072257 | 3300014325 | Bacteria | 3439 |
| 345 | Ga0163163_10480053 | 3300014325 | Bacteria | 1304 |
| 346 | Ga0163163_10721352 | 3300014325 | Bacteria | 1060 |
| 347 | Ga0163163_10957643 | 3300014325 | Bacteria | 919 |
| 348 | Ga0157380_10000883 | 3300014326 | Bacteria | 18846 |
| 349 | Ga0157380_10002524 | 3300014326 | Bacteria | 12351 |
| 350 | Ga0157380_10075783 | 3300014326 | Bacteria | 2735 |
| 351 | Ga0157380_10096702 | 3300014326 | Bacteria | 2449 |
| 352 | Ga0157380_10456434 | 3300014326 | Bacteria | 1229 |
| 353 | Ga0157380_10895017 | 3300014326 | Bacteria | 913 |
| 354 | Ga0182008_10390683 | 3300014497 | Bacteria | 745 |
| 355 | Ga0157377_10226163 | 3300014745 | Bacteria | 1200 |
| 356 | Ga0157379_10010033 | 3300014968 | Bacteria | 8252 |
| 357 | Ga0157379_10019381 | 3300014968 | Bacteria | 6008 |
| 358 | Ga0157376_10370149 | 3300014969 | Bacteria | 1377 |
| 359 | Ga0157376_12426559 | 3300014969 | Bacteria | 564 |
| 360 | Ga0157376_12874989 | 3300014969 | Bacteria | 521 |
| 361 | Ga0183363_1002 | 3300015690 | Bacteria | 425040 |
| 362 | Ga0183361_10771 | 3300016635 | Bacteria | 1506 |
| 363 | Ga0163161_10000110 | 3300017792 | Bacteria | 78102 |
| 364 | Ga0163161_10329742 | 3300017792 | Bacteria | 1208 |
| 365 | Ga0163161_11161327 | 3300017792 | Bacteria | 666 |
| 366 | Ga0213875_10006754 | 3300021388 | Bacteria | 5996 |
| 367 | Ga0207672_1000465 | 3300025223 | Bacteria | 5119 |
| 368 | Ga0209674_103675 | 3300025226 | Bacteria | 2739 |
| 369 | Ga0209563_100024 | 3300025230 | Bacteria | 601155 |
| 370 | Ga0209646_1026252 | 3300025246 | Bacteria | 809 |
| 371 | Ga0209677_103840 | 3300025253 | Bacteria | 4632 |
| 372 | Ga0209148_1000008 | 3300025254 | Bacteria | 1504371 |
| 373 | Ga0209455_1000002 | 3300025272 | Bacteria | 1505459 |
| 374 | Ga0209675_1000306 | 3300025291 | Bacteria | 44321 |
| 375 | Ga0209676_1000359 | 3300025292 | Bacteria | 86410 |
| 376 | Ga0209676_1002125 | 3300025292 | Bacteria | 15153 |
| 377 | Ga0209025_1054774 | 3300025294 | Bacteria | 1549 |
| 378 | Ga0209758_1000007 | 3300025297 | Bacteria | 1270410 |
| 379 | Ga0209758_1032664 | 3300025297 | Bacteria | 2107 |
| 380 | Ga0209050_1000001 | 3300025298 | Bacteria | 3563507 |
| 381 | Ga0209050_1000067 | 3300025298 | Bacteria | 304206 |
| 382 | Ga0209050_1000166 | 3300025298 | Bacteria | 152073 |
| 383 | Ga0209051_1000291 | 3300025303 | Bacteria | 80318 |
| 384 | Ga0209257_1000392 | 3300025304 | Bacteria | 87104 |
| 385 | Ga0209257_1000665 | 3300025304 | Bacteria | 53751 |
| 386 | Ga0209257_1007212 | 3300025304 | Bacteria | 6811 |
| 387 | Ga0209257_1009940 | 3300025304 | Bacteria | 4948 |
| 388 | Ga0207697_10009072 | 3300025315 | Bacteria | 4310 |
| 389 | Ga0207697_10095186 | 3300025315 | Bacteria | 1265 |
| 390 | Ga0207656_10000439 | 3300025321 | Bacteria | 13952 |
| 391 | Ga0207696_1013319 | 3300025711 | Bacteria | 2871 |
| 392 | Ga0207713_1003157 | 3300025735 | Bacteria | 11415 |
| 393 | Ga0207682_10000039 | 3300025893 | Bacteria | 53500 |
| 394 | Ga0207682_10246485 | 3300025893 | Bacteria | 831 |
| 395 | Ga0207688_10026624 | 3300025901 | Bacteria | 3181 |
| 396 | Ga0207688_10110927 | 3300025901 | Bacteria | 1592 |
| 397 | Ga0207680_10000009 | 3300025903 | Bacteria | 464571 |
| 398 | Ga0207680_10009304 | 3300025903 | Bacteria | 4869 |
| 399 | Ga0207680_10256710 | 3300025903 | Bacteria | 1209 |
| 400 | Ga0207680_10409592 | 3300025903 | Bacteria | 959 |
| 401 | Ga0207647_10016588 | 3300025904 | Bacteria | 5024 |
| 402 | Ga0207647_10033491 | 3300025904 | Bacteria | 3290 |
| 403 | Ga0207647_10066134 | 3300025904 | Bacteria | 2193 |
| 404 | Ga0207647_10166105 | 3300025904 | Bacteria | 1286 |
| 405 | Ga0207647_10264057 | 3300025904 | Bacteria | 985 |
| 406 | Ga0207647_10289606 | 3300025904 | Bacteria | 934 |
| 407 | Ga0207645_10035923 | 3300025907 | Bacteria | 3181 |
| 408 | Ga0207645_10231619 | 3300025907 | Bacteria | 1219 |
| 409 | Ga0207645_10624832 | 3300025907 | Bacteria | 732 |
| 410 | Ga0207705_10000208 | 3300025909 | Bacteria | 59559 |
| 411 | Ga0207705_10002135 | 3300025909 | Bacteria | 15344 |
| 412 | Ga0207705_10025084 | 3300025909 | Bacteria | 4255 |
| 413 | Ga0207705_10076426 | 3300025909 | Bacteria | 2434 |
| 414 | Ga0207705_10107505 | 3300025909 | Bacteria | 2058 |
| 415 | Ga0207705_10113887 | 3300025909 | Bacteria | 2000 |
| 416 | Ga0207705_10149149 | 3300025909 | Bacteria | 1751 |
| 417 | Ga0207705_10231184 | 3300025909 | Bacteria | 1406 |
| 418 | Ga0207654_10003098 | 3300025911 | Bacteria | 8411 |
| 419 | Ga0207654_10191013 | 3300025911 | Bacteria | 1342 |
| 420 | Ga0207707_10302616 | 3300025912 | Bacteria | 1383 |
| 421 | Ga0207695_10005515 | 3300025913 | Bacteria | 16748 |
| 422 | Ga0207695_10175633 | 3300025913 | Bacteria | 2065 |
| 423 | Ga0207695_10202868 | 3300025913 | Bacteria | 1897 |
| 424 | Ga0207671_10007336 | 3300025914 | Bacteria | 9574 |
| 425 | Ga0207671_10458414 | 3300025914 | Bacteria | 1016 |
| 426 | Ga0207671_10925167 | 3300025914 | Bacteria | 689 |
| 427 | Ga0207660_10361714 | 3300025917 | Bacteria | 1164 |
| 428 | Ga0207662_10125658 | 3300025918 | Bacteria | 1613 |
| 429 | Ga0207657_10005322 | 3300025919 | Bacteria | 13488 |
| 430 | Ga0207657_10035734 | 3300025919 | Bacteria | 4453 |
| 431 | Ga0207657_10319210 | 3300025919 | Bacteria | 1228 |
| 432 | Ga0207649_10001745 | 3300025920 | Bacteria | 12469 |
| 433 | Ga0207649_10069342 | 3300025920 | Bacteria | 2245 |
| 434 | Ga0207649_10236649 | 3300025920 | Bacteria | 1309 |
| 435 | Ga0207649_10386603 | 3300025920 | Bacteria | 1044 |
| 436 | Ga0207649_10899490 | 3300025920 | Bacteria | 694 |
| 437 | Ga0207652_10103832 | 3300025921 | Bacteria | 2513 |
| 438 | Ga0207652_10374041 | 3300025921 | Bacteria | 1286 |
| 439 | Ga0207652_10537172 | 3300025921 | Bacteria | 1051 |
| 440 | Ga0207652_10749115 | 3300025921 | Bacteria | 869 |
| 441 | Ga0207681_10000003 | 3300025923 | Bacteria | 713245 |
| 442 | Ga0207681_10000106 | 3300025923 | Bacteria | 71721 |
| 443 | Ga0207681_10065248 | 3300025923 | Bacteria | 2516 |
| 444 | Ga0207681_10113356 | 3300025923 | Bacteria | 1976 |
| 445 | Ga0207681_10162212 | 3300025923 | Bacteria | 1686 |
| 446 | Ga0207681_10205610 | 3300025923 | Bacteria | 1514 |
| 447 | Ga0207681_11048530 | 3300025923 | Bacteria | 684 |
| 448 | Ga0207694_10160723 | 3300025924 | Bacteria | 1814 |
| 449 | Ga0207694_10324902 | 3300025924 | Bacteria | 1270 |
| 450 | Ga0207694_11483886 | 3300025924 | Bacteria | 572 |
| 451 | Ga0207694_11859676 | 3300025924 | Bacteria | 505 |
| 452 | Ga0207650_10000012 | 3300025925 | Bacteria | 437889 |
| 453 | Ga0207650_10000638 | 3300025925 | Bacteria | 27850 |
| 454 | Ga0207650_10001256 | 3300025925 | Bacteria | 18423 |
| 455 | Ga0207650_10008010 | 3300025925 | Bacteria | 7200 |
| 456 | Ga0207650_10018291 | 3300025925 | Bacteria | 4916 |
| 457 | Ga0207650_10029671 | 3300025925 | Bacteria | 3934 |
| 458 | Ga0207650_10230303 | 3300025925 | Bacteria | 1494 |
| 459 | Ga0207650_10268227 | 3300025925 | Bacteria | 1387 |
| 460 | Ga0207650_10270496 | 3300025925 | Bacteria | 1381 |
| 461 | Ga0207650_10461867 | 3300025925 | Bacteria | 1058 |
| 462 | Ga0207650_10482176 | 3300025925 | Bacteria | 1035 |
| 463 | Ga0207659_10040564 | 3300025926 | Bacteria | 3256 |
| 464 | Ga0207659_10064639 | 3300025926 | Bacteria | 2649 |
| 465 | Ga0207659_10174995 | 3300025926 | Bacteria | 1696 |
| 466 | Ga0207659_10648815 | 3300025926 | Bacteria | 902 |
| 467 | Ga0207664_11006118 | 3300025929 | Bacteria | 747 |
| 468 | Ga0207644_10001914 | 3300025931 | Bacteria | 13494 |
| 469 | Ga0207644_10149325 | 3300025931 | Bacteria | 1807 |
| 470 | Ga0207644_10452176 | 3300025931 | Bacteria | 1055 |
| 471 | Ga0207644_10534193 | 3300025931 | Bacteria | 970 |
| 472 | Ga0207690_10117045 | 3300025932 | Bacteria | 1929 |
| 473 | Ga0207690_10118703 | 3300025932 | Bacteria | 1917 |
| 474 | Ga0207690_10978439 | 3300025932 | Bacteria | 703 |
| 475 | Ga0207690_11118146 | 3300025932 | Bacteria | 657 |
| 476 | Ga0207690_11359688 | 3300025932 | Bacteria | 594 |
| 477 | Ga0207706_10004398 | 3300025933 | Bacteria | 13237 |
| 478 | Ga0207706_10034096 | 3300025933 | Bacteria | 4530 |
| 479 | Ga0207706_10044371 | 3300025933 | Bacteria | 3940 |
| 480 | Ga0207706_10063755 | 3300025933 | Bacteria | 3244 |
| 481 | Ga0207706_10266658 | 3300025933 | Bacteria | 1495 |
| 482 | Ga0207706_10429972 | 3300025933 | Bacteria | 1143 |
| 483 | Ga0207706_10672553 | 3300025933 | Bacteria | 886 |
| 484 | Ga0207670_10000903 | 3300025936 | Bacteria | 15668 |
| 485 | Ga0207670_11352923 | 3300025936 | Bacteria | 604 |
| 486 | Ga0207669_10001337 | 3300025937 | Bacteria | 10500 |
| 487 | Ga0207669_10101224 | 3300025937 | Bacteria | 1905 |
| 488 | Ga0207704_10209602 | 3300025938 | Bacteria | 1433 |
| 489 | Ga0207691_10015030 | 3300025940 | Bacteria | 7367 |
| 490 | Ga0207691_10224540 | 3300025940 | Bacteria | 1628 |
| 491 | Ga0207691_10429159 | 3300025940 | Bacteria | 1126 |
| 492 | Ga0207711_10000017 | 3300025941 | Bacteria | 441730 |
| 493 | Ga0207711_10013830 | 3300025941 | Bacteria | 6701 |
| 494 | Ga0207711_10016424 | 3300025941 | Bacteria | 6152 |
| 495 | Ga0207711_10020255 | 3300025941 | Bacteria | 5542 |
| 496 | Ga0207711_10047049 | 3300025941 | Bacteria | 3687 |
| 497 | Ga0207711_10200849 | 3300025941 | Bacteria | 1819 |
| 498 | Ga0207711_10562097 | 3300025941 | Bacteria | 1064 |
| 499 | Ga0207711_11146159 | 3300025941 | Bacteria | 718 |
| 500 | Ga0207711_11325089 | 3300025941 | Bacteria | 662 |
| 501 | Ga0207689_10049402 | 3300025942 | Bacteria | 3470 |
| 502 | Ga0207679_10333910 | 3300025945 | Bacteria | 1316 |
| 503 | Ga0207679_10416167 | 3300025945 | Bacteria | 1185 |
| 504 | Ga0207679_10887233 | 3300025945 | Bacteria | 815 |
| 505 | Ga0207667_10000074 | 3300025949 | Bacteria | 171635 |
| 506 | Ga0207667_10004542 | 3300025949 | Bacteria | 17006 |
| 507 | Ga0207667_10004895 | 3300025949 | Bacteria | 16353 |
| 508 | Ga0207667_10012017 | 3300025949 | Bacteria | 10019 |
| 509 | Ga0207667_10363860 | 3300025949 | Bacteria | 1475 |
| 510 | Ga0207667_10650108 | 3300025949 | Bacteria | 1060 |
| 511 | Ga0207651_10114821 | 3300025960 | Bacteria | 2029 |
| 512 | Ga0207651_10176065 | 3300025960 | Bacteria | 1692 |
| 513 | Ga0207651_11162658 | 3300025960 | Bacteria | 692 |
| 514 | Ga0207712_10000044 | 3300025961 | Bacteria | 171240 |
| 515 | Ga0207712_10001469 | 3300025961 | Bacteria | 16080 |
| 516 | Ga0207712_10408023 | 3300025961 | Bacteria | 1143 |
| 517 | Ga0207712_10746933 | 3300025961 | Bacteria | 857 |
| 518 | Ga0207712_10973662 | 3300025961 | Bacteria | 752 |
| 519 | Ga0207712_11201869 | 3300025961 | Bacteria | 676 |
| 520 | Ga0207668_10000006 | 3300025972 | Bacteria | 191468 |
| 521 | Ga0207668_10064921 | 3300025972 | Bacteria | 2582 |
| 522 | Ga0207668_10065339 | 3300025972 | Bacteria | 2574 |
| 523 | Ga0207668_10095528 | 3300025972 | Bacteria | 2194 |
| 524 | Ga0207668_10144394 | 3300025972 | Bacteria | 1834 |
| 525 | Ga0207668_10614747 | 3300025972 | Bacteria | 948 |
| 526 | Ga0207668_10644397 | 3300025972 | Bacteria | 927 |
| 527 | Ga0207668_11035644 | 3300025972 | Bacteria | 734 |
| 528 | Ga0207668_11144757 | 3300025972 | Bacteria | 698 |
| 529 | Ga0207640_10115701 | 3300025981 | Bacteria | 1910 |
| 530 | Ga0207640_10163481 | 3300025981 | Bacteria | 1650 |
| 531 | Ga0207640_11766013 | 3300025981 | Bacteria | 559 |
| 532 | Ga0207658_10000026 | 3300025986 | Bacteria | 178292 |
| 533 | Ga0207658_10000340 | 3300025986 | Bacteria | 46680 |
| 534 | Ga0207658_10000863 | 3300025986 | Bacteria | 25346 |
| 535 | Ga0207658_10006141 | 3300025986 | Bacteria | 8200 |
| 536 | Ga0207658_10139879 | 3300025986 | Bacteria | 1957 |
| 537 | Ga0207658_10322120 | 3300025986 | Bacteria | 1338 |
| 538 | Ga0207658_10754244 | 3300025986 | Bacteria | 881 |
| 539 | Ga0207658_10762895 | 3300025986 | Bacteria | 876 |
| 540 | Ga0207677_10430759 | 3300026023 | Bacteria | 1126 |
| 541 | Ga0207677_10978925 | 3300026023 | Bacteria | 766 |
| 542 | Ga0207703_10005385 | 3300026035 | Bacteria | 10304 |
| 543 | Ga0207703_10006763 | 3300026035 | Bacteria | 9146 |
| 544 | Ga0207703_10020483 | 3300026035 | Bacteria | 5172 |
| 545 | Ga0207703_10098830 | 3300026035 | Bacteria | 2469 |
| 546 | Ga0207703_11695853 | 3300026035 | Bacteria | 608 |
| 547 | Ga0207703_12283568 | 3300026035 | Bacteria | 517 |
| 548 | Ga0207639_10004764 | 3300026041 | Bacteria | 9142 |
| 549 | Ga0207639_10109150 | 3300026041 | Bacteria | 2251 |
| 550 | Ga0207639_10180817 | 3300026041 | Bacteria | 1794 |
| 551 | Ga0207678_10011599 | 3300026067 | Bacteria | 7742 |
| 552 | Ga0207678_10048738 | 3300026067 | Bacteria | 3661 |
| 553 | Ga0207678_10334956 | 3300026067 | Bacteria | 1303 |
| 554 | Ga0207678_10583072 | 3300026067 | Bacteria | 980 |
| 555 | Ga0207678_10601785 | 3300026067 | Bacteria | 964 |
| 556 | Ga0207678_11040647 | 3300026067 | Bacteria | 725 |
| 557 | Ga0207708_10086506 | 3300026075 | Bacteria | 2412 |
| 558 | Ga0207702_10034221 | 3300026078 | Bacteria | 4247 |
| 559 | Ga0207702_10106765 | 3300026078 | Bacteria | 2482 |
| 560 | Ga0207641_10000008 | 3300026088 | Bacteria | 424415 |
| 561 | Ga0207641_10000672 | 3300026088 | Bacteria | 37136 |
| 562 | Ga0207641_10000761 | 3300026088 | Bacteria | 34699 |
| 563 | Ga0207641_10000779 | 3300026088 | Bacteria | 34088 |
| 564 | Ga0207641_10031946 | 3300026088 | Bacteria | 4369 |
| 565 | Ga0207641_10951219 | 3300026088 | Bacteria | 854 |
| 566 | Ga0207641_11080981 | 3300026088 | Bacteria | 800 |
| 567 | Ga0207648_10176437 | 3300026089 | Bacteria | 1890 |
| 568 | Ga0207676_10000009 | 3300026095 | Bacteria | 545256 |
| 569 | Ga0207676_10000060 | 3300026095 | Bacteria | 118841 |
| 570 | Ga0207676_10035521 | 3300026095 | Bacteria | 3783 |
| 571 | Ga0207676_10094243 | 3300026095 | Bacteria | 2466 |
| 572 | Ga0207676_10429292 | 3300026095 | Bacteria | 1241 |
| 573 | Ga0207676_10586250 | 3300026095 | Bacteria | 1069 |
| 574 | Ga0207676_10685452 | 3300026095 | Bacteria | 991 |
| 575 | Ga0207676_11797888 | 3300026095 | Bacteria | 611 |
| 576 | Ga0207674_10044419 | 3300026116 | Bacteria | 4576 |
| 577 | Ga0207674_10094976 | 3300026116 | Bacteria | 2968 |
| 578 | Ga0207674_10159318 | 3300026116 | Bacteria | 2212 |
| 579 | Ga0207674_10516607 | 3300026116 | Bacteria | 1154 |
| 580 | Ga0207674_10625467 | 3300026116 | Bacteria | 1040 |
| 581 | Ga0207674_10667219 | 3300026116 | Bacteria | 1004 |
| 582 | Ga0207674_11155580 | 3300026116 | Bacteria | 744 |
| 583 | Ga0207674_12274227 | 3300026116 | Bacteria | 504 |
| 584 | Ga0207675_100000514 | 3300026118 | Bacteria | 37563 |
| 585 | Ga0207675_100001142 | 3300026118 | Bacteria | 26307 |
| 586 | Ga0207675_100001681 | 3300026118 | Bacteria | 22129 |
| 587 | Ga0207675_100029504 | 3300026118 | Bacteria | 5110 |
| 588 | Ga0207675_100031814 | 3300026118 | Bacteria | 4915 |
| 589 | Ga0207675_100257365 | 3300026118 | Bacteria | 1691 |
| 590 | Ga0207675_100562938 | 3300026118 | Bacteria | 1140 |
| 591 | Ga0207675_100570273 | 3300026118 | Bacteria | 1132 |
| 592 | Ga0207683_10002590 | 3300026121 | Bacteria | 15792 |
| 593 | Ga0207683_10014772 | 3300026121 | Bacteria | 6646 |
| 594 | Ga0207683_10078371 | 3300026121 | Bacteria | 2928 |
| 595 | Ga0207683_10634750 | 3300026121 | Bacteria | 989 |
| 596 | Ga0207683_10913938 | 3300026121 | Bacteria | 815 |
| 597 | Ga0207698_10031824 | 3300026142 | Bacteria | 3813 |
| 598 | Ga0207698_10236917 | 3300026142 | Bacteria | 1660 |
| 599 | Ga0207698_10257463 | 3300026142 | Bacteria | 1601 |
| 600 | Ga0207698_10387721 | 3300026142 | Bacteria | 1331 |
| 601 | Ga0207698_10525089 | 3300026142 | Bacteria | 1156 |
| 602 | Ga0207698_12526045 | 3300026142 | Bacteria | 524 |
| 603 | Ga0209983_1026010 | 3300027665 | Bacteria | 1237 |
| 604 | Ga0209974_10002918 | 3300027876 | Bacteria | 6203 |
| 605 | Ga0207428_10155494 | 3300027907 | Bacteria | 1739 |
| 606 | Ga0268266_10000069 | 3300028379 | Bacteria | 239714 |
| 607 | Ga0268266_10023211 | 3300028379 | Bacteria | 5283 |
| 608 | Ga0268266_10805685 | 3300028379 | Bacteria | 907 |
| 609 | Ga0268265_10000001 | 3300028380 | Bacteria | 1230727 |
| 610 | Ga0268265_10000011 | 3300028380 | Bacteria | 343832 |
| 611 | Ga0268265_10000100 | 3300028380 | Bacteria | 108659 |
| 612 | Ga0268265_10001457 | 3300028380 | Bacteria | 19873 |
| 613 | Ga0268265_10023954 | 3300028380 | Bacteria | 4311 |
| 614 | Ga0268265_10100837 | 3300028380 | Bacteria | 2331 |
| 615 | Ga0268265_10117904 | 3300028380 | Bacteria | 2181 |
| 616 | Ga0268265_10246548 | 3300028380 | Bacteria | 1579 |
| 617 | Ga0268265_10506790 | 3300028380 | Bacteria | 1138 |
| 618 | Ga0268264_10000076 | 3300028381 | Bacteria | 255518 |
| 619 | Ga0268264_10000131 | 3300028381 | Bacteria | 181459 |
| 620 | Ga0268264_10000755 | 3300028381 | Bacteria | 36243 |
| 621 | Ga0268264_10004670 | 3300028381 | Bacteria | 11644 |
| 622 | Ga0268264_10034476 | 3300028381 | Bacteria | 4164 |
| 623 | Ga0268264_10121250 | 3300028381 | Bacteria | 2304 |
| 624 | Ga0268264_11290603 | 3300028381 | Bacteria | 740 |
| 625 | Ga0307517_10012625 | 3300028786 | Bacteria | 11569 |
| 626 | Ga0307517_10017361 | 3300028786 | Bacteria | 9386 |
| 627 | Ga0316182_1291942 | 3300030745 | Bacteria | 601 |
| 628 | Ga0307408_100041577 | 3300031548 | Bacteria | 3259 |
| 629 | Ga0307408_100307461 | 3300031548 | Bacteria | 1330 |
| 630 | Ga0307408_100326170 | 3300031548 | Bacteria | 1295 |
| 631 | Ga0307408_100576402 | 3300031548 | Bacteria | 996 |
| 632 | Ga0307408_100613685 | 3300031548 | Bacteria | 968 |
| 633 | Ga0307408_101280746 | 3300031548 | Bacteria | 686 |
| 634 | Ga0307408_101309092 | 3300031548 | Bacteria | 679 |
| 635 | Ga0307405_10034684 | 3300031731 | Bacteria | 3005 |
| 636 | Ga0307405_10046364 | 3300031731 | Bacteria | 2670 |
| 637 | Ga0307405_10113838 | 3300031731 | Bacteria | 1837 |
| 638 | Ga0307405_10287352 | 3300031731 | Bacteria | 1241 |
| 639 | Ga0307405_10510779 | 3300031731 | Bacteria | 965 |
| 640 | Ga0307405_10627811 | 3300031731 | Bacteria | 880 |
| 641 | Ga0307405_10642516 | 3300031731 | Bacteria | 871 |
| 642 | Ga0307405_11061330 | 3300031731 | Bacteria | 694 |
| 643 | Ga0307405_11121242 | 3300031731 | Bacteria | 677 |
| 644 | Ga0307413_10023965 | 3300031824 | Bacteria | 3317 |
| 645 | Ga0307413_10037662 | 3300031824 | Bacteria | 2795 |
| 646 | Ga0307413_10085789 | 3300031824 | Bacteria | 2034 |
| 647 | Ga0307413_10098907 | 3300031824 | Bacteria | 1922 |
| 648 | Ga0307413_10172041 | 3300031824 | Bacteria | 1534 |
| 649 | Ga0307413_10257729 | 3300031824 | Bacteria | 1298 |
| 650 | Ga0307413_10525219 | 3300031824 | Bacteria | 955 |
| 651 | Ga0307413_11007132 | 3300031824 | Bacteria | 714 |
| 652 | Ga0307413_12044353 | 3300031824 | Bacteria | 517 |
| 653 | Ga0307410_10078904 | 3300031852 | Bacteria | 2305 |
| 654 | Ga0307410_10100163 | 3300031852 | Bacteria | 2075 |
| 655 | Ga0307410_10242688 | 3300031852 | Bacteria | 1397 |
| 656 | Ga0307410_10284446 | 3300031852 | Bacteria | 1299 |
| 657 | Ga0307410_10430612 | 3300031852 | Bacteria | 1072 |
| 658 | Ga0307406_10109407 | 3300031901 | Bacteria | 1899 |
| 659 | Ga0307406_10116945 | 3300031901 | Bacteria | 1846 |
| 660 | Ga0307406_10402620 | 3300031901 | Bacteria | 1085 |
| 661 | Ga0307406_10691178 | 3300031901 | Bacteria | 851 |
| 662 | Ga0307406_11472903 | 3300031901 | Bacteria | 598 |
| 663 | Ga0307406_11937672 | 3300031901 | Bacteria | 526 |
| 664 | Ga0307406_12101955 | 3300031901 | Bacteria | 506 |
| 665 | Ga0307412_10013263 | 3300031911 | Bacteria | 4825 |
| 666 | Ga0307412_10018021 | 3300031911 | Bacteria | 4238 |
| 667 | Ga0307412_10021005 | 3300031911 | Bacteria | 3982 |
| 668 | Ga0307412_10025103 | 3300031911 | Bacteria | 3687 |
| 669 | Ga0307412_10032399 | 3300031911 | Bacteria | 3311 |
| 670 | Ga0307412_10043271 | 3300031911 | Bacteria | 2931 |
| 671 | Ga0307412_10101086 | 3300031911 | Bacteria | 2039 |
| 672 | Ga0307412_10257835 | 3300031911 | Bacteria | 1357 |
| 673 | Ga0307412_10269042 | 3300031911 | Bacteria | 1332 |
| 674 | Ga0307412_10768682 | 3300031911 | Bacteria | 833 |
| 675 | Ga0307409_100080490 | 3300031995 | Bacteria | 2629 |
| 676 | Ga0307409_100305636 | 3300031995 | Bacteria | 1482 |
| 677 | Ga0307409_100310723 | 3300031995 | Bacteria | 1471 |
| 678 | Ga0307409_100325503 | 3300031995 | Bacteria | 1440 |
| 679 | Ga0307409_100580288 | 3300031995 | Bacteria | 1105 |
| 680 | Ga0307409_100998211 | 3300031995 | Bacteria | 855 |
| 681 | Ga0307409_101008745 | 3300031995 | Bacteria | 851 |
| 682 | Ga0307409_101083267 | 3300031995 | Bacteria | 822 |
| 683 | Ga0307409_101951919 | 3300031995 | Bacteria | 616 |
| 684 | Ga0307409_102251423 | 3300031995 | Bacteria | 574 |
| 685 | Ga0307409_102734548 | 3300031995 | Bacteria | 521 |
| 686 | Ga0307416_100016870 | 3300032002 | Bacteria | 5090 |
| 687 | Ga0307416_100035044 | 3300032002 | Bacteria | 3827 |
| 688 | Ga0307416_100281823 | 3300032002 | Bacteria | 1639 |
| 689 | Ga0307416_100820295 | 3300032002 | Bacteria | 1027 |
| 690 | Ga0307416_101002029 | 3300032002 | Bacteria | 938 |
| 691 | Ga0307416_103119237 | 3300032002 | Bacteria | 554 |
| 692 | Ga0307414_10002871 | 3300032004 | Bacteria | 9097 |
| 693 | Ga0307414_10070699 | 3300032004 | Bacteria | 2514 |
| 694 | Ga0307414_10101153 | 3300032004 | Bacteria | 2169 |
| 695 | Ga0307414_10140253 | 3300032004 | Bacteria | 1891 |
| 696 | Ga0307414_10162790 | 3300032004 | Bacteria | 1774 |
| 697 | Ga0307414_10168218 | 3300032004 | Bacteria | 1749 |
| 698 | Ga0307414_10224419 | 3300032004 | Bacteria | 1544 |
| 699 | Ga0307414_10232765 | 3300032004 | Bacteria | 1520 |
| 700 | Ga0307414_10390053 | 3300032004 | Bacteria | 1206 |
| 701 | Ga0307414_10393073 | 3300032004 | Bacteria | 1202 |
| 702 | Ga0307414_10436192 | 3300032004 | Bacteria | 1146 |
| 703 | Ga0307414_10630740 | 3300032004 | Bacteria | 964 |
| 704 | Ga0307414_10816904 | 3300032004 | Bacteria | 851 |
| 705 | Ga0307414_10998243 | 3300032004 | Bacteria | 770 |
| 706 | Ga0307414_11004837 | 3300032004 | Bacteria | 768 |
| 707 | Ga0307414_11249385 | 3300032004 | Bacteria | 688 |
| 708 | Ga0307414_11475558 | 3300032004 | Bacteria | 633 |
| 709 | Ga0307414_11850868 | 3300032004 | Bacteria | 563 |
| 710 | Ga0307411_10028876 | 3300032005 | Bacteria | 3378 |
| 711 | Ga0307411_10050728 | 3300032005 | Bacteria | 2703 |
| 712 | Ga0307411_10131049 | 3300032005 | Bacteria | 1832 |
| 713 | Ga0307411_10201773 | 3300032005 | Bacteria | 1528 |
| 714 | Ga0307411_10351925 | 3300032005 | Bacteria | 1201 |
| 715 | Ga0307411_10401423 | 3300032005 | Bacteria | 1133 |
| 716 | Ga0307411_10561434 | 3300032005 | Bacteria | 975 |
| 717 | Ga0307411_10676438 | 3300032005 | Bacteria | 896 |
| 718 | Ga0307411_10701713 | 3300032005 | Bacteria | 881 |
| 719 | Ga0307411_10870921 | 3300032005 | Bacteria | 798 |
| 720 | Ga0307411_11071337 | 3300032005 | Bacteria | 725 |
| 721 | Ga0307411_11116431 | 3300032005 | Bacteria | 711 |
| 722 | Ga0307411_12339935 | 3300032005 | Bacteria | 502 |
| 723 | Ga0307415_100100176 | 3300032126 | Bacteria | 2122 |
| 724 | Ga0307415_100195758 | 3300032126 | Bacteria | 1599 |
| 725 | Ga0307415_100583746 | 3300032126 | Bacteria | 992 |
| 726 | Ga0307510_10439757 | 3300033180 | Bacteria | 745 |
| 727 | Ga0373943_0484005 | 3300035170 | Bacteria | 722 |
| 728 | Ga0373935_0003141 | 3300035692 | Bacteria | 9528 |
| 729 | Ga0373937_1457284 | 3300036401 | Bacteria | 632 |
| 730 | Ga0395899_0016902 | 3300037312 | Bacteria | 5561 |
| 731 | Ga0395899_0021184 | 3300037312 | Bacteria | 4931 |
| 732 | Ga0395899_0033415 | 3300037312 | Bacteria | 3863 |
| 733 | Ga0395899_0220475 | 3300037312 | Bacteria | 1314 |
| 734 | Ga0395900_0003931 | 3300037418 | Bacteria | 15861 |
| 735 | Ga0395900_0091675 | 3300037418 | Bacteria | 3122 |
| 736 | Ga0395900_0116425 | 3300037418 | Bacteria | 2742 |
| 737 | Ga0395900_1506301 | 3300037418 | Bacteria | 585 |
| 738 | Ga0395900_1607851 | 3300037418 | Bacteria | 561 |
| 739 | Ga0395898_0065887 | 3300037466 | Bacteria | 3511 |
| 740 | Ga0395898_0164552 | 3300037466 | Bacteria | 2121 |
| 741 | Ga0395905_0000128 | 3300037471 | Bacteria | 124305 |
| 742 | Ga0395905_0015445 | 3300037471 | Bacteria | 7259 |
| 743 | Ga0395905_0147073 | 3300037471 | Bacteria | 2217 |
| 744 | Ga0395905_0214315 | 3300037471 | Bacteria | 1804 |
| 745 | Ga0395905_0247461 | 3300037471 | Bacteria | 1665 |
| 746 | Ga0395905_0739624 | 3300037471 | Bacteria | 886 |
| 747 | Ga0395905_0756412 | 3300037471 | Bacteria | 874 |
| 748 | Ga0395905_1193820 | 3300037471 | Bacteria | 664 |
| 749 | Ga0436364_0154840 | 3300037853 | Bacteria | 188668 |
| 750 | Ga0436364_1351302 | 3300037853 | Bacteria | 15199 |
| 751 | Ga0395901_0002771 | 3300038443 | Bacteria | 17662 |
| 752 | Ga0395901_0027145 | 3300038443 | Bacteria | 5881 |
| 753 | Ga0395901_0150031 | 3300038443 | Bacteria | 2450 |
| 754 | Ga0395901_1217131 | 3300038443 | Bacteria | 718 |
| 755 | Ga0436365_0619502 | 3300039437 | Bacteria | 1356 |
| 756 | Ga0436365_1187875 | 3300039437 | Bacteria | 1504 |
| 757 | Ga0436363_0884963 | 3300039450 | Bacteria | 1184 |
| 758 | Ga0436363_1120500 | 3300039450 | Bacteria | 850 |
| 759 | Ga0451789_0899707 | 3300041443 | Bacteria | 681 |
| 760 | Ga0451793_1773260 | 3300041452 | Bacteria | 611 |
| 761 | Ga0451807_1027240 | 3300041486 | Bacteria | 699 |
| 762 | Ga0450905_020758 | 3300042142 | Bacteria | 968 |
| 763 | Ga0439464_0150824 | 3300042439 | Bacteria | 727 |
| 764 | Ga0466966_0023062 | 3300044684 | Bacteria | 4078 |
| 765 | Ga0466966_0088303 | 3300044684 | Unclassified | 1927 |
| 766 | Ga0466970_0155040 | 3300044765 | Bacteria | 1266 |
| 767 | Ga0466960_0283555 | 3300044901 | Bacteria | 929 |
| 768 | Ga0466959_0112521 | 3300045049 | Bacteria | 1942 |
| 769 | Ga0466967_0135933 | 3300045976 | Bacteria | 2286 |
| 770 | Ga0466967_0291541 | 3300045976 | Bacteria | 1568 |
| 771 | Ga0495617_008797 | 3300046452 | Bacteria | 3477 |
| 772 | Ga0495592_0261858 | 3300046454 | Bacteria | 1139 |
| 773 | Ga0495629_0183206 | 3300046459 | Bacteria | 1451 |
| 774 | Ga0495638_0198518 | 3300046460 | Bacteria | 1134 |
| 775 | Ga0495650_0004722 | 3300046471 | Bacteria | 9171 |
| 776 | Ga0495662_0531430 | 3300046476 | Bacteria | 576 |
| 777 | Ga0495584_0659634 | 3300046491 | Bacteria | 533 |
| 778 | Ga0495585_0011108 | 3300046492 | Bacteria | 5341 |
| 779 | Ga0495585_0083769 | 3300046492 | Bacteria | 1725 |
| 780 | Ga0495585_0324624 | 3300046492 | Bacteria | 752 |
| 781 | Ga0495596_0006083 | 3300046500 | Bacteria | 5620 |
| 782 | Ga0495583_0004957 | 3300046506 | Bacteria | 9239 |
| 783 | Ga0495583_0016258 | 3300046506 | Bacteria | 4010 |
| 784 | Ga0495583_0016458 | 3300046506 | Bacteria | 3972 |
| 785 | Ga0495583_0078412 | 3300046506 | Bacteria | 1439 |
| 786 | Ga0495606_0242453 | 3300046507 | Bacteria | 1004 |
| 787 | Ga0495631_0178031 | 3300046518 | Bacteria | 911 |
| 788 | Ga0495643_0010725 | 3300046522 | Bacteria | 5629 |
| 789 | Ga0495643_0016713 | 3300046522 | Bacteria | 4307 |
| 790 | Ga0495643_0046546 | 3300046522 | Bacteria | 2351 |
| 791 | Ga0495648_0001684 | 3300046524 | Bacteria | 21375 |
| 792 | Ga0495663_0001228 | 3300046525 | Bacteria | 8194 |
| 793 | Ga0495663_0003428 | 3300046525 | Bacteria | 4573 |
| 794 | Ga0495663_0012348 | 3300046525 | Bacteria | 2379 |
| 795 | Ga0495663_0014740 | 3300046525 | Bacteria | 2194 |
| 796 | Ga0495642_0097077 | 3300046528 | Bacteria | 1251 |
| 797 | Ga0495654_0006421 | 3300046530 | Bacteria | 6683 |
| 798 | Ga0495587_0039997 | 3300046536 | Bacteria | 2804 |
| 799 | Ga0495598_0003634 | 3300046537 | Bacteria | 3291 |
| 800 | Ga0495598_0029987 | 3300046537 | Bacteria | 1520 |
| 801 | Ga0495621_0009367 | 3300046539 | Bacteria | 2971 |
| 802 | Ga0495621_0033442 | 3300046539 | Bacteria | 1773 |
| 803 | Ga0495621_0035398 | 3300046539 | Bacteria | 1729 |
| 804 | Ga0495597_0073444 | 3300046542 | Bacteria | 1470 |
| 805 | Ga0495633_0034695 | 3300046558 | Bacteria | 2425 |
| 806 | Ga0495633_0396962 | 3300046558 | Bacteria | 624 |
| 807 | Ga0495668_0000002 | 3300046616 | Bacteria | 763179 |
| 808 | Ga0495668_0000098 | 3300046616 | Bacteria | 138553 |
| 809 | Ga0495668_0020786 | 3300046616 | Bacteria | 3770 |
| 810 | Ga0495668_0091963 | 3300046616 | Bacteria | 1662 |
| 811 | Ga0495668_0128218 | 3300046616 | Bacteria | 1389 |
| 812 | Ga0495668_0749640 | 3300046616 | Bacteria | 540 |
| 813 | Ga0495611_0110181 | 3300046648 | Bacteria | 1281 |
| 814 | Ga0495611_0230191 | 3300046648 | Bacteria | 861 |
| 815 | Ga0495625_0000522 | 3300046660 | Bacteria | 56677 |
| 816 | Ga0495625_0051472 | 3300046660 | Bacteria | 2952 |
| 817 | Ga0495625_0086473 | 3300046660 | Bacteria | 2175 |
| 818 | Ga0495625_0220121 | 3300046660 | Bacteria | 1244 |
| 819 | Ga0495625_0647666 | 3300046660 | Bacteria | 629 |
| 820 | Ga0495625_0720276 | 3300046660 | Bacteria | 587 |
| 821 | Ga0495659_0001448 | 3300046664 | Bacteria | 8049 |
| 822 | Ga0495661_0051089 | 3300046665 | Bacteria | 2498 |
| 823 | Ga0495669_0000026 | 3300046684 | Bacteria | 111814 |
| 824 | Ga0495669_0035415 | 3300046684 | Bacteria | 2204 |
| 825 | Ga0495669_0492290 | 3300046684 | Bacteria | 596 |
| 826 | Ga0495670_0000023 | 3300046691 | Bacteria | 92374 |
| 827 | Ga0495670_0019656 | 3300046691 | Bacteria | 3328 |
| 828 | Ga0495670_0045451 | 3300046691 | Bacteria | 2192 |
| 829 | Ga0495670_0045929 | 3300046691 | Bacteria | 2181 |
| 830 | Ga0495671_0613544 | 3300046692 | Bacteria | 517 |
| 831 | Ga0495600_0004283 | 3300046809 | Bacteria | 8530 |
| 832 | Ga0495636_0176276 | 3300047318 | Bacteria | 968 |
| 833 | Ga0495683_0006873 | 3300047323 | Bacteria | 6182 |
| 834 | Ga0495683_0062950 | 3300047323 | Bacteria | 1834 |
| 835 | Ga0495687_000083 | 3300047443 | Bacteria | 145688 |
| 836 | Ga0495687_015404 | 3300047443 | Bacteria | 3890 |
| 837 | Ga0495677_0007554 | 3300047445 | Bacteria | 4056 |
| 838 | Ga0495677_0022968 | 3300047445 | Bacteria | 2264 |
| 839 | Ga0495685_152922 | 3300047447 | Bacteria | 749 |
| 840 | Ga0495681_0010757 | 3300047470 | Bacteria | 5512 |
| 841 | Ga0495681_0139749 | 3300047470 | Bacteria | 1024 |
| 842 | Ga0495686_0192046 | 3300047472 | Bacteria | 1177 |
| 843 | Ga0495686_0459030 | 3300047472 | Bacteria | 676 |
| 844 | Ga0496101_0215979 | 3300048904 | Bacteria | 1487 |
| 845 | Ga0496101_0349554 | 3300048904 | Bacteria | 1162 |
| 846 | Ga0496102_0005922 | 3300048905 | Bacteria | 10409 |
| 847 | Ga0496103_0004376 | 3300048906 | Bacteria | 8578 |
| 848 | Ga0496104_0211001 | 3300048907 | Bacteria | 1853 |
| 849 | Ga0496105_0115733 | 3300048908 | Bacteria | 2211 |
| 850 | Ga0496107_0067757 | 3300048910 | Bacteria | 2590 |
| 851 | Ga0496107_0135728 | 3300048910 | Bacteria | 1817 |
| 852 | Ga0496107_1304037 | 3300048910 | Bacteria | 519 |
| 853 | Ga0496108_0031276 | 3300048911 | Bacteria | 4415 |
| 854 | Ga0496108_0187645 | 3300048911 | Bacteria | 1791 |
| 855 | Ga0496109_0213154 | 3300048912 | Bacteria | 1816 |
| 856 | Ga0496109_0978256 | 3300048912 | Bacteria | 784 |
| 857 | Ga0496109_1613650 | 3300048912 | Bacteria | 583 |
| 858 | Ga0496110_1148052 | 3300048913 | Bacteria | 685 |
| 859 | Ga0496111_0604886 | 3300048914 | Bacteria | 802 |
| 860 | Ga0496112_0654254 | 3300048915 | Bacteria | 980 |
| 861 | Ga0496114_0000006 | 3300048917 | Bacteria | 472921 |
| 862 | Ga0496114_0007656 | 3300048917 | Bacteria | 8540 |
| 863 | Ga0496115_0003797 | 3300048918 | Bacteria | 10871 |
| 864 | Ga0496116_0043615 | 3300048919 | Bacteria | 3054 |
| 865 | Ga0496117_0013816 | 3300048920 | Bacteria | 7010 |
| 866 | Ga0496117_0025412 | 3300048920 | Bacteria | 4658 |
| 867 | Ga0496118_0008661 | 3300048921 | Bacteria | 10463 |
| 868 | Ga0496118_0028521 | 3300048921 | Bacteria | 4698 |
| 869 | Ga0496119_0204898 | 3300048922 | Bacteria | 1018 |
| 870 | Ga0496119_0325079 | 3300048922 | Bacteria | 752 |
| 871 | Ga0496121_0001042 | 3300048924 | Bacteria | 49414 |
| 872 | Ga0496121_0382778 | 3300048924 | Bacteria | 927 |
| 873 | Ga0496122_0007218 | 3300048925 | Bacteria | 12432 |
| 874 | Ga0496122_0036789 | 3300048925 | Bacteria | 3951 |
| 875 | Ga0496122_0112991 | 3300048925 | Bacteria | 1776 |
| 876 | Ga0496122_0130928 | 3300048925 | Bacteria | 1594 |
| 877 | Ga0496123_0000521 | 3300048926 | Bacteria | 66722 |
| 878 | Ga0496123_0023953 | 3300048926 | Bacteria | 4657 |
| 879 | Ga0496123_0036372 | 3300048926 | Bacteria | 3493 |
| 880 | Ga0496123_0046123 | 3300048926 | Bacteria | 2959 |
| 881 | Ga0496123_0095057 | 3300048926 | Bacteria | 1754 |
| 882 | Ga0496124_0015436 | 3300048927 | Bacteria | 7321 |
| 883 | Ga0496124_0156709 | 3300048927 | Bacteria | 1780 |
| 884 | Ga0496124_0193207 | 3300048927 | Bacteria | 1555 |
| 885 | Ga0496124_0228859 | 3300048927 | Bacteria | 1392 |
| 886 | Ga0496125_0012632 | 3300048928 | Bacteria | 8361 |
| 887 | Ga0496125_0106591 | 3300048928 | Bacteria | 2045 |
| 888 | Ga0496125_0317057 | 3300048928 | Bacteria | 947 |
| 889 | Ga0496126_0154712 | 3300048929 | Bacteria | 1963 |
| 890 | Ga0501307_084195 | 3300049162 | Bacteria | 523 |
| 891 | Ga0501290_000685 | 3300049513 | Bacteria | 5053 |
| 892 | Ga0501292_000487 | 3300049515 | Bacteria | 5006 |
| 893 | Ga0501294_000665 | 3300049517 | Bacteria | 3871 |
| 894 | Ga0501300_002856 | 3300049523 | Bacteria | 2581 |
| 895 | Ga0501300_005402 | 3300049523 | Bacteria | 1882 |
| 896 | Ga0501302_001877 | 3300049525 | Bacteria | 1167 |
| 897 | Ga0501317_006142 | 3300049533 | Bacteria | 1309 |
| 898 | Ga0501031_0105480 | 3300049568 | Bacteria | 1839 |
| 899 | Ga0501032_0013932 | 3300049569 | Bacteria | 5704 |
| 900 | Ga0501033_0011355 | 3300049570 | Bacteria | 6815 |
| 901 | Ga0501034_1151892 | 3300049571 | Bacteria | 655 |
| 902 | Ga0501037_0017979 | 3300049573 | Bacteria | 5204 |
| 903 | Ga0501038_0037043 | 3300049574 | Bacteria | 4279 |
| 904 | Ga0501039_0033385 | 3300049575 | Bacteria | 3968 |
| 905 | Ga0501043_0128338 | 3300049579 | Bacteria | 1988 |
| 906 | Ga0501046_0076654 | 3300049580 | Bacteria | 2590 |
| 907 | Ga0501047_0037023 | 3300049581 | Bacteria | 4716 |
| 908 | Ga0501047_0198876 | 3300049581 | Bacteria | 1865 |
| 909 | Ga0501048_0472835 | 3300049582 | Bacteria | 898 |
| 910 | Ga0501067_0311232 | 3300049583 | Bacteria | 877 |
| 911 | Ga0501068_0302660 | 3300049584 | Bacteria | 1024 |
| 912 | Ga0501201_045823 | 3300049651 | Bacteria | 535 |
| 913 | Ga0501206_000908 | 3300049653 | Bacteria | 3657 |
| 914 | Ga0501223_001633 | 3300049663 | Bacteria | 5150 |
| 915 | Ga0501223_051827 | 3300049663 | Bacteria | 797 |
| 916 | Ga0501224_004715 | 3300049664 | Bacteria | 1941 |
| 917 | Ga0501227_003674 | 3300049665 | Bacteria | 3326 |
| 918 | Ga0501227_182629 | 3300049665 | Bacteria | 590 |
| 919 | Ga0501233_008810 | 3300049668 | Bacteria | 1954 |
| 920 | Ga0501235_011447 | 3300049669 | Bacteria | 1946 |
| 921 | Ga0501249_000153 | 3300049679 | Bacteria | 21509 |
| 922 | Ga0501257_002532 | 3300049686 | Bacteria | 3855 |
| 923 | Ga0501261_000765 | 3300049690 | Bacteria | 3999 |
| 924 | Ga0501221_007274 | 3300049704 | Bacteria | 1895 |
| 925 | Ga0501225_0011572 | 3300049705 | Bacteria | 2481 |
| 926 | Ga0501245_054042 | 3300049708 | Bacteria | 718 |
| 927 | Ga0501264_011722 | 3300049761 | Bacteria | 855 |
| 928 | Ga0501279_000487 | 3300049775 | Bacteria | 5220 |
| 929 | Ga0501280_006279 | 3300049776 | Bacteria | 1678 |
| 930 | Ga0501281_00997 | 3300049777 | Bacteria | 2356 |
| 931 | Ga0501282_000590 | 3300049778 | Bacteria | 4237 |
| 932 | Ga0501035_0023573 | 3300049822 | Bacteria | 5646 |
| 933 | Ga0501044_0149167 | 3300049823 | Bacteria | 2321 |
| 934 | nmdc:mga03n38_309700_c1 | 3300050490 | Bacteria | 850 |
| 935 | nmdc:mga0k408_88107_c1 | 3300050493 | Bacteria | 1823 |
| 936 | nmdc:mga07m45_890054_c1 | 3300050496 | Bacteria | 509 |
| 937 | nmdc:mga08y16_246751_c1 | 3300050511 | Bacteria | 1845 |
| 938 | nmdc:mga0a205_748466_c1 | 3300050515 | Bacteria | 826 |
| 939 | nmdc:mga0sz30_68790_c1 | 3300050516 | Bacteria | 1522 |
| 940 | Ga0500610_0000368 | 3300053079 | Bacteria | 13593 |
| 941 | Ga0500641_0043999 | 3300053096 | Bacteria | 1814 |
| 942 | Ga0500562_146049 | 3300053108 | Bacteria | 644 |
| 943 | Ga0500595_012404 | 3300053119 | Bacteria | 3298 |
| 944 | Ga0500607_121850 | 3300053121 | Bacteria | 1260 |
| 945 | Ga0500614_037620 | 3300053123 | Bacteria | 1215 |
| 946 | Ga0500642_0003405 | 3300053130 | Bacteria | 4806 |
| 947 | Ga0500559_0109098 | 3300053136 | Bacteria | 1281 |
| 948 | Ga0500577_0083788 | 3300053142 | Bacteria | 1276 |
| 949 | Ga0500585_052705 | 3300053144 | Bacteria | 1455 |
| 950 | Ga0500604_0001564 | 3300053151 | Bacteria | 6411 |
| 951 | Ga0500604_0346696 | 3300053151 | Bacteria | 516 |
| 952 | Ga0500622_0015622 | 3300053156 | Bacteria | 4065 |
| 953 | Ga0500627_0013523 | 3300053158 | Bacteria | 3097 |
| 954 | Ga0500627_0168315 | 3300053158 | Bacteria | 988 |
| 955 | Ga0500627_0436951 | 3300053158 | Bacteria | 553 |
| 956 | Ga0500570_016307 | 3300053724 | Bacteria | 4163 |
| 957 | Ga0500645_000045 | 3300053730 | Bacteria | 108141 |
| 958 | Ga0500596_002788 | 3300053735 | Bacteria | 3418 |
| 959 | Ga0466962_0558114 | 3300061719 | Bacteria | 582 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300001979 | JGI24740J21852_10084230 | JGI24740J21852_100842302 | 125 |
| 2 | 3300014497 | Ga0182008_10390683 | Ga0182008_103906831 | 125 |
| 3 | 3300048924 | Ga0496121_0001042 | Ga0496121_0001042_44150_44536 | 127 |
| 4 | iso_pu_bacteria | 2512564014 | 2512643673 | 127 |
| 5 | iso_pu_bacteria | 2643221560 | 2643820656 | 127 |
| 6 | 3300001426 | JGI24030J14995_101362 | JGI24030J14995_1013622 | 128 |
| 7 | 3300001432 | JGI24034J14986_103069 | JGI24034J14986_1030691 | 128 |
| 8 | 3300001976 | JGI24752J21851_1000787 | JGI24752J21851_10007873 | 128 |
| 9 | 3300001979 | JGI24740J21852_10050872 | JGI24740J21852_100508722 | 128 |
| 10 | 3300002070 | JGI24750J21931_1000739 | JGI24750J21931_10007392 | 128 |
| 11 | 3300002074 | JGI24748J21848_1000044 | JGI24748J21848_10000442 | 128 |
| 12 | 3300002076 | JGI24749J21850_1004130 | JGI24749J21850_10041302 | 128 |
| 13 | 3300002239 | JGI24034J26672_10000020 | JGI24034J26672_1000002053 | 128 |
| 14 | 3300002459 | JGI24751J29686_10013615 | JGI24751J29686_100136152 | 128 |
| 15 | 3300005295 | Ga0065707_10026456 | Ga0065707_100264562 | 128 |
| 16 | 3300005330 | Ga0070690_100000181 | Ga0070690_1000001812 | 128 |
| 17 | 3300005331 | Ga0070670_100029945 | Ga0070670_1000299455 | 128 |
| 18 | 3300005335 | Ga0070666_10000027 | Ga0070666_1000002788 | 128 |
| 19 | 3300005340 | Ga0070689_100000953 | Ga0070689_1000009532 | 128 |
| 20 | 3300005353 | Ga0070669_100000099 | Ga0070669_10000009979 | 128 |
| 21 | 3300005355 | Ga0070671_100001942 | Ga0070671_1000019428 | 128 |
| 22 | 3300005365 | Ga0070688_100012042 | Ga0070688_1000120422 | 128 |
| 23 | 3300005367 | Ga0070667_100015419 | Ga0070667_1000154194 | 128 |
| 24 | 3300005457 | Ga0070662_100161403 | Ga0070662_1001614032 | 128 |
| 25 | 3300005466 | Ga0070685_10000040 | Ga0070685_100000405 | 128 |
| 26 | 3300005544 | Ga0070686_100000010 | Ga0070686_10000001082 | 128 |
| 27 | 3300005548 | Ga0070665_100000254 | Ga0070665_10000025497 | 128 |
| 28 | 3300005577 | Ga0068857_100185348 | Ga0068857_1001853482 | 128 |
| 29 | 3300005617 | Ga0068859_100013746 | Ga0068859_1000137467 | 128 |
| 30 | 3300005618 | Ga0068864_100019119 | Ga0068864_1000191192 | 128 |
| 31 | 3300005719 | Ga0068861_100018823 | Ga0068861_1000188233 | 128 |
| 32 | 3300005841 | Ga0068863_100012480 | Ga0068863_1000124808 | 128 |
| 33 | 3300005842 | Ga0068858_100029286 | Ga0068858_1000292863 | 128 |
| 34 | 3300005843 | Ga0068860_100000080 | Ga0068860_10000008082 | 128 |
| 35 | 3300005844 | Ga0068862_100000115 | Ga0068862_10000011583 | 128 |
| 36 | 3300005937 | Ga0081455_10000294 | Ga0081455_1000029436 | 128 |
| 37 | 3300006931 | Ga0097620_100013744 | Ga0097620_1000137443 | 128 |
| 38 | 3300009551 | Ga0105238_10397283 | Ga0105238_103972832 | 128 |
| 39 | 3300009553 | Ga0105249_10000064 | Ga0105249_1000006489 | 128 |
| 40 | 3300014325 | Ga0163163_10072257 | Ga0163163_100722572 | 128 |
| 41 | 3300014326 | Ga0157380_10002524 | Ga0157380_100025244 | 128 |
| 42 | 3300017792 | Ga0163161_10000110 | Ga0163161_1000011087 | 128 |
| 43 | 3300025223 | Ga0207672_1000465 | Ga0207672_10004652 | 128 |
| 44 | 3300025903 | Ga0207680_10000009 | Ga0207680_1000000985 | 128 |
| 45 | 3300025923 | Ga0207681_10000106 | Ga0207681_100001068 | 128 |
| 46 | 3300025924 | Ga0207694_10324902 | Ga0207694_103249022 | 128 |
| 47 | 3300025925 | Ga0207650_10018291 | Ga0207650_100182912 | 128 |
| 48 | 3300025931 | Ga0207644_10001914 | Ga0207644_100019147 | 128 |
| 49 | 3300025933 | Ga0207706_10034096 | Ga0207706_100340965 | 128 |
| 50 | 3300025936 | Ga0207670_10000903 | Ga0207670_1000090314 | 128 |
| 51 | 3300025941 | Ga0207711_10020255 | Ga0207711_100202553 | 128 |
| 52 | 3300025961 | Ga0207712_10000044 | Ga0207712_1000004482 | 128 |
| 53 | 3300025972 | Ga0207668_10064921 | Ga0207668_100649212 | 128 |
| 54 | 3300025986 | Ga0207658_10000340 | Ga0207658_1000034025 | 128 |
| 55 | 3300026035 | Ga0207703_10005385 | Ga0207703_100053855 | 128 |
| 56 | 3300026088 | Ga0207641_10000672 | Ga0207641_100006728 | 128 |
| 57 | 3300026095 | Ga0207676_10035521 | Ga0207676_100355212 | 128 |
| 58 | 3300026116 | Ga0207674_11155580 | Ga0207674_111555801 | 128 |
| 59 | 3300026118 | Ga0207675_100001681 | Ga0207675_10000168121 | 128 |
| 60 | 3300028379 | Ga0268266_10000069 | Ga0268266_1000006984 | 128 |
| 61 | 3300028380 | Ga0268265_10000100 | Ga0268265_1000010037 | 128 |
| 62 | 3300028381 | Ga0268264_10000131 | Ga0268264_1000013182 | 128 |
| 63 | 3300031731 | Ga0307405_10642516 | Ga0307405_106425162 | 128 |
| 64 | 3300031901 | Ga0307406_11472903 | Ga0307406_114729032 | 128 |
| 65 | 3300031911 | Ga0307412_10257835 | Ga0307412_102578352 | 128 |
| 66 | 3300031995 | Ga0307409_100080490 | Ga0307409_1000804902 | 128 |
| 67 | 3300039437 | Ga0436365_1187875 | Ga0436365_1187875_970_1356 | 128 |
| 68 | 3300046616 | Ga0495668_0091963 | Ga0495668_0091963_1168_1554 | 128 |
| 69 | 3300048904 | Ga0496101_0349554 | Ga0496101_0349554_696_1082 | 128 |
| 70 | 3300048905 | Ga0496102_0005922 | Ga0496102_0005922_2255_2641 | 128 |
| 71 | 3300048906 | Ga0496103_0004376 | Ga0496103_0004376_4186_4572 | 128 |
| 72 | 3300048907 | Ga0496104_0211001 | Ga0496104_0211001_1142_1528 | 128 |
| 73 | 3300048908 | Ga0496105_0115733 | Ga0496105_0115733_374_760 | 128 |
| 74 | 3300048910 | Ga0496107_0135728 | Ga0496107_0135728_329_715 | 128 |
| 75 | 3300048914 | Ga0496111_0604886 | Ga0496111_0604886_381_767 | 128 |
| 76 | 3300048919 | Ga0496116_0043615 | Ga0496116_0043615_1084_1470 | 128 |
| 77 | 3300048920 | Ga0496117_0025412 | Ga0496117_0025412_1060_1446 | 128 |
| 78 | 3300048921 | Ga0496118_0028521 | Ga0496118_0028521_1353_1739 | 128 |
| 79 | 3300048922 | Ga0496119_0204898 | Ga0496119_0204898_175_561 | 128 |
| 80 | 3300048927 | Ga0496124_0156709 | Ga0496124_0156709_382_768 | 128 |
| 81 | 3300053151 | Ga0500604_0346696 | Ga0500604_0346696_112_498 | 128 |
| 82 | 3300053158 | Ga0500627_0436951 | Ga0500627_0436951_28_414 | 128 |
| 83 | iso_pu_bacteria | 2643221541 | 2643728037 | 128 |
| 84 | iso_pu_bacteria | 2643221605 | 2644039231 | 128 |
| 85 | iso_pu_bacteria | 2643221606 | 2644043013 | 128 |
| 86 | iso_pu_bacteria | 2643221671 | 2644395556 | 128 |
| 87 | iso_pu_bacteria | 2928526807 | 2928529683 | 128 |
| 88 | iso_pu_bacteria | 2928968154 | 2928970831 | 128 |
| 89 | 3300003215 | JGI25153J46596_10000075 | JGI25153J46596_1000007552 | 129 |
| 90 | 3300005336 | Ga0070680_101023284 | Ga0070680_1010232842 | 129 |
| 91 | 3300005338 | Ga0068868_101268816 | Ga0068868_1012688162 | 129 |
| 92 | 3300005339 | Ga0070660_100077685 | Ga0070660_1000776853 | 129 |
| 93 | 3300005344 | Ga0070661_100065866 | Ga0070661_1000658662 | 129 |
| 94 | 3300005367 | Ga0070667_100040433 | Ga0070667_1000404336 | 129 |
| 95 | 3300005457 | Ga0070662_100209328 | Ga0070662_1002093282 | 129 |
| 96 | 3300005458 | Ga0070681_10498477 | Ga0070681_104984772 | 129 |
| 97 | 3300005530 | Ga0070679_100168636 | Ga0070679_1001686362 | 129 |
| 98 | 3300005530 | Ga0070679_100251467 | Ga0070679_1002514672 | 129 |
| 99 | 3300005535 | Ga0070684_100916936 | Ga0070684_1009169362 | 129 |
| 100 | 3300005539 | Ga0068853_100086702 | Ga0068853_1000867024 | 129 |
| 101 | 3300005539 | Ga0068853_100101653 | Ga0068853_1001016532 | 129 |
| 102 | 3300005563 | Ga0068855_100002453 | Ga0068855_10000245320 | 129 |
| 103 | 3300005564 | Ga0070664_101180499 | Ga0070664_1011804992 | 129 |
| 104 | 3300005577 | Ga0068857_100689418 | Ga0068857_1006894181 | 129 |
| 105 | 3300005614 | Ga0068856_100293740 | Ga0068856_1002937402 | 129 |
| 106 | 3300005718 | Ga0068866_10312721 | Ga0068866_103127212 | 129 |
| 107 | 3300005843 | Ga0068860_100084797 | Ga0068860_1000847975 | 129 |
| 108 | 3300006353 | Ga0075370_10983137 | Ga0075370_109831371 | 129 |
| 109 | 3300009093 | Ga0105240_10022660 | Ga0105240_100226604 | 129 |
| 110 | 3300009147 | Ga0114129_12579388 | Ga0114129_125793882 | 129 |
| 111 | 3300009174 | Ga0105241_10184359 | Ga0105241_101843592 | 129 |
| 112 | 3300009176 | Ga0105242_11435441 | Ga0105242_114354412 | 129 |
| 113 | 3300009545 | Ga0105237_10179765 | Ga0105237_101797652 | 129 |
| 114 | 3300009551 | Ga0105238_10053133 | Ga0105238_100531335 | 129 |
| 115 | 3300010375 | Ga0105239_10344257 | Ga0105239_103442572 | 129 |
| 116 | 3300013297 | Ga0157378_10432363 | Ga0157378_104323633 | 129 |
| 117 | 3300013308 | Ga0157375_10779994 | Ga0157375_107799942 | 129 |
| 118 | 3300014325 | Ga0163163_10957643 | Ga0163163_109576432 | 129 |
| 119 | 3300025297 | Ga0209758_1000007 | Ga0209758_10000071074 | 129 |
| 120 | 3300025912 | Ga0207707_10302616 | Ga0207707_103026163 | 129 |
| 121 | 3300025913 | Ga0207695_10005515 | Ga0207695_100055154 | 129 |
| 122 | 3300025917 | Ga0207660_10361714 | Ga0207660_103617142 | 129 |
| 123 | 3300025920 | Ga0207649_10069342 | Ga0207649_100693423 | 129 |
| 124 | 3300025921 | Ga0207652_10103832 | Ga0207652_101038323 | 129 |
| 125 | 3300025933 | Ga0207706_10063755 | Ga0207706_100637555 | 129 |
| 126 | 3300025949 | Ga0207667_10004542 | Ga0207667_1000454217 | 129 |
| 127 | 3300025972 | Ga0207668_10144394 | Ga0207668_101443942 | 129 |
| 128 | 3300025981 | Ga0207640_10163481 | Ga0207640_101634812 | 129 |
| 129 | 3300026023 | Ga0207677_10978925 | Ga0207677_109789252 | 129 |
| 130 | 3300026041 | Ga0207639_10180817 | Ga0207639_101808172 | 129 |
| 131 | 3300026067 | Ga0207678_11040647 | Ga0207678_110406472 | 129 |
| 132 | 3300026078 | Ga0207702_10106765 | Ga0207702_101067652 | 129 |
| 133 | 3300026116 | Ga0207674_10516607 | Ga0207674_105166072 | 129 |
| 134 | 3300026116 | Ga0207674_10667219 | Ga0207674_106672191 | 129 |
| 135 | 3300026142 | Ga0207698_10236917 | Ga0207698_102369173 | 129 |
| 136 | 3300028379 | Ga0268266_10805685 | Ga0268266_108056852 | 129 |
| 137 | 3300028381 | Ga0268264_10034476 | Ga0268264_100344765 | 129 |
| 138 | 3300030745 | Ga0316182_1291942 | Ga0316182_12919422 | 129 |
| 139 | 3300032004 | Ga0307414_10998243 | Ga0307414_109982431 | 129 |
| 140 | 3300036401 | Ga0373937_1457284 | Ga0373937_1457284_31_423 | 129 |
| 141 | 3300037312 | Ga0395899_0033415 | Ga0395899_0033415_1998_2387 | 129 |
| 142 | 3300037471 | Ga0395905_0739624 | Ga0395905_0739624_210_599 | 129 |
| 143 | 3300037471 | Ga0395905_0756412 | Ga0395905_0756412_65_454 | 129 |
| 144 | 3300039450 | Ga0436363_1120500 | Ga0436363_1120500_117_506 | 129 |
| 145 | 3300046452 | Ga0495617_008797 | Ga0495617_008797_30_422 | 129 |
| 146 | 3300048925 | Ga0496122_0007218 | Ga0496122_0007218_2660_3049 | 129 |
| 147 | 3300048926 | Ga0496123_0000521 | Ga0496123_0000521_5007_5396 | 129 |
| 148 | 3300049513 | Ga0501290_000685 | Ga0501290_000685_4546_4935 | 129 |
| 149 | 3300049515 | Ga0501292_000487 | Ga0501292_000487_4540_4929 | 129 |
| 150 | 3300049517 | Ga0501294_000665 | Ga0501294_000665_3077_3466 | 129 |
| 151 | 3300049523 | Ga0501300_002856 | Ga0501300_002856_1514_1903 | 129 |
| 152 | 3300049523 | Ga0501300_005402 | Ga0501300_005402_1453_1842 | 129 |
| 153 | 3300049525 | Ga0501302_001877 | Ga0501302_001877_78_467 | 129 |
| 154 | 3300049533 | Ga0501317_006142 | Ga0501317_006142_576_965 | 129 |
| 155 | 3300049571 | Ga0501034_1151892 | Ga0501034_1151892_33_425 | 129 |
| 156 | 3300049583 | Ga0501067_0311232 | Ga0501067_0311232_381_770 | 129 |
| 157 | 3300049584 | Ga0501068_0302660 | Ga0501068_0302660_539_928 | 129 |
| 158 | 3300049653 | Ga0501206_000908 | Ga0501206_000908_78_467 | 129 |
| 159 | 3300049663 | Ga0501223_001633 | Ga0501223_001633_78_467 | 129 |
| 160 | 3300049663 | Ga0501223_051827 | Ga0501223_051827_212_601 | 129 |
| 161 | 3300049664 | Ga0501224_004715 | Ga0501224_004715_1475_1864 | 129 |
| 162 | 3300049665 | Ga0501227_003674 | Ga0501227_003674_2836_3225 | 129 |
| 163 | 3300049668 | Ga0501233_008810 | Ga0501233_008810_38_427 | 129 |
| 164 | 3300049669 | Ga0501235_011447 | Ga0501235_011447_83_472 | 129 |
| 165 | 3300049686 | Ga0501257_002532 | Ga0501257_002532_3403_3792 | 129 |
| 166 | 3300049690 | Ga0501261_000765 | Ga0501261_000765_475_864 | 129 |
| 167 | 3300049704 | Ga0501221_007274 | Ga0501221_007274_1425_1814 | 129 |
| 168 | 3300049705 | Ga0501225_0011572 | Ga0501225_0011572_225_614 | 129 |
| 169 | 3300049708 | Ga0501245_054042 | Ga0501245_054042_312_701 | 129 |
| 170 | 3300049761 | Ga0501264_011722 | Ga0501264_011722_425_814 | 129 |
| 171 | 3300049775 | Ga0501279_000487 | Ga0501279_000487_476_865 | 129 |
| 172 | 3300049776 | Ga0501280_006279 | Ga0501280_006279_487_876 | 129 |
| 173 | 3300049777 | Ga0501281_00997 | Ga0501281_00997_344_733 | 129 |
| 174 | 3300049778 | Ga0501282_000590 | Ga0501282_000590_624_1013 | 129 |
| 175 | 3300050496 | nmdc:mga07m45_890054_c1 | nmdc:mga07m45_890054_c1_27_416 | 129 |
| 176 | iso_pu_bacteria | 2818991466 | 2819715662 | 129 |
| 177 | iso_pu_bacteria | 2879163058 | 2879163772 | 129 |
| 178 | iso_pu_bacteria | 2885427238 | 2885428793 | 129 |
| 179 | iso_pu_bacteria | 2984564862 | 2984565387 | 129 |
| 180 | 3300001976 | JGI24752J21851_1048343 | JGI24752J21851_10483432 | 130 |
| 181 | 3300001977 | JGI24746J21847_1026031 | JGI24746J21847_10260312 | 130 |
| 182 | 3300001990 | JGI24737J22298_10035296 | JGI24737J22298_100352963 | 130 |
| 183 | 3300001990 | JGI24737J22298_10157564 | JGI24737J22298_101575641 | 130 |
| 184 | 3300002076 | JGI24749J21850_1012167 | JGI24749J21850_10121671 | 130 |
| 185 | 3300002239 | JGI24034J26672_10035881 | JGI24034J26672_100358812 | 130 |
| 186 | 3300002244 | JGI24742J22300_10055040 | JGI24742J22300_100550402 | 130 |
| 187 | 3300002459 | JGI24751J29686_10027125 | JGI24751J29686_100271252 | 130 |
| 188 | 3300005288 | Ga0065714_10260705 | Ga0065714_102607052 | 130 |
| 189 | 3300005290 | Ga0065712_10007663 | Ga0065712_100076633 | 130 |
| 190 | 3300005290 | Ga0065712_10078419 | Ga0065712_100784195 | 130 |
| 191 | 3300005293 | Ga0065715_10011341 | Ga0065715_100113412 | 130 |
| 192 | 3300005293 | Ga0065715_10052118 | Ga0065715_100521181 | 130 |
| 193 | 3300005293 | Ga0065715_10413386 | Ga0065715_104133861 | 130 |
| 194 | 3300005293 | Ga0065715_10496833 | Ga0065715_104968331 | 130 |
| 195 | 3300005327 | Ga0070658_10028060 | Ga0070658_100280602 | 130 |
| 196 | 3300005327 | Ga0070658_10097226 | Ga0070658_100972261 | 130 |
| 197 | 3300005327 | Ga0070658_10103278 | Ga0070658_101032783 | 130 |
| 198 | 3300005327 | Ga0070658_10108465 | Ga0070658_101084654 | 130 |
| 199 | 3300005327 | Ga0070658_10134928 | Ga0070658_101349282 | 130 |
| 200 | 3300005327 | Ga0070658_10218938 | Ga0070658_102189381 | 130 |
| 201 | 3300005327 | Ga0070658_10315931 | Ga0070658_103159312 | 130 |
| 202 | 3300005327 | Ga0070658_10933806 | Ga0070658_109338061 | 130 |
| 203 | 3300005327 | Ga0070658_11110562 | Ga0070658_111105622 | 130 |
| 204 | 3300005328 | Ga0070676_10079810 | Ga0070676_100798101 | 130 |
| 205 | 3300005328 | Ga0070676_10450265 | Ga0070676_104502652 | 130 |
| 206 | 3300005331 | Ga0070670_100002658 | Ga0070670_1000026583 | 130 |
| 207 | 3300005331 | Ga0070670_100024157 | Ga0070670_1000241571 | 130 |
| 208 | 3300005331 | Ga0070670_100185225 | Ga0070670_1001852252 | 130 |
| 209 | 3300005331 | Ga0070670_100274388 | Ga0070670_1002743882 | 130 |
| 210 | 3300005333 | Ga0070677_10081804 | Ga0070677_100818043 | 130 |
| 211 | 3300005333 | Ga0070677_10247580 | Ga0070677_102475802 | 130 |
| 212 | 3300005334 | Ga0068869_100351559 | Ga0068869_1003515592 | 130 |
| 213 | 3300005334 | Ga0068869_101200252 | Ga0068869_1012002521 | 130 |
| 214 | 3300005336 | Ga0070680_100567718 | Ga0070680_1005677182 | 130 |
| 215 | 3300005338 | Ga0068868_100890437 | Ga0068868_1008904371 | 130 |
| 216 | 3300005339 | Ga0070660_100001180 | Ga0070660_10000118017 | 130 |
| 217 | 3300005339 | Ga0070660_100012188 | Ga0070660_1000121882 | 130 |
| 218 | 3300005339 | Ga0070660_100013865 | Ga0070660_1000138655 | 130 |
| 219 | 3300005339 | Ga0070660_100421373 | Ga0070660_1004213732 | 130 |
| 220 | 3300005339 | Ga0070660_100583839 | Ga0070660_1005838391 | 130 |
| 221 | 3300005341 | Ga0070691_10084779 | Ga0070691_100847792 | 130 |
| 222 | 3300005343 | Ga0070687_100347145 | Ga0070687_1003471452 | 130 |
| 223 | 3300005344 | Ga0070661_100498434 | Ga0070661_1004984342 | 130 |
| 224 | 3300005345 | Ga0070692_10013089 | Ga0070692_100130893 | 130 |
| 225 | 3300005347 | Ga0070668_100117911 | Ga0070668_1001179112 | 130 |
| 226 | 3300005353 | Ga0070669_100087151 | Ga0070669_1000871513 | 130 |
| 227 | 3300005353 | Ga0070669_100204177 | Ga0070669_1002041772 | 130 |
| 228 | 3300005353 | Ga0070669_100232753 | Ga0070669_1002327532 | 130 |
| 229 | 3300005353 | Ga0070669_100265429 | Ga0070669_1002654293 | 130 |
| 230 | 3300005354 | Ga0070675_100003988 | Ga0070675_1000039889 | 130 |
| 231 | 3300005355 | Ga0070671_100108548 | Ga0070671_1001085482 | 130 |
| 232 | 3300005355 | Ga0070671_100122949 | Ga0070671_1001229492 | 130 |
| 233 | 3300005355 | Ga0070671_100151675 | Ga0070671_1001516752 | 130 |
| 234 | 3300005355 | Ga0070671_100410641 | Ga0070671_1004106412 | 130 |
| 235 | 3300005355 | Ga0070671_100984581 | Ga0070671_1009845812 | 130 |
| 236 | 3300005356 | Ga0070674_100092464 | Ga0070674_1000924643 | 130 |
| 237 | 3300005364 | Ga0070673_100029821 | Ga0070673_1000298212 | 130 |
| 238 | 3300005364 | Ga0070673_100129447 | Ga0070673_1001294471 | 130 |
| 239 | 3300005364 | Ga0070673_100152150 | Ga0070673_1001521502 | 130 |
| 240 | 3300005365 | Ga0070688_100951444 | Ga0070688_1009514442 | 130 |
| 241 | 3300005366 | Ga0070659_100010103 | Ga0070659_1000101038 | 130 |
| 242 | 3300005366 | Ga0070659_100075858 | Ga0070659_1000758582 | 130 |
| 243 | 3300005366 | Ga0070659_100133100 | Ga0070659_1001331002 | 130 |
| 244 | 3300005366 | Ga0070659_100198711 | Ga0070659_1001987113 | 130 |
| 245 | 3300005366 | Ga0070659_100442487 | Ga0070659_1004424871 | 130 |
| 246 | 3300005366 | Ga0070659_101190214 | Ga0070659_1011902142 | 130 |
| 247 | 3300005367 | Ga0070667_100020105 | Ga0070667_1000201053 | 130 |
| 248 | 3300005367 | Ga0070667_100242231 | Ga0070667_1002422313 | 130 |
| 249 | 3300005367 | Ga0070667_100445799 | Ga0070667_1004457992 | 130 |
| 250 | 3300005367 | Ga0070667_100986147 | Ga0070667_1009861472 | 130 |
| 251 | 3300005436 | Ga0070713_100033391 | Ga0070713_1000333916 | 130 |
| 252 | 3300005438 | Ga0070701_10037166 | Ga0070701_100371662 | 130 |
| 253 | 3300005441 | Ga0070700_100472007 | Ga0070700_1004720072 | 130 |
| 254 | 3300005441 | Ga0070700_101974148 | Ga0070700_1019741481 | 130 |
| 255 | 3300005455 | Ga0070663_100055977 | Ga0070663_1000559772 | 130 |
| 256 | 3300005455 | Ga0070663_100060393 | Ga0070663_1000603932 | 130 |
| 257 | 3300005455 | Ga0070663_100181265 | Ga0070663_1001812651 | 130 |
| 258 | 3300005456 | Ga0070678_100096872 | Ga0070678_1000968722 | 130 |
| 259 | 3300005456 | Ga0070678_100172839 | Ga0070678_1001728392 | 130 |
| 260 | 3300005457 | Ga0070662_100000679 | Ga0070662_1000006792 | 130 |
| 261 | 3300005457 | Ga0070662_100101062 | Ga0070662_1001010624 | 130 |
| 262 | 3300005457 | Ga0070662_100274360 | Ga0070662_1002743602 | 130 |
| 263 | 3300005459 | Ga0068867_100007156 | Ga0068867_1000071562 | 130 |
| 264 | 3300005466 | Ga0070685_10714771 | Ga0070685_107147711 | 130 |
| 265 | 3300005530 | Ga0070679_100383727 | Ga0070679_1003837272 | 130 |
| 266 | 3300005530 | Ga0070679_101376866 | Ga0070679_1013768662 | 130 |
| 267 | 3300005530 | Ga0070679_101430792 | Ga0070679_1014307921 | 130 |
| 268 | 3300005539 | Ga0068853_100910447 | Ga0068853_1009104472 | 130 |
| 269 | 3300005543 | Ga0070672_100040513 | Ga0070672_1000405134 | 130 |
| 270 | 3300005543 | Ga0070672_100178963 | Ga0070672_1001789632 | 130 |
| 271 | 3300005545 | Ga0070695_101196000 | Ga0070695_1011960002 | 130 |
| 272 | 3300005548 | Ga0070665_100005616 | Ga0070665_1000056163 | 130 |
| 273 | 3300005548 | Ga0070665_100057545 | Ga0070665_1000575453 | 130 |
| 274 | 3300005563 | Ga0068855_100000348 | Ga0068855_10000034834 | 130 |
| 275 | 3300005563 | Ga0068855_100744393 | Ga0068855_1007443932 | 130 |
| 276 | 3300005563 | Ga0068855_101279963 | Ga0068855_1012799632 | 130 |
| 277 | 3300005564 | Ga0070664_100085729 | Ga0070664_1000857293 | 130 |
| 278 | 3300005564 | Ga0070664_100652007 | Ga0070664_1006520072 | 130 |
| 279 | 3300005577 | Ga0068857_100056493 | Ga0068857_1000564936 | 130 |
| 280 | 3300005577 | Ga0068857_101052430 | Ga0068857_1010524302 | 130 |
| 281 | 3300005616 | Ga0068852_100532963 | Ga0068852_1005329632 | 130 |
| 282 | 3300005617 | Ga0068859_100002941 | Ga0068859_10000294116 | 130 |
| 283 | 3300005617 | Ga0068859_100012656 | Ga0068859_1000126566 | 130 |
| 284 | 3300005617 | Ga0068859_100536646 | Ga0068859_1005366462 | 130 |
| 285 | 3300005617 | Ga0068859_100724386 | Ga0068859_1007243862 | 130 |
| 286 | 3300005618 | Ga0068864_100055855 | Ga0068864_1000558552 | 130 |
| 287 | 3300005618 | Ga0068864_100181101 | Ga0068864_1001811012 | 130 |
| 288 | 3300005618 | Ga0068864_100711408 | Ga0068864_1007114082 | 130 |
| 289 | 3300005719 | Ga0068861_100021530 | Ga0068861_1000215302 | 130 |
| 290 | 3300005719 | Ga0068861_100449408 | Ga0068861_1004494081 | 130 |
| 291 | 3300005719 | Ga0068861_100666677 | Ga0068861_1006666772 | 130 |
| 292 | 3300005719 | Ga0068861_101034052 | Ga0068861_1010340522 | 130 |
| 293 | 3300005841 | Ga0068863_100035622 | Ga0068863_1000356222 | 130 |
| 294 | 3300005842 | Ga0068858_100001162 | Ga0068858_10000116213 | 130 |
| 295 | 3300005842 | Ga0068858_100016027 | Ga0068858_1000160273 | 130 |
| 296 | 3300005842 | Ga0068858_101942137 | Ga0068858_1019421371 | 130 |
| 297 | 3300005843 | Ga0068860_100026111 | Ga0068860_1000261115 | 130 |
| 298 | 3300005843 | Ga0068860_100026902 | Ga0068860_1000269024 | 130 |
| 299 | 3300005843 | Ga0068860_100067443 | Ga0068860_1000674433 | 130 |
| 300 | 3300005843 | Ga0068860_100759394 | Ga0068860_1007593942 | 130 |
| 301 | 3300005844 | Ga0068862_100308568 | Ga0068862_1003085682 | 130 |
| 302 | 3300005844 | Ga0068862_100501247 | Ga0068862_1005012472 | 130 |
| 303 | 3300005844 | Ga0068862_100588523 | Ga0068862_1005885232 | 130 |
| 304 | 3300006358 | Ga0068871_101829113 | Ga0068871_1018291132 | 130 |
| 305 | 3300006871 | Ga0075434_102190148 | Ga0075434_1021901482 | 130 |
| 306 | 3300006931 | Ga0097620_100002941 | Ga0097620_1000029412 | 130 |
| 307 | 3300006931 | Ga0097620_100012657 | Ga0097620_1000126576 | 130 |
| 308 | 3300006931 | Ga0097620_100536633 | Ga0097620_1005366332 | 130 |
| 309 | 3300006931 | Ga0097620_100724412 | Ga0097620_1007244122 | 130 |
| 310 | 3300009092 | Ga0105250_10012794 | Ga0105250_100127942 | 130 |
| 311 | 3300009093 | Ga0105240_10061647 | Ga0105240_100616472 | 130 |
| 312 | 3300009094 | Ga0111539_10794666 | Ga0111539_107946662 | 130 |
| 313 | 3300009147 | Ga0114129_10345493 | Ga0114129_103454932 | 130 |
| 314 | 3300009177 | Ga0105248_10388843 | Ga0105248_103888431 | 130 |
| 315 | 3300009177 | Ga0105248_10860954 | Ga0105248_108609541 | 130 |
| 316 | 3300009545 | Ga0105237_11489919 | Ga0105237_114899192 | 130 |
| 317 | 3300009553 | Ga0105249_10021979 | Ga0105249_100219797 | 130 |
| 318 | 3300009553 | Ga0105249_10277098 | Ga0105249_102770982 | 130 |
| 319 | 3300009553 | Ga0105249_10367535 | Ga0105249_103675351 | 130 |
| 320 | 3300009553 | Ga0105249_10728938 | Ga0105249_107289382 | 130 |
| 321 | 3300011119 | Ga0105246_10322581 | Ga0105246_103225812 | 130 |
| 322 | 3300011119 | Ga0105246_10579673 | Ga0105246_105796732 | 130 |
| 323 | 3300011119 | Ga0105246_10964332 | Ga0105246_109643322 | 130 |
| 324 | 3300013100 | Ga0157373_10279321 | Ga0157373_102793212 | 130 |
| 325 | 3300013102 | Ga0157371_10013524 | Ga0157371_100135244 | 130 |
| 326 | 3300013105 | Ga0157369_11967960 | Ga0157369_119679602 | 130 |
| 327 | 3300013296 | Ga0157374_12588274 | Ga0157374_125882742 | 130 |
| 328 | 3300013297 | Ga0157378_10817188 | Ga0157378_108171881 | 130 |
| 329 | 3300013307 | Ga0157372_10009012 | Ga0157372_100090122 | 130 |
| 330 | 3300013308 | Ga0157375_11435204 | Ga0157375_114352042 | 130 |
| 331 | 3300013308 | Ga0157375_13016466 | Ga0157375_130164662 | 130 |
| 332 | 3300014325 | Ga0163163_10721352 | Ga0163163_107213522 | 130 |
| 333 | 3300014326 | Ga0157380_10075783 | Ga0157380_100757833 | 130 |
| 334 | 3300014326 | Ga0157380_10096702 | Ga0157380_100967022 | 130 |
| 335 | 3300014326 | Ga0157380_10456434 | Ga0157380_104564342 | 130 |
| 336 | 3300014326 | Ga0157380_10895017 | Ga0157380_108950171 | 130 |
| 337 | 3300014745 | Ga0157377_10226163 | Ga0157377_102261632 | 130 |
| 338 | 3300014968 | Ga0157379_10010033 | Ga0157379_100100337 | 130 |
| 339 | 3300017792 | Ga0163161_11161327 | Ga0163161_111613271 | 130 |
| 340 | 3300021388 | Ga0213875_10006754 | Ga0213875_100067544 | 130 |
| 341 | 3300025315 | Ga0207697_10009072 | Ga0207697_100090726 | 130 |
| 342 | 3300025711 | Ga0207696_1013319 | Ga0207696_10133192 | 130 |
| 343 | 3300025893 | Ga0207682_10000039 | Ga0207682_100000399 | 130 |
| 344 | 3300025893 | Ga0207682_10246485 | Ga0207682_102464852 | 130 |
| 345 | 3300025901 | Ga0207688_10026624 | Ga0207688_100266244 | 130 |
| 346 | 3300025901 | Ga0207688_10110927 | Ga0207688_101109272 | 130 |
| 347 | 3300025904 | Ga0207647_10033491 | Ga0207647_100334916 | 130 |
| 348 | 3300025904 | Ga0207647_10066134 | Ga0207647_100661343 | 130 |
| 349 | 3300025904 | Ga0207647_10166105 | Ga0207647_101661052 | 130 |
| 350 | 3300025904 | Ga0207647_10289606 | Ga0207647_102896061 | 130 |
| 351 | 3300025907 | Ga0207645_10035923 | Ga0207645_100359236 | 130 |
| 352 | 3300025907 | Ga0207645_10231619 | Ga0207645_102316193 | 130 |
| 353 | 3300025907 | Ga0207645_10624832 | Ga0207645_106248321 | 130 |
| 354 | 3300025909 | Ga0207705_10000208 | Ga0207705_1000020850 | 130 |
| 355 | 3300025909 | Ga0207705_10025084 | Ga0207705_100250844 | 130 |
| 356 | 3300025909 | Ga0207705_10076426 | Ga0207705_100764264 | 130 |
| 357 | 3300025909 | Ga0207705_10107505 | Ga0207705_101075052 | 130 |
| 358 | 3300025909 | Ga0207705_10113887 | Ga0207705_101138874 | 130 |
| 359 | 3300025909 | Ga0207705_10149149 | Ga0207705_101491493 | 130 |
| 360 | 3300025909 | Ga0207705_10231184 | Ga0207705_102311841 | 130 |
| 361 | 3300025911 | Ga0207654_10191013 | Ga0207654_101910132 | 130 |
| 362 | 3300025913 | Ga0207695_10175633 | Ga0207695_101756332 | 130 |
| 363 | 3300025914 | Ga0207671_10925167 | Ga0207671_109251672 | 130 |
| 364 | 3300025918 | Ga0207662_10125658 | Ga0207662_101256582 | 130 |
| 365 | 3300025919 | Ga0207657_10035734 | Ga0207657_100357344 | 130 |
| 366 | 3300025919 | Ga0207657_10319210 | Ga0207657_103192102 | 130 |
| 367 | 3300025920 | Ga0207649_10236649 | Ga0207649_102366492 | 130 |
| 368 | 3300025920 | Ga0207649_10386603 | Ga0207649_103866031 | 130 |
| 369 | 3300025921 | Ga0207652_10374041 | Ga0207652_103740412 | 130 |
| 370 | 3300025921 | Ga0207652_10537172 | Ga0207652_105371722 | 130 |
| 371 | 3300025921 | Ga0207652_10749115 | Ga0207652_107491151 | 130 |
| 372 | 3300025923 | Ga0207681_10113356 | Ga0207681_101133561 | 130 |
| 373 | 3300025923 | Ga0207681_10162212 | Ga0207681_101622123 | 130 |
| 374 | 3300025923 | Ga0207681_10205610 | Ga0207681_102056102 | 130 |
| 375 | 3300025923 | Ga0207681_11048530 | Ga0207681_110485302 | 130 |
| 376 | 3300025925 | Ga0207650_10001256 | Ga0207650_100012567 | 130 |
| 377 | 3300025925 | Ga0207650_10008010 | Ga0207650_100080107 | 130 |
| 378 | 3300025925 | Ga0207650_10230303 | Ga0207650_102303032 | 130 |
| 379 | 3300025925 | Ga0207650_10461867 | Ga0207650_104618672 | 130 |
| 380 | 3300025925 | Ga0207650_10482176 | Ga0207650_104821762 | 130 |
| 381 | 3300025926 | Ga0207659_10040564 | Ga0207659_100405645 | 130 |
| 382 | 3300025926 | Ga0207659_10064639 | Ga0207659_100646392 | 130 |
| 383 | 3300025926 | Ga0207659_10648815 | Ga0207659_106488152 | 130 |
| 384 | 3300025929 | Ga0207664_11006118 | Ga0207664_110061182 | 130 |
| 385 | 3300025931 | Ga0207644_10452176 | Ga0207644_104521762 | 130 |
| 386 | 3300025932 | Ga0207690_10117045 | Ga0207690_101170452 | 130 |
| 387 | 3300025932 | Ga0207690_10118703 | Ga0207690_101187033 | 130 |
| 388 | 3300025932 | Ga0207690_11118146 | Ga0207690_111181461 | 130 |
| 389 | 3300025932 | Ga0207690_11359688 | Ga0207690_113596881 | 130 |
| 390 | 3300025933 | Ga0207706_10004398 | Ga0207706_1000439810 | 130 |
| 391 | 3300025933 | Ga0207706_10044371 | Ga0207706_100443716 | 130 |
| 392 | 3300025933 | Ga0207706_10429972 | Ga0207706_104299721 | 130 |
| 393 | 3300025933 | Ga0207706_10672553 | Ga0207706_106725532 | 130 |
| 394 | 3300025936 | Ga0207670_11352923 | Ga0207670_113529232 | 130 |
| 395 | 3300025937 | Ga0207669_10101224 | Ga0207669_101012244 | 130 |
| 396 | 3300025938 | Ga0207704_10209602 | Ga0207704_102096022 | 130 |
| 397 | 3300025940 | Ga0207691_10015030 | Ga0207691_100150306 | 130 |
| 398 | 3300025940 | Ga0207691_10429159 | Ga0207691_104291592 | 130 |
| 399 | 3300025941 | Ga0207711_10016424 | Ga0207711_100164244 | 130 |
| 400 | 3300025941 | Ga0207711_10047049 | Ga0207711_100470491 | 130 |
| 401 | 3300025941 | Ga0207711_10200849 | Ga0207711_102008493 | 130 |
| 402 | 3300025941 | Ga0207711_10562097 | Ga0207711_105620971 | 130 |
| 403 | 3300025941 | Ga0207711_11146159 | Ga0207711_111461592 | 130 |
| 404 | 3300025942 | Ga0207689_10049402 | Ga0207689_100494022 | 130 |
| 405 | 3300025945 | Ga0207679_10416167 | Ga0207679_104161672 | 130 |
| 406 | 3300025945 | Ga0207679_10887233 | Ga0207679_108872331 | 130 |
| 407 | 3300025949 | Ga0207667_10004895 | Ga0207667_1000489515 | 130 |
| 408 | 3300025949 | Ga0207667_10363860 | Ga0207667_103638602 | 130 |
| 409 | 3300025949 | Ga0207667_10650108 | Ga0207667_106501081 | 130 |
| 410 | 3300025960 | Ga0207651_10114821 | Ga0207651_101148211 | 130 |
| 411 | 3300025960 | Ga0207651_10176065 | Ga0207651_101760652 | 130 |
| 412 | 3300025961 | Ga0207712_10408023 | Ga0207712_104080232 | 130 |
| 413 | 3300025961 | Ga0207712_10973662 | Ga0207712_109736621 | 130 |
| 414 | 3300025961 | Ga0207712_11201869 | Ga0207712_112018691 | 130 |
| 415 | 3300025972 | Ga0207668_10065339 | Ga0207668_100653394 | 130 |
| 416 | 3300025972 | Ga0207668_10644397 | Ga0207668_106443972 | 130 |
| 417 | 3300025972 | Ga0207668_11035644 | Ga0207668_110356442 | 130 |
| 418 | 3300025972 | Ga0207668_11144757 | Ga0207668_111447572 | 130 |
| 419 | 3300025986 | Ga0207658_10006141 | Ga0207658_100061418 | 130 |
| 420 | 3300025986 | Ga0207658_10754244 | Ga0207658_107542441 | 130 |
| 421 | 3300025986 | Ga0207658_10762895 | Ga0207658_107628951 | 130 |
| 422 | 3300026023 | Ga0207677_10430759 | Ga0207677_104307592 | 130 |
| 423 | 3300026035 | Ga0207703_10020483 | Ga0207703_100204832 | 130 |
| 424 | 3300026035 | Ga0207703_10098830 | Ga0207703_100988303 | 130 |
| 425 | 3300026035 | Ga0207703_11695853 | Ga0207703_116958532 | 130 |
| 426 | 3300026067 | Ga0207678_10011599 | Ga0207678_100115998 | 130 |
| 427 | 3300026067 | Ga0207678_10048738 | Ga0207678_100487383 | 130 |
| 428 | 3300026067 | Ga0207678_10334956 | Ga0207678_103349562 | 130 |
| 429 | 3300026075 | Ga0207708_10086506 | Ga0207708_100865062 | 130 |
| 430 | 3300026088 | Ga0207641_10000761 | Ga0207641_1000076118 | 130 |
| 431 | 3300026088 | Ga0207641_10951219 | Ga0207641_109512192 | 130 |
| 432 | 3300026088 | Ga0207641_11080981 | Ga0207641_110809812 | 130 |
| 433 | 3300026089 | Ga0207648_10176437 | Ga0207648_101764371 | 130 |
| 434 | 3300026095 | Ga0207676_10094243 | Ga0207676_100942432 | 130 |
| 435 | 3300026095 | Ga0207676_10586250 | Ga0207676_105862502 | 130 |
| 436 | 3300026095 | Ga0207676_10685452 | Ga0207676_106854521 | 130 |
| 437 | 3300026095 | Ga0207676_11797888 | Ga0207676_117978882 | 130 |
| 438 | 3300026116 | Ga0207674_10044419 | Ga0207674_100444198 | 130 |
| 439 | 3300026116 | Ga0207674_10625467 | Ga0207674_106254671 | 130 |
| 440 | 3300026116 | Ga0207674_12274227 | Ga0207674_122742271 | 130 |
| 441 | 3300026118 | Ga0207675_100029504 | Ga0207675_1000295042 | 130 |
| 442 | 3300026118 | Ga0207675_100257365 | Ga0207675_1002573652 | 130 |
| 443 | 3300026118 | Ga0207675_100570273 | Ga0207675_1005702733 | 130 |
| 444 | 3300026121 | Ga0207683_10014772 | Ga0207683_100147724 | 130 |
| 445 | 3300026121 | Ga0207683_10078371 | Ga0207683_100783712 | 130 |
| 446 | 3300026121 | Ga0207683_10634750 | Ga0207683_106347502 | 130 |
| 447 | 3300026121 | Ga0207683_10913938 | Ga0207683_109139382 | 130 |
| 448 | 3300026142 | Ga0207698_10525089 | Ga0207698_105250892 | 130 |
| 449 | 3300027665 | Ga0209983_1026010 | Ga0209983_10260102 | 130 |
| 450 | 3300027876 | Ga0209974_10002918 | Ga0209974_100029189 | 130 |
| 451 | 3300027907 | Ga0207428_10155494 | Ga0207428_101554943 | 130 |
| 452 | 3300028379 | Ga0268266_10023211 | Ga0268266_100232112 | 130 |
| 453 | 3300028380 | Ga0268265_10023954 | Ga0268265_100239542 | 130 |
| 454 | 3300028380 | Ga0268265_10100837 | Ga0268265_101008373 | 130 |
| 455 | 3300028380 | Ga0268265_10117904 | Ga0268265_101179042 | 130 |
| 456 | 3300028380 | Ga0268265_10246548 | Ga0268265_102465481 | 130 |
| 457 | 3300028380 | Ga0268265_10506790 | Ga0268265_105067902 | 130 |
| 458 | 3300028381 | Ga0268264_10000755 | Ga0268264_100007554 | 130 |
| 459 | 3300028381 | Ga0268264_10004670 | Ga0268264_100046707 | 130 |
| 460 | 3300028381 | Ga0268264_10121250 | Ga0268264_101212502 | 130 |
| 461 | 3300028381 | Ga0268264_11290603 | Ga0268264_112906031 | 130 |
| 462 | 3300031548 | Ga0307408_100041577 | Ga0307408_1000415775 | 130 |
| 463 | 3300031548 | Ga0307408_100307461 | Ga0307408_1003074613 | 130 |
| 464 | 3300031548 | Ga0307408_100576402 | Ga0307408_1005764021 | 130 |
| 465 | 3300031548 | Ga0307408_100613685 | Ga0307408_1006136851 | 130 |
| 466 | 3300031548 | Ga0307408_101309092 | Ga0307408_1013090922 | 130 |
| 467 | 3300031731 | Ga0307405_10046364 | Ga0307405_100463643 | 130 |
| 468 | 3300031731 | Ga0307405_10113838 | Ga0307405_101138384 | 130 |
| 469 | 3300031731 | Ga0307405_10287352 | Ga0307405_102873522 | 130 |
| 470 | 3300031731 | Ga0307405_10510779 | Ga0307405_105107792 | 130 |
| 471 | 3300031731 | Ga0307405_10627811 | Ga0307405_106278112 | 130 |
| 472 | 3300031731 | Ga0307405_11061330 | Ga0307405_110613302 | 130 |
| 473 | 3300031731 | Ga0307405_11121242 | Ga0307405_111212421 | 130 |
| 474 | 3300031824 | Ga0307413_10023965 | Ga0307413_100239652 | 130 |
| 475 | 3300031824 | Ga0307413_10037662 | Ga0307413_100376625 | 130 |
| 476 | 3300031824 | Ga0307413_10085789 | Ga0307413_100857892 | 130 |
| 477 | 3300031824 | Ga0307413_10098907 | Ga0307413_100989072 | 130 |
| 478 | 3300031824 | Ga0307413_10172041 | Ga0307413_101720412 | 130 |
| 479 | 3300031824 | Ga0307413_10257729 | Ga0307413_102577292 | 130 |
| 480 | 3300031824 | Ga0307413_10525219 | Ga0307413_105252192 | 130 |
| 481 | 3300031824 | Ga0307413_11007132 | Ga0307413_110071321 | 130 |
| 482 | 3300031824 | Ga0307413_12044353 | Ga0307413_120443531 | 130 |
| 483 | 3300031852 | Ga0307410_10078904 | Ga0307410_100789043 | 130 |
| 484 | 3300031852 | Ga0307410_10100163 | Ga0307410_101001633 | 130 |
| 485 | 3300031852 | Ga0307410_10242688 | Ga0307410_102426882 | 130 |
| 486 | 3300031852 | Ga0307410_10284446 | Ga0307410_102844462 | 130 |
| 487 | 3300031852 | Ga0307410_10430612 | Ga0307410_104306122 | 130 |
| 488 | 3300031901 | Ga0307406_10109407 | Ga0307406_101094072 | 130 |
| 489 | 3300031901 | Ga0307406_10116945 | Ga0307406_101169453 | 130 |
| 490 | 3300031901 | Ga0307406_10402620 | Ga0307406_104026202 | 130 |
| 491 | 3300031901 | Ga0307406_10691178 | Ga0307406_106911782 | 130 |
| 492 | 3300031901 | Ga0307406_12101955 | Ga0307406_121019551 | 130 |
| 493 | 3300031911 | Ga0307412_10021005 | Ga0307412_100210052 | 130 |
| 494 | 3300031911 | Ga0307412_10032399 | Ga0307412_100323995 | 130 |
| 495 | 3300031911 | Ga0307412_10043271 | Ga0307412_100432711 | 130 |
| 496 | 3300031911 | Ga0307412_10101086 | Ga0307412_101010862 | 130 |
| 497 | 3300031911 | Ga0307412_10269042 | Ga0307412_102690422 | 130 |
| 498 | 3300031995 | Ga0307409_100305636 | Ga0307409_1003056363 | 130 |
| 499 | 3300031995 | Ga0307409_100310723 | Ga0307409_1003107232 | 130 |
| 500 | 3300031995 | Ga0307409_100325503 | Ga0307409_1003255032 | 130 |
| 501 | 3300031995 | Ga0307409_100580288 | Ga0307409_1005802882 | 130 |
| 502 | 3300031995 | Ga0307409_100998211 | Ga0307409_1009982112 | 130 |
| 503 | 3300031995 | Ga0307409_101008745 | Ga0307409_1010087452 | 130 |
| 504 | 3300031995 | Ga0307409_101083267 | Ga0307409_1010832672 | 130 |
| 505 | 3300031995 | Ga0307409_101951919 | Ga0307409_1019519191 | 130 |
| 506 | 3300031995 | Ga0307409_102251423 | Ga0307409_1022514231 | 130 |
| 507 | 3300031995 | Ga0307409_102734548 | Ga0307409_1027345481 | 130 |
| 508 | 3300032002 | Ga0307416_100016870 | Ga0307416_1000168706 | 130 |
| 509 | 3300032002 | Ga0307416_100035044 | Ga0307416_1000350442 | 130 |
| 510 | 3300032002 | Ga0307416_100281823 | Ga0307416_1002818233 | 130 |
| 511 | 3300032002 | Ga0307416_100820295 | Ga0307416_1008202952 | 130 |
| 512 | 3300032002 | Ga0307416_101002029 | Ga0307416_1010020292 | 130 |
| 513 | 3300032002 | Ga0307416_103119237 | Ga0307416_1031192372 | 130 |
| 514 | 3300032004 | Ga0307414_10002871 | Ga0307414_100028713 | 130 |
| 515 | 3300032004 | Ga0307414_10101153 | Ga0307414_101011533 | 130 |
| 516 | 3300032004 | Ga0307414_10140253 | Ga0307414_101402533 | 130 |
| 517 | 3300032004 | Ga0307414_10162790 | Ga0307414_101627902 | 130 |
| 518 | 3300032004 | Ga0307414_10168218 | Ga0307414_101682182 | 130 |
| 519 | 3300032004 | Ga0307414_10224419 | Ga0307414_102244192 | 130 |
| 520 | 3300032004 | Ga0307414_10232765 | Ga0307414_102327652 | 130 |
| 521 | 3300032004 | Ga0307414_10390053 | Ga0307414_103900532 | 130 |
| 522 | 3300032004 | Ga0307414_10436192 | Ga0307414_104361922 | 130 |
| 523 | 3300032004 | Ga0307414_10630740 | Ga0307414_106307402 | 130 |
| 524 | 3300032004 | Ga0307414_10816904 | Ga0307414_108169042 | 130 |
| 525 | 3300032004 | Ga0307414_11004837 | Ga0307414_110048372 | 130 |
| 526 | 3300032004 | Ga0307414_11249385 | Ga0307414_112493852 | 130 |
| 527 | 3300032004 | Ga0307414_11475558 | Ga0307414_114755582 | 130 |
| 528 | 3300032005 | Ga0307411_10028876 | Ga0307411_100288766 | 130 |
| 529 | 3300032005 | Ga0307411_10050728 | Ga0307411_100507283 | 130 |
| 530 | 3300032005 | Ga0307411_10131049 | Ga0307411_101310492 | 130 |
| 531 | 3300032005 | Ga0307411_10351925 | Ga0307411_103519252 | 130 |
| 532 | 3300032005 | Ga0307411_10401423 | Ga0307411_104014233 | 130 |
| 533 | 3300032005 | Ga0307411_10561434 | Ga0307411_105614342 | 130 |
| 534 | 3300032005 | Ga0307411_10676438 | Ga0307411_106764382 | 130 |
| 535 | 3300032005 | Ga0307411_10701713 | Ga0307411_107017132 | 130 |
| 536 | 3300032005 | Ga0307411_10870921 | Ga0307411_108709212 | 130 |
| 537 | 3300032005 | Ga0307411_12339935 | Ga0307411_123399351 | 130 |
| 538 | 3300032126 | Ga0307415_100100176 | Ga0307415_1001001762 | 130 |
| 539 | 3300032126 | Ga0307415_100195758 | Ga0307415_1001957583 | 130 |
| 540 | 3300032126 | Ga0307415_100583746 | Ga0307415_1005837462 | 130 |
| 541 | 3300033180 | Ga0307510_10439757 | Ga0307510_104397571 | 130 |
| 542 | 3300035170 | Ga0373943_0484005 | Ga0373943_0484005_70_462 | 130 |
| 543 | 3300035692 | Ga0373935_0003141 | Ga0373935_0003141_8368_8760 | 130 |
| 544 | 3300037312 | Ga0395899_0016902 | Ga0395899_0016902_2106_2498 | 130 |
| 545 | 3300037312 | Ga0395899_0220475 | Ga0395899_0220475_42_434 | 130 |
| 546 | 3300037418 | Ga0395900_0003931 | Ga0395900_0003931_7856_8248 | 130 |
| 547 | 3300037418 | Ga0395900_0116425 | Ga0395900_0116425_1496_1888 | 130 |
| 548 | 3300037418 | Ga0395900_1506301 | Ga0395900_1506301_79_471 | 130 |
| 549 | 3300037418 | Ga0395900_1607851 | Ga0395900_1607851_45_437 | 130 |
| 550 | 3300037466 | Ga0395898_0164552 | Ga0395898_0164552_1359_1751 | 130 |
| 551 | 3300037471 | Ga0395905_0000128 | Ga0395905_0000128_65890_66282 | 130 |
| 552 | 3300037471 | Ga0395905_0147073 | Ga0395905_0147073_1203_1595 | 130 |
| 553 | 3300037471 | Ga0395905_0214315 | Ga0395905_0214315_107_499 | 130 |
| 554 | 3300037471 | Ga0395905_0247461 | Ga0395905_0247461_82_474 | 130 |
| 555 | 3300037471 | Ga0395905_1193820 | Ga0395905_1193820_206_598 | 130 |
| 556 | 3300037853 | Ga0436364_1351302 | Ga0436364_1351302_2099_2491 | 130 |
| 557 | 3300038443 | Ga0395901_0002771 | Ga0395901_0002771_1363_1755 | 130 |
| 558 | 3300038443 | Ga0395901_1217131 | Ga0395901_1217131_229_621 | 130 |
| 559 | 3300039450 | Ga0436363_0884963 | Ga0436363_0884963_50_442 | 130 |
| 560 | 3300042439 | Ga0439464_0150824 | Ga0439464_0150824_313_705 | 130 |
| 561 | 3300044684 | Ga0466966_0023062 | Ga0466966_0023062_3154_3546 | 130 |
| 562 | 3300044684 | Ga0466966_0088303 | Ga0466966_0088303_969_1361 | 130 |
| 563 | 3300044765 | Ga0466970_0155040 | Ga0466970_0155040_142_534 | 130 |
| 564 | 3300044901 | Ga0466960_0283555 | Ga0466960_0283555_192_584 | 130 |
| 565 | 3300045049 | Ga0466959_0112521 | Ga0466959_0112521_1033_1425 | 130 |
| 566 | 3300045976 | Ga0466967_0135933 | Ga0466967_0135933_1644_2036 | 130 |
| 567 | 3300045976 | Ga0466967_0291541 | Ga0466967_0291541_139_531 | 130 |
| 568 | 3300046454 | Ga0495592_0261858 | Ga0495592_0261858_49_444 | 130 |
| 569 | 3300046459 | Ga0495629_0183206 | Ga0495629_0183206_581_976 | 130 |
| 570 | 3300046476 | Ga0495662_0531430 | Ga0495662_0531430_38_433 | 130 |
| 571 | 3300046525 | Ga0495663_0003428 | Ga0495663_0003428_471_863 | 130 |
| 572 | 3300046525 | Ga0495663_0014740 | Ga0495663_0014740_1058_1450 | 130 |
| 573 | 3300046528 | Ga0495642_0097077 | Ga0495642_0097077_844_1236 | 130 |
| 574 | 3300046536 | Ga0495587_0039997 | Ga0495587_0039997_1605_2000 | 130 |
| 575 | 3300046537 | Ga0495598_0003634 | Ga0495598_0003634_2408_2800 | 130 |
| 576 | 3300046537 | Ga0495598_0029987 | Ga0495598_0029987_259_651 | 130 |
| 577 | 3300046539 | Ga0495621_0009367 | Ga0495621_0009367_1036_1428 | 130 |
| 578 | 3300046539 | Ga0495621_0033442 | Ga0495621_0033442_954_1346 | 130 |
| 579 | 3300046539 | Ga0495621_0035398 | Ga0495621_0035398_102_494 | 130 |
| 580 | 3300046558 | Ga0495633_0034695 | Ga0495633_0034695_1710_2102 | 130 |
| 581 | 3300046558 | Ga0495633_0396962 | Ga0495633_0396962_102_494 | 130 |
| 582 | 3300046616 | Ga0495668_0000002 | Ga0495668_0000002_758014_758424 | 130 |
| 583 | 3300046616 | Ga0495668_0128218 | Ga0495668_0128218_946_1338 | 130 |
| 584 | 3300046660 | Ga0495625_0086473 | Ga0495625_0086473_1005_1397 | 130 |
| 585 | 3300046664 | Ga0495659_0001448 | Ga0495659_0001448_5594_5986 | 130 |
| 586 | 3300046684 | Ga0495669_0035415 | Ga0495669_0035415_1294_1686 | 130 |
| 587 | 3300046684 | Ga0495669_0492290 | Ga0495669_0492290_97_489 | 130 |
| 588 | 3300046691 | Ga0495670_0019656 | Ga0495670_0019656_1211_1603 | 130 |
| 589 | 3300046691 | Ga0495670_0045451 | Ga0495670_0045451_914_1306 | 130 |
| 590 | 3300046691 | Ga0495670_0045929 | Ga0495670_0045929_489_881 | 130 |
| 591 | 3300046809 | Ga0495600_0004283 | Ga0495600_0004283_4800_5195 | 130 |
| 592 | 3300047318 | Ga0495636_0176276 | Ga0495636_0176276_26_418 | 130 |
| 593 | 3300047445 | Ga0495677_0007554 | Ga0495677_0007554_1722_2114 | 130 |
| 594 | 3300047445 | Ga0495677_0022968 | Ga0495677_0022968_533_925 | 130 |
| 595 | 3300048910 | Ga0496107_0067757 | Ga0496107_0067757_780_1172 | 130 |
| 596 | 3300048910 | Ga0496107_1304037 | Ga0496107_1304037_110_502 | 130 |
| 597 | 3300048911 | Ga0496108_0031276 | Ga0496108_0031276_130_522 | 130 |
| 598 | 3300048912 | Ga0496109_0978256 | Ga0496109_0978256_50_442 | 130 |
| 599 | 3300048912 | Ga0496109_1613650 | Ga0496109_1613650_114_506 | 130 |
| 600 | 3300048927 | Ga0496124_0228859 | Ga0496124_0228859_780_1178 | 130 |
| 601 | 3300048929 | Ga0496126_0154712 | Ga0496126_0154712_1310_1711 | 130 |
| 602 | 3300049651 | Ga0501201_045823 | Ga0501201_045823_10_402 | 130 |
| 603 | 3300050511 | nmdc:mga08y16_246751_c1 | nmdc:mga08y16_246751_c1_470_862 | 130 |
| 604 | 3300050515 | nmdc:mga0a205_748466_c1 | nmdc:mga0a205_748466_c1_287_679 | 130 |
| 605 | 3300053108 | Ga0500562_146049 | Ga0500562_146049_195_587 | 130 |
| 606 | 3300053119 | Ga0500595_012404 | Ga0500595_012404_78_473 | 130 |
| 607 | 3300053121 | Ga0500607_121850 | Ga0500607_121850_554_949 | 130 |
| 608 | 3300061719 | Ga0466962_0558114 | Ga0466962_0558114_81_473 | 130 |
| 609 | 3300001915 | JGI24741J21665_1005545 | JGI24741J21665_10055451 | 131 |
| 610 | 3300001979 | JGI24740J21852_10020499 | JGI24740J21852_100204995 | 131 |
| 611 | 3300001989 | JGI24739J22299_10012359 | JGI24739J22299_100123593 | 131 |
| 612 | 3300001990 | JGI24737J22298_10162797 | JGI24737J22298_101627972 | 131 |
| 613 | 3300002067 | JGI24735J21928_10154245 | JGI24735J21928_101542452 | 131 |
| 614 | 3300005335 | Ga0070666_10485366 | Ga0070666_104853662 | 131 |
| 615 | 3300005353 | Ga0070669_100143248 | Ga0070669_1001432482 | 131 |
| 616 | 3300005354 | Ga0070675_100179961 | Ga0070675_1001799612 | 131 |
| 617 | 3300005355 | Ga0070671_100260332 | Ga0070671_1002603323 | 131 |
| 618 | 3300005355 | Ga0070671_100371700 | Ga0070671_1003717002 | 131 |
| 619 | 3300005355 | Ga0070671_100594184 | Ga0070671_1005941842 | 131 |
| 620 | 3300005356 | Ga0070674_100058426 | Ga0070674_1000584262 | 131 |
| 621 | 3300005367 | Ga0070667_100181031 | Ga0070667_1001810312 | 131 |
| 622 | 3300005438 | Ga0070701_11157890 | Ga0070701_111578901 | 131 |
| 623 | 3300005455 | Ga0070663_100085279 | Ga0070663_1000852795 | 131 |
| 624 | 3300005456 | Ga0070678_100000997 | Ga0070678_10000099714 | 131 |
| 625 | 3300005457 | Ga0070662_100299832 | Ga0070662_1002998322 | 131 |
| 626 | 3300005539 | Ga0068853_100114920 | Ga0068853_1001149202 | 131 |
| 627 | 3300005543 | Ga0070672_100216640 | Ga0070672_1002166402 | 131 |
| 628 | 3300005548 | Ga0070665_100301874 | Ga0070665_1003018743 | 131 |
| 629 | 3300005616 | Ga0068852_100696265 | Ga0068852_1006962652 | 131 |
| 630 | 3300005617 | Ga0068859_102183913 | Ga0068859_1021839132 | 131 |
| 631 | 3300005618 | Ga0068864_100010035 | Ga0068864_1000100354 | 131 |
| 632 | 3300005719 | Ga0068861_100007077 | Ga0068861_1000070774 | 131 |
| 633 | 3300005834 | Ga0068851_10387881 | Ga0068851_103878811 | 131 |
| 634 | 3300005841 | Ga0068863_100033434 | Ga0068863_1000334342 | 131 |
| 635 | 3300006237 | Ga0097621_100196814 | Ga0097621_1001968142 | 131 |
| 636 | 3300006358 | Ga0068871_100510299 | Ga0068871_1005102992 | 131 |
| 637 | 3300006931 | Ga0097620_102183347 | Ga0097620_1021833472 | 131 |
| 638 | 3300009177 | Ga0105248_10274961 | Ga0105248_102749612 | 131 |
| 639 | 3300009551 | Ga0105238_11170451 | Ga0105238_111704512 | 131 |
| 640 | 3300009553 | Ga0105249_10886224 | Ga0105249_108862242 | 131 |
| 641 | 3300013102 | Ga0157371_10000773 | Ga0157371_1000077311 | 131 |
| 642 | 3300013104 | Ga0157370_10199673 | Ga0157370_101996732 | 131 |
| 643 | 3300013105 | Ga0157369_10172233 | Ga0157369_101722331 | 131 |
| 644 | 3300013296 | Ga0157374_10844892 | Ga0157374_108448921 | 131 |
| 645 | 3300013306 | Ga0163162_11331001 | Ga0163162_113310012 | 131 |
| 646 | 3300013308 | Ga0157375_10191588 | Ga0157375_101915884 | 131 |
| 647 | 3300014969 | Ga0157376_12874989 | Ga0157376_128749892 | 131 |
| 648 | 3300015690 | Ga0183363_1002 | Ga0183363_100253 | 131 |
| 649 | 3300016635 | Ga0183361_10771 | Ga0183361_107712 | 131 |
| 650 | 3300017792 | Ga0163161_10329742 | Ga0163161_103297423 | 131 |
| 651 | 3300025304 | Ga0209257_1009940 | Ga0209257_10099407 | 131 |
| 652 | 3300025315 | Ga0207697_10095186 | Ga0207697_100951862 | 131 |
| 653 | 3300025903 | Ga0207680_10409592 | Ga0207680_104095922 | 131 |
| 654 | 3300025924 | Ga0207694_11483886 | Ga0207694_114838862 | 131 |
| 655 | 3300025925 | Ga0207650_10268227 | Ga0207650_102682271 | 131 |
| 656 | 3300025925 | Ga0207650_10270496 | Ga0207650_102704962 | 131 |
| 657 | 3300025926 | Ga0207659_10174995 | Ga0207659_101749952 | 131 |
| 658 | 3300025931 | Ga0207644_10149325 | Ga0207644_101493253 | 131 |
| 659 | 3300025933 | Ga0207706_10266658 | Ga0207706_102666582 | 131 |
| 660 | 3300025937 | Ga0207669_10001337 | Ga0207669_100013376 | 131 |
| 661 | 3300025940 | Ga0207691_10224540 | Ga0207691_102245402 | 131 |
| 662 | 3300025941 | Ga0207711_11325089 | Ga0207711_113250892 | 131 |
| 663 | 3300025960 | Ga0207651_11162658 | Ga0207651_111626582 | 131 |
| 664 | 3300025972 | Ga0207668_10614747 | Ga0207668_106147472 | 131 |
| 665 | 3300025986 | Ga0207658_10322120 | Ga0207658_103221201 | 131 |
| 666 | 3300026035 | Ga0207703_12283568 | Ga0207703_122835681 | 131 |
| 667 | 3300026067 | Ga0207678_10583072 | Ga0207678_105830722 | 131 |
| 668 | 3300026088 | Ga0207641_10000779 | Ga0207641_1000077925 | 131 |
| 669 | 3300026095 | Ga0207676_10429292 | Ga0207676_104292921 | 131 |
| 670 | 3300026118 | Ga0207675_100000514 | Ga0207675_1000005143 | 131 |
| 671 | 3300026118 | Ga0207675_100562938 | Ga0207675_1005629382 | 131 |
| 672 | 3300026121 | Ga0207683_10002590 | Ga0207683_100025902 | 131 |
| 673 | 3300028786 | Ga0307517_10017361 | Ga0307517_100173614 | 131 |
| 674 | 3300031911 | Ga0307412_10025103 | Ga0307412_100251032 | 131 |
| 675 | 3300032005 | Ga0307411_11071337 | Ga0307411_110713371 | 131 |
| 676 | 3300032005 | Ga0307411_11116431 | Ga0307411_111164312 | 131 |
| 677 | 3300038443 | Ga0395901_0150031 | Ga0395901_0150031_66_461 | 131 |
| 678 | 3300041443 | Ga0451789_0899707 | Ga0451789_0899707_140_535 | 131 |
| 679 | 3300041452 | Ga0451793_1773260 | Ga0451793_1773260_72_467 | 131 |
| 680 | 3300041486 | Ga0451807_1027240 | Ga0451807_1027240_102_497 | 131 |
| 681 | 3300046492 | Ga0495585_0324624 | Ga0495585_0324624_262_660 | 131 |
| 682 | 3300046506 | Ga0495583_0016258 | Ga0495583_0016258_246_644 | 131 |
| 683 | 3300046518 | Ga0495631_0178031 | Ga0495631_0178031_199_594 | 131 |
| 684 | 3300046522 | Ga0495643_0016713 | Ga0495643_0016713_3806_4201 | 131 |
| 685 | 3300046525 | Ga0495663_0001228 | Ga0495663_0001228_3207_3605 | 131 |
| 686 | 3300046616 | Ga0495668_0749640 | Ga0495668_0749640_49_447 | 131 |
| 687 | 3300046648 | Ga0495611_0110181 | Ga0495611_0110181_32_427 | 131 |
| 688 | 3300046648 | Ga0495611_0230191 | Ga0495611_0230191_399_797 | 131 |
| 689 | 3300046691 | Ga0495670_0000023 | Ga0495670_0000023_3963_4358 | 131 |
| 690 | 3300047323 | Ga0495683_0006873 | Ga0495683_0006873_1152_1550 | 131 |
| 691 | 3300047443 | Ga0495687_000083 | Ga0495687_000083_3470_3865 | 131 |
| 692 | 3300047470 | Ga0495681_0010757 | Ga0495681_0010757_3323_3721 | 131 |
| 693 | 3300048911 | Ga0496108_0187645 | Ga0496108_0187645_1000_1395 | 131 |
| 694 | 3300048913 | Ga0496110_1148052 | Ga0496110_1148052_92_487 | 131 |
| 695 | 3300048917 | Ga0496114_0007656 | Ga0496114_0007656_4163_4558 | 131 |
| 696 | 3300048926 | Ga0496123_0095057 | Ga0496123_0095057_1344_1739 | 131 |
| 697 | 3300048928 | Ga0496125_0106591 | Ga0496125_0106591_725_1120 | 131 |
| 698 | 3300053136 | Ga0500559_0109098 | Ga0500559_0109098_647_1045 | 131 |
| 699 | 3300053158 | Ga0500627_0168315 | Ga0500627_0168315_207_602 | 131 |
| 700 | 3300053730 | Ga0500645_000045 | Ga0500645_000045_107717_108112 | 131 |
| 701 | iso_pu_bacteria | 2852680915 | 2852682576 | 131 |
| 702 | 3300001979 | JGI24740J21852_10008187 | JGI24740J21852_100081873 | 132 |
| 703 | 3300001990 | JGI24737J22298_10012282 | JGI24737J22298_100122822 | 132 |
| 704 | 3300001990 | JGI24737J22298_10032459 | JGI24737J22298_100324591 | 132 |
| 705 | 3300003762 | Ga0055542_1000259 | Ga0055542_100025953 | 132 |
| 706 | 3300003763 | Ga0055529_1000301 | Ga0055529_100030117 | 132 |
| 707 | 3300003784 | Ga0055534_1007285 | Ga0055534_10072853 | 132 |
| 708 | 3300003791 | Ga0055530_10000012 | Ga0055530_1000001293 | 132 |
| 709 | 3300003794 | Ga0055531_10004440 | Ga0055531_100044403 | 132 |
| 710 | 3300005262 | Ga0065165_1014358 | Ga0065165_10143581 | 132 |
| 711 | 3300005331 | Ga0070670_100019396 | Ga0070670_1000193962 | 132 |
| 712 | 3300005331 | Ga0070670_100061850 | Ga0070670_1000618506 | 132 |
| 713 | 3300005335 | Ga0070666_10005298 | Ga0070666_100052984 | 132 |
| 714 | 3300005339 | Ga0070660_100043892 | Ga0070660_1000438922 | 132 |
| 715 | 3300005344 | Ga0070661_100003713 | Ga0070661_1000037133 | 132 |
| 716 | 3300005347 | Ga0070668_100000003 | Ga0070668_100000003144 | 132 |
| 717 | 3300005353 | Ga0070669_100360596 | Ga0070669_1003605962 | 132 |
| 718 | 3300005355 | Ga0070671_100000639 | Ga0070671_10000063917 | 132 |
| 719 | 3300005367 | Ga0070667_100000035 | Ga0070667_100000035162 | 132 |
| 720 | 3300005455 | Ga0070663_100485545 | Ga0070663_1004855452 | 132 |
| 721 | 3300005564 | Ga0070664_100282630 | Ga0070664_1002826302 | 132 |
| 722 | 3300005577 | Ga0068857_101799232 | Ga0068857_1017992321 | 132 |
| 723 | 3300005614 | Ga0068856_102258836 | Ga0068856_1022588361 | 132 |
| 724 | 3300005616 | Ga0068852_102007250 | Ga0068852_1020072501 | 132 |
| 725 | 3300005616 | Ga0068852_102565391 | Ga0068852_1025653911 | 132 |
| 726 | 3300005617 | Ga0068859_100027021 | Ga0068859_1000270214 | 132 |
| 727 | 3300005719 | Ga0068861_100037161 | Ga0068861_1000371614 | 132 |
| 728 | 3300005834 | Ga0068851_10168097 | Ga0068851_101680971 | 132 |
| 729 | 3300005842 | Ga0068858_100009853 | Ga0068858_1000098534 | 132 |
| 730 | 3300005843 | Ga0068860_100000143 | Ga0068860_100000143101 | 132 |
| 731 | 3300005844 | Ga0068862_100000168 | Ga0068862_10000016842 | 132 |
| 732 | 3300006048 | Ga0075363_100360428 | Ga0075363_1003604282 | 132 |
| 733 | 3300006186 | Ga0075369_10102425 | Ga0075369_101024252 | 132 |
| 734 | 3300006195 | Ga0075366_10166487 | Ga0075366_101664872 | 132 |
| 735 | 3300006931 | Ga0097620_100027021 | Ga0097620_1000270214 | 132 |
| 736 | 3300009011 | Ga0105251_10155750 | Ga0105251_101557502 | 132 |
| 737 | 3300009093 | Ga0105240_11506374 | Ga0105240_115063741 | 132 |
| 738 | 3300009174 | Ga0105241_10197524 | Ga0105241_101975242 | 132 |
| 739 | 3300009174 | Ga0105241_11828686 | Ga0105241_118286861 | 132 |
| 740 | 3300009177 | Ga0105248_10313327 | Ga0105248_103133272 | 132 |
| 741 | 3300009545 | Ga0105237_10394207 | Ga0105237_103942072 | 132 |
| 742 | 3300009545 | Ga0105237_12034482 | Ga0105237_120344821 | 132 |
| 743 | 3300009551 | Ga0105238_12224347 | Ga0105238_122243471 | 132 |
| 744 | 3300012475 | Ga0157317_1015382 | Ga0157317_10153822 | 132 |
| 745 | 3300012513 | Ga0157326_1004331 | Ga0157326_10043312 | 132 |
| 746 | 3300013100 | Ga0157373_10367671 | Ga0157373_103676711 | 132 |
| 747 | 3300013104 | Ga0157370_11415562 | Ga0157370_114155621 | 132 |
| 748 | 3300013105 | Ga0157369_11378314 | Ga0157369_113783141 | 132 |
| 749 | 3300014969 | Ga0157376_12426559 | Ga0157376_124265592 | 132 |
| 750 | 3300025226 | Ga0209674_103675 | Ga0209674_1036752 | 132 |
| 751 | 3300025246 | Ga0209646_1026252 | Ga0209646_10262521 | 132 |
| 752 | 3300025253 | Ga0209677_103840 | Ga0209677_1038406 | 132 |
| 753 | 3300025254 | Ga0209148_1000008 | Ga0209148_1000008337 | 132 |
| 754 | 3300025272 | Ga0209455_1000002 | Ga0209455_10000021086 | 132 |
| 755 | 3300025291 | Ga0209675_1000306 | Ga0209675_100030617 | 132 |
| 756 | 3300025292 | Ga0209676_1000359 | Ga0209676_100035995 | 132 |
| 757 | 3300025294 | Ga0209025_1054774 | Ga0209025_10547742 | 132 |
| 758 | 3300025297 | Ga0209758_1032664 | Ga0209758_10326643 | 132 |
| 759 | 3300025298 | Ga0209050_1000067 | Ga0209050_1000067315 | 132 |
| 760 | 3300025304 | Ga0209257_1007212 | Ga0209257_10072121 | 132 |
| 761 | 3300025321 | Ga0207656_10000439 | Ga0207656_100004398 | 132 |
| 762 | 3300025903 | Ga0207680_10009304 | Ga0207680_100093046 | 132 |
| 763 | 3300025904 | Ga0207647_10016588 | Ga0207647_100165882 | 132 |
| 764 | 3300025904 | Ga0207647_10264057 | Ga0207647_102640572 | 132 |
| 765 | 3300025909 | Ga0207705_10002135 | Ga0207705_100021356 | 132 |
| 766 | 3300025911 | Ga0207654_10003098 | Ga0207654_100030982 | 132 |
| 767 | 3300025913 | Ga0207695_10202868 | Ga0207695_102028683 | 132 |
| 768 | 3300025914 | Ga0207671_10007336 | Ga0207671_100073365 | 132 |
| 769 | 3300025914 | Ga0207671_10458414 | Ga0207671_104584141 | 132 |
| 770 | 3300025919 | Ga0207657_10005322 | Ga0207657_1000532212 | 132 |
| 771 | 3300025920 | Ga0207649_10001745 | Ga0207649_100017458 | 132 |
| 772 | 3300025920 | Ga0207649_10899490 | Ga0207649_108994902 | 132 |
| 773 | 3300025923 | Ga0207681_10065248 | Ga0207681_100652482 | 132 |
| 774 | 3300025924 | Ga0207694_10160723 | Ga0207694_101607233 | 132 |
| 775 | 3300025924 | Ga0207694_11859676 | Ga0207694_118596761 | 132 |
| 776 | 3300025925 | Ga0207650_10029671 | Ga0207650_100296712 | 132 |
| 777 | 3300025931 | Ga0207644_10534193 | Ga0207644_105341932 | 132 |
| 778 | 3300025932 | Ga0207690_10978439 | Ga0207690_109784392 | 132 |
| 779 | 3300025945 | Ga0207679_10333910 | Ga0207679_103339102 | 132 |
| 780 | 3300025949 | Ga0207667_10000074 | Ga0207667_10000074112 | 132 |
| 781 | 3300025949 | Ga0207667_10012017 | Ga0207667_1001201714 | 132 |
| 782 | 3300025972 | Ga0207668_10000006 | Ga0207668_10000006140 | 132 |
| 783 | 3300025981 | Ga0207640_10115701 | Ga0207640_101157014 | 132 |
| 784 | 3300025981 | Ga0207640_11766013 | Ga0207640_117660131 | 132 |
| 785 | 3300025986 | Ga0207658_10000026 | Ga0207658_1000002686 | 132 |
| 786 | 3300025986 | Ga0207658_10139879 | Ga0207658_101398792 | 132 |
| 787 | 3300026035 | Ga0207703_10006763 | Ga0207703_100067634 | 132 |
| 788 | 3300026041 | Ga0207639_10004764 | Ga0207639_100047644 | 132 |
| 789 | 3300026067 | Ga0207678_10601785 | Ga0207678_106017851 | 132 |
| 790 | 3300026078 | Ga0207702_10034221 | Ga0207702_100342212 | 132 |
| 791 | 3300026118 | Ga0207675_100031814 | Ga0207675_1000318146 | 132 |
| 792 | 3300026142 | Ga0207698_10031824 | Ga0207698_100318246 | 132 |
| 793 | 3300026142 | Ga0207698_10387721 | Ga0207698_103877212 | 132 |
| 794 | 3300026142 | Ga0207698_12526045 | Ga0207698_125260451 | 132 |
| 795 | 3300028380 | Ga0268265_10001457 | Ga0268265_100014574 | 132 |
| 796 | 3300028381 | Ga0268264_10000076 | Ga0268264_10000076101 | 132 |
| 797 | 3300031548 | Ga0307408_100326170 | Ga0307408_1003261702 | 132 |
| 798 | 3300031911 | Ga0307412_10768682 | Ga0307412_107686822 | 132 |
| 799 | 3300032004 | Ga0307414_10070699 | Ga0307414_100706992 | 132 |
| 800 | 3300032004 | Ga0307414_10393073 | Ga0307414_103930732 | 132 |
| 801 | 3300032005 | Ga0307411_10201773 | Ga0307411_102017732 | 132 |
| 802 | 3300039437 | Ga0436365_0619502 | Ga0436365_0619502_764_1162 | 132 |
| 803 | 3300046491 | Ga0495584_0659634 | Ga0495584_0659634_36_434 | 132 |
| 804 | 3300046500 | Ga0495596_0006083 | Ga0495596_0006083_3438_3836 | 132 |
| 805 | 3300046506 | Ga0495583_0004957 | Ga0495583_0004957_5315_5713 | 132 |
| 806 | 3300046506 | Ga0495583_0016458 | Ga0495583_0016458_535_933 | 132 |
| 807 | 3300046506 | Ga0495583_0078412 | Ga0495583_0078412_912_1310 | 132 |
| 808 | 3300046507 | Ga0495606_0242453 | Ga0495606_0242453_209_607 | 132 |
| 809 | 3300046522 | Ga0495643_0010725 | Ga0495643_0010725_2546_2944 | 132 |
| 810 | 3300046524 | Ga0495648_0001684 | Ga0495648_0001684_4754_5155 | 132 |
| 811 | 3300046542 | Ga0495597_0073444 | Ga0495597_0073444_59_457 | 132 |
| 812 | 3300046616 | Ga0495668_0000098 | Ga0495668_0000098_133222_133620 | 132 |
| 813 | 3300046660 | Ga0495625_0000522 | Ga0495625_0000522_51403_51801 | 132 |
| 814 | 3300046660 | Ga0495625_0051472 | Ga0495625_0051472_2303_2701 | 132 |
| 815 | 3300046660 | Ga0495625_0647666 | Ga0495625_0647666_157_555 | 132 |
| 816 | 3300046684 | Ga0495669_0000026 | Ga0495669_0000026_5344_5742 | 132 |
| 817 | 3300046692 | Ga0495671_0613544 | Ga0495671_0613544_84_485 | 132 |
| 818 | 3300047323 | Ga0495683_0062950 | Ga0495683_0062950_1369_1767 | 132 |
| 819 | 3300047443 | Ga0495687_015404 | Ga0495687_015404_130_528 | 132 |
| 820 | 3300047472 | Ga0495686_0192046 | Ga0495686_0192046_58_456 | 132 |
| 821 | 3300047472 | Ga0495686_0459030 | Ga0495686_0459030_165_563 | 132 |
| 822 | 3300048912 | Ga0496109_0213154 | Ga0496109_0213154_321_722 | 132 |
| 823 | 3300048915 | Ga0496112_0654254 | Ga0496112_0654254_414_815 | 132 |
| 824 | 3300048925 | Ga0496122_0036789 | Ga0496122_0036789_2369_2770 | 132 |
| 825 | 3300048925 | Ga0496122_0130928 | Ga0496122_0130928_1070_1468 | 132 |
| 826 | 3300048926 | Ga0496123_0036372 | Ga0496123_0036372_2337_2738 | 132 |
| 827 | 3300048927 | Ga0496124_0193207 | Ga0496124_0193207_79_477 | 132 |
| 828 | 3300048928 | Ga0496125_0012632 | Ga0496125_0012632_2155_2556 | 132 |
| 829 | 3300049162 | Ga0501307_084195 | Ga0501307_084195_76_474 | 132 |
| 830 | 3300049568 | Ga0501031_0105480 | Ga0501031_0105480_910_1323 | 132 |
| 831 | 3300049569 | Ga0501032_0013932 | Ga0501032_0013932_4548_4961 | 132 |
| 832 | 3300049570 | Ga0501033_0011355 | Ga0501033_0011355_4929_5342 | 132 |
| 833 | 3300049573 | Ga0501037_0017979 | Ga0501037_0017979_3844_4257 | 132 |
| 834 | 3300049574 | Ga0501038_0037043 | Ga0501038_0037043_1677_2090 | 132 |
| 835 | 3300049575 | Ga0501039_0033385 | Ga0501039_0033385_1171_1584 | 132 |
| 836 | 3300049579 | Ga0501043_0128338 | Ga0501043_0128338_556_954 | 132 |
| 837 | 3300049580 | Ga0501046_0076654 | Ga0501046_0076654_1324_1737 | 132 |
| 838 | 3300049581 | Ga0501047_0037023 | Ga0501047_0037023_506_904 | 132 |
| 839 | 3300049581 | Ga0501047_0198876 | Ga0501047_0198876_1291_1704 | 132 |
| 840 | 3300049582 | Ga0501048_0472835 | Ga0501048_0472835_104_517 | 132 |
| 841 | 3300049665 | Ga0501227_182629 | Ga0501227_182629_94_492 | 132 |
| 842 | 3300049679 | Ga0501249_000153 | Ga0501249_000153_1041_1439 | 132 |
| 843 | 3300049822 | Ga0501035_0023573 | Ga0501035_0023573_553_966 | 132 |
| 844 | 3300049823 | Ga0501044_0149167 | Ga0501044_0149167_326_739 | 132 |
| 845 | 3300050490 | nmdc:mga03n38_309700_c1 | nmdc:mga03n38_309700_c1_428_829 | 132 |
| 846 | 3300050493 | nmdc:mga0k408_88107_c1 | nmdc:mga0k408_88107_c1_494_892 | 132 |
| 847 | 3300050516 | nmdc:mga0sz30_68790_c1 | nmdc:mga0sz30_68790_c1_688_1089 | 132 |
| 848 | 3300053079 | Ga0500610_0000368 | Ga0500610_0000368_7968_8366 | 132 |
| 849 | 3300053130 | Ga0500642_0003405 | Ga0500642_0003405_3131_3532 | 132 |
| 850 | 3300053144 | Ga0500585_052705 | Ga0500585_052705_1033_1431 | 132 |
| 851 | 3300053735 | Ga0500596_002788 | Ga0500596_002788_2914_3312 | 132 |
| 852 | 3300002076 | JGI24749J21850_1000180 | JGI24749J21850_10001803 | 133 |
| 853 | 3300002459 | JGI24751J29686_10000034 | JGI24751J29686_1000003447 | 133 |
| 854 | 3300003759 | Ga0055525_1000058 | Ga0055525_100005851 | 133 |
| 855 | 3300003792 | Ga0055540_1000935 | Ga0055540_100093517 | 133 |
| 856 | 3300005295 | Ga0065707_10097761 | Ga0065707_100977612 | 133 |
| 857 | 3300005331 | Ga0070670_100000033 | Ga0070670_100000033126 | 133 |
| 858 | 3300005335 | Ga0070666_10286186 | Ga0070666_102861862 | 133 |
| 859 | 3300005347 | Ga0070668_100153324 | Ga0070668_1001533242 | 133 |
| 860 | 3300005353 | Ga0070669_100000550 | Ga0070669_10000055030 | 133 |
| 861 | 3300005367 | Ga0070667_100000509 | Ga0070667_10000050923 | 133 |
| 862 | 3300005539 | Ga0068853_100725374 | Ga0068853_1007253741 | 133 |
| 863 | 3300005563 | Ga0068855_100600833 | Ga0068855_1006008333 | 133 |
| 864 | 3300005578 | Ga0068854_100034758 | Ga0068854_1000347583 | 133 |
| 865 | 3300005617 | Ga0068859_100001213 | Ga0068859_10000121320 | 133 |
| 866 | 3300005618 | Ga0068864_100000042 | Ga0068864_100000042128 | 133 |
| 867 | 3300005719 | Ga0068861_100018588 | Ga0068861_1000185883 | 133 |
| 868 | 3300005841 | Ga0068863_100132562 | Ga0068863_1001325622 | 133 |
| 869 | 3300005844 | Ga0068862_100000005 | Ga0068862_1000000056 | 133 |
| 870 | 3300006051 | Ga0075364_10218803 | Ga0075364_102188032 | 133 |
| 871 | 3300006195 | Ga0075366_10045145 | Ga0075366_100451454 | 133 |
| 872 | 3300006931 | Ga0097620_100001213 | Ga0097620_10000121320 | 133 |
| 873 | 3300009176 | Ga0105242_10055407 | Ga0105242_100554072 | 133 |
| 874 | 3300009177 | Ga0105248_10016770 | Ga0105248_100167705 | 133 |
| 875 | 3300009553 | Ga0105249_10145636 | Ga0105249_101456362 | 133 |
| 876 | 3300013105 | Ga0157369_10968858 | Ga0157369_109688581 | 133 |
| 877 | 3300013297 | Ga0157378_10096833 | Ga0157378_100968332 | 133 |
| 878 | 3300013307 | Ga0157372_10203861 | Ga0157372_102038612 | 133 |
| 879 | 3300014325 | Ga0163163_10052819 | Ga0163163_100528192 | 133 |
| 880 | 3300014326 | Ga0157380_10000883 | Ga0157380_100008835 | 133 |
| 881 | 3300014969 | Ga0157376_10370149 | Ga0157376_103701492 | 133 |
| 882 | 3300025230 | Ga0209563_100024 | Ga0209563_100024381 | 133 |
| 883 | 3300025292 | Ga0209676_1002125 | Ga0209676_100212514 | 133 |
| 884 | 3300025298 | Ga0209050_1000001 | Ga0209050_1000001813 | 133 |
| 885 | 3300025298 | Ga0209050_1000166 | Ga0209050_100016624 | 133 |
| 886 | 3300025303 | Ga0209051_1000291 | Ga0209051_100029147 | 133 |
| 887 | 3300025304 | Ga0209257_1000665 | Ga0209257_100066514 | 133 |
| 888 | 3300025903 | Ga0207680_10256710 | Ga0207680_102567102 | 133 |
| 889 | 3300025923 | Ga0207681_10000003 | Ga0207681_10000003310 | 133 |
| 890 | 3300025925 | Ga0207650_10000012 | Ga0207650_10000012319 | 133 |
| 891 | 3300025941 | Ga0207711_10013830 | Ga0207711_100138303 | 133 |
| 892 | 3300025961 | Ga0207712_10746933 | Ga0207712_107469332 | 133 |
| 893 | 3300025972 | Ga0207668_10095528 | Ga0207668_100955283 | 133 |
| 894 | 3300026041 | Ga0207639_10109150 | Ga0207639_101091501 | 133 |
| 895 | 3300026088 | Ga0207641_10031946 | Ga0207641_100319463 | 133 |
| 896 | 3300026095 | Ga0207676_10000009 | Ga0207676_10000009309 | 133 |
| 897 | 3300026116 | Ga0207674_10159318 | Ga0207674_101593183 | 133 |
| 898 | 3300026118 | Ga0207675_100001142 | Ga0207675_1000011428 | 133 |
| 899 | 3300028380 | Ga0268265_10000001 | Ga0268265_1000000199 | 133 |
| 900 | 3300028786 | Ga0307517_10012625 | Ga0307517_100126259 | 133 |
| 901 | 3300042142 | Ga0450905_020758 | Ga0450905_020758_376_780 | 133 |
| 902 | 3300046460 | Ga0495638_0198518 | Ga0495638_0198518_632_1033 | 133 |
| 903 | 3300046471 | Ga0495650_0004722 | Ga0495650_0004722_3407_3808 | 133 |
| 904 | 3300046492 | Ga0495585_0011108 | Ga0495585_0011108_3641_4042 | 133 |
| 905 | 3300046492 | Ga0495585_0083769 | Ga0495585_0083769_1041_1442 | 133 |
| 906 | 3300046525 | Ga0495663_0012348 | Ga0495663_0012348_1108_1509 | 133 |
| 907 | 3300046530 | Ga0495654_0006421 | Ga0495654_0006421_1368_1769 | 133 |
| 908 | 3300046616 | Ga0495668_0020786 | Ga0495668_0020786_2418_2819 | 133 |
| 909 | 3300046660 | Ga0495625_0720276 | Ga0495625_0720276_53_454 | 133 |
| 910 | 3300046665 | Ga0495661_0051089 | Ga0495661_0051089_1566_1967 | 133 |
| 911 | 3300047447 | Ga0495685_152922 | Ga0495685_152922_53_454 | 133 |
| 912 | 3300047470 | Ga0495681_0139749 | Ga0495681_0139749_273_674 | 133 |
| 913 | 3300048917 | Ga0496114_0000006 | Ga0496114_0000006_128614_129015 | 133 |
| 914 | 3300048925 | Ga0496122_0112991 | Ga0496122_0112991_1334_1735 | 133 |
| 915 | 3300048926 | Ga0496123_0023953 | Ga0496123_0023953_655_1056 | 133 |
| 916 | 3300048927 | Ga0496124_0015436 | Ga0496124_0015436_4835_5236 | 133 |
| 917 | 3300053151 | Ga0500604_0001564 | Ga0500604_0001564_4983_5387 | 133 |
| 918 | 3300053158 | Ga0500627_0013523 | Ga0500627_0013523_2086_2487 | 133 |
| 919 | 3300003794 | Ga0055531_10010086 | Ga0055531_100100863 | 134 |
| 920 | 3300025304 | Ga0209257_1000392 | Ga0209257_100039258 | 134 |
| 921 | 3300026116 | Ga0207674_10094976 | Ga0207674_100949762 | 134 |
| 922 | 3300031548 | Ga0307408_101280746 | Ga0307408_1012807462 | 134 |
| 923 | 3300031911 | Ga0307412_10013263 | Ga0307412_100132635 | 134 |
| 924 | 3300037312 | Ga0395899_0021184 | Ga0395899_0021184_2599_3003 | 134 |
| 925 | 3300037418 | Ga0395900_0091675 | Ga0395900_0091675_426_830 | 134 |
| 926 | 3300037466 | Ga0395898_0065887 | Ga0395898_0065887_1192_1596 | 134 |
| 927 | 3300037471 | Ga0395905_0015445 | Ga0395905_0015445_593_997 | 134 |
| 928 | 3300038443 | Ga0395901_0027145 | Ga0395901_0027145_937_1341 | 134 |
| 929 | 3300046522 | Ga0495643_0046546 | Ga0495643_0046546_668_1072 | 134 |
| 930 | 3300046660 | Ga0495625_0220121 | Ga0495625_0220121_796_1200 | 134 |
| 931 | 3300048918 | Ga0496115_0003797 | Ga0496115_0003797_4815_5219 | 134 |
| 932 | 3300048926 | Ga0496123_0046123 | Ga0496123_0046123_547_951 | 134 |
| 933 | 3300053096 | Ga0500641_0043999 | Ga0500641_0043999_1355_1759 | 134 |
| 934 | 3300053123 | Ga0500614_037620 | Ga0500614_037620_748_1152 | 134 |
| 935 | 3300053142 | Ga0500577_0083788 | Ga0500577_0083788_42_446 | 134 |
| 936 | 3300053156 | Ga0500622_0015622 | Ga0500622_0015622_48_452 | 134 |
| 937 | 3300053724 | Ga0500570_016307 | Ga0500570_016307_3711_4115 | 134 |
| 938 | 3300005295 | Ga0065707_10181440 | Ga0065707_101814401 | 135 |
| 939 | 3300005578 | Ga0068854_100032460 | Ga0068854_1000324604 | 135 |
| 940 | 3300005616 | Ga0068852_100514330 | Ga0068852_1005143302 | 135 |
| 941 | 3300026142 | Ga0207698_10257463 | Ga0207698_102574632 | 135 |
| 942 | 3300031731 | Ga0307405_10034684 | Ga0307405_100346842 | 135 |
| 943 | 3300031901 | Ga0307406_11937672 | Ga0307406_119376721 | 135 |
| 944 | 3300031911 | Ga0307412_10018021 | Ga0307412_100180213 | 135 |
| 945 | 3300032004 | Ga0307414_11850868 | Ga0307414_118508681 | 135 |
| 946 | 3300048928 | Ga0496125_0317057 | Ga0496125_0317057_321_737 | 135 |
| 947 | 2162886007 | SwRhRL2b_contig_1847577 | SwRhRL2b_0593.00001020 | 136 |
| 948 | 3300001976 | JGI24752J21851_1000011 | JGI24752J21851_100001111 | 136 |
| 949 | 3300005289 | Ga0065704_10093266 | Ga0065704_100932664 | 136 |
| 950 | 3300005841 | Ga0068863_100000083 | Ga0068863_1000000832 | 136 |
| 951 | 3300009011 | Ga0105251_10005042 | Ga0105251_100050424 | 136 |
| 952 | 3300009092 | Ga0105250_10138297 | Ga0105250_101382971 | 136 |
| 953 | 3300009177 | Ga0105248_10000061 | Ga0105248_10000061111 | 136 |
| 954 | 3300009553 | Ga0105249_10000646 | Ga0105249_100006466 | 136 |
| 955 | 3300012513 | Ga0157326_1000010 | Ga0157326_100001019 | 136 |
| 956 | 3300013306 | Ga0163162_10675067 | Ga0163162_106750672 | 136 |
| 957 | 3300014325 | Ga0163163_10480053 | Ga0163163_104800532 | 136 |
| 958 | 3300014968 | Ga0157379_10019381 | Ga0157379_100193813 | 136 |
| 959 | 3300025735 | Ga0207713_1003157 | Ga0207713_10031574 | 136 |
| 960 | 3300025925 | Ga0207650_10000638 | Ga0207650_1000063814 | 136 |
| 961 | 3300025941 | Ga0207711_10000017 | Ga0207711_10000017243 | 136 |
| 962 | 3300025961 | Ga0207712_10001469 | Ga0207712_100014696 | 136 |
| 963 | 3300025986 | Ga0207658_10000863 | Ga0207658_1000086312 | 136 |
| 964 | 3300026088 | Ga0207641_10000008 | Ga0207641_1000000814 | 136 |
| 965 | 3300026095 | Ga0207676_10000060 | Ga0207676_10000060104 | 136 |
| 966 | 3300028380 | Ga0268265_10000011 | Ga0268265_1000001114 | 136 |
| 967 | 3300037853 | Ga0436364_0154840 | Ga0436364_0154840_153539_153961 | 136 |
| 968 | 3300048904 | Ga0496101_0215979 | Ga0496101_0215979_812_1249 | 136 |
| 969 | 3300048920 | Ga0496117_0013816 | Ga0496117_0013816_1643_2053 | 136 |
| 970 | 3300048921 | Ga0496118_0008661 | Ga0496118_0008661_4891_5328 | 136 |
| 971 | 3300048922 | Ga0496119_0325079 | Ga0496119_0325079_249_686 | 136 |
| 972 | 3300048924 | Ga0496121_0382778 | Ga0496121_0382778_341_778 | 136 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2dyj-assembly1.cif.gz_A | crystal structure of ribosome-binding factor a from thermus thermophilus hb8 | 0.9171 | 14 | 104 |
| 2dyj-assembly2.cif.gz_B | crystal structure of ribosome-binding factor a from thermus thermophilus hb8 | 0.9037 | 14 | 104 |
| 8bxa-assembly1.cif.gz_A | crystal structure of ribosome binding factor a (rbfa) from s. aureus | 0.8667 | 12 | 107 |
| 2r1c-assembly1.cif.gz_A | coordinates of the thermus thermophilus ribosome binding factor a (rbfa) homology model as fitted into the cryo-em map of a 30s-rbfa complex | 0.8549 | 19 | 107 |
| 7nav-assembly1.cif.gz_V | bacterial 30s ribosomal subunit assembly complex state d (consensus refinement) | 0.8528 | 13 | 107 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2dyjB00 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.9037 | 14 | 104 | 3.30.300.20 |
| 2dyjB00 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.8479 | 14 | 104 | 3.30.300.20 |
| af_Q8SXX0_83_186_3.30.300.20 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.8422 | 1 | 105 | 3.30.300.20 |
| af_Q5VPH3_41_157_3.30.300.20 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.8381 | 13 | 111 | 3.30.300.20 |
| af_A0A0G2K1B0_81_186_3.30.300.20 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.835 | 2 | 105 | 3.30.300.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A257LQE8-F1-model_v4 | Ribosome-binding factor A | 0.9609 | 4 | 108 |
GO:0005829
GO:0006364 GO:0043024 |
| AF-A0A2S6TDV1-F1-model_v4 | Ribosome-binding factor A | 0.959 | 13 | 102 |
GO:0005829
GO:0006364 GO:0043024 |
| AF-A0A2N3CKN1-F1-model_v4 | Ribosome-binding factor A | 0.9547 | 13 | 121 |
GO:0005829
GO:0030490 GO:0043024 |
| AF-A0A1Y6CRS9-F1-model_v4 | Ribosome-binding factor A | 0.9526 | 13 | 121 |
GO:0005829
GO:0030490 GO:0043024 |
| AF-A0A257LQE8-F1-model_v4 | Ribosome-binding factor A | 0.9432 | 4 | 108 |
GO:0005829
GO:0006364 GO:0043024 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar