F487043
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 968 | 394 | 1936 | 173 |
Family's Representative Sequence
| Representative Sequence | 3300014325|Ga0163163_10386792|Ga0163163_103867922 |
| Length | 193 |
| Sequence | LEYLAVSTDNRLISPSISPAFITPPHPAAPVGKAKLLDEHARHEIDHWVKKFPPGRHRSACITALRAAQHQNEGHLTQDLLEAVAEYLNLPPIQVYEVASFYSMFELHPCGRHHVSVCTNISCMLNGSDKIVEYVEKKLGIKTGESTPDGRIFLKREEECLAACTGAPMMMVDEVFHEWLTPEKIDKVLDELK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 4 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 5 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 6 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 14 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 43 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 50 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 57 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 59 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 60 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 61 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 62 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 63 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 64 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 65 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 66 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 67 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 68 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 69 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 70 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 72 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 76 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 77 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 78 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 79 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 81 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 82 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 83 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 97 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013874 | Rhizosphere microbial communities from switchgrass harvested rhizosphere in Austin, TX, USA - RS_213 | Metagenome | Rhizosphere |
| 106 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 111 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 112 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 113 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 114 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 180 | 3300028036 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 | Metagenome | Rhizosphere |
| 181 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 185 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 186 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 187 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 188 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 189 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 190 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 191 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 192 | 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 193 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 194 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 195 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 196 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 197 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 198 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 199 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 200 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 201 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 202 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 203 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 204 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 205 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 206 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 207 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 208 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 209 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 210 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 211 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 212 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 213 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 214 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 215 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 216 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 217 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 218 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 219 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 220 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 221 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 222 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 223 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 224 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 225 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 226 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 227 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 228 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 229 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 230 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 231 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 232 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 233 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 234 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 235 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 236 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 237 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 238 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 239 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 240 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 241 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 242 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 243 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 244 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 245 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 246 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 247 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 248 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 249 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 250 | 3300042118 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 | Metagenome | Rhizosphere |
| 251 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 252 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 253 | 3300042123 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 | Metagenome | Rhizosphere |
| 254 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 255 | 3300042128 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 | Metagenome | Rhizosphere |
| 256 | 3300042132 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 | Metagenome | Rhizosphere |
| 257 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 258 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 259 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 260 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 261 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 262 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 263 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 264 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 265 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 266 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 267 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 268 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 269 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 270 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 271 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 272 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 273 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 274 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 275 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 276 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 277 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 278 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 279 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 280 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 281 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 282 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 312 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 313 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 314 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 315 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 316 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 317 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 318 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 319 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 320 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 321 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 322 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 323 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 324 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 325 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 326 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 327 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 328 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 329 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 330 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 331 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 332 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 333 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 334 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 335 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 337 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 339 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 340 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 341 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 342 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 343 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 344 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 345 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 346 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 347 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 348 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 349 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 350 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 353 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 356 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 357 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 359 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 361 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 362 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 363 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 364 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 365 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 366 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 367 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 368 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 369 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 370 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 371 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 372 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 373 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 374 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 375 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 379 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 380 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 381 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 382 | 3300053124 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere | Metagenome | Endosphere |
| 383 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 384 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 385 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 386 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 387 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 388 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 389 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 390 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 391 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 392 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 393 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 394 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.69 |
| Metatranscriptomes | 0.31 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.07 |
| Nodule | 0 |
| Rhizoplane | 4.13 |
| Rhizosphere | 89.05 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.31 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0163163_10386792 | 3300014325 | Bacteria | 1457 |
| 2 | SwRhRL2b_contig_1969530 | 2162886007 | Bacteria | 11767 |
| 3 | JGI25406J46586_10030861 | 3300003203 | Unclassified | 2012 |
| 4 | rootH2_10003948 | 3300003320 | Bacteria | 1207 |
| 5 | rootL2_10140466 | 3300003322 | Bacteria | 1209 |
| 6 | Ga0065704_10003141 | 3300005289 | Bacteria | 4693 |
| 7 | Ga0065707_10087251 | 3300005295 | Bacteria | 5103 |
| 8 | Ga0070658_10417754 | 3300005327 | Bacteria | 1153 |
| 9 | Ga0070683_100081464 | 3300005329 | Bacteria | 3030 |
| 10 | Ga0070683_100573210 | 3300005329 | Bacteria | 1080 |
| 11 | Ga0070690_100043752 | 3300005330 | Bacteria | 2840 |
| 12 | Ga0070690_100084037 | 3300005330 | Bacteria | 2086 |
| 13 | Ga0070690_100387132 | 3300005330 | Bacteria | 1023 |
| 14 | Ga0070670_100064584 | 3300005331 | Bacteria | 3141 |
| 15 | Ga0070670_101009335 | 3300005331 | Bacteria | 757 |
| 16 | Ga0070677_10074087 | 3300005333 | Bacteria | 1439 |
| 17 | Ga0068869_100178028 | 3300005334 | Bacteria | 1666 |
| 18 | Ga0068869_100764679 | 3300005334 | Bacteria | 828 |
| 19 | Ga0070666_10005768 | 3300005335 | Bacteria | 7606 |
| 20 | Ga0070666_10016261 | 3300005335 | Bacteria | 4758 |
| 21 | Ga0070666_10063443 | 3300005335 | Bacteria | 2504 |
| 22 | Ga0070666_10099617 | 3300005335 | Bacteria | 2001 |
| 23 | Ga0070680_100004918 | 3300005336 | Bacteria | 10056 |
| 24 | Ga0070680_100084139 | 3300005336 | Bacteria | 2627 |
| 25 | Ga0070680_100097096 | 3300005336 | Bacteria | 2443 |
| 26 | Ga0070680_100481754 | 3300005336 | Bacteria | 1060 |
| 27 | Ga0070682_100046190 | 3300005337 | Bacteria | 2701 |
| 28 | Ga0070682_100141083 | 3300005337 | Bacteria | 1643 |
| 29 | Ga0070682_101034758 | 3300005337 | Bacteria | 684 |
| 30 | Ga0068868_100038697 | 3300005338 | Bacteria | 3702 |
| 31 | Ga0068868_100245038 | 3300005338 | Bacteria | 1507 |
| 32 | Ga0070689_100075487 | 3300005340 | Bacteria | 2639 |
| 33 | Ga0070691_10250982 | 3300005341 | Bacteria | 949 |
| 34 | Ga0070661_100245623 | 3300005344 | Bacteria | 1380 |
| 35 | Ga0070669_100060498 | 3300005353 | Bacteria | 2782 |
| 36 | Ga0070669_100333177 | 3300005353 | Bacteria | 1228 |
| 37 | Ga0070675_100393809 | 3300005354 | Bacteria | 1235 |
| 38 | Ga0070675_100718375 | 3300005354 | Bacteria | 911 |
| 39 | Ga0070671_100000211 | 3300005355 | Bacteria | 38816 |
| 40 | Ga0070671_100203219 | 3300005355 | Bacteria | 1680 |
| 41 | Ga0070674_100163804 | 3300005356 | Bacteria | 1689 |
| 42 | Ga0070673_100027809 | 3300005364 | Bacteria | 4196 |
| 43 | Ga0070673_100704199 | 3300005364 | Bacteria | 927 |
| 44 | Ga0070688_100099986 | 3300005365 | Bacteria | 1910 |
| 45 | Ga0070688_100927580 | 3300005365 | Bacteria | 688 |
| 46 | Ga0070667_100000176 | 3300005367 | Bacteria | 79346 |
| 47 | Ga0070667_100004044 | 3300005367 | Bacteria | 12402 |
| 48 | Ga0070667_100009234 | 3300005367 | Bacteria | 8167 |
| 49 | Ga0070667_100029909 | 3300005367 | Bacteria | 4541 |
| 50 | Ga0070667_100082793 | 3300005367 | Bacteria | 2748 |
| 51 | Ga0070667_100122027 | 3300005367 | Bacteria | 2267 |
| 52 | Ga0070667_100729737 | 3300005367 | Bacteria | 918 |
| 53 | Ga0070709_10142420 | 3300005434 | Bacteria | 1648 |
| 54 | Ga0070709_10236145 | 3300005434 | Bacteria | 1310 |
| 55 | Ga0070709_10653626 | 3300005434 | Bacteria | 814 |
| 56 | Ga0070714_100001900 | 3300005435 | Bacteria | 15241 |
| 57 | Ga0070713_100077002 | 3300005436 | Bacteria | 2835 |
| 58 | Ga0070713_100078632 | 3300005436 | Bacteria | 2808 |
| 59 | Ga0070713_100095603 | 3300005436 | Bacteria | 2563 |
| 60 | Ga0070713_101306485 | 3300005436 | Bacteria | 703 |
| 61 | Ga0070710_10012267 | 3300005437 | Bacteria | 4249 |
| 62 | Ga0070710_10014273 | 3300005437 | Bacteria | 3997 |
| 63 | Ga0070710_10537280 | 3300005437 | Bacteria | 806 |
| 64 | Ga0070701_10031829 | 3300005438 | Bacteria | 2620 |
| 65 | Ga0070711_100002206 | 3300005439 | Bacteria | 11051 |
| 66 | Ga0070711_100211067 | 3300005439 | Bacteria | 1504 |
| 67 | Ga0070705_100238042 | 3300005440 | Bacteria | 1270 |
| 68 | Ga0070700_100888841 | 3300005441 | Bacteria | 724 |
| 69 | Ga0070694_100223614 | 3300005444 | Bacteria | 1413 |
| 70 | Ga0070708_101133947 | 3300005445 | Bacteria | 732 |
| 71 | Ga0070663_100654811 | 3300005455 | Bacteria | 889 |
| 72 | Ga0070663_100816665 | 3300005455 | Bacteria | 800 |
| 73 | Ga0070678_100115339 | 3300005456 | Bacteria | 2109 |
| 74 | Ga0070662_100414329 | 3300005457 | Bacteria | 1114 |
| 75 | Ga0070681_10003817 | 3300005458 | Bacteria | 14167 |
| 76 | Ga0070681_10041176 | 3300005458 | Bacteria | 4629 |
| 77 | Ga0070681_10066969 | 3300005458 | Bacteria | 3560 |
| 78 | Ga0070681_10106172 | 3300005458 | Bacteria | 2750 |
| 79 | Ga0070681_10256196 | 3300005458 | Bacteria | 1662 |
| 80 | Ga0070681_10330041 | 3300005458 | Bacteria | 1435 |
| 81 | Ga0070681_10586478 | 3300005458 | Bacteria | 1029 |
| 82 | Ga0068867_100080836 | 3300005459 | Bacteria | 2448 |
| 83 | Ga0068867_100421547 | 3300005459 | Bacteria | 1130 |
| 84 | Ga0070685_10526006 | 3300005466 | Bacteria | 841 |
| 85 | Ga0070706_100794633 | 3300005467 | Bacteria | 876 |
| 86 | Ga0070698_100495863 | 3300005471 | Bacteria | 1159 |
| 87 | Ga0070699_100192150 | 3300005518 | Bacteria | 1814 |
| 88 | Ga0070679_100005267 | 3300005530 | Bacteria | 11971 |
| 89 | Ga0070679_100034903 | 3300005530 | Bacteria | 4988 |
| 90 | Ga0070679_100179309 | 3300005530 | Bacteria | 2091 |
| 91 | Ga0070684_100084990 | 3300005535 | Bacteria | 2806 |
| 92 | Ga0070684_100527477 | 3300005535 | Bacteria | 1095 |
| 93 | Ga0068853_100108373 | 3300005539 | Bacteria | 2464 |
| 94 | Ga0068853_100346615 | 3300005539 | Bacteria | 1381 |
| 95 | Ga0068853_100485584 | 3300005539 | Bacteria | 1165 |
| 96 | Ga0068853_100764686 | 3300005539 | Bacteria | 924 |
| 97 | Ga0070672_100195188 | 3300005543 | Bacteria | 1691 |
| 98 | Ga0070672_100344521 | 3300005543 | Bacteria | 1269 |
| 99 | Ga0070672_100361186 | 3300005543 | Bacteria | 1239 |
| 100 | Ga0070672_101299202 | 3300005543 | Bacteria | 649 |
| 101 | Ga0070686_100023565 | 3300005544 | Bacteria | 3680 |
| 102 | Ga0070686_100721987 | 3300005544 | Bacteria | 797 |
| 103 | Ga0070695_100006727 | 3300005545 | Bacteria | 6804 |
| 104 | Ga0070695_100221985 | 3300005545 | Bacteria | 1362 |
| 105 | Ga0070696_100200500 | 3300005546 | Bacteria | 1490 |
| 106 | Ga0070693_100410724 | 3300005547 | Bacteria | 941 |
| 107 | Ga0070665_100002453 | 3300005548 | Bacteria | 20441 |
| 108 | Ga0070665_100013615 | 3300005548 | Bacteria | 8180 |
| 109 | Ga0070665_100028034 | 3300005548 | Bacteria | 5672 |
| 110 | Ga0070665_100102416 | 3300005548 | Bacteria | 2866 |
| 111 | Ga0068855_100002113 | 3300005563 | Bacteria | 24577 |
| 112 | Ga0068855_100003941 | 3300005563 | Bacteria | 18117 |
| 113 | Ga0068855_100469048 | 3300005563 | Bacteria | 1372 |
| 114 | Ga0068855_100556107 | 3300005563 | Bacteria | 1241 |
| 115 | Ga0068855_101003390 | 3300005563 | Bacteria | 877 |
| 116 | Ga0070664_100107091 | 3300005564 | Bacteria | 2437 |
| 117 | Ga0070664_100207604 | 3300005564 | Bacteria | 1750 |
| 118 | Ga0068854_100576598 | 3300005578 | Bacteria | 957 |
| 119 | Ga0068856_100028500 | 3300005614 | Bacteria | 5453 |
| 120 | Ga0068856_100060596 | 3300005614 | Bacteria | 3739 |
| 121 | Ga0068856_100192994 | 3300005614 | Bacteria | 2050 |
| 122 | Ga0068852_100939529 | 3300005616 | Bacteria | 883 |
| 123 | Ga0068859_100002490 | 3300005617 | Bacteria | 18744 |
| 124 | Ga0068859_100023424 | 3300005617 | Bacteria | 6196 |
| 125 | Ga0068859_100305720 | 3300005617 | Bacteria | 1684 |
| 126 | Ga0068859_100456037 | 3300005617 | Bacteria | 1374 |
| 127 | Ga0068859_100717537 | 3300005617 | Bacteria | 1090 |
| 128 | Ga0068864_100201860 | 3300005618 | Bacteria | 1827 |
| 129 | Ga0068864_100345061 | 3300005618 | Bacteria | 1404 |
| 130 | Ga0068861_100020851 | 3300005719 | Bacteria | 4701 |
| 131 | Ga0068861_100021827 | 3300005719 | Bacteria | 4604 |
| 132 | Ga0068861_100131403 | 3300005719 | Bacteria | 2032 |
| 133 | Ga0068863_100006902 | 3300005841 | Bacteria | 11127 |
| 134 | Ga0068863_100007707 | 3300005841 | Bacteria | 10527 |
| 135 | Ga0068863_100009550 | 3300005841 | Bacteria | 9458 |
| 136 | Ga0068863_100035861 | 3300005841 | Bacteria | 4723 |
| 137 | Ga0068863_100107638 | 3300005841 | Bacteria | 2653 |
| 138 | Ga0068863_100599993 | 3300005841 | Bacteria | 1090 |
| 139 | Ga0068863_100719179 | 3300005841 | Bacteria | 993 |
| 140 | Ga0068858_100001768 | 3300005842 | Bacteria | 22037 |
| 141 | Ga0068858_100003825 | 3300005842 | Bacteria | 14883 |
| 142 | Ga0068858_100105686 | 3300005842 | Bacteria | 2627 |
| 143 | Ga0068858_100114531 | 3300005842 | Bacteria | 2519 |
| 144 | Ga0068858_100172193 | 3300005842 | Bacteria | 2042 |
| 145 | Ga0068858_100214148 | 3300005842 | Bacteria | 1823 |
| 146 | Ga0068858_100622518 | 3300005842 | Bacteria | 1048 |
| 147 | Ga0068860_100017517 | 3300005843 | Bacteria | 6980 |
| 148 | Ga0068860_100495339 | 3300005843 | Bacteria | 1219 |
| 149 | Ga0068860_100511859 | 3300005843 | Bacteria | 1199 |
| 150 | Ga0068860_101906556 | 3300005843 | Bacteria | 616 |
| 151 | Ga0068862_100110870 | 3300005844 | Bacteria | 2408 |
| 152 | Ga0068862_100118929 | 3300005844 | Bacteria | 2327 |
| 153 | Ga0068862_100302164 | 3300005844 | Bacteria | 1473 |
| 154 | Ga0068862_100307730 | 3300005844 | Bacteria | 1460 |
| 155 | Ga0068862_100400007 | 3300005844 | Bacteria | 1285 |
| 156 | Ga0068862_100420670 | 3300005844 | Bacteria | 1254 |
| 157 | Ga0068862_100520669 | 3300005844 | Bacteria | 1132 |
| 158 | Ga0068862_100671078 | 3300005844 | Bacteria | 1002 |
| 159 | Ga0081455_10001496 | 3300005937 | Bacteria | 28888 |
| 160 | Ga0081455_10003509 | 3300005937 | Bacteria | 18014 |
| 161 | Ga0081455_10552356 | 3300005937 | Bacteria | 761 |
| 162 | Ga0081539_10000046 | 3300005985 | Bacteria | 275677 |
| 163 | Ga0070717_10018074 | 3300006028 | Bacteria | 5500 |
| 164 | Ga0070717_10822740 | 3300006028 | Bacteria | 845 |
| 165 | Ga0075432_10252642 | 3300006058 | Bacteria | 716 |
| 166 | Ga0070716_100023442 | 3300006173 | Bacteria | 3274 |
| 167 | Ga0070716_100122567 | 3300006173 | Bacteria | 1630 |
| 168 | Ga0070716_100217933 | 3300006173 | Bacteria | 1280 |
| 169 | Ga0070716_100236105 | 3300006173 | Bacteria | 1237 |
| 170 | Ga0070712_100059227 | 3300006175 | Bacteria | 2696 |
| 171 | Ga0070712_100788229 | 3300006175 | Bacteria | 815 |
| 172 | Ga0097621_100034231 | 3300006237 | Bacteria | 4051 |
| 173 | Ga0097621_100061127 | 3300006237 | Bacteria | 3089 |
| 174 | Ga0097621_100124659 | 3300006237 | Bacteria | 2187 |
| 175 | Ga0097621_101305098 | 3300006237 | Bacteria | 685 |
| 176 | Ga0068871_100025561 | 3300006358 | Bacteria | 4596 |
| 177 | Ga0068871_100137665 | 3300006358 | Bacteria | 2074 |
| 178 | Ga0068871_100224841 | 3300006358 | Bacteria | 1627 |
| 179 | Ga0068871_100403058 | 3300006358 | Bacteria | 1218 |
| 180 | Ga0068871_100760622 | 3300006358 | Bacteria | 891 |
| 181 | Ga0068871_101054953 | 3300006358 | Bacteria | 759 |
| 182 | Ga0068871_101096845 | 3300006358 | Bacteria | 744 |
| 183 | Ga0068871_101530702 | 3300006358 | Bacteria | 630 |
| 184 | Ga0075433_10001448 | 3300006852 | Bacteria | 17525 |
| 185 | Ga0075434_100000572 | 3300006871 | Bacteria | 28363 |
| 186 | Ga0068865_100022345 | 3300006881 | Bacteria | 4126 |
| 187 | Ga0068865_100048126 | 3300006881 | Bacteria | 2933 |
| 188 | Ga0068865_100820523 | 3300006881 | Bacteria | 804 |
| 189 | Ga0068865_101033127 | 3300006881 | Bacteria | 721 |
| 190 | Ga0097620_100002490 | 3300006931 | Bacteria | 18744 |
| 191 | Ga0097620_100023425 | 3300006931 | Bacteria | 6196 |
| 192 | Ga0097620_100305694 | 3300006931 | Bacteria | 1684 |
| 193 | Ga0097620_100401404 | 3300006931 | Bacteria | 1467 |
| 194 | Ga0097620_100456010 | 3300006931 | Bacteria | 1374 |
| 195 | Ga0097620_100717569 | 3300006931 | Bacteria | 1090 |
| 196 | Ga0097620_101110075 | 3300006931 | Bacteria | 870 |
| 197 | Ga0075435_100036416 | 3300007076 | Bacteria | 3911 |
| 198 | Ga0099794_10012498 | 3300007265 | Bacteria | 3666 |
| 199 | Ga0099795_10000128 | 3300007788 | Bacteria | 12772 |
| 200 | Ga0099795_10006320 | 3300007788 | Bacteria | 3224 |
| 201 | Ga0099795_10494676 | 3300007788 | Bacteria | 569 |
| 202 | Ga0105250_10028827 | 3300009092 | Bacteria | 2234 |
| 203 | Ga0105250_10070849 | 3300009092 | Bacteria | 1407 |
| 204 | Ga0105240_10007091 | 3300009093 | Bacteria | 16338 |
| 205 | Ga0105240_10015264 | 3300009093 | Bacteria | 10452 |
| 206 | Ga0105240_10020906 | 3300009093 | Bacteria | 8715 |
| 207 | Ga0105240_10041324 | 3300009093 | Bacteria | 5886 |
| 208 | Ga0105240_10048824 | 3300009093 | Bacteria | 5347 |
| 209 | Ga0105240_10134123 | 3300009093 | Bacteria | 2966 |
| 210 | Ga0105240_10188846 | 3300009093 | Bacteria | 2424 |
| 211 | Ga0105240_10381327 | 3300009093 | Bacteria | 1592 |
| 212 | Ga0105240_10502801 | 3300009093 | Bacteria | 1347 |
| 213 | Ga0105240_10653130 | 3300009093 | Bacteria | 1152 |
| 214 | Ga0105240_11265356 | 3300009093 | Bacteria | 779 |
| 215 | Ga0111539_10214109 | 3300009094 | Bacteria | 2244 |
| 216 | Ga0111539_11056845 | 3300009094 | Bacteria | 944 |
| 217 | Ga0105245_10035278 | 3300009098 | Bacteria | 4439 |
| 218 | Ga0105245_10059126 | 3300009098 | Bacteria | 3451 |
| 219 | Ga0105245_11165870 | 3300009098 | Bacteria | 818 |
| 220 | Ga0105245_12467526 | 3300009098 | Bacteria | 573 |
| 221 | Ga0105247_10000088 | 3300009101 | Bacteria | 98964 |
| 222 | Ga0105247_10032510 | 3300009101 | Bacteria | 3170 |
| 223 | Ga0105247_10059041 | 3300009101 | Bacteria | 2374 |
| 224 | Ga0105247_10122193 | 3300009101 | Bacteria | 1689 |
| 225 | Ga0114129_11670546 | 3300009147 | Bacteria | 778 |
| 226 | Ga0105243_10452752 | 3300009148 | Bacteria | 1205 |
| 227 | Ga0105243_11816843 | 3300009148 | Bacteria | 641 |
| 228 | Ga0105241_10308281 | 3300009174 | Bacteria | 1361 |
| 229 | Ga0105241_10680799 | 3300009174 | Bacteria | 937 |
| 230 | Ga0105241_11111104 | 3300009174 | Bacteria | 745 |
| 231 | Ga0105242_10065708 | 3300009176 | Bacteria | 2993 |
| 232 | Ga0105242_10196562 | 3300009176 | Bacteria | 1789 |
| 233 | Ga0105242_10588013 | 3300009176 | Bacteria | 1073 |
| 234 | Ga0105242_10748195 | 3300009176 | Bacteria | 962 |
| 235 | Ga0105248_10022103 | 3300009177 | Bacteria | 7049 |
| 236 | Ga0105248_10069869 | 3300009177 | Bacteria | 3944 |
| 237 | Ga0105248_10136209 | 3300009177 | Bacteria | 2770 |
| 238 | Ga0105248_10189937 | 3300009177 | Bacteria | 2315 |
| 239 | Ga0105248_10273247 | 3300009177 | Bacteria | 1903 |
| 240 | Ga0105248_10373138 | 3300009177 | Bacteria | 1606 |
| 241 | Ga0105248_10394230 | 3300009177 | Bacteria | 1559 |
| 242 | Ga0105248_10709453 | 3300009177 | Bacteria | 1135 |
| 243 | Ga0105237_10021211 | 3300009545 | Bacteria | 6681 |
| 244 | Ga0105237_10193655 | 3300009545 | Bacteria | 2033 |
| 245 | Ga0105237_10571996 | 3300009545 | Bacteria | 1137 |
| 246 | Ga0105237_11995536 | 3300009545 | Bacteria | 589 |
| 247 | Ga0105238_10010567 | 3300009551 | Bacteria | 9269 |
| 248 | Ga0105238_10153959 | 3300009551 | Bacteria | 2274 |
| 249 | Ga0105238_10173440 | 3300009551 | Bacteria | 2133 |
| 250 | Ga0105238_10351995 | 3300009551 | Bacteria | 1462 |
| 251 | Ga0105238_10467996 | 3300009551 | Bacteria | 1259 |
| 252 | Ga0105238_10733622 | 3300009551 | Bacteria | 1001 |
| 253 | Ga0105249_10165602 | 3300009553 | Bacteria | 2140 |
| 254 | Ga0105249_10217367 | 3300009553 | Bacteria | 1879 |
| 255 | Ga0105249_10285122 | 3300009553 | Bacteria | 1651 |
| 256 | Ga0105249_11404359 | 3300009553 | Bacteria | 770 |
| 257 | Ga0105249_11600131 | 3300009553 | Bacteria | 724 |
| 258 | Ga0099796_10000281 | 3300010159 | Bacteria | 8025 |
| 259 | Ga0099796_10000913 | 3300010159 | Bacteria | 5481 |
| 260 | Ga0099796_10008063 | 3300010159 | Bacteria | 2789 |
| 261 | Ga0099796_10108256 | 3300010159 | Bacteria | 1055 |
| 262 | Ga0105239_10128424 | 3300010375 | Bacteria | 2818 |
| 263 | Ga0105239_10279893 | 3300010375 | Bacteria | 1878 |
| 264 | Ga0105239_10341154 | 3300010375 | Bacteria | 1691 |
| 265 | Ga0105239_11065883 | 3300010375 | Bacteria | 930 |
| 266 | Ga0157370_10008536 | 3300013104 | Bacteria | 11043 |
| 267 | Ga0157370_10742661 | 3300013104 | Bacteria | 894 |
| 268 | Ga0157370_11208350 | 3300013104 | Unclassified | 682 |
| 269 | Ga0157369_10013340 | 3300013105 | Bacteria | 9294 |
| 270 | Ga0157369_10069819 | 3300013105 | Bacteria | 3774 |
| 271 | Ga0157369_10220836 | 3300013105 | Bacteria | 1984 |
| 272 | Ga0157369_10235731 | 3300013105 | Bacteria | 1912 |
| 273 | Ga0157374_10005413 | 3300013296 | Bacteria | 10724 |
| 274 | Ga0157374_10300947 | 3300013296 | Bacteria | 1587 |
| 275 | Ga0157374_10332546 | 3300013296 | Bacteria | 1507 |
| 276 | Ga0157378_10070674 | 3300013297 | Bacteria | 3134 |
| 277 | Ga0157378_10134056 | 3300013297 | Bacteria | 2295 |
| 278 | Ga0163162_10064260 | 3300013306 | Bacteria | 3715 |
| 279 | Ga0163162_10082446 | 3300013306 | Bacteria | 3288 |
| 280 | Ga0163162_10253152 | 3300013306 | Bacteria | 1893 |
| 281 | Ga0163162_10415994 | 3300013306 | Bacteria | 1477 |
| 282 | Ga0163162_10582001 | 3300013306 | Bacteria | 1246 |
| 283 | Ga0163162_10863724 | 3300013306 | Bacteria | 1019 |
| 284 | Ga0163162_10873221 | 3300013306 | Bacteria | 1014 |
| 285 | Ga0163162_11019243 | 3300013306 | Bacteria | 936 |
| 286 | Ga0163162_11112030 | 3300013306 | Bacteria | 895 |
| 287 | Ga0157372_10520527 | 3300013307 | Bacteria | 1387 |
| 288 | Ga0157372_10594813 | 3300013307 | Bacteria | 1289 |
| 289 | Ga0157375_10430640 | 3300013308 | Bacteria | 1485 |
| 290 | Ga0157514_108775 | 3300013874 | Bacteria | 1739 |
| 291 | Ga0163163_10027632 | 3300014325 | Bacteria | 5437 |
| 292 | Ga0163163_10105052 | 3300014325 | Bacteria | 2850 |
| 293 | Ga0163163_10117981 | 3300014325 | Bacteria | 2686 |
| 294 | Ga0163163_10270870 | 3300014325 | Bacteria | 1749 |
| 295 | Ga0163163_10335142 | 3300014325 | Bacteria | 1568 |
| 296 | Ga0163163_10340793 | 3300014325 | Bacteria | 1554 |
| 297 | Ga0157380_10715418 | 3300014326 | Bacteria | 1008 |
| 298 | Ga0157379_10001073 | 3300014968 | Bacteria | 22288 |
| 299 | Ga0157379_10052270 | 3300014968 | Bacteria | 3650 |
| 300 | Ga0157379_10267299 | 3300014968 | Bacteria | 1555 |
| 301 | Ga0157376_10022511 | 3300014969 | Bacteria | 4915 |
| 302 | Ga0157376_10071919 | 3300014969 | Bacteria | 2940 |
| 303 | Ga0157376_10215306 | 3300014969 | Bacteria | 1776 |
| 304 | Ga0163161_10407188 | 3300017792 | Bacteria | 1092 |
| 305 | Ga0213873_10238101 | 3300021358 | Unclassified | 574 |
| 306 | Ga0213874_10027512 | 3300021377 | Bacteria | 1618 |
| 307 | Ga0213876_10021570 | 3300021384 | Bacteria | 3407 |
| 308 | Ga0213871_10100810 | 3300021441 | Bacteria | 845 |
| 309 | Ga0207697_10107347 | 3300025315 | Bacteria | 1194 |
| 310 | Ga0207656_10077235 | 3300025321 | Bacteria | 1491 |
| 311 | Ga0207682_10003258 | 3300025893 | Bacteria | 7102 |
| 312 | Ga0207682_10066536 | 3300025893 | Bacteria | 1519 |
| 313 | Ga0207682_10070084 | 3300025893 | Bacteria | 1484 |
| 314 | Ga0207692_10018213 | 3300025898 | Bacteria | 3148 |
| 315 | Ga0207642_10381291 | 3300025899 | Bacteria | 839 |
| 316 | Ga0207642_10677202 | 3300025899 | Bacteria | 648 |
| 317 | Ga0207710_10000200 | 3300025900 | Bacteria | 56100 |
| 318 | Ga0207710_10116066 | 3300025900 | Bacteria | 1275 |
| 319 | Ga0207680_10007688 | 3300025903 | Bacteria | 5267 |
| 320 | Ga0207680_10100983 | 3300025903 | Bacteria | 1854 |
| 321 | Ga0207680_10212789 | 3300025903 | Bacteria | 1322 |
| 322 | Ga0207680_10488298 | 3300025903 | Bacteria | 876 |
| 323 | Ga0207680_10498377 | 3300025903 | Bacteria | 867 |
| 324 | Ga0207647_10032204 | 3300025904 | Bacteria | 3371 |
| 325 | Ga0207685_10063229 | 3300025905 | Bacteria | 1473 |
| 326 | Ga0207685_10105579 | 3300025905 | Bacteria | 1212 |
| 327 | Ga0207699_10287207 | 3300025906 | Bacteria | 1145 |
| 328 | Ga0207699_10560029 | 3300025906 | Bacteria | 830 |
| 329 | Ga0207645_10082957 | 3300025907 | Bacteria | 2055 |
| 330 | Ga0207643_10080383 | 3300025908 | Bacteria | 1888 |
| 331 | Ga0207705_10506499 | 3300025909 | Bacteria | 938 |
| 332 | Ga0207654_10128164 | 3300025911 | Bacteria | 1603 |
| 333 | Ga0207654_10614061 | 3300025911 | Bacteria | 777 |
| 334 | Ga0207707_10000045 | 3300025912 | Bacteria | 122598 |
| 335 | Ga0207707_10028153 | 3300025912 | Bacteria | 4912 |
| 336 | Ga0207707_10032540 | 3300025912 | Bacteria | 4564 |
| 337 | Ga0207707_10035577 | 3300025912 | Bacteria | 4354 |
| 338 | Ga0207707_10036535 | 3300025912 | Bacteria | 4294 |
| 339 | Ga0207707_10079228 | 3300025912 | Bacteria | 2869 |
| 340 | Ga0207707_10094844 | 3300025912 | Bacteria | 2608 |
| 341 | Ga0207707_10316934 | 3300025912 | Bacteria | 1347 |
| 342 | Ga0207695_10005045 | 3300025913 | Bacteria | 17727 |
| 343 | Ga0207695_10025917 | 3300025913 | Bacteria | 6553 |
| 344 | Ga0207695_10065000 | 3300025913 | Bacteria | 3752 |
| 345 | Ga0207695_10075705 | 3300025913 | Bacteria | 3423 |
| 346 | Ga0207695_10095396 | 3300025913 | Bacteria | 2978 |
| 347 | Ga0207695_10155355 | 3300025913 | Bacteria | 2223 |
| 348 | Ga0207695_10199560 | 3300025913 | Bacteria | 1915 |
| 349 | Ga0207695_10221796 | 3300025913 | Bacteria | 1798 |
| 350 | Ga0207695_10450934 | 3300025913 | Bacteria | 1169 |
| 351 | Ga0207671_10015884 | 3300025914 | Bacteria | 5873 |
| 352 | Ga0207671_10247866 | 3300025914 | Bacteria | 1400 |
| 353 | Ga0207671_10263169 | 3300025914 | Bacteria | 1358 |
| 354 | Ga0207671_11054115 | 3300025914 | Bacteria | 640 |
| 355 | Ga0207693_10000161 | 3300025915 | Bacteria | 61727 |
| 356 | Ga0207663_10143307 | 3300025916 | Bacteria | 1667 |
| 357 | Ga0207663_10183431 | 3300025916 | Bacteria | 1496 |
| 358 | Ga0207663_10189814 | 3300025916 | Bacteria | 1474 |
| 359 | Ga0207663_10935142 | 3300025916 | Bacteria | 694 |
| 360 | Ga0207660_10005866 | 3300025917 | Bacteria | 7974 |
| 361 | Ga0207660_10079151 | 3300025917 | Bacteria | 2410 |
| 362 | Ga0207662_10159414 | 3300025918 | Bacteria | 1440 |
| 363 | Ga0207657_10227397 | 3300025919 | Bacteria | 1493 |
| 364 | Ga0207657_10462304 | 3300025919 | Bacteria | 995 |
| 365 | Ga0207649_10050433 | 3300025920 | Bacteria | 2574 |
| 366 | Ga0207652_10025512 | 3300025921 | Bacteria | 4916 |
| 367 | Ga0207652_10031880 | 3300025921 | Bacteria | 4426 |
| 368 | Ga0207652_10179360 | 3300025921 | Bacteria | 1903 |
| 369 | Ga0207652_10188631 | 3300025921 | Bacteria | 1854 |
| 370 | Ga0207652_10407849 | 3300025921 | Bacteria | 1226 |
| 371 | Ga0207652_10510405 | 3300025921 | Bacteria | 1082 |
| 372 | Ga0207681_10135584 | 3300025923 | Bacteria | 1826 |
| 373 | Ga0207681_10234035 | 3300025923 | Bacteria | 1427 |
| 374 | Ga0207681_10680452 | 3300025923 | Bacteria | 854 |
| 375 | Ga0207694_10075495 | 3300025924 | Bacteria | 2639 |
| 376 | Ga0207694_10223578 | 3300025924 | Bacteria | 1536 |
| 377 | Ga0207694_10242224 | 3300025924 | Bacteria | 1474 |
| 378 | Ga0207694_10266252 | 3300025924 | Bacteria | 1405 |
| 379 | Ga0207694_10788926 | 3300025924 | Bacteria | 802 |
| 380 | Ga0207694_10814745 | 3300025924 | Bacteria | 789 |
| 381 | Ga0207650_10018490 | 3300025925 | Bacteria | 4890 |
| 382 | Ga0207650_10530877 | 3300025925 | Bacteria | 985 |
| 383 | Ga0207650_10927865 | 3300025925 | Bacteria | 739 |
| 384 | Ga0207659_10119425 | 3300025926 | Bacteria | 2018 |
| 385 | Ga0207659_10146368 | 3300025926 | Bacteria | 1840 |
| 386 | Ga0207659_10375263 | 3300025926 | Bacteria | 1185 |
| 387 | Ga0207659_10685485 | 3300025926 | Bacteria | 877 |
| 388 | Ga0207687_10235010 | 3300025927 | Bacteria | 1450 |
| 389 | Ga0207700_10030691 | 3300025928 | Bacteria | 3809 |
| 390 | Ga0207700_10084826 | 3300025928 | Bacteria | 2484 |
| 391 | Ga0207700_10230403 | 3300025928 | Bacteria | 1575 |
| 392 | Ga0207700_10556371 | 3300025928 | Bacteria | 1018 |
| 393 | Ga0207664_10003053 | 3300025929 | Bacteria | 11131 |
| 394 | Ga0207664_10424440 | 3300025929 | Bacteria | 1185 |
| 395 | Ga0207664_11079199 | 3300025929 | Bacteria | 718 |
| 396 | Ga0207644_10002758 | 3300025931 | Bacteria | 11315 |
| 397 | Ga0207644_10079434 | 3300025931 | Bacteria | 2420 |
| 398 | Ga0207644_10438919 | 3300025931 | Bacteria | 1071 |
| 399 | Ga0207706_10404908 | 3300025933 | Bacteria | 1183 |
| 400 | Ga0207706_10741872 | 3300025933 | Bacteria | 837 |
| 401 | Ga0207686_10047090 | 3300025934 | Bacteria | 2664 |
| 402 | Ga0207686_10069165 | 3300025934 | Bacteria | 2264 |
| 403 | Ga0207686_10964583 | 3300025934 | Bacteria | 690 |
| 404 | Ga0207709_10220664 | 3300025935 | Bacteria | 1367 |
| 405 | Ga0207670_10194316 | 3300025936 | Bacteria | 1537 |
| 406 | Ga0207670_10319990 | 3300025936 | Bacteria | 1220 |
| 407 | Ga0207670_10346327 | 3300025936 | Bacteria | 1176 |
| 408 | Ga0207670_10406350 | 3300025936 | Bacteria | 1090 |
| 409 | Ga0207669_10238461 | 3300025937 | Bacteria | 1346 |
| 410 | Ga0207704_10159028 | 3300025938 | Bacteria | 1605 |
| 411 | Ga0207704_10697347 | 3300025938 | Bacteria | 840 |
| 412 | Ga0207665_10018237 | 3300025939 | Bacteria | 4612 |
| 413 | Ga0207665_10033643 | 3300025939 | Bacteria | 3399 |
| 414 | Ga0207665_10111851 | 3300025939 | Bacteria | 1920 |
| 415 | Ga0207665_10442907 | 3300025939 | Bacteria | 996 |
| 416 | Ga0207665_10548591 | 3300025939 | Bacteria | 898 |
| 417 | Ga0207691_10004505 | 3300025940 | Bacteria | 13492 |
| 418 | Ga0207691_10034548 | 3300025940 | Bacteria | 4700 |
| 419 | Ga0207691_10091171 | 3300025940 | Bacteria | 2731 |
| 420 | Ga0207691_10239126 | 3300025940 | Bacteria | 1570 |
| 421 | Ga0207691_10639340 | 3300025940 | Bacteria | 899 |
| 422 | Ga0207711_10009924 | 3300025941 | Bacteria | 7915 |
| 423 | Ga0207711_10188138 | 3300025941 | Bacteria | 1880 |
| 424 | Ga0207711_10192864 | 3300025941 | Bacteria | 1857 |
| 425 | Ga0207711_10369635 | 3300025941 | Bacteria | 1330 |
| 426 | Ga0207711_10748631 | 3300025941 | Bacteria | 911 |
| 427 | Ga0207689_10121750 | 3300025942 | Bacteria | 2146 |
| 428 | Ga0207689_10147357 | 3300025942 | Bacteria | 1939 |
| 429 | Ga0207689_10172754 | 3300025942 | Bacteria | 1782 |
| 430 | Ga0207689_10182043 | 3300025942 | Bacteria | 1733 |
| 431 | Ga0207689_10212697 | 3300025942 | Bacteria | 1598 |
| 432 | Ga0207689_10263022 | 3300025942 | Bacteria | 1427 |
| 433 | Ga0207689_10426572 | 3300025942 | Bacteria | 1107 |
| 434 | Ga0207661_10018888 | 3300025944 | Bacteria | 5130 |
| 435 | Ga0207661_10154170 | 3300025944 | Bacteria | 1988 |
| 436 | Ga0207679_10055626 | 3300025945 | Bacteria | 2918 |
| 437 | Ga0207679_10802839 | 3300025945 | Bacteria | 858 |
| 438 | Ga0207667_10000887 | 3300025949 | Bacteria | 38097 |
| 439 | Ga0207667_10030219 | 3300025949 | Bacteria | 5863 |
| 440 | Ga0207667_10210927 | 3300025949 | Bacteria | 1991 |
| 441 | Ga0207667_10224111 | 3300025949 | Bacteria | 1926 |
| 442 | Ga0207667_10234465 | 3300025949 | Bacteria | 1879 |
| 443 | Ga0207651_10126078 | 3300025960 | Bacteria | 1951 |
| 444 | Ga0207651_10262509 | 3300025960 | Bacteria | 1419 |
| 445 | Ga0207712_10168905 | 3300025961 | Bacteria | 1708 |
| 446 | Ga0207712_10184451 | 3300025961 | Bacteria | 1642 |
| 447 | Ga0207712_10429045 | 3300025961 | Bacteria | 1117 |
| 448 | Ga0207712_10465924 | 3300025961 | Bacteria | 1074 |
| 449 | Ga0207668_10489709 | 3300025972 | Bacteria | 1056 |
| 450 | Ga0207668_11415715 | 3300025972 | Bacteria | 627 |
| 451 | Ga0207658_10000236 | 3300025986 | Bacteria | 58435 |
| 452 | Ga0207658_10117310 | 3300025986 | Bacteria | 2115 |
| 453 | Ga0207658_10489041 | 3300025986 | Bacteria | 1094 |
| 454 | Ga0207658_10627901 | 3300025986 | Bacteria | 967 |
| 455 | Ga0207658_10998011 | 3300025986 | Bacteria | 764 |
| 456 | Ga0207658_11172178 | 3300025986 | Bacteria | 702 |
| 457 | Ga0207677_10102483 | 3300026023 | Bacteria | 2110 |
| 458 | Ga0207677_10129061 | 3300026023 | Bacteria | 1916 |
| 459 | Ga0207677_10249108 | 3300026023 | Bacteria | 1442 |
| 460 | Ga0207703_10000919 | 3300026035 | Bacteria | 28682 |
| 461 | Ga0207703_10191873 | 3300026035 | Bacteria | 1810 |
| 462 | Ga0207703_10355844 | 3300026035 | Bacteria | 1349 |
| 463 | Ga0207703_10592497 | 3300026035 | Bacteria | 1048 |
| 464 | Ga0207639_10420684 | 3300026041 | Bacteria | 1208 |
| 465 | Ga0207639_10457785 | 3300026041 | Bacteria | 1159 |
| 466 | Ga0207639_10569334 | 3300026041 | Bacteria | 1042 |
| 467 | Ga0207678_10164162 | 3300026067 | Bacteria | 1897 |
| 468 | Ga0207678_10197495 | 3300026067 | Bacteria | 1719 |
| 469 | Ga0207708_10456796 | 3300026075 | Bacteria | 1065 |
| 470 | Ga0207702_10149416 | 3300026078 | Bacteria | 2124 |
| 471 | Ga0207702_10183866 | 3300026078 | Bacteria | 1927 |
| 472 | Ga0207702_10419369 | 3300026078 | Bacteria | 1294 |
| 473 | Ga0207641_10013218 | 3300026088 | Bacteria | 6769 |
| 474 | Ga0207641_10040304 | 3300026088 | Bacteria | 3910 |
| 475 | Ga0207641_10073395 | 3300026088 | Bacteria | 2948 |
| 476 | Ga0207641_10159033 | 3300026088 | Bacteria | 2052 |
| 477 | Ga0207641_10159501 | 3300026088 | Bacteria | 2049 |
| 478 | Ga0207641_10179923 | 3300026088 | Bacteria | 1936 |
| 479 | Ga0207641_10476905 | 3300026088 | Bacteria | 1209 |
| 480 | Ga0207641_10488175 | 3300026088 | Bacteria | 1195 |
| 481 | Ga0207648_10117682 | 3300026089 | Bacteria | 2335 |
| 482 | Ga0207648_10133968 | 3300026089 | Bacteria | 2181 |
| 483 | Ga0207648_10747055 | 3300026089 | Bacteria | 908 |
| 484 | Ga0207676_10059925 | 3300026095 | Bacteria | 3008 |
| 485 | Ga0207676_10284712 | 3300026095 | Bacteria | 1502 |
| 486 | Ga0207676_10860294 | 3300026095 | Bacteria | 887 |
| 487 | Ga0207676_11203631 | 3300026095 | Bacteria | 751 |
| 488 | Ga0207674_10310164 | 3300026116 | Bacteria | 1527 |
| 489 | Ga0207674_10647439 | 3300026116 | Bacteria | 1020 |
| 490 | Ga0207675_100030392 | 3300026118 | Bacteria | 5031 |
| 491 | Ga0207675_100169311 | 3300026118 | Bacteria | 2087 |
| 492 | Ga0207675_100176127 | 3300026118 | Bacteria | 2046 |
| 493 | Ga0207675_100916751 | 3300026118 | Bacteria | 893 |
| 494 | Ga0207683_10004973 | 3300026121 | Bacteria | 11433 |
| 495 | Ga0207683_10024756 | 3300026121 | Bacteria | 5171 |
| 496 | Ga0207698_10109115 | 3300026142 | Bacteria | 2315 |
| 497 | Ga0207698_10220483 | 3300026142 | Bacteria | 1714 |
| 498 | Ga0209179_1000062 | 3300027512 | Bacteria | 19549 |
| 499 | Ga0209179_1054979 | 3300027512 | Bacteria | 858 |
| 500 | Ga0209971_1044609 | 3300027682 | Bacteria | 1069 |
| 501 | Ga0209998_10016582 | 3300027717 | Bacteria | 1552 |
| 502 | Ga0209998_10021833 | 3300027717 | Bacteria | 1377 |
| 503 | Ga0265356_1009491 | 3300028017 | Bacteria | 1095 |
| 504 | Ga0265355_1000333 | 3300028036 | Bacteria | 2343 |
| 505 | Ga0268266_10002139 | 3300028379 | Bacteria | 21753 |
| 506 | Ga0268266_10003011 | 3300028379 | Bacteria | 17313 |
| 507 | Ga0268266_10020040 | 3300028379 | Bacteria | 5701 |
| 508 | Ga0268266_10027811 | 3300028379 | Bacteria | 4808 |
| 509 | Ga0268266_10051773 | 3300028379 | Bacteria | 3525 |
| 510 | Ga0268266_10303530 | 3300028379 | Bacteria | 1490 |
| 511 | Ga0268266_10390673 | 3300028379 | Bacteria | 1314 |
| 512 | Ga0268266_10507445 | 3300028379 | Bacteria | 1152 |
| 513 | Ga0268265_10021882 | 3300028380 | Bacteria | 4486 |
| 514 | Ga0268265_10049268 | 3300028380 | Bacteria | 3167 |
| 515 | Ga0268265_10080948 | 3300028380 | Bacteria | 2563 |
| 516 | Ga0268265_10222647 | 3300028380 | Bacteria | 1652 |
| 517 | Ga0268265_10250278 | 3300028380 | Bacteria | 1569 |
| 518 | Ga0268265_10525368 | 3300028380 | Bacteria | 1119 |
| 519 | Ga0268265_11480076 | 3300028380 | Bacteria | 682 |
| 520 | Ga0268264_10000142 | 3300028381 | Bacteria | 170046 |
| 521 | Ga0268264_10018513 | 3300028381 | Bacteria | 5696 |
| 522 | Ga0268264_10133529 | 3300028381 | Bacteria | 2204 |
| 523 | Ga0268264_10171523 | 3300028381 | Bacteria | 1962 |
| 524 | Ga0268264_10282774 | 3300028381 | Bacteria | 1555 |
| 525 | Ga0268264_11518297 | 3300028381 | Bacteria | 681 |
| 526 | Ga0265326_10016634 | 3300028558 | Bacteria | 2124 |
| 527 | Ga0265319_1020404 | 3300028563 | Bacteria | 2457 |
| 528 | Ga0265334_10000887 | 3300028573 | Bacteria | 14948 |
| 529 | Ga0265334_10033514 | 3300028573 | Bacteria | 2044 |
| 530 | Ga0265318_10031803 | 3300028577 | Bacteria | 2044 |
| 531 | Ga0307515_10028681 | 3300028794 | Bacteria | 9447 |
| 532 | Ga0307515_10310721 | 3300028794 | Bacteria | 1252 |
| 533 | Ga0307515_10436974 | 3300028794 | Bacteria | 926 |
| 534 | Ga0265338_10017926 | 3300028800 | Bacteria | 7604 |
| 535 | Ga0265338_10074316 | 3300028800 | Bacteria | 2892 |
| 536 | Ga0265338_10083360 | 3300028800 | Bacteria | 2674 |
| 537 | Ga0265338_10239249 | 3300028800 | Bacteria | 1345 |
| 538 | Ga0307511_10004421 | 3300030521 | Bacteria | 14347 |
| 539 | Ga0265762_1033034 | 3300030760 | Bacteria | 989 |
| 540 | Ga0265763_1015060 | 3300030763 | Bacteria | 764 |
| 541 | Ga0265760_10006487 | 3300031090 | Bacteria | 3344 |
| 542 | Ga0265328_10023735 | 3300031239 | Bacteria | 2324 |
| 543 | Ga0265320_10007320 | 3300031240 | Bacteria | 6855 |
| 544 | Ga0265320_10101299 | 3300031240 | Bacteria | 1326 |
| 545 | Ga0265325_10012737 | 3300031241 | Bacteria | 4800 |
| 546 | Ga0265329_10002758 | 3300031242 | Bacteria | 7865 |
| 547 | Ga0265329_10019973 | 3300031242 | Bacteria | 2268 |
| 548 | Ga0265340_10025562 | 3300031247 | Bacteria | 2989 |
| 549 | Ga0265340_10026707 | 3300031247 | Bacteria | 2916 |
| 550 | Ga0265340_10040502 | 3300031247 | Bacteria | 2295 |
| 551 | Ga0265340_10109488 | 3300031247 | Bacteria | 1278 |
| 552 | Ga0265340_10190806 | 3300031247 | Bacteria | 924 |
| 553 | Ga0265339_10029521 | 3300031249 | Bacteria | 3111 |
| 554 | Ga0265331_10001286 | 3300031250 | Bacteria | 18690 |
| 555 | Ga0265331_10035450 | 3300031250 | Bacteria | 2455 |
| 556 | Ga0265331_10279732 | 3300031250 | Bacteria | 748 |
| 557 | Ga0307513_10005147 | 3300031456 | Bacteria | 17318 |
| 558 | Ga0307513_10015166 | 3300031456 | Bacteria | 9354 |
| 559 | Ga0307513_10026731 | 3300031456 | Bacteria | 6643 |
| 560 | Ga0307513_10116966 | 3300031456 | Bacteria | 2644 |
| 561 | Ga0307513_10489377 | 3300031456 | Bacteria | 949 |
| 562 | Ga0307509_10026777 | 3300031507 | Bacteria | 6426 |
| 563 | Ga0307509_10214636 | 3300031507 | Bacteria | 1745 |
| 564 | Ga0307408_100165324 | 3300031548 | Bacteria | 1761 |
| 565 | Ga0307408_100179502 | 3300031548 | Bacteria | 1697 |
| 566 | Ga0265313_10008984 | 3300031595 | Bacteria | 6554 |
| 567 | Ga0265313_10091448 | 3300031595 | Bacteria | 1366 |
| 568 | Ga0307508_10151915 | 3300031616 | Bacteria | 1920 |
| 569 | Ga0307514_10116549 | 3300031649 | Bacteria | 1876 |
| 570 | Ga0265314_10011743 | 3300031711 | Bacteria | 7203 |
| 571 | Ga0265342_10008972 | 3300031712 | Bacteria | 7100 |
| 572 | Ga0316578_10219494 | 3300031728 | Bacteria | 1143 |
| 573 | Ga0307516_10001401 | 3300031730 | Bacteria | 33337 |
| 574 | Ga0307516_10203704 | 3300031730 | Bacteria | 1697 |
| 575 | Ga0307405_10198099 | 3300031731 | Bacteria | 1456 |
| 576 | Ga0307405_10623210 | 3300031731 | Bacteria | 883 |
| 577 | Ga0307405_11038935 | 3300031731 | Bacteria | 701 |
| 578 | Ga0316577_10328070 | 3300031733 | Bacteria | 868 |
| 579 | Ga0307413_10007661 | 3300031824 | Bacteria | 5037 |
| 580 | Ga0307413_10012589 | 3300031824 | Bacteria | 4215 |
| 581 | Ga0307413_10121029 | 3300031824 | Bacteria | 1773 |
| 582 | Ga0307413_10240831 | 3300031824 | Bacteria | 1335 |
| 583 | Ga0307410_10021366 | 3300031852 | Bacteria | 3980 |
| 584 | Ga0307410_10210867 | 3300031852 | Bacteria | 1488 |
| 585 | Ga0307410_10525034 | 3300031852 | Bacteria | 977 |
| 586 | Ga0307410_11008764 | 3300031852 | Bacteria | 718 |
| 587 | Ga0307406_10049114 | 3300031901 | Bacteria | 2669 |
| 588 | Ga0307406_11277973 | 3300031901 | Bacteria | 640 |
| 589 | Ga0307407_10047569 | 3300031903 | Bacteria | 2435 |
| 590 | Ga0307407_10067651 | 3300031903 | Bacteria | 2112 |
| 591 | Ga0307407_10142704 | 3300031903 | Bacteria | 1547 |
| 592 | Ga0307407_10624920 | 3300031903 | Bacteria | 804 |
| 593 | Ga0307412_10128089 | 3300031911 | Bacteria | 1839 |
| 594 | Ga0307412_11236217 | 3300031911 | Bacteria | 670 |
| 595 | Ga0307409_100009013 | 3300031995 | Bacteria | 6102 |
| 596 | Ga0307409_100009487 | 3300031995 | Bacteria | 5981 |
| 597 | Ga0307409_100034452 | 3300031995 | Bacteria | 3698 |
| 598 | Ga0307409_100334793 | 3300031995 | Bacteria | 1422 |
| 599 | Ga0307409_100397179 | 3300031995 | Bacteria | 1316 |
| 600 | Ga0307409_100420844 | 3300031995 | Bacteria | 1281 |
| 601 | Ga0307409_101037512 | 3300031995 | Bacteria | 839 |
| 602 | Ga0307416_100008715 | 3300032002 | Bacteria | 6569 |
| 603 | Ga0307416_100171510 | 3300032002 | Bacteria | 2020 |
| 604 | Ga0307416_100185637 | 3300032002 | Bacteria | 1954 |
| 605 | Ga0307416_100792702 | 3300032002 | Bacteria | 1043 |
| 606 | Ga0307416_100897966 | 3300032002 | Bacteria | 986 |
| 607 | Ga0307414_10241053 | 3300032004 | Bacteria | 1497 |
| 608 | Ga0307411_10000609 | 3300032005 | Bacteria | 12862 |
| 609 | Ga0307415_100151585 | 3300032126 | Bacteria | 1785 |
| 610 | Ga0307510_10000001 | 3300033180 | Bacteria | 1172244 |
| 611 | Ga0307510_10032614 | 3300033180 | Bacteria | 5865 |
| 612 | Ga0373936_0190135 | 3300035113 | Bacteria | 903 |
| 613 | Ga0373956_0069467 | 3300035119 | Bacteria | 1606 |
| 614 | Ga0373956_0287881 | 3300035119 | Bacteria | 782 |
| 615 | Ga0373957_0032331 | 3300035120 | Bacteria | 1926 |
| 616 | Ga0373946_0086965 | 3300035171 | Bacteria | 1379 |
| 617 | Ga0373955_0386764 | 3300035172 | Bacteria | 849 |
| 618 | Ga0316574_0085744 | 3300035398 | Bacteria | 2004 |
| 619 | Ga0316574_0111807 | 3300035398 | Bacteria | 1751 |
| 620 | Ga0316574_0200930 | 3300035398 | Bacteria | 1280 |
| 621 | Ga0373924_0228926 | 3300035410 | Bacteria | 822 |
| 622 | Ga0373924_0324521 | 3300035410 | Bacteria | 685 |
| 623 | Ga0373927_0074550 | 3300035695 | Bacteria | 2197 |
| 624 | Ga0373927_0182721 | 3300035695 | Bacteria | 1376 |
| 625 | Ga0373933_0029416 | 3300035724 | Bacteria | 3177 |
| 626 | Ga0373933_0161910 | 3300035724 | Bacteria | 1421 |
| 627 | Ga0373947_0020123 | 3300035725 | Bacteria | 3852 |
| 628 | Ga0373937_0002558 | 3300036401 | Bacteria | 15119 |
| 629 | Ga0373937_0137059 | 3300036401 | Bacteria | 2289 |
| 630 | Ga0373937_0228660 | 3300036401 | Bacteria | 1751 |
| 631 | Ga0373937_0231271 | 3300036401 | Bacteria | 1741 |
| 632 | Ga0373937_0280442 | 3300036401 | Bacteria | 1574 |
| 633 | Ga0373937_0417777 | 3300036401 | Bacteria | 1273 |
| 634 | Ga0373937_0555222 | 3300036401 | Bacteria | 1091 |
| 635 | Ga0316584_0041810 | 3300036712 | Bacteria | 3417 |
| 636 | Ga0373925_0135044 | 3300037068 | Bacteria | 1927 |
| 637 | Ga0395898_0006256 | 3300037466 | Bacteria | 12739 |
| 638 | Ga0395905_1322085 | 3300037471 | Bacteria | 625 |
| 639 | Ga0436365_1315948 | 3300039437 | Bacteria | 1018 |
| 640 | Ga0436365_1863591 | 3300039437 | Bacteria | 9458 |
| 641 | Ga0436360_0209535 | 3300039438 | Bacteria | 1450 |
| 642 | Ga0436360_0304140 | 3300039438 | Bacteria | 4428 |
| 643 | Ga0436360_0330103 | 3300039438 | Bacteria | 1294 |
| 644 | Ga0436360_0497289 | 3300039438 | Bacteria | 2688 |
| 645 | Ga0436361_0084531 | 3300039447 | Bacteria | 880 |
| 646 | Ga0436363_0142927 | 3300039450 | Bacteria | 5763 |
| 647 | Ga0436363_0644535 | 3300039450 | Bacteria | 1035 |
| 648 | Ga0436363_1089212 | 3300039450 | Bacteria | 1476 |
| 649 | Ga0436363_1139935 | 3300039450 | Bacteria | 715 |
| 650 | Ga0436362_0980315 | 3300039453 | Bacteria | 1451 |
| 651 | Ga0436362_1202716 | 3300039453 | Bacteria | 2494 |
| 652 | Ga0451807_0200745 | 3300041486 | Bacteria | 739 |
| 653 | Ga0451807_0415911 | 3300041486 | Bacteria | 2103 |
| 654 | Ga0451807_2061194 | 3300041486 | Bacteria | 1484 |
| 655 | Ga0451833_0220826 | 3300041491 | Bacteria | 654 |
| 656 | Ga0451835_0465860 | 3300041492 | Bacteria | 953 |
| 657 | Ga0451837_1119479 | 3300041494 | Bacteria | 1194 |
| 658 | Ga0439431_0041826 | 3300041997 | Bacteria | 1169 |
| 659 | Ga0439431_0075207 | 3300041997 | Bacteria | 905 |
| 660 | Ga0439433_0007127 | 3300041999 | Bacteria | 2413 |
| 661 | Ga0450914_013388 | 3300042118 | Bacteria | 835 |
| 662 | Ga0450919_012547 | 3300042121 | Bacteria | 961 |
| 663 | Ga0450920_018481 | 3300042122 | Bacteria | 1334 |
| 664 | Ga0450921_011596 | 3300042123 | Bacteria | 754 |
| 665 | Ga0450923_002135 | 3300042125 | Bacteria | 2778 |
| 666 | Ga0450923_079877 | 3300042125 | Bacteria | 734 |
| 667 | Ga0450897_012339 | 3300042128 | Bacteria | 842 |
| 668 | Ga0450895_001082 | 3300042132 | Bacteria | 1814 |
| 669 | Ga0450896_008050 | 3300042133 | Bacteria | 1458 |
| 670 | Ga0450907_014141 | 3300042146 | Bacteria | 1331 |
| 671 | Ga0450910_003152 | 3300042147 | Bacteria | 2180 |
| 672 | Ga0450910_020685 | 3300042147 | Bacteria | 993 |
| 673 | Ga0439446_0005967 | 3300042156 | Bacteria | 3156 |
| 674 | Ga0439446_0010025 | 3300042156 | Bacteria | 2545 |
| 675 | Ga0450908_006105 | 3300042184 | Bacteria | 2296 |
| 676 | Ga0450908_010278 | 3300042184 | Bacteria | 1729 |
| 677 | Ga0439434_0006875 | 3300042435 | Bacteria | 3321 |
| 678 | Ga0439435_0000245 | 3300042436 | Bacteria | 7822 |
| 679 | Ga0439444_0012984 | 3300042437 | Bacteria | 1374 |
| 680 | Ga0439444_0022008 | 3300042437 | Bacteria | 1133 |
| 681 | Ga0450918_007532 | 3300042531 | Bacteria | 1925 |
| 682 | Ga0451577_0021340 | 3300042876 | Bacteria | 5928 |
| 683 | Ga0451577_0478066 | 3300042876 | Bacteria | 1131 |
| 684 | Ga0466969_0001467 | 3300044656 | Bacteria | 12666 |
| 685 | Ga0466969_0006521 | 3300044656 | Bacteria | 6208 |
| 686 | Ga0466969_0093037 | 3300044656 | Bacteria | 1427 |
| 687 | Ga0466965_0162995 | 3300044683 | Bacteria | 1170 |
| 688 | Ga0466966_0004272 | 3300044684 | Bacteria | 9420 |
| 689 | Ga0466966_0321157 | 3300044684 | Bacteria | 930 |
| 690 | Ga0466966_0396431 | 3300044684 | Bacteria | 829 |
| 691 | Ga0466961_0001905 | 3300044693 | Bacteria | 13004 |
| 692 | Ga0466961_0347004 | 3300044693 | Bacteria | 904 |
| 693 | Ga0466964_0001076 | 3300044706 | Bacteria | 9138 |
| 694 | Ga0453684_0008627 | 3300044712 | Bacteria | 18154 |
| 695 | Ga0453684_0232370 | 3300044712 | Bacteria | 2128 |
| 696 | Ga0453684_0404282 | 3300044712 | Bacteria | 1529 |
| 697 | Ga0466971_0000737 | 3300044719 | Bacteria | 13113 |
| 698 | Ga0466968_0080781 | 3300044735 | Bacteria | 1428 |
| 699 | Ga0466970_0001269 | 3300044765 | Bacteria | 12209 |
| 700 | Ga0466970_0166892 | 3300044765 | Bacteria | 1219 |
| 701 | Ga0466957_0248159 | 3300044842 | Bacteria | 1183 |
| 702 | Ga0466960_0157434 | 3300044901 | Bacteria | 1217 |
| 703 | Ga0466959_0007191 | 3300045049 | Bacteria | 7797 |
| 704 | Ga0466959_0009745 | 3300045049 | Bacteria | 6842 |
| 705 | Ga0466959_0022809 | 3300045049 | Bacteria | 4628 |
| 706 | Ga0466959_0037627 | 3300045049 | Bacteria | 3576 |
| 707 | Ga0466959_0077862 | 3300045049 | Bacteria | 2392 |
| 708 | Ga0466959_0414775 | 3300045049 | Bacteria | 914 |
| 709 | Ga0451576_0021430 | 3300045051 | Bacteria | 7024 |
| 710 | Ga0451576_0656038 | 3300045051 | Bacteria | 1103 |
| 711 | Ga0466958_0061397 | 3300045836 | Bacteria | 2290 |
| 712 | Ga0466958_0175862 | 3300045836 | Bacteria | 1357 |
| 713 | Ga0466967_0400934 | 3300045976 | Bacteria | 1335 |
| 714 | Ga0495638_0445770 | 3300046460 | Bacteria | 662 |
| 715 | Ga0495580_0144857 | 3300046472 | Bacteria | 1646 |
| 716 | Ga0495580_0150213 | 3300046472 | Bacteria | 1614 |
| 717 | Ga0495582_0213211 | 3300046473 | Bacteria | 1104 |
| 718 | Ga0495582_0541284 | 3300046473 | Bacteria | 673 |
| 719 | Ga0495596_0087142 | 3300046500 | Bacteria | 1212 |
| 720 | Ga0495596_0144020 | 3300046500 | Bacteria | 926 |
| 721 | Ga0495583_0064792 | 3300046506 | Bacteria | 1620 |
| 722 | Ga0495628_0743997 | 3300046516 | Bacteria | 689 |
| 723 | Ga0495630_0100180 | 3300046517 | Bacteria | 2192 |
| 724 | Ga0495632_0033474 | 3300046519 | Bacteria | 2638 |
| 725 | Ga0495632_0043799 | 3300046519 | Bacteria | 2236 |
| 726 | Ga0495632_0101351 | 3300046519 | Bacteria | 1357 |
| 727 | Ga0495632_0197037 | 3300046519 | Bacteria | 918 |
| 728 | Ga0495642_0060249 | 3300046528 | Bacteria | 1574 |
| 729 | Ga0495598_0018223 | 3300046537 | Bacteria | 1822 |
| 730 | Ga0495621_0004951 | 3300046539 | Bacteria | 3790 |
| 731 | Ga0495656_0467301 | 3300046615 | Bacteria | 666 |
| 732 | Ga0495668_0356453 | 3300046616 | Bacteria | 803 |
| 733 | Ga0495625_0022072 | 3300046660 | Bacteria | 4886 |
| 734 | Ga0495625_0096122 | 3300046660 | Bacteria | 2041 |
| 735 | Ga0495625_0352662 | 3300046660 | Bacteria | 930 |
| 736 | Ga0495635_0253168 | 3300046663 | Bacteria | 1187 |
| 737 | Ga0495659_0064846 | 3300046664 | Bacteria | 1357 |
| 738 | Ga0495647_0031507 | 3300046681 | Bacteria | 1972 |
| 739 | Ga0495658_0248749 | 3300046683 | Bacteria | 1118 |
| 740 | Ga0495658_0388066 | 3300046683 | Bacteria | 890 |
| 741 | Ga0495658_0508973 | 3300046683 | Bacteria | 770 |
| 742 | Ga0495613_0217796 | 3300046689 | Bacteria | 1341 |
| 743 | Ga0495671_0344552 | 3300046692 | Bacteria | 715 |
| 744 | Ga0495649_0023794 | 3300046694 | Bacteria | 3420 |
| 745 | Ga0495604_0534276 | 3300047317 | Bacteria | 758 |
| 746 | Ga0495674_0844043 | 3300047319 | Bacteria | 710 |
| 747 | Ga0495683_0257808 | 3300047323 | Bacteria | 763 |
| 748 | Ga0495687_029427 | 3300047443 | Bacteria | 2543 |
| 749 | Ga0495687_083927 | 3300047443 | Bacteria | 1239 |
| 750 | Ga0495675_0646546 | 3300047444 | Bacteria | 596 |
| 751 | Ga0495681_0067271 | 3300047470 | Bacteria | 1633 |
| 752 | Ga0495686_0114592 | 3300047472 | Bacteria | 1613 |
| 753 | Ga0495686_0238726 | 3300047472 | Bacteria | 1026 |
| 754 | Ga0495686_0342888 | 3300047472 | Bacteria | 814 |
| 755 | Ga0495626_0152578 | 3300048091 | Bacteria | 973 |
| 756 | Ga0496100_0075121 | 3300048903 | Bacteria | 2266 |
| 757 | Ga0496100_0132310 | 3300048903 | Bacteria | 1758 |
| 758 | Ga0496100_0617633 | 3300048903 | Bacteria | 843 |
| 759 | Ga0496101_0042108 | 3300048904 | Bacteria | 3260 |
| 760 | Ga0496101_0048076 | 3300048904 | Bacteria | 3064 |
| 761 | Ga0496102_0012836 | 3300048905 | Bacteria | 7251 |
| 762 | Ga0496102_1108043 | 3300048905 | Bacteria | 711 |
| 763 | Ga0496103_0073759 | 3300048906 | Bacteria | 2138 |
| 764 | Ga0496103_0094125 | 3300048906 | Bacteria | 1893 |
| 765 | Ga0496104_0022861 | 3300048907 | Bacteria | 5744 |
| 766 | Ga0496104_0173515 | 3300048907 | Bacteria | 2066 |
| 767 | Ga0496104_0536410 | 3300048907 | Bacteria | 1081 |
| 768 | Ga0496105_0024795 | 3300048908 | Bacteria | 4875 |
| 769 | Ga0496105_0075341 | 3300048908 | Bacteria | 2786 |
| 770 | Ga0496105_1036727 | 3300048908 | Bacteria | 612 |
| 771 | Ga0496106_0012245 | 3300048909 | Bacteria | 6332 |
| 772 | Ga0496106_0505891 | 3300048909 | Bacteria | 970 |
| 773 | Ga0496107_0028268 | 3300048910 | Bacteria | 3984 |
| 774 | Ga0496107_0144351 | 3300048910 | Bacteria | 1759 |
| 775 | Ga0496107_0160540 | 3300048910 | Bacteria | 1666 |
| 776 | Ga0496108_0008084 | 3300048911 | Bacteria | 8534 |
| 777 | Ga0496109_0068484 | 3300048912 | Bacteria | 3253 |
| 778 | Ga0496109_0142485 | 3300048912 | Bacteria | 2242 |
| 779 | Ga0496109_0571643 | 3300048912 | Bacteria | 1066 |
| 780 | Ga0496110_0010275 | 3300048913 | Bacteria | 7607 |
| 781 | Ga0496110_0010653 | 3300048913 | Bacteria | 7484 |
| 782 | Ga0496111_0035338 | 3300048914 | Bacteria | 3570 |
| 783 | Ga0496111_0051294 | 3300048914 | Bacteria | 2978 |
| 784 | Ga0496112_0018154 | 3300048915 | Bacteria | 6620 |
| 785 | Ga0496112_0079411 | 3300048915 | Bacteria | 3245 |
| 786 | Ga0496113_0080623 | 3300048916 | Bacteria | 2493 |
| 787 | Ga0496114_0002253 | 3300048917 | Bacteria | 14687 |
| 788 | Ga0496114_0015278 | 3300048917 | Bacteria | 6173 |
| 789 | Ga0496114_0106016 | 3300048917 | Bacteria | 2405 |
| 790 | Ga0496115_0042802 | 3300048918 | Bacteria | 3609 |
| 791 | Ga0496115_0116791 | 3300048918 | Bacteria | 2194 |
| 792 | Ga0496115_0341437 | 3300048918 | Bacteria | 1222 |
| 793 | Ga0496117_0000341 | 3300048920 | Bacteria | 82537 |
| 794 | Ga0496118_0000040 | 3300048921 | Bacteria | 304516 |
| 795 | Ga0496118_0263199 | 3300048921 | Bacteria | 971 |
| 796 | Ga0496119_0014519 | 3300048922 | Bacteria | 6155 |
| 797 | Ga0496119_0016541 | 3300048922 | Bacteria | 5606 |
| 798 | Ga0496120_0000997 | 3300048923 | Bacteria | 38249 |
| 799 | Ga0496120_0090430 | 3300048923 | Bacteria | 1636 |
| 800 | Ga0496121_0000461 | 3300048924 | Bacteria | 79954 |
| 801 | Ga0496121_0240282 | 3300048924 | Bacteria | 1262 |
| 802 | Ga0496121_0493981 | 3300048924 | Bacteria | 778 |
| 803 | Ga0496124_0036797 | 3300048927 | Bacteria | 4263 |
| 804 | Ga0496125_0004912 | 3300048928 | Bacteria | 15136 |
| 805 | Ga0496125_0009060 | 3300048928 | Bacteria | 10302 |
| 806 | Ga0496125_0078275 | 3300048928 | Bacteria | 2542 |
| 807 | Ga0496126_0031649 | 3300048929 | Bacteria | 4993 |
| 808 | Ga0496126_1138595 | 3300048929 | Bacteria | 577 |
| 809 | Ga0495678_127255 | 3300049459 | Bacteria | 848 |
| 810 | Ga0501031_0029207 | 3300049568 | Bacteria | 3597 |
| 811 | Ga0501031_0157068 | 3300049568 | Bacteria | 1487 |
| 812 | Ga0501031_0220589 | 3300049568 | Bacteria | 1235 |
| 813 | Ga0501032_0019143 | 3300049569 | Bacteria | 4790 |
| 814 | Ga0501032_0140896 | 3300049569 | Bacteria | 1588 |
| 815 | Ga0501032_0352588 | 3300049569 | Bacteria | 948 |
| 816 | Ga0501033_0123097 | 3300049570 | Bacteria | 1881 |
| 817 | Ga0501033_0127278 | 3300049570 | Bacteria | 1847 |
| 818 | Ga0501033_0183306 | 3300049570 | Bacteria | 1500 |
| 819 | Ga0501034_0477741 | 3300049571 | Bacteria | 1162 |
| 820 | Ga0501036_0013643 | 3300049572 | Bacteria | 6756 |
| 821 | Ga0501036_0016284 | 3300049572 | Bacteria | 6211 |
| 822 | Ga0501036_0310462 | 3300049572 | Bacteria | 1318 |
| 823 | Ga0501037_0184996 | 3300049573 | Bacteria | 1477 |
| 824 | Ga0501037_0280022 | 3300049573 | Bacteria | 1162 |
| 825 | Ga0501037_0281207 | 3300049573 | Bacteria | 1159 |
| 826 | Ga0501037_0529999 | 3300049573 | Bacteria | 797 |
| 827 | Ga0501038_0002611 | 3300049574 | Bacteria | 16847 |
| 828 | Ga0501038_0075910 | 3300049574 | Bacteria | 2840 |
| 829 | Ga0501038_0193763 | 3300049574 | Bacteria | 1634 |
| 830 | Ga0501038_0993515 | 3300049574 | Bacteria | 616 |
| 831 | Ga0501039_0002347 | 3300049575 | Bacteria | 14083 |
| 832 | Ga0501039_0095049 | 3300049575 | Bacteria | 2323 |
| 833 | Ga0501039_0260002 | 3300049575 | Bacteria | 1364 |
| 834 | Ga0501039_0347964 | 3300049575 | Bacteria | 1165 |
| 835 | Ga0501040_0004324 | 3300049576 | Bacteria | 9228 |
| 836 | Ga0501040_0401408 | 3300049576 | Bacteria | 984 |
| 837 | Ga0501040_0440003 | 3300049576 | Bacteria | 938 |
| 838 | Ga0501041_0006421 | 3300049577 | Bacteria | 6882 |
| 839 | Ga0501041_0013343 | 3300049577 | Bacteria | 4868 |
| 840 | Ga0501041_0016384 | 3300049577 | Bacteria | 4405 |
| 841 | Ga0501042_0002141 | 3300049578 | Bacteria | 11998 |
| 842 | Ga0501042_0074623 | 3300049578 | Bacteria | 2427 |
| 843 | Ga0501042_0281667 | 3300049578 | Bacteria | 1201 |
| 844 | Ga0501043_0294335 | 3300049579 | Bacteria | 1242 |
| 845 | Ga0501046_0084907 | 3300049580 | Bacteria | 2441 |
| 846 | Ga0501048_0013872 | 3300049582 | Bacteria | 5976 |
| 847 | Ga0501048_0017825 | 3300049582 | Bacteria | 5225 |
| 848 | Ga0501048_0596132 | 3300049582 | Bacteria | 793 |
| 849 | Ga0501067_0012686 | 3300049583 | Bacteria | 4673 |
| 850 | Ga0501067_0225867 | 3300049583 | Bacteria | 1042 |
| 851 | Ga0501068_0118061 | 3300049584 | Bacteria | 1653 |
| 852 | Ga0501068_0130057 | 3300049584 | Bacteria | 1574 |
| 853 | Ga0501068_0318620 | 3300049584 | Bacteria | 996 |
| 854 | Ga0501069_0146749 | 3300049585 | Bacteria | 1354 |
| 855 | Ga0501070_0005151 | 3300049586 | Bacteria | 11141 |
| 856 | Ga0501070_0135216 | 3300049586 | Bacteria | 2036 |
| 857 | Ga0501070_0436855 | 3300049586 | Bacteria | 1056 |
| 858 | Ga0501071_0004887 | 3300049587 | Bacteria | 8545 |
| 859 | Ga0501071_0005655 | 3300049587 | Bacteria | 8060 |
| 860 | Ga0501071_0006895 | 3300049587 | Bacteria | 7408 |
| 861 | Ga0501071_0067646 | 3300049587 | Bacteria | 2598 |
| 862 | Ga0501071_0090311 | 3300049587 | Bacteria | 2249 |
| 863 | Ga0501071_0837341 | 3300049587 | Bacteria | 709 |
| 864 | Ga0501072_0023119 | 3300049588 | Bacteria | 4826 |
| 865 | Ga0501072_0039804 | 3300049588 | Bacteria | 3690 |
| 866 | Ga0501072_0570846 | 3300049588 | Bacteria | 893 |
| 867 | Ga0501073_0000202 | 3300049589 | Bacteria | 39531 |
| 868 | Ga0501073_0028276 | 3300049589 | Bacteria | 4006 |
| 869 | Ga0501073_0702830 | 3300049589 | Bacteria | 697 |
| 870 | Ga0501074_0006548 | 3300049590 | Bacteria | 8415 |
| 871 | Ga0501074_0013983 | 3300049590 | Bacteria | 5834 |
| 872 | Ga0501074_0101629 | 3300049590 | Bacteria | 2058 |
| 873 | Ga0501074_0141516 | 3300049590 | Bacteria | 1721 |
| 874 | Ga0501074_0186788 | 3300049590 | Bacteria | 1478 |
| 875 | Ga0501074_1169989 | 3300049590 | Bacteria | 540 |
| 876 | Ga0501075_0011703 | 3300049591 | Bacteria | 6217 |
| 877 | Ga0501075_0025965 | 3300049591 | Bacteria | 4306 |
| 878 | Ga0501075_0083749 | 3300049591 | Bacteria | 2415 |
| 879 | Ga0501075_0092733 | 3300049591 | Bacteria | 2292 |
| 880 | Ga0501075_0126212 | 3300049591 | Bacteria | 1948 |
| 881 | Ga0501075_0129317 | 3300049591 | Bacteria | 1924 |
| 882 | Ga0501076_0035862 | 3300049592 | Bacteria | 3882 |
| 883 | Ga0501076_0103350 | 3300049592 | Bacteria | 2298 |
| 884 | Ga0501076_0315008 | 3300049592 | Bacteria | 1283 |
| 885 | Ga0501076_0355048 | 3300049592 | Bacteria | 1204 |
| 886 | Ga0501076_0355791 | 3300049592 | Bacteria | 1203 |
| 887 | Ga0501076_0370494 | 3300049592 | Bacteria | 1177 |
| 888 | Ga0501076_0444216 | 3300049592 | Bacteria | 1067 |
| 889 | Ga0501077_0002457 | 3300049593 | Bacteria | 11100 |
| 890 | Ga0501077_0008720 | 3300049593 | Bacteria | 6291 |
| 891 | Ga0501077_0013443 | 3300049593 | Bacteria | 5134 |
| 892 | Ga0501243_027713 | 3300049675 | Bacteria | 957 |
| 893 | Ga0501079_0011222 | 3300049741 | Bacteria | 6835 |
| 894 | Ga0501079_0012685 | 3300049741 | Bacteria | 6436 |
| 895 | Ga0501079_0029064 | 3300049741 | Bacteria | 4243 |
| 896 | Ga0501079_0082594 | 3300049741 | Bacteria | 2485 |
| 897 | Ga0501079_0171940 | 3300049741 | Bacteria | 1689 |
| 898 | Ga0501079_0477141 | 3300049741 | Bacteria | 980 |
| 899 | Ga0501079_0524786 | 3300049741 | Bacteria | 931 |
| 900 | Ga0501079_0584189 | 3300049741 | Bacteria | 879 |
| 901 | Ga0501080_0002270 | 3300049742 | Bacteria | 16730 |
| 902 | Ga0501080_0003157 | 3300049742 | Bacteria | 14519 |
| 903 | Ga0501080_0076430 | 3300049742 | Bacteria | 3114 |
| 904 | Ga0501080_0098382 | 3300049742 | Bacteria | 2715 |
| 905 | Ga0501080_0234231 | 3300049742 | Bacteria | 1678 |
| 906 | Ga0501080_0607267 | 3300049742 | Bacteria | 971 |
| 907 | Ga0501080_0854357 | 3300049742 | Bacteria | 795 |
| 908 | Ga0501080_0944725 | 3300049742 | Bacteria | 750 |
| 909 | Ga0501081_0002191 | 3300049743 | Bacteria | 12284 |
| 910 | Ga0501081_0007052 | 3300049743 | Bacteria | 7306 |
| 911 | Ga0501081_0022448 | 3300049743 | Bacteria | 4223 |
| 912 | Ga0501081_0028333 | 3300049743 | Bacteria | 3779 |
| 913 | Ga0501081_0206837 | 3300049743 | Bacteria | 1424 |
| 914 | Ga0501081_0231163 | 3300049743 | Bacteria | 1347 |
| 915 | Ga0501081_0746194 | 3300049743 | Bacteria | 736 |
| 916 | Ga0501083_0006614 | 3300049744 | Bacteria | 8226 |
| 917 | Ga0501083_0237445 | 3300049744 | Bacteria | 1187 |
| 918 | Ga0501035_0046446 | 3300049822 | Bacteria | 3907 |
| 919 | Ga0501035_0205772 | 3300049822 | Bacteria | 1686 |
| 920 | Ga0501035_0238705 | 3300049822 | Bacteria | 1547 |
| 921 | Ga0501045_0000225 | 3300049824 | Bacteria | 32621 |
| 922 | Ga0501045_0003148 | 3300049824 | Bacteria | 11283 |
| 923 | Ga0501045_0120295 | 3300049824 | Bacteria | 1950 |
| 924 | Ga0501045_0629978 | 3300049824 | Bacteria | 793 |
| 925 | nmdc:mga0k408_763374_c1 | 3300050493 | Bacteria | 564 |
| 926 | nmdc:mga0qj67_574099_c1 | 3300050509 | Bacteria | 903 |
| 927 | nmdc:mga08y16_222381_c1 | 3300050511 | Bacteria | 1954 |
| 928 | nmdc:mga0n895_27894_c1 | 3300050512 | Bacteria | 5365 |
| 929 | nmdc:mga0rr50_450629_c1 | 3300050513 | Bacteria | 1091 |
| 930 | nmdc:mga08x19_38560_c1 | 3300050514 | Bacteria | 3035 |
| 931 | nmdc:mga0a205_603_c1 | 3300050515 | Bacteria | 28564 |
| 932 | Ga0495601_0452030 | 3300053077 | Bacteria | 831 |
| 933 | Ga0495601_0557967 | 3300053077 | Bacteria | 737 |
| 934 | Ga0495612_0242415 | 3300053078 | Bacteria | 801 |
| 935 | Ga0495619_0051305 | 3300053085 | Bacteria | 2726 |
| 936 | Ga0500583_0035637 | 3300053092 | Bacteria | 2222 |
| 937 | Ga0500556_0001072 | 3300053104 | Bacteria | 13870 |
| 938 | Ga0500556_0100145 | 3300053104 | Bacteria | 1115 |
| 939 | Ga0500562_077440 | 3300053108 | Bacteria | 899 |
| 940 | Ga0500572_005400 | 3300053111 | Bacteria | 2894 |
| 941 | Ga0500617_114342 | 3300053124 | Bacteria | 1123 |
| 942 | Ga0500658_0126317 | 3300053134 | Bacteria | 1137 |
| 943 | Ga0500658_0199248 | 3300053134 | Bacteria | 915 |
| 944 | Ga0500658_0249296 | 3300053134 | Bacteria | 816 |
| 945 | Ga0500568_0032769 | 3300053139 | Bacteria | 2135 |
| 946 | Ga0500588_0144609 | 3300053146 | Bacteria | 856 |
| 947 | Ga0500616_0000569 | 3300053153 | Bacteria | 45203 |
| 948 | Ga0500616_0035735 | 3300053153 | Bacteria | 2701 |
| 949 | Ga0500622_0052293 | 3300053156 | Bacteria | 2100 |
| 950 | Ga0500636_0153639 | 3300053177 | Bacteria | 1262 |
| 951 | Ga0500637_0008200 | 3300053178 | Bacteria | 5259 |
| 952 | Ga0500637_0021322 | 3300053178 | Bacteria | 3519 |
| 953 | Ga0500637_0128147 | 3300053178 | Bacteria | 1472 |
| 954 | Ga0500611_031509 | 3300053727 | Bacteria | 1102 |
| 955 | Ga0501084_0008361 | 3300054114 | Bacteria | 8543 |
| 956 | Ga0501084_0051730 | 3300054114 | Bacteria | 3438 |
| 957 | Ga0501084_0071640 | 3300054114 | Bacteria | 2902 |
| 958 | Ga0501084_0307293 | 3300054114 | Bacteria | 1339 |
| 959 | Ga0501084_0589772 | 3300054114 | Bacteria | 939 |
| 960 | Ga0501082_0003957 | 3300060353 | Bacteria | 12932 |
| 961 | Ga0501082_0007102 | 3300060353 | Bacteria | 9661 |
| 962 | Ga0501082_0007945 | 3300060353 | Bacteria | 9162 |
| 963 | Ga0501082_0056300 | 3300060353 | Bacteria | 3387 |
| 964 | Ga0501082_0142707 | 3300060353 | Bacteria | 2078 |
| 965 | Ga0501082_0595593 | 3300060353 | Bacteria | 967 |
| 966 | Ga0466962_0001942 | 3300061719 | Bacteria | 9745 |
| 967 | Ga0530510_0091703 | 3300061734 | Bacteria | 2217 |
| 968 | Ga0530510_0096465 | 3300061734 | Bacteria | 2161 |
| 969 | Ga0163163_10386792 | |||
| 970 | SwRhRL2b_contig_1969530 | |||
| 971 | JGI25406J46586_10030861 | |||
| 972 | rootH2_10003948 | |||
| 973 | rootL2_10140466 | |||
| 974 | Ga0065704_10003141 | |||
| 975 | Ga0065707_10087251 | |||
| 976 | Ga0070658_10417754 | |||
| 977 | Ga0070683_100081464 | |||
| 978 | Ga0070683_100573210 | |||
| 979 | Ga0070690_100043752 | |||
| 980 | Ga0070690_100084037 | |||
| 981 | Ga0070690_100387132 | |||
| 982 | Ga0070670_100064584 | |||
| 983 | Ga0070670_101009335 | |||
| 984 | Ga0070677_10074087 | |||
| 985 | Ga0068869_100178028 | |||
| 986 | Ga0068869_100764679 | |||
| 987 | Ga0070666_10005768 | |||
| 988 | Ga0070666_10016261 | |||
| 989 | Ga0070666_10063443 | |||
| 990 | Ga0070666_10099617 | |||
| 991 | Ga0070680_100004918 | |||
| 992 | Ga0070680_100084139 | |||
| 993 | Ga0070680_100097096 | |||
| 994 | Ga0070680_100481754 | |||
| 995 | Ga0070682_100046190 | |||
| 996 | Ga0070682_100141083 | |||
| 997 | Ga0070682_101034758 | |||
| 998 | Ga0068868_100038697 | |||
| 999 | Ga0068868_100245038 | |||
| 1000 | Ga0070689_100075487 | |||
| 1001 | Ga0070691_10250982 | |||
| 1002 | Ga0070661_100245623 | |||
| 1003 | Ga0070669_100060498 | |||
| 1004 | Ga0070669_100333177 | |||
| 1005 | Ga0070675_100393809 | |||
| 1006 | Ga0070675_100718375 | |||
| 1007 | Ga0070671_100000211 | |||
| 1008 | Ga0070671_100203219 | |||
| 1009 | Ga0070674_100163804 | |||
| 1010 | Ga0070673_100027809 | |||
| 1011 | Ga0070673_100704199 | |||
| 1012 | Ga0070688_100099986 | |||
| 1013 | Ga0070688_100927580 | |||
| 1014 | Ga0070667_100000176 | |||
| 1015 | Ga0070667_100004044 | |||
| 1016 | Ga0070667_100009234 | |||
| 1017 | Ga0070667_100029909 | |||
| 1018 | Ga0070667_100082793 | |||
| 1019 | Ga0070667_100122027 | |||
| 1020 | Ga0070667_100729737 | |||
| 1021 | Ga0070709_10142420 | |||
| 1022 | Ga0070709_10236145 | |||
| 1023 | Ga0070709_10653626 | |||
| 1024 | Ga0070714_100001900 | |||
| 1025 | Ga0070713_100077002 | |||
| 1026 | Ga0070713_100078632 | |||
| 1027 | Ga0070713_100095603 | |||
| 1028 | Ga0070713_101306485 | |||
| 1029 | Ga0070710_10012267 | |||
| 1030 | Ga0070710_10014273 | |||
| 1031 | Ga0070710_10537280 | |||
| 1032 | Ga0070701_10031829 | |||
| 1033 | Ga0070711_100002206 | |||
| 1034 | Ga0070711_100211067 | |||
| 1035 | Ga0070705_100238042 | |||
| 1036 | Ga0070700_100888841 | |||
| 1037 | Ga0070694_100223614 | |||
| 1038 | Ga0070708_101133947 | |||
| 1039 | Ga0070663_100654811 | |||
| 1040 | Ga0070663_100816665 | |||
| 1041 | Ga0070678_100115339 | |||
| 1042 | Ga0070662_100414329 | |||
| 1043 | Ga0070681_10003817 | |||
| 1044 | Ga0070681_10041176 | |||
| 1045 | Ga0070681_10066969 | |||
| 1046 | Ga0070681_10106172 | |||
| 1047 | Ga0070681_10256196 | |||
| 1048 | Ga0070681_10330041 | |||
| 1049 | Ga0070681_10586478 | |||
| 1050 | Ga0068867_100080836 | |||
| 1051 | Ga0068867_100421547 | |||
| 1052 | Ga0070685_10526006 | |||
| 1053 | Ga0070706_100794633 | |||
| 1054 | Ga0070698_100495863 | |||
| 1055 | Ga0070699_100192150 | |||
| 1056 | Ga0070679_100005267 | |||
| 1057 | Ga0070679_100034903 | |||
| 1058 | Ga0070679_100179309 | |||
| 1059 | Ga0070684_100084990 | |||
| 1060 | Ga0070684_100527477 | |||
| 1061 | Ga0068853_100108373 | |||
| 1062 | Ga0068853_100346615 | |||
| 1063 | Ga0068853_100485584 | |||
| 1064 | Ga0068853_100764686 | |||
| 1065 | Ga0070672_100195188 | |||
| 1066 | Ga0070672_100344521 | |||
| 1067 | Ga0070672_100361186 | |||
| 1068 | Ga0070672_101299202 | |||
| 1069 | Ga0070686_100023565 | |||
| 1070 | Ga0070686_100721987 | |||
| 1071 | Ga0070695_100006727 | |||
| 1072 | Ga0070695_100221985 | |||
| 1073 | Ga0070696_100200500 | |||
| 1074 | Ga0070693_100410724 | |||
| 1075 | Ga0070665_100002453 | |||
| 1076 | Ga0070665_100013615 | |||
| 1077 | Ga0070665_100028034 | |||
| 1078 | Ga0070665_100102416 | |||
| 1079 | Ga0068855_100002113 | |||
| 1080 | Ga0068855_100003941 | |||
| 1081 | Ga0068855_100469048 | |||
| 1082 | Ga0068855_100556107 | |||
| 1083 | Ga0068855_101003390 | |||
| 1084 | Ga0070664_100107091 | |||
| 1085 | Ga0070664_100207604 | |||
| 1086 | Ga0068854_100576598 | |||
| 1087 | Ga0068856_100028500 | |||
| 1088 | Ga0068856_100060596 | |||
| 1089 | Ga0068856_100192994 | |||
| 1090 | Ga0068852_100939529 | |||
| 1091 | Ga0068859_100002490 | |||
| 1092 | Ga0068859_100023424 | |||
| 1093 | Ga0068859_100305720 | |||
| 1094 | Ga0068859_100456037 | |||
| 1095 | Ga0068859_100717537 | |||
| 1096 | Ga0068864_100201860 | |||
| 1097 | Ga0068864_100345061 | |||
| 1098 | Ga0068861_100020851 | |||
| 1099 | Ga0068861_100021827 | |||
| 1100 | Ga0068861_100131403 | |||
| 1101 | Ga0068863_100006902 | |||
| 1102 | Ga0068863_100007707 | |||
| 1103 | Ga0068863_100009550 | |||
| 1104 | Ga0068863_100035861 | |||
| 1105 | Ga0068863_100107638 | |||
| 1106 | Ga0068863_100599993 | |||
| 1107 | Ga0068863_100719179 | |||
| 1108 | Ga0068858_100001768 | |||
| 1109 | Ga0068858_100003825 | |||
| 1110 | Ga0068858_100105686 | |||
| 1111 | Ga0068858_100114531 | |||
| 1112 | Ga0068858_100172193 | |||
| 1113 | Ga0068858_100214148 | |||
| 1114 | Ga0068858_100622518 | |||
| 1115 | Ga0068860_100017517 | |||
| 1116 | Ga0068860_100495339 | |||
| 1117 | Ga0068860_100511859 | |||
| 1118 | Ga0068860_101906556 | |||
| 1119 | Ga0068862_100110870 | |||
| 1120 | Ga0068862_100118929 | |||
| 1121 | Ga0068862_100302164 | |||
| 1122 | Ga0068862_100307730 | |||
| 1123 | Ga0068862_100400007 | |||
| 1124 | Ga0068862_100420670 | |||
| 1125 | Ga0068862_100520669 | |||
| 1126 | Ga0068862_100671078 | |||
| 1127 | Ga0081455_10001496 | |||
| 1128 | Ga0081455_10003509 | |||
| 1129 | Ga0081455_10552356 | |||
| 1130 | Ga0081539_10000046 | |||
| 1131 | Ga0070717_10018074 | |||
| 1132 | Ga0070717_10822740 | |||
| 1133 | Ga0075432_10252642 | |||
| 1134 | Ga0070716_100023442 | |||
| 1135 | Ga0070716_100122567 | |||
| 1136 | Ga0070716_100217933 | |||
| 1137 | Ga0070716_100236105 | |||
| 1138 | Ga0070712_100059227 | |||
| 1139 | Ga0070712_100788229 | |||
| 1140 | Ga0097621_100034231 | |||
| 1141 | Ga0097621_100061127 | |||
| 1142 | Ga0097621_100124659 | |||
| 1143 | Ga0097621_101305098 | |||
| 1144 | Ga0068871_100025561 | |||
| 1145 | Ga0068871_100137665 | |||
| 1146 | Ga0068871_100224841 | |||
| 1147 | Ga0068871_100403058 | |||
| 1148 | Ga0068871_100760622 | |||
| 1149 | Ga0068871_101054953 | |||
| 1150 | Ga0068871_101096845 | |||
| 1151 | Ga0068871_101530702 | |||
| 1152 | Ga0075433_10001448 | |||
| 1153 | Ga0075434_100000572 | |||
| 1154 | Ga0068865_100022345 | |||
| 1155 | Ga0068865_100048126 | |||
| 1156 | Ga0068865_100820523 | |||
| 1157 | Ga0068865_101033127 | |||
| 1158 | Ga0097620_100002490 | |||
| 1159 | Ga0097620_100023425 | |||
| 1160 | Ga0097620_100305694 | |||
| 1161 | Ga0097620_100401404 | |||
| 1162 | Ga0097620_100456010 | |||
| 1163 | Ga0097620_100717569 | |||
| 1164 | Ga0097620_101110075 | |||
| 1165 | Ga0075435_100036416 | |||
| 1166 | Ga0099794_10012498 | |||
| 1167 | Ga0099795_10000128 | |||
| 1168 | Ga0099795_10006320 | |||
| 1169 | Ga0099795_10494676 | |||
| 1170 | Ga0105250_10028827 | |||
| 1171 | Ga0105250_10070849 | |||
| 1172 | Ga0105240_10007091 | |||
| 1173 | Ga0105240_10015264 | |||
| 1174 | Ga0105240_10020906 | |||
| 1175 | Ga0105240_10041324 | |||
| 1176 | Ga0105240_10048824 | |||
| 1177 | Ga0105240_10134123 | |||
| 1178 | Ga0105240_10188846 | |||
| 1179 | Ga0105240_10381327 | |||
| 1180 | Ga0105240_10502801 | |||
| 1181 | Ga0105240_10653130 | |||
| 1182 | Ga0105240_11265356 | |||
| 1183 | Ga0111539_10214109 | |||
| 1184 | Ga0111539_11056845 | |||
| 1185 | Ga0105245_10035278 | |||
| 1186 | Ga0105245_10059126 | |||
| 1187 | Ga0105245_11165870 | |||
| 1188 | Ga0105245_12467526 | |||
| 1189 | Ga0105247_10000088 | |||
| 1190 | Ga0105247_10032510 | |||
| 1191 | Ga0105247_10059041 | |||
| 1192 | Ga0105247_10122193 | |||
| 1193 | Ga0114129_11670546 | |||
| 1194 | Ga0105243_10452752 | |||
| 1195 | Ga0105243_11816843 | |||
| 1196 | Ga0105241_10308281 | |||
| 1197 | Ga0105241_10680799 | |||
| 1198 | Ga0105241_11111104 | |||
| 1199 | Ga0105242_10065708 | |||
| 1200 | Ga0105242_10196562 | |||
| 1201 | Ga0105242_10588013 | |||
| 1202 | Ga0105242_10748195 | |||
| 1203 | Ga0105248_10022103 | |||
| 1204 | Ga0105248_10069869 | |||
| 1205 | Ga0105248_10136209 | |||
| 1206 | Ga0105248_10189937 | |||
| 1207 | Ga0105248_10273247 | |||
| 1208 | Ga0105248_10373138 | |||
| 1209 | Ga0105248_10394230 | |||
| 1210 | Ga0105248_10709453 | |||
| 1211 | Ga0105237_10021211 | |||
| 1212 | Ga0105237_10193655 | |||
| 1213 | Ga0105237_10571996 | |||
| 1214 | Ga0105237_11995536 | |||
| 1215 | Ga0105238_10010567 | |||
| 1216 | Ga0105238_10153959 | |||
| 1217 | Ga0105238_10173440 | |||
| 1218 | Ga0105238_10351995 | |||
| 1219 | Ga0105238_10467996 | |||
| 1220 | Ga0105238_10733622 | |||
| 1221 | Ga0105249_10165602 | |||
| 1222 | Ga0105249_10217367 | |||
| 1223 | Ga0105249_10285122 | |||
| 1224 | Ga0105249_11404359 | |||
| 1225 | Ga0105249_11600131 | |||
| 1226 | Ga0099796_10000281 | |||
| 1227 | Ga0099796_10000913 | |||
| 1228 | Ga0099796_10008063 | |||
| 1229 | Ga0099796_10108256 | |||
| 1230 | Ga0105239_10128424 | |||
| 1231 | Ga0105239_10279893 | |||
| 1232 | Ga0105239_10341154 | |||
| 1233 | Ga0105239_11065883 | |||
| 1234 | Ga0157370_10008536 | |||
| 1235 | Ga0157370_10742661 | |||
| 1236 | Ga0157370_11208350 | |||
| 1237 | Ga0157369_10013340 | |||
| 1238 | Ga0157369_10069819 | |||
| 1239 | Ga0157369_10220836 | |||
| 1240 | Ga0157369_10235731 | |||
| 1241 | Ga0157374_10005413 | |||
| 1242 | Ga0157374_10300947 | |||
| 1243 | Ga0157374_10332546 | |||
| 1244 | Ga0157378_10070674 | |||
| 1245 | Ga0157378_10134056 | |||
| 1246 | Ga0163162_10064260 | |||
| 1247 | Ga0163162_10082446 | |||
| 1248 | Ga0163162_10253152 | |||
| 1249 | Ga0163162_10415994 | |||
| 1250 | Ga0163162_10582001 | |||
| 1251 | Ga0163162_10863724 | |||
| 1252 | Ga0163162_10873221 | |||
| 1253 | Ga0163162_11019243 | |||
| 1254 | Ga0163162_11112030 | |||
| 1255 | Ga0157372_10520527 | |||
| 1256 | Ga0157372_10594813 | |||
| 1257 | Ga0157375_10430640 | |||
| 1258 | Ga0157514_108775 | |||
| 1259 | Ga0163163_10027632 | |||
| 1260 | Ga0163163_10105052 | |||
| 1261 | Ga0163163_10117981 | |||
| 1262 | Ga0163163_10270870 | |||
| 1263 | Ga0163163_10335142 | |||
| 1264 | Ga0163163_10340793 | |||
| 1265 | Ga0157380_10715418 | |||
| 1266 | Ga0157379_10001073 | |||
| 1267 | Ga0157379_10052270 | |||
| 1268 | Ga0157379_10267299 | |||
| 1269 | Ga0157376_10022511 | |||
| 1270 | Ga0157376_10071919 | |||
| 1271 | Ga0157376_10215306 | |||
| 1272 | Ga0163161_10407188 | |||
| 1273 | Ga0213873_10238101 | |||
| 1274 | Ga0213874_10027512 | |||
| 1275 | Ga0213876_10021570 | |||
| 1276 | Ga0213871_10100810 | |||
| 1277 | Ga0207697_10107347 | |||
| 1278 | Ga0207656_10077235 | |||
| 1279 | Ga0207682_10003258 | |||
| 1280 | Ga0207682_10066536 | |||
| 1281 | Ga0207682_10070084 | |||
| 1282 | Ga0207692_10018213 | |||
| 1283 | Ga0207642_10381291 | |||
| 1284 | Ga0207642_10677202 | |||
| 1285 | Ga0207710_10000200 | |||
| 1286 | Ga0207710_10116066 | |||
| 1287 | Ga0207680_10007688 | |||
| 1288 | Ga0207680_10100983 | |||
| 1289 | Ga0207680_10212789 | |||
| 1290 | Ga0207680_10488298 | |||
| 1291 | Ga0207680_10498377 | |||
| 1292 | Ga0207647_10032204 | |||
| 1293 | Ga0207685_10063229 | |||
| 1294 | Ga0207685_10105579 | |||
| 1295 | Ga0207699_10287207 | |||
| 1296 | Ga0207699_10560029 | |||
| 1297 | Ga0207645_10082957 | |||
| 1298 | Ga0207643_10080383 | |||
| 1299 | Ga0207705_10506499 | |||
| 1300 | Ga0207654_10128164 | |||
| 1301 | Ga0207654_10614061 | |||
| 1302 | Ga0207707_10000045 | |||
| 1303 | Ga0207707_10028153 | |||
| 1304 | Ga0207707_10032540 | |||
| 1305 | Ga0207707_10035577 | |||
| 1306 | Ga0207707_10036535 | |||
| 1307 | Ga0207707_10079228 | |||
| 1308 | Ga0207707_10094844 | |||
| 1309 | Ga0207707_10316934 | |||
| 1310 | Ga0207695_10005045 | |||
| 1311 | Ga0207695_10025917 | |||
| 1312 | Ga0207695_10065000 | |||
| 1313 | Ga0207695_10075705 | |||
| 1314 | Ga0207695_10095396 | |||
| 1315 | Ga0207695_10155355 | |||
| 1316 | Ga0207695_10199560 | |||
| 1317 | Ga0207695_10221796 | |||
| 1318 | Ga0207695_10450934 | |||
| 1319 | Ga0207671_10015884 | |||
| 1320 | Ga0207671_10247866 | |||
| 1321 | Ga0207671_10263169 | |||
| 1322 | Ga0207671_11054115 | |||
| 1323 | Ga0207693_10000161 | |||
| 1324 | Ga0207663_10143307 | |||
| 1325 | Ga0207663_10183431 | |||
| 1326 | Ga0207663_10189814 | |||
| 1327 | Ga0207663_10935142 | |||
| 1328 | Ga0207660_10005866 | |||
| 1329 | Ga0207660_10079151 | |||
| 1330 | Ga0207662_10159414 | |||
| 1331 | Ga0207657_10227397 | |||
| 1332 | Ga0207657_10462304 | |||
| 1333 | Ga0207649_10050433 | |||
| 1334 | Ga0207652_10025512 | |||
| 1335 | Ga0207652_10031880 | |||
| 1336 | Ga0207652_10179360 | |||
| 1337 | Ga0207652_10188631 | |||
| 1338 | Ga0207652_10407849 | |||
| 1339 | Ga0207652_10510405 | |||
| 1340 | Ga0207681_10135584 | |||
| 1341 | Ga0207681_10234035 | |||
| 1342 | Ga0207681_10680452 | |||
| 1343 | Ga0207694_10075495 | |||
| 1344 | Ga0207694_10223578 | |||
| 1345 | Ga0207694_10242224 | |||
| 1346 | Ga0207694_10266252 | |||
| 1347 | Ga0207694_10788926 | |||
| 1348 | Ga0207694_10814745 | |||
| 1349 | Ga0207650_10018490 | |||
| 1350 | Ga0207650_10530877 | |||
| 1351 | Ga0207650_10927865 | |||
| 1352 | Ga0207659_10119425 | |||
| 1353 | Ga0207659_10146368 | |||
| 1354 | Ga0207659_10375263 | |||
| 1355 | Ga0207659_10685485 | |||
| 1356 | Ga0207687_10235010 | |||
| 1357 | Ga0207700_10030691 | |||
| 1358 | Ga0207700_10084826 | |||
| 1359 | Ga0207700_10230403 | |||
| 1360 | Ga0207700_10556371 | |||
| 1361 | Ga0207664_10003053 | |||
| 1362 | Ga0207664_10424440 | |||
| 1363 | Ga0207664_11079199 | |||
| 1364 | Ga0207644_10002758 | |||
| 1365 | Ga0207644_10079434 | |||
| 1366 | Ga0207644_10438919 | |||
| 1367 | Ga0207706_10404908 | |||
| 1368 | Ga0207706_10741872 | |||
| 1369 | Ga0207686_10047090 | |||
| 1370 | Ga0207686_10069165 | |||
| 1371 | Ga0207686_10964583 | |||
| 1372 | Ga0207709_10220664 | |||
| 1373 | Ga0207670_10194316 | |||
| 1374 | Ga0207670_10319990 | |||
| 1375 | Ga0207670_10346327 | |||
| 1376 | Ga0207670_10406350 | |||
| 1377 | Ga0207669_10238461 | |||
| 1378 | Ga0207704_10159028 | |||
| 1379 | Ga0207704_10697347 | |||
| 1380 | Ga0207665_10018237 | |||
| 1381 | Ga0207665_10033643 | |||
| 1382 | Ga0207665_10111851 | |||
| 1383 | Ga0207665_10442907 | |||
| 1384 | Ga0207665_10548591 | |||
| 1385 | Ga0207691_10004505 | |||
| 1386 | Ga0207691_10034548 | |||
| 1387 | Ga0207691_10091171 | |||
| 1388 | Ga0207691_10239126 | |||
| 1389 | Ga0207691_10639340 | |||
| 1390 | Ga0207711_10009924 | |||
| 1391 | Ga0207711_10188138 | |||
| 1392 | Ga0207711_10192864 | |||
| 1393 | Ga0207711_10369635 | |||
| 1394 | Ga0207711_10748631 | |||
| 1395 | Ga0207689_10121750 | |||
| 1396 | Ga0207689_10147357 | |||
| 1397 | Ga0207689_10172754 | |||
| 1398 | Ga0207689_10182043 | |||
| 1399 | Ga0207689_10212697 | |||
| 1400 | Ga0207689_10263022 | |||
| 1401 | Ga0207689_10426572 | |||
| 1402 | Ga0207661_10018888 | |||
| 1403 | Ga0207661_10154170 | |||
| 1404 | Ga0207679_10055626 | |||
| 1405 | Ga0207679_10802839 | |||
| 1406 | Ga0207667_10000887 | |||
| 1407 | Ga0207667_10030219 | |||
| 1408 | Ga0207667_10210927 | |||
| 1409 | Ga0207667_10224111 | |||
| 1410 | Ga0207667_10234465 | |||
| 1411 | Ga0207651_10126078 | |||
| 1412 | Ga0207651_10262509 | |||
| 1413 | Ga0207712_10168905 | |||
| 1414 | Ga0207712_10184451 | |||
| 1415 | Ga0207712_10429045 | |||
| 1416 | Ga0207712_10465924 | |||
| 1417 | Ga0207668_10489709 | |||
| 1418 | Ga0207668_11415715 | |||
| 1419 | Ga0207658_10000236 | |||
| 1420 | Ga0207658_10117310 | |||
| 1421 | Ga0207658_10489041 | |||
| 1422 | Ga0207658_10627901 | |||
| 1423 | Ga0207658_10998011 | |||
| 1424 | Ga0207658_11172178 | |||
| 1425 | Ga0207677_10102483 | |||
| 1426 | Ga0207677_10129061 | |||
| 1427 | Ga0207677_10249108 | |||
| 1428 | Ga0207703_10000919 | |||
| 1429 | Ga0207703_10191873 | |||
| 1430 | Ga0207703_10355844 | |||
| 1431 | Ga0207703_10592497 | |||
| 1432 | Ga0207639_10420684 | |||
| 1433 | Ga0207639_10457785 | |||
| 1434 | Ga0207639_10569334 | |||
| 1435 | Ga0207678_10164162 | |||
| 1436 | Ga0207678_10197495 | |||
| 1437 | Ga0207708_10456796 | |||
| 1438 | Ga0207702_10149416 | |||
| 1439 | Ga0207702_10183866 | |||
| 1440 | Ga0207702_10419369 | |||
| 1441 | Ga0207641_10013218 | |||
| 1442 | Ga0207641_10040304 | |||
| 1443 | Ga0207641_10073395 | |||
| 1444 | Ga0207641_10159033 | |||
| 1445 | Ga0207641_10159501 | |||
| 1446 | Ga0207641_10179923 | |||
| 1447 | Ga0207641_10476905 | |||
| 1448 | Ga0207641_10488175 | |||
| 1449 | Ga0207648_10117682 | |||
| 1450 | Ga0207648_10133968 | |||
| 1451 | Ga0207648_10747055 | |||
| 1452 | Ga0207676_10059925 | |||
| 1453 | Ga0207676_10284712 | |||
| 1454 | Ga0207676_10860294 | |||
| 1455 | Ga0207676_11203631 | |||
| 1456 | Ga0207674_10310164 | |||
| 1457 | Ga0207674_10647439 | |||
| 1458 | Ga0207675_100030392 | |||
| 1459 | Ga0207675_100169311 | |||
| 1460 | Ga0207675_100176127 | |||
| 1461 | Ga0207675_100916751 | |||
| 1462 | Ga0207683_10004973 | |||
| 1463 | Ga0207683_10024756 | |||
| 1464 | Ga0207698_10109115 | |||
| 1465 | Ga0207698_10220483 | |||
| 1466 | Ga0209179_1000062 | |||
| 1467 | Ga0209179_1054979 | |||
| 1468 | Ga0209971_1044609 | |||
| 1469 | Ga0209998_10016582 | |||
| 1470 | Ga0209998_10021833 | |||
| 1471 | Ga0265356_1009491 | |||
| 1472 | Ga0265355_1000333 | |||
| 1473 | Ga0268266_10002139 | |||
| 1474 | Ga0268266_10003011 | |||
| 1475 | Ga0268266_10020040 | |||
| 1476 | Ga0268266_10027811 | |||
| 1477 | Ga0268266_10051773 | |||
| 1478 | Ga0268266_10303530 | |||
| 1479 | Ga0268266_10390673 | |||
| 1480 | Ga0268266_10507445 | |||
| 1481 | Ga0268265_10021882 | |||
| 1482 | Ga0268265_10049268 | |||
| 1483 | Ga0268265_10080948 | |||
| 1484 | Ga0268265_10222647 | |||
| 1485 | Ga0268265_10250278 | |||
| 1486 | Ga0268265_10525368 | |||
| 1487 | Ga0268265_11480076 | |||
| 1488 | Ga0268264_10000142 | |||
| 1489 | Ga0268264_10018513 | |||
| 1490 | Ga0268264_10133529 | |||
| 1491 | Ga0268264_10171523 | |||
| 1492 | Ga0268264_10282774 | |||
| 1493 | Ga0268264_11518297 | |||
| 1494 | Ga0265326_10016634 | |||
| 1495 | Ga0265319_1020404 | |||
| 1496 | Ga0265334_10000887 | |||
| 1497 | Ga0265334_10033514 | |||
| 1498 | Ga0265318_10031803 | |||
| 1499 | Ga0307515_10028681 | |||
| 1500 | Ga0307515_10310721 | |||
| 1501 | Ga0307515_10436974 | |||
| 1502 | Ga0265338_10017926 | |||
| 1503 | Ga0265338_10074316 | |||
| 1504 | Ga0265338_10083360 | |||
| 1505 | Ga0265338_10239249 | |||
| 1506 | Ga0307511_10004421 | |||
| 1507 | Ga0265762_1033034 | |||
| 1508 | Ga0265763_1015060 | |||
| 1509 | Ga0265760_10006487 | |||
| 1510 | Ga0265328_10023735 | |||
| 1511 | Ga0265320_10007320 | |||
| 1512 | Ga0265320_10101299 | |||
| 1513 | Ga0265325_10012737 | |||
| 1514 | Ga0265329_10002758 | |||
| 1515 | Ga0265329_10019973 | |||
| 1516 | Ga0265340_10025562 | |||
| 1517 | Ga0265340_10026707 | |||
| 1518 | Ga0265340_10040502 | |||
| 1519 | Ga0265340_10109488 | |||
| 1520 | Ga0265340_10190806 | |||
| 1521 | Ga0265339_10029521 | |||
| 1522 | Ga0265331_10001286 | |||
| 1523 | Ga0265331_10035450 | |||
| 1524 | Ga0265331_10279732 | |||
| 1525 | Ga0307513_10005147 | |||
| 1526 | Ga0307513_10015166 | |||
| 1527 | Ga0307513_10026731 | |||
| 1528 | Ga0307513_10116966 | |||
| 1529 | Ga0307513_10489377 | |||
| 1530 | Ga0307509_10026777 | |||
| 1531 | Ga0307509_10214636 | |||
| 1532 | Ga0307408_100165324 | |||
| 1533 | Ga0307408_100179502 | |||
| 1534 | Ga0265313_10008984 | |||
| 1535 | Ga0265313_10091448 | |||
| 1536 | Ga0307508_10151915 | |||
| 1537 | Ga0307514_10116549 | |||
| 1538 | Ga0265314_10011743 | |||
| 1539 | Ga0265342_10008972 | |||
| 1540 | Ga0316578_10219494 | |||
| 1541 | Ga0307516_10001401 | |||
| 1542 | Ga0307516_10203704 | |||
| 1543 | Ga0307405_10198099 | |||
| 1544 | Ga0307405_10623210 | |||
| 1545 | Ga0307405_11038935 | |||
| 1546 | Ga0316577_10328070 | |||
| 1547 | Ga0307413_10007661 | |||
| 1548 | Ga0307413_10012589 | |||
| 1549 | Ga0307413_10121029 | |||
| 1550 | Ga0307413_10240831 | |||
| 1551 | Ga0307410_10021366 | |||
| 1552 | Ga0307410_10210867 | |||
| 1553 | Ga0307410_10525034 | |||
| 1554 | Ga0307410_11008764 | |||
| 1555 | Ga0307406_10049114 | |||
| 1556 | Ga0307406_11277973 | |||
| 1557 | Ga0307407_10047569 | |||
| 1558 | Ga0307407_10067651 | |||
| 1559 | Ga0307407_10142704 | |||
| 1560 | Ga0307407_10624920 | |||
| 1561 | Ga0307412_10128089 | |||
| 1562 | Ga0307412_11236217 | |||
| 1563 | Ga0307409_100009013 | |||
| 1564 | Ga0307409_100009487 | |||
| 1565 | Ga0307409_100034452 | |||
| 1566 | Ga0307409_100334793 | |||
| 1567 | Ga0307409_100397179 | |||
| 1568 | Ga0307409_100420844 | |||
| 1569 | Ga0307409_101037512 | |||
| 1570 | Ga0307416_100008715 | |||
| 1571 | Ga0307416_100171510 | |||
| 1572 | Ga0307416_100185637 | |||
| 1573 | Ga0307416_100792702 | |||
| 1574 | Ga0307416_100897966 | |||
| 1575 | Ga0307414_10241053 | |||
| 1576 | Ga0307411_10000609 | |||
| 1577 | Ga0307415_100151585 | |||
| 1578 | Ga0307510_10000001 | |||
| 1579 | Ga0307510_10032614 | |||
| 1580 | Ga0373936_0190135 | |||
| 1581 | Ga0373956_0069467 | |||
| 1582 | Ga0373956_0287881 | |||
| 1583 | Ga0373957_0032331 | |||
| 1584 | Ga0373946_0086965 | |||
| 1585 | Ga0373955_0386764 | |||
| 1586 | Ga0316574_0085744 | |||
| 1587 | Ga0316574_0111807 | |||
| 1588 | Ga0316574_0200930 | |||
| 1589 | Ga0373924_0228926 | |||
| 1590 | Ga0373924_0324521 | |||
| 1591 | Ga0373927_0074550 | |||
| 1592 | Ga0373927_0182721 | |||
| 1593 | Ga0373933_0029416 | |||
| 1594 | Ga0373933_0161910 | |||
| 1595 | Ga0373947_0020123 | |||
| 1596 | Ga0373937_0002558 | |||
| 1597 | Ga0373937_0137059 | |||
| 1598 | Ga0373937_0228660 | |||
| 1599 | Ga0373937_0231271 | |||
| 1600 | Ga0373937_0280442 | |||
| 1601 | Ga0373937_0417777 | |||
| 1602 | Ga0373937_0555222 | |||
| 1603 | Ga0316584_0041810 | |||
| 1604 | Ga0373925_0135044 | |||
| 1605 | Ga0395898_0006256 | |||
| 1606 | Ga0395905_1322085 | |||
| 1607 | Ga0436365_1315948 | |||
| 1608 | Ga0436365_1863591 | |||
| 1609 | Ga0436360_0209535 | |||
| 1610 | Ga0436360_0304140 | |||
| 1611 | Ga0436360_0330103 | |||
| 1612 | Ga0436360_0497289 | |||
| 1613 | Ga0436361_0084531 | |||
| 1614 | Ga0436363_0142927 | |||
| 1615 | Ga0436363_0644535 | |||
| 1616 | Ga0436363_1089212 | |||
| 1617 | Ga0436363_1139935 | |||
| 1618 | Ga0436362_0980315 | |||
| 1619 | Ga0436362_1202716 | |||
| 1620 | Ga0451807_0200745 | |||
| 1621 | Ga0451807_0415911 | |||
| 1622 | Ga0451807_2061194 | |||
| 1623 | Ga0451833_0220826 | |||
| 1624 | Ga0451835_0465860 | |||
| 1625 | Ga0451837_1119479 | |||
| 1626 | Ga0439431_0041826 | |||
| 1627 | Ga0439431_0075207 | |||
| 1628 | Ga0439433_0007127 | |||
| 1629 | Ga0450914_013388 | |||
| 1630 | Ga0450919_012547 | |||
| 1631 | Ga0450920_018481 | |||
| 1632 | Ga0450921_011596 | |||
| 1633 | Ga0450923_002135 | |||
| 1634 | Ga0450923_079877 | |||
| 1635 | Ga0450897_012339 | |||
| 1636 | Ga0450895_001082 | |||
| 1637 | Ga0450896_008050 | |||
| 1638 | Ga0450907_014141 | |||
| 1639 | Ga0450910_003152 | |||
| 1640 | Ga0450910_020685 | |||
| 1641 | Ga0439446_0005967 | |||
| 1642 | Ga0439446_0010025 | |||
| 1643 | Ga0450908_006105 | |||
| 1644 | Ga0450908_010278 | |||
| 1645 | Ga0439434_0006875 | |||
| 1646 | Ga0439435_0000245 | |||
| 1647 | Ga0439444_0012984 | |||
| 1648 | Ga0439444_0022008 | |||
| 1649 | Ga0450918_007532 | |||
| 1650 | Ga0451577_0021340 | |||
| 1651 | Ga0451577_0478066 | |||
| 1652 | Ga0466969_0001467 | |||
| 1653 | Ga0466969_0006521 | |||
| 1654 | Ga0466969_0093037 | |||
| 1655 | Ga0466965_0162995 | |||
| 1656 | Ga0466966_0004272 | |||
| 1657 | Ga0466966_0321157 | |||
| 1658 | Ga0466966_0396431 | |||
| 1659 | Ga0466961_0001905 | |||
| 1660 | Ga0466961_0347004 | |||
| 1661 | Ga0466964_0001076 | |||
| 1662 | Ga0453684_0008627 | |||
| 1663 | Ga0453684_0232370 | |||
| 1664 | Ga0453684_0404282 | |||
| 1665 | Ga0466971_0000737 | |||
| 1666 | Ga0466968_0080781 | |||
| 1667 | Ga0466970_0001269 | |||
| 1668 | Ga0466970_0166892 | |||
| 1669 | Ga0466957_0248159 | |||
| 1670 | Ga0466960_0157434 | |||
| 1671 | Ga0466959_0007191 | |||
| 1672 | Ga0466959_0009745 | |||
| 1673 | Ga0466959_0022809 | |||
| 1674 | Ga0466959_0037627 | |||
| 1675 | Ga0466959_0077862 | |||
| 1676 | Ga0466959_0414775 | |||
| 1677 | Ga0451576_0021430 | |||
| 1678 | Ga0451576_0656038 | |||
| 1679 | Ga0466958_0061397 | |||
| 1680 | Ga0466958_0175862 | |||
| 1681 | Ga0466967_0400934 | |||
| 1682 | Ga0495638_0445770 | |||
| 1683 | Ga0495580_0144857 | |||
| 1684 | Ga0495580_0150213 | |||
| 1685 | Ga0495582_0213211 | |||
| 1686 | Ga0495582_0541284 | |||
| 1687 | Ga0495596_0087142 | |||
| 1688 | Ga0495596_0144020 | |||
| 1689 | Ga0495583_0064792 | |||
| 1690 | Ga0495628_0743997 | |||
| 1691 | Ga0495630_0100180 | |||
| 1692 | Ga0495632_0033474 | |||
| 1693 | Ga0495632_0043799 | |||
| 1694 | Ga0495632_0101351 | |||
| 1695 | Ga0495632_0197037 | |||
| 1696 | Ga0495642_0060249 | |||
| 1697 | Ga0495598_0018223 | |||
| 1698 | Ga0495621_0004951 | |||
| 1699 | Ga0495656_0467301 | |||
| 1700 | Ga0495668_0356453 | |||
| 1701 | Ga0495625_0022072 | |||
| 1702 | Ga0495625_0096122 | |||
| 1703 | Ga0495625_0352662 | |||
| 1704 | Ga0495635_0253168 | |||
| 1705 | Ga0495659_0064846 | |||
| 1706 | Ga0495647_0031507 | |||
| 1707 | Ga0495658_0248749 | |||
| 1708 | Ga0495658_0388066 | |||
| 1709 | Ga0495658_0508973 | |||
| 1710 | Ga0495613_0217796 | |||
| 1711 | Ga0495671_0344552 | |||
| 1712 | Ga0495649_0023794 | |||
| 1713 | Ga0495604_0534276 | |||
| 1714 | Ga0495674_0844043 | |||
| 1715 | Ga0495683_0257808 | |||
| 1716 | Ga0495687_029427 | |||
| 1717 | Ga0495687_083927 | |||
| 1718 | Ga0495675_0646546 | |||
| 1719 | Ga0495681_0067271 | |||
| 1720 | Ga0495686_0114592 | |||
| 1721 | Ga0495686_0238726 | |||
| 1722 | Ga0495686_0342888 | |||
| 1723 | Ga0495626_0152578 | |||
| 1724 | Ga0496100_0075121 | |||
| 1725 | Ga0496100_0132310 | |||
| 1726 | Ga0496100_0617633 | |||
| 1727 | Ga0496101_0042108 | |||
| 1728 | Ga0496101_0048076 | |||
| 1729 | Ga0496102_0012836 | |||
| 1730 | Ga0496102_1108043 | |||
| 1731 | Ga0496103_0073759 | |||
| 1732 | Ga0496103_0094125 | |||
| 1733 | Ga0496104_0022861 | |||
| 1734 | Ga0496104_0173515 | |||
| 1735 | Ga0496104_0536410 | |||
| 1736 | Ga0496105_0024795 | |||
| 1737 | Ga0496105_0075341 | |||
| 1738 | Ga0496105_1036727 | |||
| 1739 | Ga0496106_0012245 | |||
| 1740 | Ga0496106_0505891 | |||
| 1741 | Ga0496107_0028268 | |||
| 1742 | Ga0496107_0144351 | |||
| 1743 | Ga0496107_0160540 | |||
| 1744 | Ga0496108_0008084 | |||
| 1745 | Ga0496109_0068484 | |||
| 1746 | Ga0496109_0142485 | |||
| 1747 | Ga0496109_0571643 | |||
| 1748 | Ga0496110_0010275 | |||
| 1749 | Ga0496110_0010653 | |||
| 1750 | Ga0496111_0035338 | |||
| 1751 | Ga0496111_0051294 | |||
| 1752 | Ga0496112_0018154 | |||
| 1753 | Ga0496112_0079411 | |||
| 1754 | Ga0496113_0080623 | |||
| 1755 | Ga0496114_0002253 | |||
| 1756 | Ga0496114_0015278 | |||
| 1757 | Ga0496114_0106016 | |||
| 1758 | Ga0496115_0042802 | |||
| 1759 | Ga0496115_0116791 | |||
| 1760 | Ga0496115_0341437 | |||
| 1761 | Ga0496117_0000341 | |||
| 1762 | Ga0496118_0000040 | |||
| 1763 | Ga0496118_0263199 | |||
| 1764 | Ga0496119_0014519 | |||
| 1765 | Ga0496119_0016541 | |||
| 1766 | Ga0496120_0000997 | |||
| 1767 | Ga0496120_0090430 | |||
| 1768 | Ga0496121_0000461 | |||
| 1769 | Ga0496121_0240282 | |||
| 1770 | Ga0496121_0493981 | |||
| 1771 | Ga0496124_0036797 | |||
| 1772 | Ga0496125_0004912 | |||
| 1773 | Ga0496125_0009060 | |||
| 1774 | Ga0496125_0078275 | |||
| 1775 | Ga0496126_0031649 | |||
| 1776 | Ga0496126_1138595 | |||
| 1777 | Ga0495678_127255 | |||
| 1778 | Ga0501031_0029207 | |||
| 1779 | Ga0501031_0157068 | |||
| 1780 | Ga0501031_0220589 | |||
| 1781 | Ga0501032_0019143 | |||
| 1782 | Ga0501032_0140896 | |||
| 1783 | Ga0501032_0352588 | |||
| 1784 | Ga0501033_0123097 | |||
| 1785 | Ga0501033_0127278 | |||
| 1786 | Ga0501033_0183306 | |||
| 1787 | Ga0501034_0477741 | |||
| 1788 | Ga0501036_0013643 | |||
| 1789 | Ga0501036_0016284 | |||
| 1790 | Ga0501036_0310462 | |||
| 1791 | Ga0501037_0184996 | |||
| 1792 | Ga0501037_0280022 | |||
| 1793 | Ga0501037_0281207 | |||
| 1794 | Ga0501037_0529999 | |||
| 1795 | Ga0501038_0002611 | |||
| 1796 | Ga0501038_0075910 | |||
| 1797 | Ga0501038_0193763 | |||
| 1798 | Ga0501038_0993515 | |||
| 1799 | Ga0501039_0002347 | |||
| 1800 | Ga0501039_0095049 | |||
| 1801 | Ga0501039_0260002 | |||
| 1802 | Ga0501039_0347964 | |||
| 1803 | Ga0501040_0004324 | |||
| 1804 | Ga0501040_0401408 | |||
| 1805 | Ga0501040_0440003 | |||
| 1806 | Ga0501041_0006421 | |||
| 1807 | Ga0501041_0013343 | |||
| 1808 | Ga0501041_0016384 | |||
| 1809 | Ga0501042_0002141 | |||
| 1810 | Ga0501042_0074623 | |||
| 1811 | Ga0501042_0281667 | |||
| 1812 | Ga0501043_0294335 | |||
| 1813 | Ga0501046_0084907 | |||
| 1814 | Ga0501048_0013872 | |||
| 1815 | Ga0501048_0017825 | |||
| 1816 | Ga0501048_0596132 | |||
| 1817 | Ga0501067_0012686 | |||
| 1818 | Ga0501067_0225867 | |||
| 1819 | Ga0501068_0118061 | |||
| 1820 | Ga0501068_0130057 | |||
| 1821 | Ga0501068_0318620 | |||
| 1822 | Ga0501069_0146749 | |||
| 1823 | Ga0501070_0005151 | |||
| 1824 | Ga0501070_0135216 | |||
| 1825 | Ga0501070_0436855 | |||
| 1826 | Ga0501071_0004887 | |||
| 1827 | Ga0501071_0005655 | |||
| 1828 | Ga0501071_0006895 | |||
| 1829 | Ga0501071_0067646 | |||
| 1830 | Ga0501071_0090311 | |||
| 1831 | Ga0501071_0837341 | |||
| 1832 | Ga0501072_0023119 | |||
| 1833 | Ga0501072_0039804 | |||
| 1834 | Ga0501072_0570846 | |||
| 1835 | Ga0501073_0000202 | |||
| 1836 | Ga0501073_0028276 | |||
| 1837 | Ga0501073_0702830 | |||
| 1838 | Ga0501074_0006548 | |||
| 1839 | Ga0501074_0013983 | |||
| 1840 | Ga0501074_0101629 | |||
| 1841 | Ga0501074_0141516 | |||
| 1842 | Ga0501074_0186788 | |||
| 1843 | Ga0501074_1169989 | |||
| 1844 | Ga0501075_0011703 | |||
| 1845 | Ga0501075_0025965 | |||
| 1846 | Ga0501075_0083749 | |||
| 1847 | Ga0501075_0092733 | |||
| 1848 | Ga0501075_0126212 | |||
| 1849 | Ga0501075_0129317 | |||
| 1850 | Ga0501076_0035862 | |||
| 1851 | Ga0501076_0103350 | |||
| 1852 | Ga0501076_0315008 | |||
| 1853 | Ga0501076_0355048 | |||
| 1854 | Ga0501076_0355791 | |||
| 1855 | Ga0501076_0370494 | |||
| 1856 | Ga0501076_0444216 | |||
| 1857 | Ga0501077_0002457 | |||
| 1858 | Ga0501077_0008720 | |||
| 1859 | Ga0501077_0013443 | |||
| 1860 | Ga0501243_027713 | |||
| 1861 | Ga0501079_0011222 | |||
| 1862 | Ga0501079_0012685 | |||
| 1863 | Ga0501079_0029064 | |||
| 1864 | Ga0501079_0082594 | |||
| 1865 | Ga0501079_0171940 | |||
| 1866 | Ga0501079_0477141 | |||
| 1867 | Ga0501079_0524786 | |||
| 1868 | Ga0501079_0584189 | |||
| 1869 | Ga0501080_0002270 | |||
| 1870 | Ga0501080_0003157 | |||
| 1871 | Ga0501080_0076430 | |||
| 1872 | Ga0501080_0098382 | |||
| 1873 | Ga0501080_0234231 | |||
| 1874 | Ga0501080_0607267 | |||
| 1875 | Ga0501080_0854357 | |||
| 1876 | Ga0501080_0944725 | |||
| 1877 | Ga0501081_0002191 | |||
| 1878 | Ga0501081_0007052 | |||
| 1879 | Ga0501081_0022448 | |||
| 1880 | Ga0501081_0028333 | |||
| 1881 | Ga0501081_0206837 | |||
| 1882 | Ga0501081_0231163 | |||
| 1883 | Ga0501081_0746194 | |||
| 1884 | Ga0501083_0006614 | |||
| 1885 | Ga0501083_0237445 | |||
| 1886 | Ga0501035_0046446 | |||
| 1887 | Ga0501035_0205772 | |||
| 1888 | Ga0501035_0238705 | |||
| 1889 | Ga0501045_0000225 | |||
| 1890 | Ga0501045_0003148 | |||
| 1891 | Ga0501045_0120295 | |||
| 1892 | Ga0501045_0629978 | |||
| 1893 | nmdc:mga0k408_763374_c1 | |||
| 1894 | nmdc:mga0qj67_574099_c1 | |||
| 1895 | nmdc:mga08y16_222381_c1 | |||
| 1896 | nmdc:mga0n895_27894_c1 | |||
| 1897 | nmdc:mga0rr50_450629_c1 | |||
| 1898 | nmdc:mga08x19_38560_c1 | |||
| 1899 | nmdc:mga0a205_603_c1 | |||
| 1900 | Ga0495601_0452030 | |||
| 1901 | Ga0495601_0557967 | |||
| 1902 | Ga0495612_0242415 | |||
| 1903 | Ga0495619_0051305 | |||
| 1904 | Ga0500583_0035637 | |||
| 1905 | Ga0500556_0001072 | |||
| 1906 | Ga0500556_0100145 | |||
| 1907 | Ga0500562_077440 | |||
| 1908 | Ga0500572_005400 | |||
| 1909 | Ga0500617_114342 | |||
| 1910 | Ga0500658_0126317 | |||
| 1911 | Ga0500658_0199248 | |||
| 1912 | Ga0500658_0249296 | |||
| 1913 | Ga0500568_0032769 | |||
| 1914 | Ga0500588_0144609 | |||
| 1915 | Ga0500616_0000569 | |||
| 1916 | Ga0500616_0035735 | |||
| 1917 | Ga0500622_0052293 | |||
| 1918 | Ga0500636_0153639 | |||
| 1919 | Ga0500637_0008200 | |||
| 1920 | Ga0500637_0021322 | |||
| 1921 | Ga0500637_0128147 | |||
| 1922 | Ga0500611_031509 | |||
| 1923 | Ga0501084_0008361 | |||
| 1924 | Ga0501084_0051730 | |||
| 1925 | Ga0501084_0071640 | |||
| 1926 | Ga0501084_0307293 | |||
| 1927 | Ga0501084_0589772 | |||
| 1928 | Ga0501082_0003957 | |||
| 1929 | Ga0501082_0007102 | |||
| 1930 | Ga0501082_0007945 | |||
| 1931 | Ga0501082_0056300 | |||
| 1932 | Ga0501082_0142707 | |||
| 1933 | Ga0501082_0595593 | |||
| 1934 | Ga0466962_0001942 | |||
| 1935 | Ga0530510_0091703 | |||
| 1936 | Ga0530510_0096465 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6r7p-assembly1.cif.gz_A | crystal structure of oxidized aquifex aeolicus nadh-quinone oxidoreductase subunits nuoe and nuof s96m | 0.919 | 13 | 168 |
| 6q9g-assembly1.cif.gz_A | crystal structure of reduced aquifex aeolicus nadh-quinone oxidoreductase subunits nuoe g129d and nuof bound to nadh | 0.9155 | 13 | 168 |
| 6q9j-assembly1.cif.gz_A | crystal structure of reduced aquifex aeolicus nadh-quinone oxidoreductase subunits nuoe g129s and nuof bound to nadh | 0.9143 | 13 | 168 |
| 6q9g-assembly1.cif.gz_A | crystal structure of reduced aquifex aeolicus nadh-quinone oxidoreductase subunits nuoe g129d and nuof bound to nadh | 0.899 | 13 | 168 |
| 6q9j-assembly1.cif.gz_A | crystal structure of reduced aquifex aeolicus nadh-quinone oxidoreductase subunits nuoe g129s and nuof bound to nadh | 0.8925 | 13 | 168 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9D6J6_126_223_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9492 | 85 | 166 | 3.40.30.10 |
| af_P0AFD1_83_165_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9467 | 84 | 165 | 3.40.30.10 |
| af_P0AFD1_13_82_1.10.10.1590 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;NADH-quinone oxidoreductase subunit E | 0.9402 | 13 | 83 | 1.10.10.1590 |
| 3iamB01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;NADH-quinone oxidoreductase subunit E | 0.9254 | 21 | 84 | 1.10.10.1590 |
| 2fug201 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;NADH-quinone oxidoreductase subunit E | 0.9249 | 21 | 84 | 1.10.10.1590 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A370KAE3-F1-model_v4 | NADH-quinone oxidoreductase subunit E (NADH dehydrogenase I subunit E) (NDH-1 subunit E) | 0.9595 | 12 | 166 |
GO:0003954
GO:0046872 GO:0051537 |
| AF-A0A1Z8X4H1-F1-model_v4 | NADH-quinone oxidoreductase subunit E (NADH dehydrogenase I subunit E) (NDH-1 subunit E) | 0.9449 | 13 | 168 |
GO:0003954
GO:0046872 GO:0051537 |
| AF-A0A0W1RRU9-F1-model_v4 | NADH-quinone oxidoreductase subunit E (NADH dehydrogenase I subunit E) (NDH-1 subunit E) | 0.9414 | 12 | 168 |
GO:0003954
GO:0046872 GO:0051537 |
| AF-A0A2R7QAY4-F1-model_v4 | deleted | 0.9397 | 27 | 166 |
|
| AF-A0A4Q3HU79-F1-model_v4 | deleted | 0.9394 | 11 | 166 |
|