F486879

General Info

Members Datasets Scaffolds Average Seq Length
961 583 790 366

Family's Representative Sequence

Representative Sequence 3300048908|Ga0496105_0008027|Ga0496105_0008027_4691_6025
Length 444
Sequence MTEHGAVRLPGHRRVAYAALFLISNEPSCVNAHTLPSTTAIWRGLCGANLHGANGWGIALSAAMHNSPLSFHRSEVSSMSQTKLFEPFKLGPIMLPNRLVMAPLTRNRAVPPGMVPSPLAADYYGQRASAGLLITEASQVSQQGQGYQDTPGIYSKEQVAGWRKVTDRVHEQGGRIFIQIWHVGRISHDSLQPGGGKPVAPSAIRAKGKTFVNNSFTDISEPRALELSEIPGIIEDFKRGTDNALTAGFDGVEIHGANGYLLDQFAKDGTNQRQDTYGGAIENRARLMLEVSKVVAAVAGPERTGIRISPVTPSNDVSDSDPQPLFDYIVDHLNALKLTYIHVVEGATGGPRDIAPFDYGSLRKRFKQAYVANNGYDFELATKVLAADAADLIAFGKPFISNPDLVERLKKGAPLNEPDKATFYGGSAKGYTDYPTLQAAEAAQ

Samples

Sample ID Description Type Environment
1 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2508501050 Microvirga lupini Lut6 Isolate Nodule
4 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
5 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
6 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
7 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
8 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
9 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
10 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
11 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
12 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
13 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
14 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
15 2526164512 Azovibrio restrictus DSM 23866 Isolate Unclassified
16 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
17 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
18 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
19 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
20 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
21 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
22 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
23 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
24 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
25 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
26 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
27 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
28 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
29 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
30 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
31 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
32 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
33 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
34 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
35 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
36 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
37 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
38 2643221583 Caulobacter sp. Root655 Isolate Unclassified
39 2643221584 Caulobacter sp. Root656 Isolate Unclassified
40 2643221640 Caulobacter sp. Root342 Isolate Unclassified
41 2643221642 Caulobacter sp. Root343 Isolate Unclassified
42 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
43 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
44 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
45 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
46 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
47 2773857925 Microvirga vignae BR3299 Isolate Unclassified
48 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
49 2791355199
50 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
51 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
52 2818991435 Caulobacter henricii 536 Isolate Unclassified
53 2818991450 Burkholderia sp. 604 Isolate Unclassified
54 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
55 2818991457 Xanthomonas translucens 569 Isolate Unclassified
56 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
57 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
58 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
59 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
60 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
61 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
62 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
63 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
64 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
65 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
66 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
67 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
68 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
69 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
70 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
71 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
72 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
73 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
74 2857553236 Duganella sp. R-74557 Isolate Unclassified
75 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
76 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
77 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
78 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
79 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
80 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
81 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
82 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
83 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
84 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
85 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
86 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere
87 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
88 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
89 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
90 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
91 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
92 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
93 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
94 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
95 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
96 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
97 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
98 2904699407
99 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
100 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
101 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
102 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
103 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
104 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
105 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
106 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
107 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
108 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
109 2919534386 Rheinheimera pacifica 3879 Isolate Unclassified
110 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
111 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
112 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
113 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
114 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
115 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
116 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
117 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
118 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
119 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
120 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
121 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
122 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
123 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
124 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
125 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
126 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
127 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
128 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
129 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
130 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
131 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
132 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
133 2937539931 Pantoea sp. LS15 Isolate Unclassified
134 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
135 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
136 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
137 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
138 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
139 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
140 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
141 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
142 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
143 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
144 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
145 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
146 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
147 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
148 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
149 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
150 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
151 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
152 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
153 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
154 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
155 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
156 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
157 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
158 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
159 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
160 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
161 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
162 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
163 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
164 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
165 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
166 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
167 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
168 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
169 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
170 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
171 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
172 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
173 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
174 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
175 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
176 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
177 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
178 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
179 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
180 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
181 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
182 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
183 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
184 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
185 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
186 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
187 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
188 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
189 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
190 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
191 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
192 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
193 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
194 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
195 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
196 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
197 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
198 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
199 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
200 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
201 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
202 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
203 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
204 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
205 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
206 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
207 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
208 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
209 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
210 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
211 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
212 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
213 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
214 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
215 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
216 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
217 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
218 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
219 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
220 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
221 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
222 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
223 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
224 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
225 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
226 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
227 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
228 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
229 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
230 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
231 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
232 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
233 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
234 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
235 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
236 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
237 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
238 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
239 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
240 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
241 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
242 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
243 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
244 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
245 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
246 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
247 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
248 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
249 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
250 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
251 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
252 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
253 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
254 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
255 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
256 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
257 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
258 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
259 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
260 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
261 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
262 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
263 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
264 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
291 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
292 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
293 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
294 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
295 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
296 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
297 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
299 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
301 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
302 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
303 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
304 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
305 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
306 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
307 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
308 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
309 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
310 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
311 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
312 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
313 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
314 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
315 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
316 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
317 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
318 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
319 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
320 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
321 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
322 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
323 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
324 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
325 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
326 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
327 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
328 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
329 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
330 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
331 3300029272 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B1.ctno.R1 Metatranscriptome Rhizosphere
332 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
333 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
334 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
335 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
336 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
337 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
338 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
339 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
340 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
341 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
342 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
343 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
344 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
345 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
346 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
347 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
348 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
349 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
350 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
351 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
352 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
353 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
354 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
355 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
356 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
357 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
358 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
359 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
360 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
361 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
362 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
363 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
364 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
365 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
366 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
367 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
368 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
369 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
370 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
371 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
372 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
373 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
374 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
375 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
376 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
377 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
378 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
379 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
380 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
381 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
382 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
383 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
384 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
385 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
386 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
387 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
388 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
389 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
390 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
391 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
392 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
393 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
394 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
395 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
396 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
397 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
398 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
399 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
400 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
401 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
402 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
403 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
404 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
405 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
406 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
407 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
408 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
409 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
410 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
411 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
412 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
413 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
414 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
415 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
416 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
417 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
418 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
419 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
420 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
421 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
422 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
423 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
424 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
425 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
426 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
427 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
428 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
429 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
430 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
431 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
432 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
433 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
434 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
435 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
436 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
437 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
438 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
439 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
440 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
441 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
442 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
443 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
444 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
445 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
446 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
447 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
448 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
449 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
450 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
451 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
452 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
453 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
454 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
455 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
456 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
457 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
458 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
459 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
460 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
461 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
462 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
463 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
464 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
465 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
466 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
467 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
468 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
469 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
470 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
471 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
472 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
473 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
474 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
475 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
476 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
477 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
478 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
479 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
480 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
481 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
482 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
483 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
484 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
485 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
486 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
487 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
488 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
489 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
490 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
491 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
492 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
493 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
494 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
495 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
496 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
497 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
498 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
499 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
500 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
501 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
502 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
503 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
504 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
505 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
506 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
507 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
508 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
509 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
510 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
511 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
512 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
513 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
514 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
515 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
516 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
517 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
518 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
519 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
520 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
521 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
522 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
523 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
524 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
525 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
526 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
527 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
528 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
529 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
530 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
531 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
532 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
533 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
534 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
535 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
536 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
537 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
538 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
539 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
540 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
541 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
542 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
543 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
544 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
545 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
546 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
547 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
548 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
549 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
550 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
551 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
552 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
553 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
554 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
555 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
556 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
557 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
558 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
559 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
560 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
561 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
562 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
563 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
564 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
565 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
566 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
567 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
568 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
569 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
570 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
571 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
572 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
573 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
574 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
575 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
576 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
577 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
578 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
579 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
580 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
581 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
582 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
583 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 81.86
Metatranscriptomes 0.52
Isolates 17.62

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.63
Nodule 8.22
Rhizoplane 4.37
Rhizosphere 52.76
Stem 0
Stem Tuber 0
Unclassified 16.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 RicEn_C518 2010549000 Bacteria 2220
2 SwRhRL2b_contig_1662827 2162886007 Eukaryota 336031
3 SwRhRL2b_contig_6154 2162886007 Eukaryota 43877
4 SwRhRL2b_contig_97404 2162886007 Eukaryota 101106
5 JGI24741J21665_1003369 3300001915 Bacteria 3819
6 JGI24735J21928_10018196 3300002067 Bacteria 2167
7 JGI25162J39368_1000004 3300002737 Bacteria 441040
8 JGI25162J39368_1000045 3300002737 Bacteria 170731
9 JGI25154J39366_1001366 3300002738 Bacteria 8872
10 JGI25163J39215_1002933 3300002771 Bacteria 1520
11 JGI25164J39214_1000026 3300002772 Bacteria 156863
12 JGI25164J39214_1000068 3300002772 Bacteria 103192
13 JGI25406J46586_10002152 3300003203 Bacteria 9320
14 JGI25406J46586_10009106 3300003203 Bacteria 4456
15 JGI25165J46597_1000011 3300003214 Bacteria 441040
16 JGI25165J46597_1000086 3300003214 Bacteria 170731
17 JGI25153J46596_10012255 3300003215 Bacteria 3718
18 JGI25160J50197_1008101 3300003354 Bacteria 4036
19 JGI25404J52841_10005899 3300003659 Bacteria 2542
20 Ga0055537_1005122 3300003773 Bacteria 3576
21 Ga0055524_1008030 3300003775 Bacteria 4419
22 Ga0055536_1000029 3300003781 Bacteria 157375
23 Ga0055536_1000057 3300003781 Bacteria 104652
24 Ga0055528_1003513 3300003790 Bacteria 7817
25 Ga0055530_10000782 3300003791 Bacteria 26513
26 Ga0055530_10005290 3300003791 Bacteria 6200
27 Ga0055531_10000224 3300003794 Bacteria 62709
28 Ga0055531_10001089 3300003794 Bacteria 21336
29 Ga0055531_10007287 3300003794 Bacteria 6067
30 Ga0058692_1000035 3300003856 Bacteria 152983
31 Ga0065165_1000388 3300005262 Bacteria 71380
32 Ga0065165_1003298 3300005262 Bacteria 11602
33 Ga0065704_10000184 3300005289 Eukaryota 889358
34 Ga0065704_10070135 3300005289 Eukaryota 561504
35 Ga0065704_10070149 3300005289 Eukaryota 261744
36 Ga0065704_10071259 3300005289 Bacteria 12164
37 Ga0065707_10000601 3300005295 Eukaryota 17008
38 Ga0065707_10082238 3300005295 Eukaryota 18518
39 Ga0070658_10273991 3300005327 Bacteria 1436
40 Ga0070658_10351784 3300005327 Bacteria 1261
41 Ga0070683_100108542 3300005329 Bacteria 2617
42 Ga0070670_100000381 3300005331 Bacteria 36865
43 Ga0068869_100018161 3300005334 Bacteria 4782
44 Ga0070660_100029057 3300005339 Bacteria 4140
45 Ga0070660_100065528 3300005339 Bacteria 2827
46 Ga0070668_100014209 3300005347 Bacteria 5948
47 Ga0070668_100116895 3300005347 Bacteria 2127
48 Ga0070668_100191174 3300005347 Bacteria 1677
49 Ga0070668_100251240 3300005347 Bacteria 1468
50 Ga0070668_100393502 3300005347 Bacteria 1182
51 Ga0070671_100302100 3300005355 Bacteria 1363
52 Ga0070688_100099877 3300005365 Bacteria 1911
53 Ga0070667_100082075 3300005367 Bacteria 2759
54 Ga0070709_10029531 3300005434 Bacteria 3280
55 Ga0070714_100109933 3300005435 Bacteria 2439
56 Ga0070714_100281586 3300005435 Bacteria 1545
57 Ga0070713_100003582 3300005436 Bacteria 10263
58 Ga0070700_100230948 3300005441 Bacteria 1317
59 Ga0070663_100029661 3300005455 Bacteria 3740
60 Ga0070663_100068533 3300005455 Bacteria 2576
61 Ga0070663_100083158 3300005455 Bacteria 2357
62 Ga0070663_100150615 3300005455 Bacteria 1783
63 Ga0070662_100166060 3300005457 Bacteria 1730
64 Ga0070681_10041650 3300005458 Bacteria 4603
65 Ga0068867_100159777 3300005459 Bacteria 1776
66 Ga0070707_100019638 3300005468 Bacteria 6369
67 Ga0070698_100342813 3300005471 Bacteria 1426
68 Ga0070679_100150029 3300005530 Bacteria 2308
69 Ga0070684_100021103 3300005535 Bacteria 5412
70 Ga0070684_100253361 3300005535 Bacteria 1609
71 Ga0068853_100019889 3300005539 Bacteria 5576
72 Ga0068853_100239471 3300005539 Bacteria 1662
73 Ga0070696_100056433 3300005546 Bacteria 2739
74 Ga0070665_100028381 3300005548 Bacteria 5637
75 Ga0070665_100055243 3300005548 Bacteria 3982
76 Ga0070665_100120791 3300005548 Bacteria 2621
77 Ga0070665_100123491 3300005548 Bacteria 2591
78 Ga0068855_100080153 3300005563 Bacteria 3786
79 Ga0068857_100066095 3300005577 Bacteria 3217
80 Ga0068857_100073207 3300005577 Bacteria 3052
81 Ga0068857_100207714 3300005577 Bacteria 1786
82 Ga0068854_100046308 3300005578 Bacteria 3096
83 Ga0068856_100197340 3300005614 Bacteria 2027
84 Ga0068856_100239578 3300005614 Bacteria 1829
85 Ga0068852_100096080 3300005616 Bacteria 2662
86 Ga0068852_100447594 3300005616 Bacteria 1278
87 Ga0068852_100456904 3300005616 Bacteria 1265
88 Ga0068859_100347130 3300005617 Bacteria 1579
89 Ga0068861_100015843 3300005719 Bacteria 5322
90 Ga0068858_100100089 3300005842 Bacteria 2703
91 Ga0068860_100214774 3300005843 Bacteria 1866
92 Ga0068862_100133564 3300005844 Bacteria 2197
93 Ga0081455_10014613 3300005937 Bacteria 7682
94 Ga0081455_10015176 3300005937 Bacteria 7496
95 Ga0081455_10021871 3300005937 Bacteria 5991
96 Ga0081455_10022224 3300005937 Bacteria 5933
97 Ga0081455_10083293 3300005937 Bacteria 2614
98 Ga0081455_10115887 3300005937 Bacteria 2120
99 Ga0081540_1002523 3300005983 Bacteria 14863
100 Ga0081540_1003176 3300005983 Bacteria 13110
101 Ga0081540_1005385 3300005983 Bacteria 9567
102 Ga0081540_1005561 3300005983 Bacteria 9385
103 Ga0081540_1008122 3300005983 Bacteria 7368
104 Ga0081540_1014063 3300005983 Bacteria 5157
105 Ga0081540_1014150 3300005983 Bacteria 5134
106 Ga0081540_1023692 3300005983 Bacteria 3583
107 Ga0081539_10001660 3300005985 Bacteria 36067
108 Ga0081539_10022424 3300005985 Bacteria 4178
109 Ga0081539_10119889 3300005985 Bacteria 1309
110 Ga0070717_10001217 3300006028 Bacteria 17468
111 Ga0075365_10039539 3300006038 Bacteria 3071
112 Ga0075365_10135234 3300006038 Bacteria 1708
113 Ga0075363_100086334 3300006048 Bacteria 1723
114 Ga0075364_10035474 3300006051 Bacteria 3223
115 Ga0075364_10113433 3300006051 Bacteria 1810
116 Ga0070712_100024239 3300006175 Bacteria 4018
117 Ga0075367_10037970 3300006178 Bacteria 2801
118 Ga0075367_10064332 3300006178 Bacteria 2194
119 Ga0075369_10044782 3300006186 Bacteria 1901
120 Ga0075366_10002966 3300006195 Bacteria 8834
121 Ga0075366_10099370 3300006195 Bacteria 1746
122 Ga0097621_100173302 3300006237 Bacteria 1861
123 Ga0075370_10062061 3300006353 Bacteria 2129
124 Ga0075428_100508497 3300006844 Bacteria 1289
125 Ga0075434_100059477 3300006871 Bacteria 3799
126 Ga0068865_100115100 3300006881 Bacteria 1990
127 Ga0068865_100150062 3300006881 Bacteria 1767
128 Ga0097620_100347112 3300006931 Bacteria 1579
129 Ga0105251_10000029 3300009011 Bacteria 125097
130 Ga0105250_10033976 3300009092 Bacteria 2047
131 Ga0105240_10035272 3300009093 Bacteria 6447
132 Ga0105240_10036633 3300009093 Bacteria 6308
133 Ga0105240_10179384 3300009093 Bacteria 2501
134 Ga0111539_10166484 3300009094 Bacteria 2577
135 Ga0105245_10333372 3300009098 Bacteria 1498
136 Ga0105247_10151573 3300009101 Bacteria 1528
137 Ga0105241_10017520 3300009174 Bacteria 5266
138 Ga0105248_10039476 3300009177 Bacteria 5288
139 Ga0105248_10104757 3300009177 Bacteria 3189
140 Ga0105248_10186033 3300009177 Bacteria 2340
141 Ga0105248_10242173 3300009177 Bacteria 2030
142 Ga0105237_10017551 3300009545 Bacteria 7416
143 Ga0105237_10068296 3300009545 Bacteria 3548
144 Ga0105237_10086943 3300009545 Bacteria 3116
145 Ga0105237_10094860 3300009545 Bacteria 2972
146 Ga0105238_10001423 3300009551 Bacteria 23977
147 Ga0105238_10014292 3300009551 Bacteria 8025
148 Ga0105238_10112067 3300009551 Bacteria 2708
149 Ga0123342_1000436 3300009766 Bacteria 65465
150 Ga0105239_10279610 3300010375 Bacteria 1879
151 Ga0157373_10032751 3300013100 Bacteria 3740
152 Ga0157371_10038427 3300013102 Bacteria 3424
153 Ga0157371_10165754 3300013102 Bacteria 1578
154 Ga0157370_10023701 3300013104 Bacteria 6091
155 Ga0157370_10115912 3300013104 Bacteria 2502
156 Ga0157369_10015529 3300013105 Bacteria 8581
157 Ga0157369_10064533 3300013105 Bacteria 3943
158 Ga0157378_10438857 3300013297 Bacteria 1294
159 Ga0157372_10059579 3300013307 Bacteria 4270
160 Ga0157372_10194448 3300013307 Bacteria 2350
161 Ga0157372_10284961 3300013307 Bacteria 1921
162 Ga0163163_10257548 3300014325 Bacteria 1796
163 Ga0157380_10015078 3300014326 Bacteria 5671
164 Ga0182008_10004315 3300014497 Bacteria 8325
165 Ga0182008_10007005 3300014497 Bacteria 6250
166 Ga0182007_10036008 3300015262 Bacteria 1667
167 Ga0182005_1002698 3300015265 Bacteria 6225
168 Ga0163161_10081274 3300017792 Bacteria 2386
169 Ga0206353_12029745 3300020082 Bacteria 2412
170 Ga0213872_10012639 3300021361 Bacteria 3968
171 Ga0213872_10047577 3300021361 Bacteria 1950
172 Ga0213872_10080224 3300021361 Bacteria 1466
173 Ga0224712_10039317 3300022467 Bacteria 1773
174 Ga0209435_100119 3300025206 Bacteria 28975
175 Ga0209760_100019 3300025207 Bacteria 170806
176 Ga0209760_100105 3300025207 Bacteria 64565
177 Ga0209563_103827 3300025230 Bacteria 3015
178 Ga0207427_100003 3300025231 Bacteria 1035004
179 Ga0207427_100011 3300025231 Bacteria 640076
180 Ga0209437_100002 3300025233 Bacteria 1574801
181 Ga0209437_100044 3300025233 Bacteria 430619
182 Ga0209646_1000240 3300025246 Bacteria 56884
183 Ga0209026_1005028 3300025250 Bacteria 3695
184 Ga0209677_101307 3300025253 Bacteria 11045
185 Ga0209677_106649 3300025253 Bacteria 2678
186 Ga0209148_1004413 3300025254 Bacteria 3474
187 Ga0209759_1000312 3300025256 Bacteria 65707
188 Ga0209233_1000004 3300025261 Bacteria 1574798
189 Ga0209233_1000057 3300025261 Bacteria 430619
190 Ga0209565_1002635 3300025263 Bacteria 6321
191 Ga0209455_1001894 3300025272 Bacteria 8695
192 Ga0209673_1000676 3300025273 Bacteria 49256
193 Ga0209675_1002010 3300025291 Bacteria 10900
194 Ga0209676_1000031 3300025292 Bacteria 478976
195 Ga0209676_1000057 3300025292 Bacteria 361061
196 Ga0209564_1000383 3300025295 Bacteria 81061
197 Ga0209564_1000602 3300025295 Bacteria 56176
198 Ga0209564_1000808 3300025295 Bacteria 42867
199 Ga0209564_1028884 3300025295 Bacteria 1759
200 Ga0209758_1000410 3300025297 Bacteria 72955
201 Ga0209758_1000455 3300025297 Bacteria 68279
202 Ga0209758_1002273 3300025297 Bacteria 19899
203 Ga0209758_1004548 3300025297 Bacteria 11456
204 Ga0209050_1000087 3300025298 Bacteria 261460
205 Ga0209050_1000096 3300025298 Bacteria 240109
206 Ga0209050_1002308 3300025298 Bacteria 16789
207 Ga0209256_1001507 3300025299 Bacteria 23585
208 Ga0209256_1002695 3300025299 Bacteria 13873
209 Ga0207426_1005676 3300025302 Bacteria 5636
210 Ga0207426_1016572 3300025302 Bacteria 2641
211 Ga0209051_1002485 3300025303 Bacteria 13150
212 Ga0209051_1031286 3300025303 Bacteria 2050
213 Ga0209257_1000050 3300025304 Bacteria 439325
214 Ga0209257_1000687 3300025304 Bacteria 52593
215 Ga0209257_1007754 3300025304 Bacteria 6386
216 Ga0209257_1022124 3300025304 Bacteria 2280
217 Ga0207697_10080544 3300025315 Bacteria 1372
218 Ga0207713_1000112 3300025735 Bacteria 133341
219 Ga0207713_1007845 3300025735 Bacteria 6224
220 Ga0207692_10103793 3300025898 Bacteria 1565
221 Ga0207642_10017501 3300025899 Bacteria 2728
222 Ga0207688_10075190 3300025901 Bacteria 1922
223 Ga0207688_10097512 3300025901 Bacteria 1694
224 Ga0207647_10015412 3300025904 Bacteria 5240
225 Ga0207647_10021272 3300025904 Bacteria 4333
226 Ga0207699_10049526 3300025906 Bacteria 2473
227 Ga0207705_10007528 3300025909 Bacteria 8002
228 Ga0207705_10080810 3300025909 Bacteria 2369
229 Ga0207684_10132220 3300025910 Bacteria 2142
230 Ga0207654_10062017 3300025911 Bacteria 2189
231 Ga0207707_10000183 3300025912 Bacteria 65793
232 Ga0207707_10041289 3300025912 Bacteria 4029
233 Ga0207707_10044334 3300025912 Bacteria 3879
234 Ga0207695_10016375 3300025913 Bacteria 8676
235 Ga0207695_10104297 3300025913 Bacteria 2825
236 Ga0207695_10202932 3300025913 Bacteria 1896
237 Ga0207671_10018896 3300025914 Bacteria 5280
238 Ga0207671_10100908 3300025914 Bacteria 2186
239 Ga0207663_10026638 3300025916 Bacteria 3359
240 Ga0207663_10051485 3300025916 Bacteria 2564
241 Ga0207660_10149496 3300025917 Bacteria 1793
242 Ga0207657_10016684 3300025919 Bacteria 7077
243 Ga0207657_10054087 3300025919 Bacteria 3473
244 Ga0207649_10025557 3300025920 Bacteria 3444
245 Ga0207652_10016523 3300025921 Bacteria 6027
246 Ga0207652_10030918 3300025921 Bacteria 4491
247 Ga0207646_10066604 3300025922 Bacteria 3216
248 Ga0207681_10132692 3300025923 Bacteria 1844
249 Ga0207694_10013217 3300025924 Bacteria 6215
250 Ga0207694_10186230 3300025924 Bacteria 1685
251 Ga0207650_10000272 3300025925 Bacteria 54462
252 Ga0207700_10057661 3300025928 Bacteria 2930
253 Ga0207664_10243575 3300025929 Bacteria 1567
254 Ga0207644_10038405 3300025931 Bacteria 3373
255 Ga0207690_10079970 3300025932 Bacteria 2280
256 Ga0207706_10178668 3300025933 Bacteria 1864
257 Ga0207709_10004673 3300025935 Bacteria 7877
258 Ga0207704_10193729 3300025938 Bacteria 1481
259 Ga0207691_10073564 3300025940 Bacteria 3082
260 Ga0207689_10009475 3300025942 Bacteria 8408
261 Ga0207689_10092855 3300025942 Bacteria 2479
262 Ga0207689_10249181 3300025942 Bacteria 1469
263 Ga0207661_10045025 3300025944 Bacteria 3489
264 Ga0207679_10222199 3300025945 Bacteria 1590
265 Ga0207667_10003742 3300025949 Bacteria 18759
266 Ga0207667_10010590 3300025949 Bacteria 10770
267 Ga0207667_10027215 3300025949 Bacteria 6230
268 Ga0207667_10053775 3300025949 Bacteria 4236
269 Ga0207667_10177638 3300025949 Bacteria 2187
270 Ga0207667_10404232 3300025949 Bacteria 1390
271 Ga0207712_10164296 3300025961 Bacteria 1729
272 Ga0207668_10002816 3300025972 Bacteria 10172
273 Ga0207668_10017435 3300025972 Bacteria 4500
274 Ga0207668_10142493 3300025972 Bacteria 1845
275 Ga0207640_10004304 3300025981 Bacteria 7707
276 Ga0207640_10008099 3300025981 Bacteria 5817
277 Ga0207677_10209737 3300026023 Bacteria 1555
278 Ga0207639_10144425 3300026041 Bacteria 1986
279 Ga0207678_10001306 3300026067 Bacteria 23107
280 Ga0207678_10028732 3300026067 Bacteria 4854
281 Ga0207678_10077726 3300026067 Bacteria 2843
282 Ga0207678_10085123 3300026067 Bacteria 2703
283 Ga0207678_10128748 3300026067 Bacteria 2159
284 Ga0207678_10174627 3300026067 Bacteria 1835
285 Ga0207708_10162731 3300026075 Bacteria 1763
286 Ga0207702_10175458 3300026078 Bacteria 1969
287 Ga0207641_10064291 3300026088 Bacteria 3136
288 Ga0207674_10014540 3300026116 Bacteria 8690
289 Ga0207674_10072873 3300026116 Bacteria 3449
290 Ga0207674_10223414 3300026116 Bacteria 1831
291 Ga0207675_100026570 3300026118 Bacteria 5390
292 Ga0207675_100043143 3300026118 Bacteria 4212
293 Ga0207675_100170054 3300026118 Bacteria 2083
294 Ga0207683_10022491 3300026121 Bacteria 5412
295 Ga0207698_10040468 3300026142 Bacteria 3464
296 Ga0207698_10042306 3300026142 Bacteria 3402
297 Ga0207698_10113771 3300026142 Bacteria 2275
298 Ga0209281_1000085 3300027111 Bacteria 252561
299 Ga0209389_1000088 3300027296 Bacteria 83578
300 Ga0209371_1000043 3300027312 Bacteria 331009
301 Ga0209589_1000189 3300027357 Bacteria 71403
302 Ga0209489_100085 3300027361 Bacteria 126199
303 Ga0209588_1003169 3300027671 Bacteria 4536
304 Ga0209813_10016262 3300027866 Bacteria 2028
305 Ga0207428_10139564 3300027907 Bacteria 1851
306 Ga0268266_10012198 3300028379 Bacteria 7435
307 Ga0268265_10228551 3300028380 Bacteria 1633
308 Ga0268264_10000038 3300028381 Bacteria 383623
309 Ga0268264_10206188 3300028381 Bacteria 1802
310 Ga0268264_10272720 3300028381 Bacteria 1581
311 Ga0265337_1004626 3300028556 Bacteria 5666
312 Ga0265326_10006100 3300028558 Bacteria 3763
313 Ga0265334_10020336 3300028573 Bacteria 2719
314 Ga0265318_10000846 3300028577 Bacteria 20131
315 Ga0265323_10000726 3300028653 Bacteria 17826
316 Ga0265336_10000228 3300028666 Bacteria 39886
317 Ga0307517_10000512 3300028786 Bacteria 66501
318 Ga0307515_10007488 3300028794 Bacteria 21572
319 Ga0307515_10062357 3300028794 Bacteria 5266
320 Ga0307515_10068026 3300028794 Bacteria 4902
321 Ga0307515_10079159 3300028794 Bacteria 4310
322 Ga0307515_10145562 3300028794 Bacteria 2512
323 Ga0265338_10000116 3300028800 Bacteria 146839
324 Ga0265338_10017804 3300028800 Bacteria 7640
325 Ga0265338_10048129 3300028800 Bacteria 3884
326 Ga0311000_127106 3300029272 Eukaryota 1453
327 Ga0268256_1000044 3300030500 Bacteria 330997
328 Ga0307511_10050496 3300030521 Bacteria 3349
329 Ga0265328_10004639 3300031239 Bacteria 5947
330 Ga0265328_10007218 3300031239 Bacteria 4647
331 Ga0265331_10000007 3300031250 Bacteria 331074
332 Ga0265331_10005934 3300031250 Bacteria 7298
333 Ga0265327_10000429 3300031251 Bacteria 76072
334 Ga0307513_10073302 3300031456 Bacteria 3565
335 Ga0307513_10236593 3300031456 Bacteria 1635
336 Ga0307509_10061128 3300031507 Bacteria 3978
337 Ga0307408_100049313 3300031548 Bacteria 3024
338 Ga0307408_100165005 3300031548 Bacteria 1763
339 Ga0307508_10000008 3300031616 Bacteria 265023
340 Ga0307508_10035397 3300031616 Bacteria 4499
341 Ga0307508_10064347 3300031616 Bacteria 3233
342 Ga0265314_10023323 3300031711 Bacteria 4720
343 Ga0265314_10057045 3300031711 Bacteria 2685
344 Ga0265342_10080579 3300031712 Bacteria 1881
345 Ga0307516_10010586 3300031730 Bacteria 10123
346 Ga0307516_10018988 3300031730 Bacteria 7135
347 Ga0307516_10030771 3300031730 Bacteria 5413
348 Ga0307516_10217765 3300031730 Bacteria 1620
349 Ga0307410_10077073 3300031852 Bacteria 2329
350 Ga0307406_10185700 3300031901 Bacteria 1518
351 Ga0307412_10000482 3300031911 Bacteria 23818
352 Ga0307409_100070475 3300031995 Bacteria 2775
353 Ga0307416_100131430 3300032002 Bacteria 2254
354 Ga0307416_100417741 3300032002 Bacteria 1384
355 Ga0307507_10070227 3300033179 Bacteria 3179
356 Ga0307510_10002929 3300033180 Bacteria 19628
357 Ga0307510_10019030 3300033180 Bacteria 8059
358 Ga0307510_10027729 3300033180 Bacteria 6482
359 Ga0373936_0030603 3300035113 Bacteria 2123
360 Ga0373936_0062284 3300035113 Bacteria 1525
361 Ga0373943_0018990 3300035170 Bacteria 3161
362 Ga0373931_0001380 3300035691 Bacteria 10387
363 Ga0373927_0071970 3300035695 Bacteria 2238
364 Ga0373927_0187110 3300035695 Bacteria 1358
365 Ga0373933_0000122 3300035724 Bacteria 50587
366 Ga0373947_0047992 3300035725 Bacteria 2561
367 Ga0395899_0093094 3300037312 Bacteria 2182
368 Ga0395900_0007038 3300037418 Bacteria 11649
369 Ga0395898_0020988 3300037466 Bacteria 6626
370 Ga0395898_0022680 3300037466 Bacteria 6355
371 Ga0395898_0160685 3300037466 Bacteria 2149
372 Ga0395905_0015842 3300037471 Bacteria 7162
373 Ga0395905_0021485 3300037471 Bacteria 6103
374 Ga0395905_0042321 3300037471 Bacteria 4274
375 Ga0395905_0233499 3300037471 Bacteria 1720
376 Ga0395901_0225213 3300038443 Bacteria 1959
377 Ga0436365_0684116 3300039437 Bacteria 2590
378 Ga0436365_1929134 3300039437 Bacteria 3899
379 Ga0436361_0083862 3300039447 Bacteria 5368
380 Ga0436361_0143038 3300039447 Bacteria 2131
381 Ga0436361_0144287 3300039447 Bacteria 22519
382 Ga0436361_0844316 3300039447 Bacteria 5728
383 Ga0439432_000561 3300042006 Bacteria 13888
384 Ga0450907_000039 3300042146 Bacteria 57175
385 Ga0450910_000003 3300042147 Bacteria 81243
386 Ga0451577_0001823 3300042876 Bacteria 27212
387 Ga0451577_0010147 3300042876 Bacteria 9021
388 Ga0451577_0257295 3300042876 Bacteria 1581
389 Ga0466972_0046781 3300044658 Bacteria 2094
390 Ga0453683_0006678 3300044673 Bacteria 7893
391 Ga0466966_0001211 3300044684 Bacteria 16554
392 Ga0466961_0000122 3300044693 Bacteria 52002
393 Ga0453684_0000149 3300044712 Bacteria 307732
394 Ga0466959_0059685 3300045049 Bacteria 2777
395 Ga0451576_0000237 3300045051 Bacteria 134538
396 Ga0451576_0235814 3300045051 Bacteria 1911
397 Ga0495617_006028 3300046452 Bacteria 4274
398 Ga0495627_000409 3300046453 Bacteria 37928
399 Ga0495590_0019970 3300046457 Bacteria 2382
400 Ga0495591_000277 3300046458 Bacteria 47800
401 Ga0495629_0006452 3300046459 Bacteria 8693
402 Ga0495629_0049926 3300046459 Bacteria 2932
403 Ga0495629_0054618 3300046459 Bacteria 2793
404 Ga0495638_0000925 3300046460 Bacteria 29816
405 Ga0495638_0002042 3300046460 Bacteria 17178
406 Ga0495638_0008938 3300046460 Bacteria 7064
407 Ga0495638_0010262 3300046460 Bacteria 6514
408 Ga0495638_0032056 3300046460 Bacteria 3371
409 Ga0495651_0021716 3300046462 Bacteria 4989
410 Ga0495653_0085305 3300046463 Bacteria 2323
411 Ga0495650_0000017 3300046471 Bacteria 542552
412 Ga0495650_0019672 3300046471 Bacteria 3313
413 Ga0495650_0039486 3300046471 Bacteria 2037
414 Ga0495639_0004138 3300046475 Bacteria 6215
415 Ga0495584_0048245 3300046491 Bacteria 2147
416 Ga0495584_0114703 3300046491 Bacteria 1363
417 Ga0495596_0002019 3300046500 Bacteria 11168
418 Ga0495596_0072654 3300046500 Bacteria 1336
419 Ga0495607_0018140 3300046501 Bacteria 4494
420 Ga0495607_0039949 3300046501 Bacteria 2797
421 Ga0495583_0000029 3300046506 Bacteria 255536
422 Ga0495583_0001522 3300046506 Bacteria 23003
423 Ga0495606_0003391 3300046507 Bacteria 16936
424 Ga0495606_0007581 3300046507 Bacteria 9665
425 Ga0495610_0000097 3300046512 Bacteria 101920
426 Ga0495610_0010921 3300046512 Bacteria 5599
427 Ga0495610_0023461 3300046512 Bacteria 3353
428 Ga0495610_0027197 3300046512 Bacteria 3044
429 Ga0495616_0003043 3300046513 Bacteria 10857
430 Ga0495616_0014457 3300046513 Bacteria 4417
431 Ga0495616_0030467 3300046513 Bacteria 2835
432 Ga0495616_0033632 3300046513 Bacteria 2669
433 Ga0495620_0014369 3300046515 Bacteria 4026
434 Ga0495631_0002855 3300046518 Bacteria 9588
435 Ga0495632_0006114 3300046519 Bacteria 7804
436 Ga0495637_0012290 3300046520 Bacteria 4099
437 Ga0495637_0030844 3300046520 Bacteria 2374
438 Ga0495643_0005173 3300046522 Bacteria 8905
439 Ga0495643_0016140 3300046522 Bacteria 4394
440 Ga0495643_0037760 3300046522 Bacteria 2647
441 Ga0495648_0000495 3300046524 Bacteria 42433
442 Ga0495648_0000509 3300046524 Bacteria 41858
443 Ga0495648_0001607 3300046524 Bacteria 21994
444 Ga0495648_0016824 3300046524 Bacteria 5256
445 Ga0495648_0055323 3300046524 Bacteria 2392
446 Ga0495663_0000307 3300046525 Bacteria 18421
447 Ga0495663_0032132 3300046525 Bacteria 1562
448 Ga0495666_0004144 3300046526 Bacteria 7310
449 Ga0495652_0042749 3300046529 Bacteria 3907
450 Ga0495654_0000012 3300046530 Bacteria 328997
451 Ga0495654_0021826 3300046530 Bacteria 3329
452 Ga0495640_0067970 3300046533 Bacteria 2399
453 Ga0495586_0008705 3300046535 Bacteria 5404
454 Ga0495597_0066941 3300046542 Bacteria 1555
455 Ga0495645_0201583 3300046543 Bacteria 1349
456 Ga0495622_0011074 3300046557 Bacteria 4163
457 Ga0495633_0001936 3300046558 Bacteria 15058
458 Ga0495633_0012386 3300046558 Bacteria 4538
459 Ga0495656_0048636 3300046615 Bacteria 1803
460 Ga0495668_0000019 3300046616 Bacteria 416042
461 Ga0495668_0007251 3300046616 Bacteria 7115
462 Ga0495668_0011144 3300046616 Bacteria 5401
463 Ga0495668_0057388 3300046616 Bacteria 2148
464 Ga0495668_0162188 3300046616 Bacteria 1225
465 Ga0495634_0057587 3300046642 Bacteria 2593
466 Ga0495625_0000186 3300046660 Bacteria 97824
467 Ga0495625_0000249 3300046660 Bacteria 84097
468 Ga0495625_0028434 3300046660 Bacteria 4192
469 Ga0495625_0053208 3300046660 Bacteria 2897
470 Ga0495625_0109462 3300046660 Bacteria 1890
471 Ga0495625_0160496 3300046660 Bacteria 1506
472 Ga0495625_0163747 3300046660 Bacteria 1488
473 Ga0495625_0192628 3300046660 Bacteria 1349
474 Ga0495635_0037712 3300046663 Bacteria 3345
475 Ga0495661_0000037 3300046665 Bacteria 164234
476 Ga0495661_0010073 3300046665 Bacteria 6465
477 Ga0495661_0011696 3300046665 Bacteria 5945
478 Ga0495657_0059608 3300046675 Bacteria 2532
479 Ga0495599_0113410 3300046678 Bacteria 1687
480 Ga0495623_0103107 3300046679 Bacteria 1736
481 Ga0495613_0067625 3300046689 Bacteria 2608
482 Ga0495624_0051230 3300046690 Bacteria 2614
483 Ga0495670_0002289 3300046691 Bacteria 9451
484 Ga0495670_0042320 3300046691 Bacteria 2272
485 Ga0495671_0003635 3300046692 Bacteria 9397
486 Ga0495671_0013022 3300046692 Bacteria 4523
487 Ga0495671_0106821 3300046692 Bacteria 1367
488 Ga0495589_0006983 3300046794 Bacteria 5924
489 Ga0495600_0007723 3300046809 Bacteria 6587
490 Ga0495600_0035921 3300046809 Bacteria 3220
491 Ga0495600_0044751 3300046809 Bacteria 2887
492 Ga0495660_0000285 3300046810 Bacteria 47026
493 Ga0495660_0078878 3300046810 Bacteria 1730
494 Ga0495581_0016575 3300047315 Bacteria 4282
495 Ga0495581_0038037 3300047315 Bacteria 2784
496 Ga0495604_0013709 3300047317 Bacteria 6462
497 Ga0495604_0033733 3300047317 Bacteria 4051
498 Ga0495604_0281673 3300047317 Bacteria 1123
499 Ga0495636_0010998 3300047318 Bacteria 3581
500 Ga0495674_0059592 3300047319 Bacteria 3334
501 Ga0495672_0004969 3300047320 Bacteria 10669
502 Ga0495672_0013056 3300047320 Bacteria 5748
503 Ga0495676_0144723 3300047321 Bacteria 1699
504 Ga0495680_0002988 3300047322 Bacteria 16883
505 Ga0495680_0025360 3300047322 Bacteria 4908
506 Ga0495683_0000268 3300047323 Bacteria 46160
507 Ga0495687_032703 3300047443 Bacteria 2370
508 Ga0495675_0009980 3300047444 Bacteria 5922
509 Ga0495675_0058306 3300047444 Bacteria 2448
510 Ga0495685_000072 3300047447 Bacteria 38017
511 Ga0495673_0000056 3300047469 Bacteria 245918
512 Ga0495673_0002343 3300047469 Bacteria 13466
513 Ga0495673_0005333 3300047469 Bacteria 7798
514 Ga0495681_0000896 3300047470 Bacteria 23009
515 Ga0495681_0033473 3300047470 Bacteria 2573
516 Ga0495686_0000164 3300047472 Bacteria 126101
517 Ga0495686_0002130 3300047472 Bacteria 19373
518 Ga0495686_0009883 3300047472 Bacteria 6836
519 Ga0495686_0012948 3300047472 Bacteria 5814
520 Ga0495686_0029522 3300047472 Bacteria 3566
521 Ga0495593_0045016 3300047673 Bacteria 2357
522 Ga0495602_0039507 3300048088 Bacteria 4344
523 Ga0495626_0001614 3300048091 Bacteria 17536
524 Ga0495626_0019457 3300048091 Bacteria 3397
525 Ga0495626_0064258 3300048091 Bacteria 1663
526 Ga0496101_0043013 3300048904 Bacteria 3226
527 Ga0496101_0110566 3300048904 Bacteria 2068
528 Ga0496102_0043655 3300048905 Bacteria 4066
529 Ga0496102_0084715 3300048905 Bacteria 2926
530 Ga0496102_0127879 3300048905 Bacteria 2376
531 Ga0496103_0004910 3300048906 Bacteria 8073
532 Ga0496104_0055365 3300048907 Bacteria 3750
533 Ga0496104_0066433 3300048907 Bacteria 3424
534 Ga0496105_0008027 3300048908 Bacteria 8200
535 Ga0496105_0124701 3300048908 Bacteria 2123
536 Ga0496105_0141303 3300048908 Bacteria 1982
537 Ga0496105_0177875 3300048908 Bacteria 1742
538 Ga0496106_0001246 3300048909 Bacteria 19041
539 Ga0496106_0018475 3300048909 Bacteria 5155
540 Ga0496106_0150380 3300048909 Bacteria 1836
541 Ga0496107_0000086 3300048910 Bacteria 44285
542 Ga0496107_0131341 3300048910 Bacteria 1849
543 Ga0496108_0103104 3300048911 Bacteria 2434
544 Ga0496109_0037159 3300048912 Bacteria 4400
545 Ga0496109_0317752 3300048912 Bacteria 1469
546 Ga0496110_0098166 3300048913 Bacteria 2624
547 Ga0496110_0289023 3300048913 Bacteria 1493
548 Ga0496112_0000092 3300048915 Bacteria 58800
549 Ga0496112_0022945 3300048915 Bacteria 5955
550 Ga0496112_0180075 3300048915 Bacteria 2077
551 Ga0496113_0055605 3300048916 Bacteria 2967
552 Ga0496113_0104267 3300048916 Bacteria 2200
553 Ga0496114_0183966 3300048917 Bacteria 1825
554 Ga0496115_0009296 3300048918 Bacteria 7305
555 Ga0496115_0047500 3300048918 Bacteria 3433
556 Ga0496115_0082927 3300048918 Bacteria 2613
557 Ga0496116_0000958 3300048919 Bacteria 35612
558 Ga0496116_0016164 3300048919 Bacteria 5856
559 Ga0496116_0026600 3300048919 Bacteria 4227
560 Ga0496117_0000597 3300048920 Bacteria 59321
561 Ga0496117_0015920 3300048920 Bacteria 6372
562 Ga0496118_0002433 3300048921 Bacteria 25052
563 Ga0496118_0003356 3300048921 Bacteria 20262
564 Ga0496118_0039189 3300048921 Bacteria 3784
565 Ga0496118_0067148 3300048921 Bacteria 2613
566 Ga0496118_0098991 3300048921 Bacteria 1978
567 Ga0496118_0100574 3300048921 Bacteria 1955
568 Ga0496118_0160266 3300048921 Bacteria 1392
569 Ga0496119_0000353 3300048922 Bacteria 64435
570 Ga0496119_0003729 3300048922 Bacteria 15607
571 Ga0496119_0063099 3300048922 Bacteria 2205
572 Ga0496119_0124763 3300048922 Bacteria 1410
573 Ga0496120_0002470 3300048923 Bacteria 18618
574 Ga0496120_0035415 3300048923 Bacteria 2981
575 Ga0496120_0061799 3300048923 Bacteria 2089
576 Ga0496120_0112491 3300048923 Bacteria 1420
577 Ga0496121_0000365 3300048924 Bacteria 92822
578 Ga0496121_0001293 3300048924 Bacteria 43066
579 Ga0496121_0001387 3300048924 Bacteria 41011
580 Ga0496121_0002376 3300048924 Bacteria 28938
581 Ga0496121_0011956 3300048924 Bacteria 9548
582 Ga0496121_0012486 3300048924 Bacteria 9251
583 Ga0496121_0136221 3300048924 Bacteria 1829
584 Ga0496121_0205731 3300048924 Bacteria 1398
585 Ga0496121_0213346 3300048924 Bacteria 1365
586 Ga0496122_0005419 3300048925 Bacteria 15214
587 Ga0496122_0017294 3300048925 Bacteria 6752
588 Ga0496122_0022873 3300048925 Bacteria 5535
589 Ga0496122_0048653 3300048925 Bacteria 3256
590 Ga0496122_0054578 3300048925 Bacteria 2999
591 Ga0496122_0107564 3300048925 Bacteria 1842
592 Ga0496122_0159495 3300048925 Bacteria 1378
593 Ga0496123_0000881 3300048926 Bacteria 47635
594 Ga0496123_0014379 3300048926 Bacteria 6565
595 Ga0496123_0026804 3300048926 Bacteria 4308
596 Ga0496123_0028038 3300048926 Bacteria 4178
597 Ga0496123_0082083 3300048926 Bacteria 1956
598 Ga0496123_0103777 3300048926 Bacteria 1645
599 Ga0496124_0000460 3300048927 Bacteria 70590
600 Ga0496124_0000747 3300048927 Bacteria 53318
601 Ga0496124_0006835 3300048927 Bacteria 12294
602 Ga0496124_0008358 3300048927 Bacteria 10839
603 Ga0496124_0186405 3300048927 Bacteria 1592
604 Ga0496125_0000465 3300048928 Bacteria 72631
605 Ga0496125_0000715 3300048928 Bacteria 54933
606 Ga0496125_0003799 3300048928 Bacteria 17957
607 Ga0496125_0006551 3300048928 Bacteria 12546
608 Ga0496125_0011535 3300048928 Bacteria 8830
609 Ga0496125_0015135 3300048928 Bacteria 7476
610 Ga0496125_0035399 3300048928 Bacteria 4380
611 Ga0496125_0046233 3300048928 Bacteria 3654
612 Ga0496126_0000102 3300048929 Bacteria 201540
613 Ga0496126_0001333 3300048929 Bacteria 39193
614 Ga0496126_0021615 3300048929 Bacteria 6282
615 Ga0496126_0032985 3300048929 Bacteria 4874
616 Ga0496126_0048648 3300048929 Bacteria 3873
617 Ga0496126_0095099 3300048929 Bacteria 2614
618 Ga0496126_0119262 3300048929 Bacteria 2289
619 Ga0496126_0168689 3300048929 Bacteria 1866
620 Ga0496126_0269315 3300048929 Bacteria 1414
621 Ga0495678_000004 3300049459 Bacteria 532920
622 Ga0495678_000463 3300049459 Bacteria 40357
623 Ga0495682_0005768 3300049460 Bacteria 5101
624 Ga0501321_003698 3300049537 Bacteria 1418
625 Ga0501325_000815 3300049541 Bacteria 1691
626 Ga0501031_0001400 3300049568 Bacteria 14900
627 Ga0501031_0001494 3300049568 Bacteria 14559
628 Ga0501032_0000088 3300049569 Bacteria 79913
629 Ga0501033_0000724 3300049570 Bacteria 30292
630 Ga0501033_0128740 3300049570 Bacteria 1835
631 Ga0501034_0000332 3300049571 Bacteria 82900
632 Ga0501034_0281881 3300049571 Bacteria 1601
633 Ga0501036_0000233 3300049572 Bacteria 37220
634 Ga0501036_0395042 3300049572 Bacteria 1154
635 Ga0501037_0000421 3300049573 Bacteria 35090
636 Ga0501038_0000049 3300049574 Bacteria 100279
637 Ga0501039_0007740 3300049575 Bacteria 8198
638 Ga0501042_0178107 3300049578 Bacteria 1533
639 Ga0501043_0000740 3300049579 Bacteria 28916
640 Ga0501043_0151716 3300049579 Bacteria 1813
641 Ga0501043_0215852 3300049579 Bacteria 1485
642 Ga0501046_0000087 3300049580 Bacteria 99252
643 Ga0501047_0000567 3300049581 Bacteria 39527
644 Ga0501047_0001375 3300049581 Bacteria 23892
645 Ga0501047_0001615 3300049581 Bacteria 21993
646 Ga0501047_0032287 3300049581 Bacteria 5053
647 Ga0501048_0000665 3300049582 Bacteria 24850
648 Ga0501067_0000497 3300049583 Bacteria 21556
649 Ga0501067_0065719 3300049583 Bacteria 2008
650 Ga0501068_0001170 3300049584 Bacteria 13935
651 Ga0501069_0027125 3300049585 Bacteria 3138
652 Ga0501070_0001902 3300049586 Bacteria 18469
653 Ga0501070_0004024 3300049586 Bacteria 12625
654 Ga0501070_0008180 3300049586 Bacteria 8845
655 Ga0501070_0096251 3300049586 Bacteria 2449
656 Ga0501070_0117422 3300049586 Bacteria 2198
657 Ga0501072_0000535 3300049588 Bacteria 27273
658 Ga0501073_0000112 3300049589 Bacteria 52280
659 Ga0501073_0001518 3300049589 Bacteria 17195
660 Ga0501074_0000095 3300049590 Bacteria 42376
661 Ga0501074_0000225 3300049590 Bacteria 31306
662 Ga0501076_0056708 3300049592 Bacteria 3110
663 Ga0501238_000647 3300049671 Bacteria 3937
664 Ga0501079_0226809 3300049741 Bacteria 1459
665 Ga0501080_0000250 3300049742 Bacteria 40604
666 Ga0501080_0012805 3300049742 Bacteria 7693
667 Ga0501080_0415678 3300049742 Bacteria 1209
668 Ga0501083_0000724 3300049744 Bacteria 21483
669 Ga0501035_0001661 3300049822 Bacteria 22487
670 Ga0501035_0001854 3300049822 Bacteria 21280
671 Ga0501035_0313546 3300049822 Bacteria 1319
672 Ga0501044_0000182 3300049823 Bacteria 78052
673 Ga0501044_0000643 3300049823 Bacteria 42193
674 Ga0501044_0005323 3300049823 Bacteria 14316
675 Ga0501044_0071704 3300049823 Bacteria 3522
676 Ga0501044_0268266 3300049823 Bacteria 1643
677 Ga0501045_0009807 3300049824 Bacteria 6700
678 nmdc:mga03n38_14093_c1 3300050490 Bacteria 3057
679 nmdc:mga03n38_164600_c1 3300050490 Bacteria 1125
680 nmdc:mga00v17_26587_c1 3300050491 Bacteria 3374
681 nmdc:mga00v17_69015_c1 3300050491 Bacteria 2186
682 nmdc:mga0yw44_174781_c1 3300050492 Bacteria 1411
683 nmdc:mga0yw44_33330_c1 3300050492 Bacteria 3008
684 nmdc:mga0k408_20123_c1 3300050493 Bacteria 2250
685 nmdc:mga0n895_59665_c1 3300050512 Bacteria 3764
686 nmdc:mga0sz30_1226_c1 3300050516 Bacteria 9165
687 nmdc:mga0sz30_28806_c1 3300050516 Bacteria 2286
688 nmdc:mga0sz30_4817_c1 3300050516 Bacteria 4912
689 Ga0500635_0026631 3300053080 Bacteria 1831
690 Ga0500635_0068446 3300053080 Bacteria 1254
691 Ga0495655_0017646 3300053083 Bacteria 1558
692 Ga0495595_0052800 3300053084 Bacteria 1887
693 Ga0495619_0060800 3300053085 Bacteria 2512
694 Ga0500578_0000134 3300053086 Bacteria 89131
695 Ga0500578_0117709 3300053086 Bacteria 1672
696 Ga0500643_000042 3300053087 Bacteria 158933
697 Ga0500643_012743 3300053087 Bacteria 2999
698 Ga0500643_022069 3300053087 Bacteria 2055
699 Ga0500644_0000645 3300053088 Bacteria 12936
700 Ga0500644_0019511 3300053088 Bacteria 2002
701 Ga0500581_041322 3300053089 Bacteria 2361
702 Ga0500647_0022811 3300053091 Bacteria 2932
703 Ga0500583_0033492 3300053092 Bacteria 2274
704 Ga0500651_0000751 3300053093 Bacteria 15835
705 Ga0500651_0051063 3300053093 Bacteria 2593
706 Ga0500566_0000621 3300053094 Bacteria 19875
707 Ga0500566_0003123 3300053094 Bacteria 9904
708 Ga0500566_0030104 3300053094 Bacteria 3167
709 Ga0500566_0045688 3300053094 Bacteria 2520
710 Ga0500640_033399 3300053095 Bacteria 2259
711 Ga0500641_0014927 3300053096 Bacteria 2873
712 Ga0500555_009551 3300053103 Bacteria 2774
713 Ga0500555_022699 3300053103 Bacteria 1801
714 Ga0500556_0000012 3300053104 Bacteria 250391
715 Ga0500556_0000016 3300053104 Bacteria 194958
716 Ga0500556_0000240 3300053104 Bacteria 44438
717 Ga0500557_001529 3300053105 Bacteria 3827
718 Ga0500562_005187 3300053108 Bacteria 3273
719 Ga0500572_006063 3300053111 Bacteria 2757
720 Ga0500572_010027 3300053111 Bacteria 2254
721 Ga0500592_001311 3300053116 Bacteria 4046
722 Ga0500592_003605 3300053116 Bacteria 2471
723 Ga0500593_000938 3300053117 Bacteria 10761
724 Ga0500594_0000166 3300053118 Bacteria 17250
725 Ga0500595_000717 3300053119 Bacteria 19743
726 Ga0500595_001143 3300053119 Bacteria 14723
727 Ga0500595_002485 3300053119 Bacteria 9121
728 Ga0500608_000004 3300053122 Bacteria 108109
729 Ga0500608_032815 3300053122 Bacteria 2468
730 Ga0500608_088098 3300053122 Bacteria 1455
731 Ga0500614_005792 3300053123 Bacteria 2595
732 Ga0500618_002744 3300053125 Bacteria 6409
733 Ga0500618_007208 3300053125 Bacteria 3195
734 Ga0500628_000384 3300053129 Bacteria 8370
735 Ga0500642_0000017 3300053130 Bacteria 167670
736 Ga0500642_0000110 3300053130 Bacteria 38826
737 Ga0500652_001959 3300053131 Bacteria 6202
738 Ga0500652_006497 3300053131 Bacteria 3767
739 Ga0500658_0001869 3300053134 Bacteria 8261
740 Ga0500559_0000029 3300053136 Bacteria 117549
741 Ga0500559_0000198 3300053136 Bacteria 47902
742 Ga0500559_0000209 3300053136 Bacteria 46899
743 Ga0500559_0006135 3300053136 Bacteria 5442
744 Ga0500559_0017592 3300053136 Bacteria 3019
745 Ga0500559_0031194 3300053136 Bacteria 2285
746 Ga0500564_000051 3300053138 Bacteria 30326
747 Ga0500568_0000005 3300053139 Bacteria 614296
748 Ga0500568_0016396 3300053139 Bacteria 3296
749 Ga0500577_0000845 3300053142 Bacteria 7919
750 Ga0500577_0001168 3300053142 Bacteria 6710
751 Ga0500577_0001303 3300053142 Bacteria 6376
752 Ga0500586_005793 3300053145 Bacteria 3156
753 Ga0500586_045191 3300053145 Bacteria 1506
754 Ga0500589_059706 3300053147 Bacteria 1750
755 Ga0500603_000230 3300053150 Bacteria 14627
756 Ga0500603_010039 3300053150 Bacteria 2128
757 Ga0500604_0021610 3300053151 Bacteria 1821
758 Ga0500616_0000035 3300053153 Bacteria 394242
759 Ga0500616_0000565 3300053153 Bacteria 45296
760 Ga0500616_0030707 3300053153 Bacteria 2948
761 Ga0500619_021123 3300053154 Bacteria 1871
762 Ga0500622_0001461 3300053156 Bacteria 18860
763 Ga0500622_0001623 3300053156 Bacteria 17639
764 Ga0500622_0002174 3300053156 Bacteria 14531
765 Ga0500622_0003356 3300053156 Bacteria 10783
766 Ga0500622_0004287 3300053156 Bacteria 9047
767 Ga0500622_0015212 3300053156 Bacteria 4125
768 Ga0500622_0110434 3300053156 Bacteria 1344
769 Ga0500630_002647 3300053159 Bacteria 8611
770 Ga0500634_0124518 3300053161 Bacteria 1248
771 Ga0500638_001678 3300053162 Bacteria 7184
772 Ga0500638_033382 3300053162 Bacteria 2488
773 Ga0500638_045874 3300053162 Bacteria 2120
774 Ga0500638_083695 3300053162 Bacteria 1512
775 Ga0500638_122657 3300053162 Bacteria 1187
776 Ga0500639_000029 3300053163 Bacteria 76014
777 Ga0500636_0001194 3300053177 Bacteria 14033
778 Ga0500636_0002691 3300053177 Bacteria 9880
779 Ga0500636_0004348 3300053177 Bacteria 8014
780 Ga0500636_0038527 3300053177 Bacteria 2827
781 Ga0500637_0000070 3300053178 Bacteria 36880
782 Ga0500637_0003997 3300053178 Bacteria 6910
783 Ga0500645_006734 3300053730 Bacteria 4069
784 Ga0500645_011919 3300053730 Bacteria 2823
785 Ga0500596_002346 3300053735 Bacteria 3742
786 Ga0500596_003221 3300053735 Bacteria 3133
787 Ga0501084_0013679 3300054114 Bacteria 6717
788 Ga0500661_000295 3300055283 Bacteria 9047
789 Ga0590071_007927 3300059421 Bacteria 2509
790 Ga0501082_0002561 3300060353 Bacteria 15915

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 2162886007 SwRhRL2b_contig_97404 SwRhRL2b_0672.00003780 292
2 3300048904 Ga0496101_0110566 Ga0496101_0110566_14_952 311
3 3300042876 Ga0451577_0257295 Ga0451577_0257295_48_1007 313
4 3300053086 Ga0500578_0117709 Ga0500578_0117709_26_1039 317
5 3300026067 Ga0207678_10174627 Ga0207678_101746272 325
6 3300046616 Ga0495668_0000019 Ga0495668_0000019_134195_135286 325
7 3300003791 Ga0055530_10005290 Ga0055530_100052902 329
8 3300025303 Ga0209051_1031286 Ga0209051_10312862 329
9 3300046616 Ga0495668_0011144 Ga0495668_0011144_3810_4883 333
10 3300053156 Ga0500622_0002174 Ga0500622_0002174_11416_12489 333
11 3300005468 Ga0070707_100019638 Ga0070707_1000196383 335
12 3300005471 Ga0070698_100342813 Ga0070698_1003428131 335
13 3300025922 Ga0207646_10066604 Ga0207646_100666044 335
14 3300047472 Ga0495686_0029522 Ga0495686_0029522_939_2015 335
15 3300053122 Ga0500608_000004 Ga0500608_000004_31729_32799 336
16 3300009093 Ga0105240_10035272 Ga0105240_100352726 337
17 3300046660 Ga0495625_0192628 Ga0495625_0192628_247_1320 337
18 3300047470 Ga0495681_0033473 Ga0495681_0033473_1478_2524 337
19 3300050490 nmdc:mga03n38_164600_c1 nmdc:mga03n38_164600_c1_60_1106 337
20 3300053145 Ga0500586_045191 Ga0500586_045191_411_1457 337
21 3300005262 Ga0065165_1000388 Ga0065165_10003884 339
22 3300025295 Ga0209564_1000808 Ga0209564_100080837 339
23 3300025263 Ga0209565_1002635 Ga0209565_10026359 340
24 3300025298 Ga0209050_1002308 Ga0209050_100230811 340
25 3300047317 Ga0495604_0281673 Ga0495604_0281673_55_1089 341
26 3300049572 Ga0501036_0395042 Ga0501036_0395042_29_1078 343
27 3300053136 Ga0500559_0006135 Ga0500559_0006135_3089_4165 343
28 3300046453 Ga0495627_000409 Ga0495627_000409_2882_3958 344
29 3300046512 Ga0495610_0010921 Ga0495610_0010921_2843_3919 344
30 3300047469 Ga0495673_0000056 Ga0495673_0000056_66760_67836 344
31 3300053142 Ga0500577_0000845 Ga0500577_0000845_6249_7325 344
32 3300046507 Ga0495606_0003391 Ga0495606_0003391_1553_2629 345
33 iso_pu_bacteria 2526164512 2526212777 345
34 iso_pu_bacteria 2585428058 2587732302 345
35 iso_pu_bacteria 2919534386 2919536707 345
36 3300046525 Ga0495663_0032132 Ga0495663_0032132_339_1412 346
37 3300048909 Ga0496106_0018475 Ga0496106_0018475_3603_4679 346
38 3300048910 Ga0496107_0000086 Ga0496107_0000086_35582_36658 346
39 3300048924 Ga0496121_0001387 Ga0496121_0001387_28609_29685 346
40 3300053156 Ga0500622_0015212 Ga0500622_0015212_899_2005 346
41 3300009551 Ga0105238_10112067 Ga0105238_101120672 347
42 3300046460 Ga0495638_0000925 Ga0495638_0000925_137_1213 347
43 3300046512 Ga0495610_0000097 Ga0495610_0000097_3772_4848 347
44 3300046522 Ga0495643_0037760 Ga0495643_0037760_544_1620 347
45 3300047320 Ga0495672_0004969 Ga0495672_0004969_4407_5483 347
46 3300053093 Ga0500651_0000751 Ga0500651_0000751_2503_3681 347
47 3300053104 Ga0500556_0000240 Ga0500556_0000240_23535_24611 347
48 3300053134 Ga0500658_0001869 Ga0500658_0001869_1503_2579 347
49 3300053156 Ga0500622_0110434 Ga0500622_0110434_39_1217 347
50 3300053730 Ga0500645_006734 Ga0500645_006734_1742_2818 347
51 3300046520 Ga0495637_0012290 Ga0495637_0012290_160_1248 348
52 3300025949 Ga0207667_10003742 Ga0207667_100037429 349
53 3300042876 Ga0451577_0001823 Ga0451577_0001823_14923_15987 349
54 3300005327 Ga0070658_10273991 Ga0070658_102739912 350
55 3300005339 Ga0070660_100065528 Ga0070660_1000655284 350
56 3300005455 Ga0070663_100029661 Ga0070663_1000296616 350
57 3300005578 Ga0068854_100046308 Ga0068854_1000463083 350
58 3300005614 Ga0068856_100197340 Ga0068856_1001973403 350
59 3300005614 Ga0068856_100239578 Ga0068856_1002395782 350
60 3300009551 Ga0105238_10014292 Ga0105238_100142923 350
61 3300013102 Ga0157371_10038427 Ga0157371_100384272 350
62 3300013307 Ga0157372_10194448 Ga0157372_101944482 350
63 3300025909 Ga0207705_10007528 Ga0207705_100075285 350
64 3300025913 Ga0207695_10016375 Ga0207695_100163756 350
65 3300025919 Ga0207657_10016684 Ga0207657_100166842 350
66 3300025949 Ga0207667_10010590 Ga0207667_100105907 350
67 3300025981 Ga0207640_10004304 Ga0207640_100043045 350
68 3300026067 Ga0207678_10001306 Ga0207678_1000130623 350
69 3300026078 Ga0207702_10175458 Ga0207702_101754582 350
70 3300026142 Ga0207698_10040468 Ga0207698_100404685 350
71 3300044712 Ga0453684_0000149 Ga0453684_0000149_68668_69738 350
72 iso_pu_bacteria 2643221640 2644226170 350
73 iso_pu_bacteria 2643221642 2644235658 350
74 iso_pu_bacteria 2857504554 2857509013 350
75 iso_pu_bacteria 2884960567 2884964860 350
76 iso_pu_bacteria 2928531327 2928535051 350
77 3300005530 Ga0070679_100150029 Ga0070679_1001500292 351
78 3300025297 Ga0209758_1000410 Ga0209758_100041011 351
79 3300025923 Ga0207681_10132692 Ga0207681_101326923 351
80 3300025972 Ga0207668_10017435 Ga0207668_100174353 351
81 3300044673 Ga0453683_0006678 Ga0453683_0006678_3895_4956 351
82 3300045051 Ga0451576_0000237 Ga0451576_0000237_27286_28359 351
83 3300046524 Ga0495648_0000509 Ga0495648_0000509_3860_4924 351
84 3300047469 Ga0495673_0005333 Ga0495673_0005333_1480_2544 351
85 3300048929 Ga0496126_0000102 Ga0496126_0000102_148910_149971 351
86 3300053138 Ga0500564_000051 Ga0500564_000051_5350_6414 351
87 iso_pu_bacteria 2510917020 2511123002 351
88 iso_pu_bacteria 2582581279 2585149995 351
89 iso_pu_bacteria 2582581280 2585153512 351
90 iso_pu_bacteria 2582581293 2585197316 351
91 iso_pu_bacteria 2617270741 2617375281 351
92 iso_pu_bacteria 2643221545 2643751476 351
93 iso_pu_bacteria 2643221583 2643926019 351
94 iso_pu_bacteria 2643221691 2644511234 351
95 iso_pu_bacteria 2818991435 2819540003 351
96 iso_pu_bacteria 2818991454 2819648997 351
97 3300031239 Ga0265328_10004639 Ga0265328_100046393 352
98 3300031250 Ga0265331_10000007 Ga0265331_10000007266 352
99 3300037471 Ga0395905_0021485 Ga0395905_0021485_1182_2240 352
100 3300037471 Ga0395905_0233499 Ga0395905_0233499_139_1227 352
101 3300053111 Ga0500572_006063 Ga0500572_006063_908_1969 352
102 3300001915 JGI24741J21665_1003369 JGI24741J21665_10033694 353
103 3300005329 Ga0070683_100108542 Ga0070683_1001085422 353
104 3300005339 Ga0070660_100029057 Ga0070660_1000290573 353
105 3300005455 Ga0070663_100083158 Ga0070663_1000831582 353
106 3300005535 Ga0070684_100021103 Ga0070684_1000211032 353
107 3300005539 Ga0068853_100019889 Ga0068853_1000198893 353
108 3300005577 Ga0068857_100066095 Ga0068857_1000660953 353
109 3300005577 Ga0068857_100207714 Ga0068857_1002077142 353
110 3300005616 Ga0068852_100096080 Ga0068852_1000960802 353
111 3300020082 Ga0206353_12029745 Ga0206353_120297453 353
112 3300025917 Ga0207660_10149496 Ga0207660_101494962 353
113 3300025919 Ga0207657_10054087 Ga0207657_100540871 353
114 3300025920 Ga0207649_10025557 Ga0207649_100255573 353
115 3300025921 Ga0207652_10016523 Ga0207652_100165232 353
116 3300025924 Ga0207694_10186230 Ga0207694_101862302 353
117 3300025932 Ga0207690_10079970 Ga0207690_100799702 353
118 3300025944 Ga0207661_10045025 Ga0207661_100450252 353
119 3300025945 Ga0207679_10222199 Ga0207679_102221991 353
120 3300025949 Ga0207667_10027215 Ga0207667_100272153 353
121 3300025981 Ga0207640_10008099 Ga0207640_100080993 353
122 3300026116 Ga0207674_10014540 Ga0207674_100145404 353
123 3300026116 Ga0207674_10223414 Ga0207674_102234142 353
124 3300026142 Ga0207698_10042306 Ga0207698_100423063 353
125 3300028558 Ga0265326_10006100 Ga0265326_100061002 353
126 3300028800 Ga0265338_10048129 Ga0265338_100481294 353
127 3300031711 Ga0265314_10023323 Ga0265314_100233238 353
128 3300045051 Ga0451576_0235814 Ga0451576_0235814_198_1277 353
129 3300046660 Ga0495625_0160496 Ga0495625_0160496_63_1130 353
130 3300046690 Ga0495624_0051230 Ga0495624_0051230_480_1547 353
131 3300048921 Ga0496118_0160266 Ga0496118_0160266_29_1213 353
132 3300049581 Ga0501047_0001615 Ga0501047_0001615_4297_5373 353
133 3300049586 Ga0501070_0001902 Ga0501070_0001902_17214_18290 353
134 3300049586 Ga0501070_0008180 Ga0501070_0008180_6497_7573 353
135 3300049589 Ga0501073_0001518 Ga0501073_0001518_4148_5224 353
136 3300049590 Ga0501074_0000095 Ga0501074_0000095_17086_18162 353
137 3300049741 Ga0501079_0226809 Ga0501079_0226809_263_1339 353
138 3300049742 Ga0501080_0000250 Ga0501080_0000250_22443_23519 353
139 3300049823 Ga0501044_0000643 Ga0501044_0000643_11160_12236 353
140 3300053091 Ga0500647_0022811 Ga0500647_0022811_1621_2685 353
141 3300053096 Ga0500641_0014927 Ga0500641_0014927_1611_2684 353
142 3300053156 Ga0500622_0001461 Ga0500622_0001461_15501_16571 353
143 iso_pu_bacteria 2510917028 2511182046 353
144 iso_pu_bacteria 2582581306 2585270049 353
145 iso_pu_bacteria 2582581865 2585389754 353
146 iso_pu_bacteria 2585427590 2585824937 353
147 3300003781 Ga0055536_1000029 Ga0055536_1000029118 354
148 3300003781 Ga0055536_1000057 Ga0055536_100005781 354
149 3300003791 Ga0055530_10000782 Ga0055530_1000078219 354
150 3300003794 Ga0055531_10000224 Ga0055531_1000022455 354
151 3300003794 Ga0055531_10001089 Ga0055531_1000108916 354
152 3300021361 Ga0213872_10047577 Ga0213872_100475772 354
153 3300025292 Ga0209676_1000031 Ga0209676_1000031217 354
154 3300025292 Ga0209676_1000057 Ga0209676_1000057161 354
155 3300025298 Ga0209050_1000087 Ga0209050_100008755 354
156 3300025298 Ga0209050_1000096 Ga0209050_100009658 354
157 3300025303 Ga0209051_1002485 Ga0209051_10024855 354
158 3300025304 Ga0209257_1000050 Ga0209257_1000050213 354
159 3300025304 Ga0209257_1007754 Ga0209257_10077546 354
160 3300029272 Ga0311000_127106 Ga0311000_1271061 354
161 3300037466 Ga0395898_0160685 Ga0395898_0160685_134_1231 354
162 3300039447 Ga0436361_0083862 Ga0436361_0083862_2251_3357 354
163 3300046501 Ga0495607_0018140 Ga0495607_0018140_2008_3078 354
164 3300046616 Ga0495668_0007251 Ga0495668_0007251_4138_5211 354
165 3300048927 Ga0496124_0006835 Ga0496124_0006835_1314_2387 354
166 3300048928 Ga0496125_0046233 Ga0496125_0046233_35_1108 354
167 3300048929 Ga0496126_0001333 Ga0496126_0001333_16643_17716 354
168 3300049459 Ga0495678_000463 Ga0495678_000463_21017_22090 354
169 3300050516 nmdc:mga0sz30_1226_c1 nmdc:mga0sz30_1226_c1_4976_6049 354
170 3300053086 Ga0500578_0000134 Ga0500578_0000134_38681_39754 354
171 3300053118 Ga0500594_0000166 Ga0500594_0000166_10938_12011 354
172 3300053162 Ga0500638_122657 Ga0500638_122657_46_1119 354
173 3300053177 Ga0500636_0002691 Ga0500636_0002691_817_1890 354
174 3300002737 JGI25162J39368_1000004 JGI25162J39368_1000004336 355
175 3300002771 JGI25163J39215_1002933 JGI25163J39215_10029331 355
176 3300002772 JGI25164J39214_1000026 JGI25164J39214_100002647 355
177 3300003214 JGI25165J46597_1000011 JGI25165J46597_1000011336 355
178 3300003773 Ga0055537_1005122 Ga0055537_10051224 355
179 3300003775 Ga0055524_1008030 Ga0055524_10080304 355
180 3300003790 Ga0055528_1003513 Ga0055528_10035139 355
181 3300003794 Ga0055531_10007287 Ga0055531_100072876 355
182 3300005616 Ga0068852_100456904 Ga0068852_1004569042 355
183 3300009177 Ga0105248_10186033 Ga0105248_101860332 355
184 3300025207 Ga0209760_100105 Ga0209760_10010556 355
185 3300025231 Ga0207427_100003 Ga0207427_100003334 355
186 3300025233 Ga0209437_100002 Ga0209437_100002679 355
187 3300025261 Ga0209233_1000004 Ga0209233_1000004746 355
188 3300025273 Ga0209673_1000676 Ga0209673_100067628 355
189 3300025295 Ga0209564_1028884 Ga0209564_10288843 355
190 3300025297 Ga0209758_1002273 Ga0209758_100227319 355
191 3300025299 Ga0209256_1001507 Ga0209256_100150711 355
192 3300025299 Ga0209256_1002695 Ga0209256_100269511 355
193 3300025304 Ga0209257_1000687 Ga0209257_100068738 355
194 3300028794 Ga0307515_10062357 Ga0307515_100623574 355
195 3300028794 Ga0307515_10068026 Ga0307515_100680266 355
196 3300028794 Ga0307515_10079159 Ga0307515_100791592 355
197 3300028800 Ga0265338_10017804 Ga0265338_100178043 355
198 3300037471 Ga0395905_0015842 Ga0395905_0015842_5913_6998 355
199 3300042876 Ga0451577_0010147 Ga0451577_0010147_350_1438 355
200 3300046457 Ga0495590_0019970 Ga0495590_0019970_731_1807 355
201 3300046471 Ga0495650_0000017 Ga0495650_0000017_365217_366293 355
202 3300046471 Ga0495650_0039486 Ga0495650_0039486_787_1863 355
203 3300046506 Ga0495583_0000029 Ga0495583_0000029_199698_200774 355
204 3300046512 Ga0495610_0023461 Ga0495610_0023461_137_1213 355
205 3300046513 Ga0495616_0003043 Ga0495616_0003043_7797_8873 355
206 3300046518 Ga0495631_0002855 Ga0495631_0002855_4703_5779 355
207 3300046519 Ga0495632_0006114 Ga0495632_0006114_5253_6329 355
208 3300046524 Ga0495648_0016824 Ga0495648_0016824_4018_5094 355
209 3300046530 Ga0495654_0000012 Ga0495654_0000012_167348_168424 355
210 3300046660 Ga0495625_0000186 Ga0495625_0000186_39706_40782 355
211 3300046660 Ga0495625_0028434 Ga0495625_0028434_1640_2716 355
212 3300046660 Ga0495625_0109462 Ga0495625_0109462_15_1091 355
213 3300046692 Ga0495671_0106821 Ga0495671_0106821_44_1120 355
214 3300046794 Ga0495589_0006983 Ga0495589_0006983_2463_3539 355
215 3300047469 Ga0495673_0002343 Ga0495673_0002343_6403_7479 355
216 3300047472 Ga0495686_0002130 Ga0495686_0002130_9634_10710 355
217 3300047472 Ga0495686_0009883 Ga0495686_0009883_5569_6645 355
218 3300048918 Ga0496115_0047500 Ga0496115_0047500_1154_2230 355
219 3300048929 Ga0496126_0095099 Ga0496126_0095099_1085_2161 355
220 3300049570 Ga0501033_0128740 Ga0501033_0128740_569_1660 355
221 3300049579 Ga0501043_0215852 Ga0501043_0215852_44_1135 355
222 3300049581 Ga0501047_0000567 Ga0501047_0000567_15205_16296 355
223 3300049671 Ga0501238_000647 Ga0501238_000647_649_1725 355
224 3300049822 Ga0501035_0001661 Ga0501035_0001661_18157_19248 355
225 3300049823 Ga0501044_0005323 Ga0501044_0005323_13021_14112 355
226 3300053087 Ga0500643_012743 Ga0500643_012743_1412_2491 355
227 3300053088 Ga0500644_0000645 Ga0500644_0000645_5363_6439 355
228 3300053088 Ga0500644_0019511 Ga0500644_0019511_510_1586 355
229 3300053103 Ga0500555_022699 Ga0500555_022699_215_1291 355
230 3300053108 Ga0500562_005187 Ga0500562_005187_1232_2308 355
231 3300053136 Ga0500559_0000029 Ga0500559_0000029_18730_19806 355
232 3300053153 Ga0500616_0030707 Ga0500616_0030707_689_1765 355
233 3300053156 Ga0500622_0001623 Ga0500622_0001623_11396_12472 355
234 iso_pu_bacteria 2602042107 2603858193 355
235 iso_pu_bacteria 2857524615 2857527582 355
236 iso_pu_bacteria 2893066018 2893067075 355
237 iso_pu_bacteria 2919073203 2919073434 355
238 3300002738 JGI25154J39366_1001366 JGI25154J39366_10013665 356
239 3300013100 Ga0157373_10032751 Ga0157373_100327512 356
240 3300013105 Ga0157369_10064533 Ga0157369_100645332 356
241 3300025206 Ga0209435_100119 Ga0209435_1001192 356
242 3300025246 Ga0209646_1000240 Ga0209646_100024015 356
243 3300025250 Ga0209026_1005028 Ga0209026_10050283 356
244 3300025256 Ga0209759_1000312 Ga0209759_100031215 356
245 3300039447 Ga0436361_0844316 Ga0436361_0844316_2255_3358 356
246 3300046660 Ga0495625_0000249 Ga0495625_0000249_73254_74378 356
247 3300053117 Ga0500593_000938 Ga0500593_000938_3742_4827 356
248 3300053139 Ga0500568_0000005 Ga0500568_0000005_151103_152188 356
249 iso_pu_bacteria 2643221552 2643780278 356
250 iso_pu_bacteria 2643221584 2643928542 356
251 iso_pu_bacteria 2857524615 2857527155 356
252 iso_pu_bacteria 2884298095 2884300387 356
253 iso_pu_bacteria 2916028427 2916028660 356
254 iso_pu_bacteria 2916055098 2916056050 356
255 iso_pu_bacteria 2921263974 2921264284 356
256 iso_pu_bacteria 2924172951 2924179475 356
257 iso_pu_bacteria 2937042894 2937047646 356
258 iso_pu_bacteria 2957478035 2957478261 356
259 iso_pu_bacteria 2967775926 2967780355 356
260 2162886007 SwRhRL2b_contig_1662827 SwRhRL2b_0993.00003530 357
261 2162886007 SwRhRL2b_contig_6154 SwRhRL2b_0854.00003530 357
262 3300005289 Ga0065704_10000184 Ga0065704_10000184100 357
263 3300005289 Ga0065704_10070135 Ga0065704_10070135186 357
264 3300005289 Ga0065704_10070149 Ga0065704_10070149103 357
265 3300005295 Ga0065707_10000601 Ga0065707_100006019 357
266 3300005295 Ga0065707_10082238 Ga0065707_100822386 357
267 3300005546 Ga0070696_100056433 Ga0070696_1000564332 357
268 3300025253 Ga0209677_101307 Ga0209677_10130714 357
269 3300031239 Ga0265328_10007218 Ga0265328_100072184 357
270 3300031250 Ga0265331_10005934 Ga0265331_100059348 357
271 3300031251 Ga0265327_10000429 Ga0265327_1000042942 357
272 3300031712 Ga0265342_10080579 Ga0265342_100805792 357
273 3300046460 Ga0495638_0002042 Ga0495638_0002042_9039_10187 357
274 3300046660 Ga0495625_0053208 Ga0495625_0053208_921_2027 357
275 3300047472 Ga0495686_0000164 Ga0495686_0000164_100316_101422 357
276 3300053119 Ga0500595_000717 Ga0500595_000717_15177_16283 357
277 3300053129 Ga0500628_000384 Ga0500628_000384_1443_2579 357
278 3300059421 Ga0590071_007927 Ga0590071_007927_983_2089 357
279 iso_pu_bacteria 2508501050 2508732705 357
280 iso_pu_bacteria 2508501114 2509078618 357
281 iso_pu_bacteria 2773857925 2774874842 357
282 iso_pu_bacteria 2775506901 2776259209 357
283 iso_pu_bacteria 2835312727 2835313678 357
284 iso_pu_bacteria 2857553236 2857554710 357
285 iso_pu_bacteria 2894232714 2894232815 357
286 iso_pu_bacteria 2937071275 2937075849 357
287 iso_pu_bacteria 2937126314 2937126588 357
288 iso_pu_bacteria 2937539931 2937541775 357
289 3300005435 Ga0070714_100109933 Ga0070714_1001099332 358
290 3300006038 Ga0075365_10135234 Ga0075365_101352341 358
291 3300021361 Ga0213872_10012639 Ga0213872_100126393 358
292 3300025295 Ga0209564_1000383 Ga0209564_100038374 358
293 3300031548 Ga0307408_100049313 Ga0307408_1000493132 358
294 3300039447 Ga0436361_0144287 Ga0436361_0144287_3284_4393 358
295 3300046616 Ga0495668_0162188 Ga0495668_0162188_86_1198 358
296 3300049571 Ga0501034_0281881 Ga0501034_0281881_483_1562 358
297 3300049581 Ga0501047_0032287 Ga0501047_0032287_289_1368 358
298 3300049586 Ga0501070_0096251 Ga0501070_0096251_247_1326 358
299 3300049823 Ga0501044_0071704 Ga0501044_0071704_396_1475 358
300 3300053125 Ga0500618_007208 Ga0500618_007208_342_1457 358
301 iso_pu_bacteria 2558860242 2559297392 358
302 iso_pu_bacteria 2582581299 2585233960 358
303 iso_pu_bacteria 2738543004 2739197193 358
304 iso_pu_bacteria 2818991450 2819621195 358
305 iso_pu_bacteria 2818991457 2819661056 358
306 iso_pu_bacteria 2878788777 2878793946 358
307 iso_pu_bacteria 2915986958 2915986983 358
308 iso_pu_bacteria 2919130084 2919131299 358
309 iso_pu_bacteria 2921201388 2921205166 358
310 iso_pu_bacteria 2928108538 2928109289 358
311 iso_pu_bacteria 2928135762 2928136511 358
312 iso_pu_bacteria 2928503688 2928503709 358
313 iso_pu_bacteria 2929195423 2929196544 358
314 iso_pu_bacteria 2937106411 2937106780 358
315 iso_pu_bacteria 2964643177 2964644613 358
316 iso_pu_bacteria 2967664464 2967664961 358
317 iso_pu_bacteria 2970082768 2970086020 358
318 iso_pu_bacteria 3004334049 3004337510 358
319 iso_pu_bacteria 8055617313 8055622571 358
320 iso_pu_bacteria 8056161164 8056162201 358
321 3300005327 Ga0070658_10351784 Ga0070658_103517841 359
322 3300006178 Ga0075367_10064332 Ga0075367_100643322 359
323 3300006186 Ga0075369_10044782 Ga0075369_100447821 359
324 3300009093 Ga0105240_10036633 Ga0105240_100366332 359
325 3300009551 Ga0105238_10001423 Ga0105238_1000142316 359
326 3300025909 Ga0207705_10080810 Ga0207705_100808101 359
327 3300025924 Ga0207694_10013217 Ga0207694_100132173 359
328 3300025949 Ga0207667_10177638 Ga0207667_101776381 359
329 3300046460 Ga0495638_0008938 Ga0495638_0008938_3297_4481 359
330 3300046500 Ga0495596_0072654 Ga0495596_0072654_78_1262 359
331 3300046501 Ga0495607_0039949 Ga0495607_0039949_128_1312 359
332 3300046512 Ga0495610_0027197 Ga0495610_0027197_925_2109 359
333 3300046513 Ga0495616_0033632 Ga0495616_0033632_423_1607 359
334 3300046522 Ga0495643_0016140 Ga0495643_0016140_359_1543 359
335 3300046542 Ga0495597_0066941 Ga0495597_0066941_161_1273 359
336 3300046660 Ga0495625_0163747 Ga0495625_0163747_157_1341 359
337 3300046665 Ga0495661_0010073 Ga0495661_0010073_5243_6352 359
338 3300046665 Ga0495661_0011696 Ga0495661_0011696_2502_3686 359
339 3300046810 Ga0495660_0078878 Ga0495660_0078878_175_1359 359
340 3300047447 Ga0495685_000072 Ga0495685_000072_26720_27829 359
341 3300047472 Ga0495686_0012948 Ga0495686_0012948_1173_2357 359
342 3300048919 Ga0496116_0000958 Ga0496116_0000958_3286_4398 359
343 3300048921 Ga0496118_0098991 Ga0496118_0098991_466_1578 359
344 3300048922 Ga0496119_0124763 Ga0496119_0124763_159_1343 359
345 3300048923 Ga0496120_0035415 Ga0496120_0035415_428_1612 359
346 3300048928 Ga0496125_0011535 Ga0496125_0011535_2825_4009 359
347 3300048929 Ga0496126_0168689 Ga0496126_0168689_227_1411 359
348 3300049460 Ga0495682_0005768 Ga0495682_0005768_2089_3198 359
349 3300053089 Ga0500581_041322 Ga0500581_041322_511_1695 359
350 3300053104 Ga0500556_0000016 Ga0500556_0000016_36406_37590 359
351 3300053116 Ga0500592_001311 Ga0500592_001311_1167_2351 359
352 3300053130 Ga0500642_0000017 Ga0500642_0000017_90679_91899 359
353 3300053131 Ga0500652_006497 Ga0500652_006497_332_1552 359
354 3300053136 Ga0500559_0000209 Ga0500559_0000209_2152_3264 359
355 3300053142 Ga0500577_0001303 Ga0500577_0001303_3823_4935 359
356 3300053153 Ga0500616_0000565 Ga0500616_0000565_7630_8814 359
357 3300053156 Ga0500622_0004287 Ga0500622_0004287_4138_5322 359
358 3300053161 Ga0500634_0124518 Ga0500634_0124518_45_1229 359
359 3300053177 Ga0500636_0004348 Ga0500636_0004348_4504_5616 359
360 3300053730 Ga0500645_011919 Ga0500645_011919_822_2006 359
361 iso_pu_bacteria 2602042107 2603857785 359
362 iso_pu_bacteria 2893066018 2893068063 359
363 iso_pu_bacteria 2919073203 2919078273 359
364 3300005347 Ga0070668_100251240 Ga0070668_1002512401 360
365 3300009766 Ga0123342_1000436 Ga0123342_100043629 360
366 3300014326 Ga0157380_10015078 Ga0157380_100150785 360
367 3300025291 Ga0209675_1002010 Ga0209675_10020108 360
368 3300025295 Ga0209564_1000602 Ga0209564_10006022 360
369 3300025901 Ga0207688_10097512 Ga0207688_100975122 360
370 3300031548 Ga0307408_100165005 Ga0307408_1001650052 360
371 3300031852 Ga0307410_10077073 Ga0307410_100770732 360
372 3300031901 Ga0307406_10185700 Ga0307406_101857002 360
373 3300031995 Ga0307409_100070475 Ga0307409_1000704752 360
374 3300032002 Ga0307416_100131430 Ga0307416_1001314303 360
375 3300037471 Ga0395905_0042321 Ga0395905_0042321_2003_3094 360
376 3300044658 Ga0466972_0046781 Ga0466972_0046781_986_2077 360
377 3300046500 Ga0495596_0002019 Ga0495596_0002019_2458_3549 360
378 3300046522 Ga0495643_0005173 Ga0495643_0005173_1309_2427 360
379 3300046810 Ga0495660_0000285 Ga0495660_0000285_44541_45629 360
380 3300047470 Ga0495681_0000896 Ga0495681_0000896_14550_15710 360
381 3300048921 Ga0496118_0039189 Ga0496118_0039189_2649_3740 360
382 3300048923 Ga0496120_0061799 Ga0496120_0061799_392_1483 360
383 3300048923 Ga0496120_0112491 Ga0496120_0112491_36_1127 360
384 3300048924 Ga0496121_0002376 Ga0496121_0002376_19359_20450 360
385 3300048925 Ga0496122_0054578 Ga0496122_0054578_679_1770 360
386 3300048925 Ga0496122_0107564 Ga0496122_0107564_149_1264 360
387 3300048926 Ga0496123_0026804 Ga0496123_0026804_2592_3707 360
388 3300048927 Ga0496124_0186405 Ga0496124_0186405_231_1322 360
389 3300048928 Ga0496125_0003799 Ga0496125_0003799_9670_10761 360
390 3300048928 Ga0496125_0015135 Ga0496125_0015135_450_1583 360
391 3300049537 Ga0501321_003698 Ga0501321_003698_14_1105 360
392 3300049541 Ga0501325_000815 Ga0501325_000815_308_1399 360
393 3300049568 Ga0501031_0001494 Ga0501031_0001494_12418_13569 360
394 iso_pu_bacteria 2554235341 2555669806 360
395 iso_pu_bacteria 2599185160 2599353183 360
396 iso_pu_bacteria 2599185164 2599378291 360
397 iso_pu_bacteria 2599185165 2599384332 360
398 iso_pu_bacteria 2599185181 2599460017 360
399 iso_pu_bacteria 2599185186 2599489038 360
400 iso_pu_bacteria 2599185356 2600212624 360
401 iso_pu_bacteria 2600255313 2601772792 360
402 iso_pu_bacteria 2643221571 2643871386 360
403 iso_pu_bacteria 2738543015 2739258041 360
404 iso_pu_bacteria 2844665904 2844670850 360
405 iso_pu_bacteria 2917070673 2917073624 360
406 iso_pu_bacteria 2935353572 2935357364 360
407 iso_pu_bacteria 637000220 637320145 360
408 iso_pu_bacteria 8054285046 8054291397 360
409 iso_pu_bacteria 8056125926 8056128345 360
410 3300027111 Ga0209281_1000085 Ga0209281_1000085197 361
411 3300049459 Ga0495678_000004 Ga0495678_000004_91968_93059 361
412 3300053094 Ga0500566_0045688 Ga0500566_0045688_834_1958 361
413 3300053119 Ga0500595_001143 Ga0500595_001143_9808_10932 361
414 3300053145 Ga0500586_005793 Ga0500586_005793_1884_2978 361
415 3300053150 Ga0500603_010039 Ga0500603_010039_448_1572 361
416 3300053162 Ga0500638_001678 Ga0500638_001678_3949_5073 361
417 3300053178 Ga0500637_0003997 Ga0500637_0003997_950_2074 361
418 iso_pu_bacteria 2791355199 2793082432 361
419 iso_pu_bacteria 2876808645 2876810782 361
420 iso_pu_bacteria 2879110137 2879118112 361
421 iso_pu_bacteria 2922361189 2922367054 361
422 iso_pu_bacteria 8006984368 8006989438 361
423 3300002067 JGI24735J21928_10018196 JGI24735J21928_100181962 362
424 3300003203 JGI25406J46586_10002152 JGI25406J46586_1000215212 362
425 3300003856 Ga0058692_1000035 Ga0058692_100003557 362
426 3300005289 Ga0065704_10071259 Ga0065704_1007125910 362
427 3300005347 Ga0070668_100393502 Ga0070668_1003935021 362
428 3300005455 Ga0070663_100068533 Ga0070663_1000685332 362
429 3300005535 Ga0070684_100253361 Ga0070684_1002533611 362
430 3300005937 Ga0081455_10015176 Ga0081455_100151766 362
431 3300005937 Ga0081455_10022224 Ga0081455_100222247 362
432 3300005937 Ga0081455_10083293 Ga0081455_100832932 362
433 3300005937 Ga0081455_10115887 Ga0081455_101158872 362
434 3300005983 Ga0081540_1003176 Ga0081540_10031766 362
435 3300005983 Ga0081540_1005385 Ga0081540_10053856 362
436 3300005983 Ga0081540_1014150 Ga0081540_10141504 362
437 3300006051 Ga0075364_10113433 Ga0075364_101134332 362
438 3300009011 Ga0105251_10000029 Ga0105251_1000002922 362
439 3300015262 Ga0182007_10036008 Ga0182007_100360082 362
440 3300025735 Ga0207713_1000112 Ga0207713_100011299 362
441 3300025904 Ga0207647_10021272 Ga0207647_100212724 362
442 3300025972 Ga0207668_10142493 Ga0207668_101424931 362
443 3300026067 Ga0207678_10077726 Ga0207678_100777263 362
444 3300027312 Ga0209371_1000043 Ga0209371_100004378 362
445 3300030500 Ga0268256_1000044 Ga0268256_100004478 362
446 3300031911 Ga0307412_10000482 Ga0307412_1000048214 362
447 3300035113 Ga0373936_0062284 Ga0373936_0062284_171_1430 362
448 3300035724 Ga0373933_0000122 Ga0373933_0000122_27583_28710 362
449 3300046506 Ga0495583_0001522 Ga0495583_0001522_2169_3263 362
450 3300046525 Ga0495663_0000307 Ga0495663_0000307_10363_11460 362
451 3300046558 Ga0495633_0001936 Ga0495633_0001936_2992_4089 362
452 3300046663 Ga0495635_0037712 Ga0495635_0037712_1525_2703 362
453 3300047318 Ga0495636_0010998 Ga0495636_0010998_2454_3548 362
454 3300047322 Ga0495680_0002988 Ga0495680_0002988_11078_12256 362
455 3300048919 Ga0496116_0016164 Ga0496116_0016164_3970_5064 362
456 3300048921 Ga0496118_0002433 Ga0496118_0002433_13169_14263 362
457 3300048922 Ga0496119_0000353 Ga0496119_0000353_34941_36035 362
458 3300048927 Ga0496124_0000460 Ga0496124_0000460_48927_50021 362
459 3300050492 nmdc:mga0yw44_174781_c1 nmdc:mga0yw44_174781_c1_109_1236 362
460 3300053105 Ga0500557_001529 Ga0500557_001529_2679_3773 362
461 iso_pu_bacteria 2513237092 2513627109 362
462 iso_pu_bacteria 2513237095 2513651611 362
463 iso_pu_bacteria 2513237102 2513703712 362
464 iso_pu_bacteria 2513237104 2513717420 362
465 iso_pu_bacteria 2513237139 2513876775 362
466 iso_pu_bacteria 2515154112 2515628811 362
467 iso_pu_bacteria 2524023205 2524439552 362
468 iso_pu_bacteria 2524023228 2524539605 362
469 iso_pu_bacteria 2617270741 2617377747 362
470 iso_pu_bacteria 2667528175 2671122106 362
471 iso_pu_bacteria 2744054633 2745081825 362
472 iso_pu_bacteria 2802429603 2805918755 362
473 iso_pu_bacteria 2816332527 2818243248 362
474 iso_pu_bacteria 2824600985 2824605490 362
475 iso_pu_bacteria 2824609381 2824614828 362
476 iso_pu_bacteria 2824617872 2824622608 362
477 iso_pu_bacteria 2824626560 2824631771 362
478 iso_pu_bacteria 2824635225 2824638939 362
479 iso_pu_bacteria 2824644064 2824648871 362
480 iso_pu_bacteria 2824653114 2824658079 362
481 iso_pu_bacteria 2824679649 2824681656 362
482 iso_pu_bacteria 2824696289 2824698158 362
483 iso_pu_bacteria 2824714736 2824721314 362
484 iso_pu_bacteria 2824723954 2824731311 362
485 iso_pu_bacteria 2824732956 2824736954 362
486 iso_pu_bacteria 2847939898 2847939983 362
487 iso_pu_bacteria 2857509624 2857510993 362
488 iso_pu_bacteria 2874590934 2874596093 362
489 iso_pu_bacteria 2874645413 2874650917 362
490 iso_pu_bacteria 2876761206 2876769104 362
491 iso_pu_bacteria 2876771140 2876776079 362
492 iso_pu_bacteria 2876818435 2876820649 362
493 iso_pu_bacteria 2879074833 2879080168 362
494 iso_pu_bacteria 2879127579 2879129941 362
495 iso_pu_bacteria 2879142872 2879147419 362
496 iso_pu_bacteria 2885366525 2885368462 362
497 iso_pu_bacteria 2885383462 2885383710 362
498 iso_pu_bacteria 2885409591 2885410049 362
499 iso_pu_bacteria 2888378607 2888386015 362
500 iso_pu_bacteria 2888388044 2888392268 362
501 iso_pu_bacteria 2888419890 2888426135 362
502 iso_pu_bacteria 2903768456 2903770054 362
503 iso_pu_bacteria 2904690495 2904698776 362
504 iso_pu_bacteria 2904699407 2904710896 362
505 iso_pu_bacteria 2906635258 2906639047 362
506 iso_pu_bacteria 2906643746 2906644089 362
507 iso_pu_bacteria 2908756301 2908759289 362
508 iso_pu_bacteria 2908775508 2908782207 362
509 iso_pu_bacteria 2932794094 2932797838 362
510 iso_pu_bacteria 2932801729 2932806374 362
511 iso_pu_bacteria 2935608549 2935610459 362
512 iso_pu_bacteria 2935777560 2935781183 362
513 iso_pu_bacteria 2935819856 2935823620 362
514 iso_pu_bacteria 2935847175 2935849146 362
515 iso_pu_bacteria 2935883170 2935888381 362
516 iso_pu_bacteria 2935975950 2935976036 362
517 iso_pu_bacteria 2939622612 2939623982 362
518 iso_pu_bacteria 3005483717 3005489159 362
519 iso_pu_bacteria 8006933436 8006934518 362
520 iso_pu_bacteria 8006973647 8006974488 362
521 iso_pu_bacteria 8016522445 8016527986 362
522 iso_pu_bacteria 8016530956 8016533109 362
523 iso_pu_bacteria 8016539877 8016546344 362
524 iso_pu_bacteria 8016548790 8016555781 362
525 iso_pu_bacteria 8016557553 8016564131 362
526 iso_pu_bacteria 8016566248 8016571427 362
527 iso_pu_bacteria 8016575299 8016575684 362
528 iso_pu_bacteria 8016595262 8016601835 362
529 iso_pu_bacteria 8016603502 8016608414 362
530 iso_pu_bacteria 8016622563 8016624685 362
531 iso_pu_bacteria 8019530166 8019532909 362
532 iso_pu_bacteria 8019538911 8019546945 362
533 iso_pu_bacteria 8019547302 8019551726 362
534 iso_pu_bacteria 8019619141 8019620345 362
535 iso_pu_bacteria 8019629233 8019632757 362
536 iso_pu_bacteria 8019659431 8019660622 362
537 iso_pu_bacteria 8019668869 8019670039 362
538 iso_pu_bacteria 8019678201 8019686061 362
539 iso_pu_bacteria 8056689827 8056694836 362
540 3300003354 JGI25160J50197_1008101 JGI25160J50197_10081012 363
541 3300005435 Ga0070714_100281586 Ga0070714_1002815861 363
542 3300006048 Ga0075363_100086334 Ga0075363_1000863342 363
543 3300006051 Ga0075364_10035474 Ga0075364_100354744 363
544 3300025302 Ga0207426_1005676 Ga0207426_10056765 363
545 3300025929 Ga0207664_10243575 Ga0207664_102435752 363
546 3300026067 Ga0207678_10085123 Ga0207678_100851232 363
547 3300028794 Ga0307515_10145562 Ga0307515_101455624 363
548 3300042006 Ga0439432_000561 Ga0439432_000561_3623_4720 363
549 3300046460 Ga0495638_0010262 Ga0495638_0010262_2359_3459 363
550 3300046460 Ga0495638_0032056 Ga0495638_0032056_2149_3249 363
551 3300046513 Ga0495616_0030467 Ga0495616_0030467_610_1710 363
552 3300046515 Ga0495620_0014369 Ga0495620_0014369_2359_3459 363
553 3300046530 Ga0495654_0021826 Ga0495654_0021826_1273_2373 363
554 3300046557 Ga0495622_0011074 Ga0495622_0011074_2261_3361 363
555 3300046691 Ga0495670_0002289 Ga0495670_0002289_5733_6833 363
556 3300048091 Ga0495626_0019457 Ga0495626_0019457_1603_2703 363
557 3300048919 Ga0496116_0026600 Ga0496116_0026600_1831_2931 363
558 3300048921 Ga0496118_0100574 Ga0496118_0100574_230_1330 363
559 3300048925 Ga0496122_0048653 Ga0496122_0048653_1506_2606 363
560 3300048926 Ga0496123_0103777 Ga0496123_0103777_376_1476 363
561 3300050491 nmdc:mga00v17_26587_c1 nmdc:mga00v17_26587_c1_1388_2488 363
562 3300050516 nmdc:mga0sz30_28806_c1 nmdc:mga0sz30_28806_c1_189_1289 363
563 3300053087 Ga0500643_022069 Ga0500643_022069_47_1147 363
564 3300053093 Ga0500651_0051063 Ga0500651_0051063_630_1730 363
565 3300053094 Ga0500566_0003123 Ga0500566_0003123_7378_8478 363
566 3300053104 Ga0500556_0000012 Ga0500556_0000012_123342_124442 363
567 3300053116 Ga0500592_003605 Ga0500592_003605_1315_2415 363
568 3300053122 Ga0500608_032815 Ga0500608_032815_1043_2143 363
569 3300053125 Ga0500618_002744 Ga0500618_002744_5121_6221 363
570 3300053130 Ga0500642_0000110 Ga0500642_0000110_4089_5189 363
571 3300053131 Ga0500652_001959 Ga0500652_001959_2906_4006 363
572 3300053136 Ga0500559_0000198 Ga0500559_0000198_26334_27434 363
573 3300053139 Ga0500568_0016396 Ga0500568_0016396_631_1731 363
574 3300053153 Ga0500616_0000035 Ga0500616_0000035_265311_266411 363
575 3300053154 Ga0500619_021123 Ga0500619_021123_459_1559 363
576 3300053156 Ga0500622_0003356 Ga0500622_0003356_2072_3172 363
577 3300053177 Ga0500636_0001194 Ga0500636_0001194_2996_4096 363
578 3300002737 JGI25162J39368_1000045 JGI25162J39368_1000045110 364
579 3300002772 JGI25164J39214_1000068 JGI25164J39214_100006844 364
580 3300003203 JGI25406J46586_10009106 JGI25406J46586_100091062 364
581 3300003214 JGI25165J46597_1000086 JGI25165J46597_1000086110 364
582 3300005331 Ga0070670_100000381 Ga0070670_10000038136 364
583 3300005985 Ga0081539_10001660 Ga0081539_100016602 364
584 3300009092 Ga0105250_10033976 Ga0105250_100339762 364
585 3300013102 Ga0157371_10165754 Ga0157371_101657542 364
586 3300013104 Ga0157370_10115912 Ga0157370_101159122 364
587 3300013307 Ga0157372_10284961 Ga0157372_102849612 364
588 3300014497 Ga0182008_10004315 Ga0182008_100043157 364
589 3300014497 Ga0182008_10007005 Ga0182008_100070054 364
590 3300015265 Ga0182005_1002698 Ga0182005_10026984 364
591 3300025207 Ga0209760_100019 Ga0209760_10001959 364
592 3300025231 Ga0207427_100011 Ga0207427_10001159 364
593 3300025233 Ga0209437_100044 Ga0209437_10004459 364
594 3300025261 Ga0209233_1000057 Ga0209233_100005759 364
595 3300025735 Ga0207713_1007845 Ga0207713_10078453 364
596 3300025925 Ga0207650_10000272 Ga0207650_100002729 364
597 3300025935 Ga0207709_10004673 Ga0207709_100046735 364
598 3300028556 Ga0265337_1004626 Ga0265337_10046262 364
599 3300028573 Ga0265334_10020336 Ga0265334_100203361 364
600 3300028577 Ga0265318_10000846 Ga0265318_100008463 364
601 3300028653 Ga0265323_10000726 Ga0265323_100007266 364
602 3300028666 Ga0265336_10000228 Ga0265336_1000022825 364
603 3300028800 Ga0265338_10000116 Ga0265338_1000011655 364
604 3300042146 Ga0450907_000039 Ga0450907_000039_20178_21347 364
605 3300042147 Ga0450910_000003 Ga0450910_000003_44336_45505 364
606 3300046452 Ga0495617_006028 Ga0495617_006028_985_2085 364
607 3300046458 Ga0495591_000277 Ga0495591_000277_42999_44135 364
608 3300046459 Ga0495629_0006452 Ga0495629_0006452_3222_4391 364
609 3300046463 Ga0495653_0085305 Ga0495653_0085305_948_2117 364
610 3300046471 Ga0495650_0019672 Ga0495650_0019672_1533_2633 364
611 3300046475 Ga0495639_0004138 Ga0495639_0004138_867_2036 364
612 3300046491 Ga0495584_0114703 Ga0495584_0114703_109_1209 364
613 3300046513 Ga0495616_0014457 Ga0495616_0014457_1010_2110 364
614 3300046520 Ga0495637_0030844 Ga0495637_0030844_109_1209 364
615 3300046524 Ga0495648_0000495 Ga0495648_0000495_27227_28363 364
616 3300046524 Ga0495648_0001607 Ga0495648_0001607_17503_18603 364
617 3300046524 Ga0495648_0055323 Ga0495648_0055323_1039_2139 364
618 3300046526 Ga0495666_0004144 Ga0495666_0004144_1588_2757 364
619 3300046535 Ga0495586_0008705 Ga0495586_0008705_1344_2513 364
620 3300046558 Ga0495633_0012386 Ga0495633_0012386_1237_2337 364
621 3300046665 Ga0495661_0000037 Ga0495661_0000037_6314_7513 364
622 3300046691 Ga0495670_0042320 Ga0495670_0042320_609_1808 364
623 3300046692 Ga0495671_0003635 Ga0495671_0003635_4733_5833 364
624 3300046692 Ga0495671_0013022 Ga0495671_0013022_906_2105 364
625 3300046809 Ga0495600_0035921 Ga0495600_0035921_1708_2877 364
626 3300047315 Ga0495581_0016575 Ga0495581_0016575_1527_2696 364
627 3300047317 Ga0495604_0013709 Ga0495604_0013709_2250_3419 364
628 3300047323 Ga0495683_0000268 Ga0495683_0000268_1004_2104 364
629 3300047444 Ga0495675_0009980 Ga0495675_0009980_1106_2275 364
630 3300048091 Ga0495626_0001614 Ga0495626_0001614_7845_8945 364
631 3300048915 Ga0496112_0000092 Ga0496112_0000092_48820_49920 364
632 3300048920 Ga0496117_0000597 Ga0496117_0000597_22102_23214 364
633 3300048921 Ga0496118_0067148 Ga0496118_0067148_904_2016 364
634 3300048922 Ga0496119_0003729 Ga0496119_0003729_4415_5527 364
635 3300048923 Ga0496120_0002470 Ga0496120_0002470_1477_2589 364
636 3300048924 Ga0496121_0011956 Ga0496121_0011956_5526_6632 364
637 3300048925 Ga0496122_0005419 Ga0496122_0005419_529_1629 364
638 3300048925 Ga0496122_0017294 Ga0496122_0017294_5504_6703 364
639 3300048925 Ga0496122_0022873 Ga0496122_0022873_1756_2868 364
640 3300048925 Ga0496122_0159495 Ga0496122_0159495_152_1255 364
641 3300048926 Ga0496123_0000881 Ga0496123_0000881_28642_29742 364
642 3300048926 Ga0496123_0014379 Ga0496123_0014379_2844_3956 364
643 3300048926 Ga0496123_0028038 Ga0496123_0028038_2295_3494 364
644 3300048927 Ga0496124_0000747 Ga0496124_0000747_9072_10184 364
645 3300048928 Ga0496125_0000465 Ga0496125_0000465_5026_6138 364
646 3300048928 Ga0496125_0000715 Ga0496125_0000715_49961_51064 364
647 3300048928 Ga0496125_0006551 Ga0496125_0006551_651_1754 364
648 3300048929 Ga0496126_0032985 Ga0496126_0032985_2419_3522 364
649 3300049568 Ga0501031_0001400 Ga0501031_0001400_108_1205 364
650 3300049569 Ga0501032_0000088 Ga0501032_0000088_8337_9434 364
651 3300049570 Ga0501033_0000724 Ga0501033_0000724_21888_22985 364
652 3300049571 Ga0501034_0000332 Ga0501034_0000332_58516_59613 364
653 3300049572 Ga0501036_0000233 Ga0501036_0000233_21888_22985 364
654 3300049573 Ga0501037_0000421 Ga0501037_0000421_11790_12887 364
655 3300049574 Ga0501038_0000049 Ga0501038_0000049_19188_20285 364
656 3300049575 Ga0501039_0007740 Ga0501039_0007740_271_1368 364
657 3300049578 Ga0501042_0178107 Ga0501042_0178107_188_1285 364
658 3300049579 Ga0501043_0000740 Ga0501043_0000740_13684_14781 364
659 3300049579 Ga0501043_0151716 Ga0501043_0151716_253_1383 364
660 3300049580 Ga0501046_0000087 Ga0501046_0000087_96125_97222 364
661 3300049581 Ga0501047_0001375 Ga0501047_0001375_22526_23623 364
662 3300049582 Ga0501048_0000665 Ga0501048_0000665_23607_24704 364
663 3300049583 Ga0501067_0000497 Ga0501067_0000497_14625_15722 364
664 3300049584 Ga0501068_0001170 Ga0501068_0001170_437_1534 364
665 3300049585 Ga0501069_0027125 Ga0501069_0027125_179_1276 364
666 3300049586 Ga0501070_0004024 Ga0501070_0004024_9222_10319 364
667 3300049586 Ga0501070_0117422 Ga0501070_0117422_719_1849 364
668 3300049588 Ga0501072_0000535 Ga0501072_0000535_24387_25484 364
669 3300049589 Ga0501073_0000112 Ga0501073_0000112_42548_43645 364
670 3300049590 Ga0501074_0000225 Ga0501074_0000225_1834_2931 364
671 3300049592 Ga0501076_0056708 Ga0501076_0056708_574_1671 364
672 3300049742 Ga0501080_0012805 Ga0501080_0012805_2278_3375 364
673 3300049742 Ga0501080_0415678 Ga0501080_0415678_41_1141 364
674 3300049744 Ga0501083_0000724 Ga0501083_0000724_2672_3769 364
675 3300049822 Ga0501035_0001854 Ga0501035_0001854_8952_10049 364
676 3300049822 Ga0501035_0313546 Ga0501035_0313546_10_1140 364
677 3300049823 Ga0501044_0000182 Ga0501044_0000182_9081_10178 364
678 3300049823 Ga0501044_0268266 Ga0501044_0268266_73_1203 364
679 3300049824 Ga0501045_0009807 Ga0501045_0009807_5324_6421 364
680 3300053142 Ga0500577_0001168 Ga0500577_0001168_179_1282 364
681 3300054114 Ga0501084_0013679 Ga0501084_0013679_1567_2664 364
682 3300060353 Ga0501082_0002561 Ga0501082_0002561_5739_6836 364
683 iso_pu_bacteria 2931396565 2931402176 364
684 3300003659 JGI25404J52841_10005899 JGI25404J52841_100058992 365
685 3300005334 Ga0068869_100018161 Ga0068869_1000181611 365
686 3300005347 Ga0070668_100014209 Ga0070668_1000142094 365
687 3300005347 Ga0070668_100116895 Ga0070668_1001168952 365
688 3300005355 Ga0070671_100302100 Ga0070671_1003021002 365
689 3300005365 Ga0070688_100099877 Ga0070688_1000998773 365
690 3300005434 Ga0070709_10029531 Ga0070709_100295312 365
691 3300005441 Ga0070700_100230948 Ga0070700_1002309481 365
692 3300005455 Ga0070663_100150615 Ga0070663_1001506151 365
693 3300005457 Ga0070662_100166060 Ga0070662_1001660601 365
694 3300005458 Ga0070681_10041650 Ga0070681_100416503 365
695 3300005459 Ga0068867_100159777 Ga0068867_1001597772 365
696 3300005539 Ga0068853_100239471 Ga0068853_1002394712 365
697 3300005548 Ga0070665_100028381 Ga0070665_1000283812 365
698 3300005548 Ga0070665_100120791 Ga0070665_1001207912 365
699 3300005577 Ga0068857_100073207 Ga0068857_1000732073 365
700 3300005617 Ga0068859_100347130 Ga0068859_1003471301 365
701 3300005719 Ga0068861_100015843 Ga0068861_1000158433 365
702 3300005842 Ga0068858_100100089 Ga0068858_1001000892 365
703 3300005843 Ga0068860_100214774 Ga0068860_1002147742 365
704 3300005844 Ga0068862_100133564 Ga0068862_1001335642 365
705 3300005937 Ga0081455_10014613 Ga0081455_100146135 365
706 3300005937 Ga0081455_10021871 Ga0081455_100218712 365
707 3300005983 Ga0081540_1002523 Ga0081540_10025233 365
708 3300005983 Ga0081540_1005561 Ga0081540_10055614 365
709 3300005983 Ga0081540_1008122 Ga0081540_10081227 365
710 3300005983 Ga0081540_1014063 Ga0081540_10140633 365
711 3300005983 Ga0081540_1023692 Ga0081540_10236922 365
712 3300005985 Ga0081539_10022424 Ga0081539_100224244 365
713 3300005985 Ga0081539_10119889 Ga0081539_101198891 365
714 3300006038 Ga0075365_10039539 Ga0075365_100395392 365
715 3300006195 Ga0075366_10099370 Ga0075366_100993702 365
716 3300006237 Ga0097621_100173302 Ga0097621_1001733022 365
717 3300006844 Ga0075428_100508497 Ga0075428_1005084971 365
718 3300006881 Ga0068865_100150062 Ga0068865_1001500622 365
719 3300006931 Ga0097620_100347112 Ga0097620_1003471121 365
720 3300009093 Ga0105240_10179384 Ga0105240_101793842 365
721 3300009094 Ga0111539_10166484 Ga0111539_101664842 365
722 3300009098 Ga0105245_10333372 Ga0105245_103333721 365
723 3300009174 Ga0105241_10017520 Ga0105241_100175205 365
724 3300009177 Ga0105248_10039476 Ga0105248_100394762 365
725 3300009177 Ga0105248_10104757 Ga0105248_101047573 365
726 3300009177 Ga0105248_10242173 Ga0105248_102421732 365
727 3300009545 Ga0105237_10017551 Ga0105237_100175511 365
728 3300013104 Ga0157370_10023701 Ga0157370_100237012 365
729 3300014325 Ga0163163_10257548 Ga0163163_102575481 365
730 3300017792 Ga0163161_10081274 Ga0163161_100812742 365
731 3300025297 Ga0209758_1004548 Ga0209758_100454811 365
732 3300025899 Ga0207642_10017501 Ga0207642_100175013 365
733 3300025901 Ga0207688_10075190 Ga0207688_100751902 365
734 3300025906 Ga0207699_10049526 Ga0207699_100495262 365
735 3300025911 Ga0207654_10062017 Ga0207654_100620172 365
736 3300025912 Ga0207707_10000183 Ga0207707_1000018325 365
737 3300025912 Ga0207707_10041289 Ga0207707_100412893 365
738 3300025912 Ga0207707_10044334 Ga0207707_100443342 365
739 3300025913 Ga0207695_10104297 Ga0207695_101042972 365
740 3300025913 Ga0207695_10202932 Ga0207695_102029323 365
741 3300025916 Ga0207663_10051485 Ga0207663_100514852 365
742 3300025921 Ga0207652_10030918 Ga0207652_100309183 365
743 3300025933 Ga0207706_10178668 Ga0207706_101786682 365
744 3300025938 Ga0207704_10193729 Ga0207704_101937291 365
745 3300025940 Ga0207691_10073564 Ga0207691_100735642 365
746 3300025942 Ga0207689_10009475 Ga0207689_100094755 365
747 3300025942 Ga0207689_10092855 Ga0207689_100928551 365
748 3300025961 Ga0207712_10164296 Ga0207712_101642961 365
749 3300025972 Ga0207668_10002816 Ga0207668_100028165 365
750 3300026023 Ga0207677_10209737 Ga0207677_102097372 365
751 3300026041 Ga0207639_10144425 Ga0207639_101444252 365
752 3300026067 Ga0207678_10128748 Ga0207678_101287481 365
753 3300026075 Ga0207708_10162731 Ga0207708_101627312 365
754 3300026116 Ga0207674_10072873 Ga0207674_100728733 365
755 3300026118 Ga0207675_100026570 Ga0207675_1000265703 365
756 3300026118 Ga0207675_100043143 Ga0207675_1000431434 365
757 3300026118 Ga0207675_100170054 Ga0207675_1001700542 365
758 3300026121 Ga0207683_10022491 Ga0207683_100224916 365
759 3300026142 Ga0207698_10113771 Ga0207698_101137711 365
760 3300027671 Ga0209588_1003169 Ga0209588_10031694 365
761 3300027866 Ga0209813_10016262 Ga0209813_100162622 365
762 3300027907 Ga0207428_10139564 Ga0207428_101395641 365
763 3300028380 Ga0268265_10228551 Ga0268265_102285512 365
764 3300028381 Ga0268264_10206188 Ga0268264_102061881 365
765 3300028381 Ga0268264_10272720 Ga0268264_102727201 365
766 3300028786 Ga0307517_10000512 Ga0307517_1000051248 365
767 3300028794 Ga0307515_10007488 Ga0307515_1000748811 365
768 3300031456 Ga0307513_10073302 Ga0307513_100733023 365
769 3300031456 Ga0307513_10236593 Ga0307513_102365931 365
770 3300031616 Ga0307508_10064347 Ga0307508_100643472 365
771 3300031730 Ga0307516_10018988 Ga0307516_100189882 365
772 3300031730 Ga0307516_10030771 Ga0307516_100307716 365
773 3300032002 Ga0307416_100417741 Ga0307416_1004177411 365
774 3300033180 Ga0307510_10019030 Ga0307510_100190307 365
775 3300033180 Ga0307510_10027729 Ga0307510_100277295 365
776 3300035691 Ga0373931_0001380 Ga0373931_0001380_1395_2720 365
777 3300035695 Ga0373927_0071970 Ga0373927_0071970_567_1700 365
778 3300046459 Ga0495629_0049926 Ga0495629_0049926_1089_2189 365
779 3300046491 Ga0495584_0048245 Ga0495584_0048245_715_1815 365
780 3300046507 Ga0495606_0007581 Ga0495606_0007581_6146_7249 365
781 3300046533 Ga0495640_0067970 Ga0495640_0067970_186_1283 365
782 3300046615 Ga0495656_0048636 Ga0495656_0048636_152_1438 365
783 3300046616 Ga0495668_0057388 Ga0495668_0057388_352_1638 365
784 3300047320 Ga0495672_0013056 Ga0495672_0013056_3406_4506 365
785 3300048904 Ga0496101_0043013 Ga0496101_0043013_1626_2951 365
786 3300048905 Ga0496102_0084715 Ga0496102_0084715_107_1207 365
787 3300048905 Ga0496102_0127879 Ga0496102_0127879_1115_2215 365
788 3300048907 Ga0496104_0055365 Ga0496104_0055365_18_1118 365
789 3300048908 Ga0496105_0008027 Ga0496105_0008027_4691_6025 365
790 3300048908 Ga0496105_0141303 Ga0496105_0141303_260_1360 365
791 3300048909 Ga0496106_0150380 Ga0496106_0150380_135_1235 365
792 3300048910 Ga0496107_0131341 Ga0496107_0131341_145_1245 365
793 3300048912 Ga0496109_0317752 Ga0496109_0317752_32_1132 365
794 3300048913 Ga0496110_0098166 Ga0496110_0098166_790_2124 365
795 3300048913 Ga0496110_0289023 Ga0496110_0289023_193_1293 365
796 3300048915 Ga0496112_0022945 Ga0496112_0022945_4720_5820 365
797 3300048915 Ga0496112_0180075 Ga0496112_0180075_775_1875 365
798 3300048916 Ga0496113_0104267 Ga0496113_0104267_785_2110 365
799 3300048917 Ga0496114_0183966 Ga0496114_0183966_396_1721 365
800 3300048918 Ga0496115_0009296 Ga0496115_0009296_5013_6347 365
801 3300048924 Ga0496121_0012486 Ga0496121_0012486_449_1627 365
802 3300048924 Ga0496121_0136221 Ga0496121_0136221_623_1723 365
803 3300048924 Ga0496121_0213346 Ga0496121_0213346_253_1353 365
804 3300048929 Ga0496126_0048648 Ga0496126_0048648_1077_2180 365
805 3300048929 Ga0496126_0269315 Ga0496126_0269315_228_1328 365
806 3300049583 Ga0501067_0065719 Ga0501067_0065719_327_1427 365
807 3300050490 nmdc:mga03n38_14093_c1 nmdc:mga03n38_14093_c1_1807_2907 365
808 3300050491 nmdc:mga00v17_69015_c1 nmdc:mga00v17_69015_c1_858_1958 365
809 3300050492 nmdc:mga0yw44_33330_c1 nmdc:mga0yw44_33330_c1_333_1433 365
810 3300053084 Ga0495595_0052800 Ga0495595_0052800_524_1624 365
811 3300053085 Ga0495619_0060800 Ga0495619_0060800_342_1442 365
812 3300053094 Ga0500566_0030104 Ga0500566_0030104_1360_2460 365
813 3300053119 Ga0500595_002485 Ga0500595_002485_1203_2303 365
814 3300053147 Ga0500589_059706 Ga0500589_059706_41_1141 365
815 3300053151 Ga0500604_0021610 Ga0500604_0021610_94_1194 365
816 3300053178 Ga0500637_0000070 Ga0500637_0000070_966_2066 365
817 3300055283 Ga0500661_000295 Ga0500661_000295_170_1270 365
818 2010549000 RicEn_C518 RicEn_09430 366
819 3300003215 JGI25153J46596_10012255 JGI25153J46596_100122554 366
820 3300005262 Ga0065165_1003298 Ga0065165_100329811 366
821 3300005347 Ga0070668_100191174 Ga0070668_1001911741 366
822 3300005367 Ga0070667_100082075 Ga0070667_1000820752 366
823 3300005436 Ga0070713_100003582 Ga0070713_1000035823 366
824 3300005548 Ga0070665_100055243 Ga0070665_1000552433 366
825 3300005548 Ga0070665_100123491 Ga0070665_1001234912 366
826 3300005563 Ga0068855_100080153 Ga0068855_1000801533 366
827 3300005616 Ga0068852_100447594 Ga0068852_1004475941 366
828 3300006028 Ga0070717_10001217 Ga0070717_100012177 366
829 3300006175 Ga0070712_100024239 Ga0070712_1000242392 366
830 3300006178 Ga0075367_10037970 Ga0075367_100379702 366
831 3300006195 Ga0075366_10002966 Ga0075366_100029662 366
832 3300006353 Ga0075370_10062061 Ga0075370_100620612 366
833 3300006871 Ga0075434_100059477 Ga0075434_1000594772 366
834 3300006881 Ga0068865_100115100 Ga0068865_1001151002 366
835 3300009101 Ga0105247_10151573 Ga0105247_101515732 366
836 3300009545 Ga0105237_10068296 Ga0105237_100682963 366
837 3300009545 Ga0105237_10086943 Ga0105237_100869433 366
838 3300009545 Ga0105237_10094860 Ga0105237_100948603 366
839 3300010375 Ga0105239_10279610 Ga0105239_102796101 366
840 3300013105 Ga0157369_10015529 Ga0157369_100155295 366
841 3300013297 Ga0157378_10438857 Ga0157378_104388571 366
842 3300013307 Ga0157372_10059579 Ga0157372_100595792 366
843 3300021361 Ga0213872_10080224 Ga0213872_100802242 366
844 3300022467 Ga0224712_10039317 Ga0224712_100393172 366
845 3300025230 Ga0209563_103827 Ga0209563_1038273 366
846 3300025253 Ga0209677_106649 Ga0209677_1066493 366
847 3300025254 Ga0209148_1004413 Ga0209148_10044133 366
848 3300025272 Ga0209455_1001894 Ga0209455_10018945 366
849 3300025297 Ga0209758_1000455 Ga0209758_100045521 366
850 3300025302 Ga0207426_1016572 Ga0207426_10165722 366
851 3300025304 Ga0209257_1022124 Ga0209257_10221242 366
852 3300025315 Ga0207697_10080544 Ga0207697_100805441 366
853 3300025898 Ga0207692_10103793 Ga0207692_101037932 366
854 3300025904 Ga0207647_10015412 Ga0207647_100154124 366
855 3300025910 Ga0207684_10132220 Ga0207684_101322202 366
856 3300025914 Ga0207671_10018896 Ga0207671_100188961 366
857 3300025914 Ga0207671_10100908 Ga0207671_101009081 366
858 3300025916 Ga0207663_10026638 Ga0207663_100266382 366
859 3300025928 Ga0207700_10057661 Ga0207700_100576613 366
860 3300025931 Ga0207644_10038405 Ga0207644_100384053 366
861 3300025942 Ga0207689_10249181 Ga0207689_102491811 366
862 3300025949 Ga0207667_10053775 Ga0207667_100537753 366
863 3300025949 Ga0207667_10404232 Ga0207667_104042321 366
864 3300026067 Ga0207678_10028732 Ga0207678_100287324 366
865 3300026088 Ga0207641_10064291 Ga0207641_100642913 366
866 3300027296 Ga0209389_1000088 Ga0209389_100008879 366
867 3300027357 Ga0209589_1000189 Ga0209589_100018969 366
868 3300027361 Ga0209489_100085 Ga0209489_100085119 366
869 3300028379 Ga0268266_10012198 Ga0268266_100121987 366
870 3300028381 Ga0268264_10000038 Ga0268264_10000038275 366
871 3300030521 Ga0307511_10050496 Ga0307511_100504962 366
872 3300031507 Ga0307509_10061128 Ga0307509_100611283 366
873 3300031616 Ga0307508_10000008 Ga0307508_1000000870 366
874 3300031616 Ga0307508_10035397 Ga0307508_100353973 366
875 3300031711 Ga0265314_10057045 Ga0265314_100570453 366
876 3300031730 Ga0307516_10010586 Ga0307516_100105862 366
877 3300031730 Ga0307516_10217765 Ga0307516_102177652 366
878 3300033179 Ga0307507_10070227 Ga0307507_100702273 366
879 3300033180 Ga0307510_10002929 Ga0307510_100029297 366
880 3300035113 Ga0373936_0030603 Ga0373936_0030603_785_1888 366
881 3300035170 Ga0373943_0018990 Ga0373943_0018990_1630_2733 366
882 3300035695 Ga0373927_0187110 Ga0373927_0187110_135_1286 366
883 3300035725 Ga0373947_0047992 Ga0373947_0047992_269_1420 366
884 3300037312 Ga0395899_0093094 Ga0395899_0093094_26_1129 366
885 3300037418 Ga0395900_0007038 Ga0395900_0007038_5607_6710 366
886 3300037466 Ga0395898_0020988 Ga0395898_0020988_5344_6447 366
887 3300037466 Ga0395898_0022680 Ga0395898_0022680_2233_3333 366
888 3300038443 Ga0395901_0225213 Ga0395901_0225213_18_1121 366
889 3300039437 Ga0436365_0684116 Ga0436365_0684116_1417_2520 366
890 3300039437 Ga0436365_1929134 Ga0436365_1929134_1612_2715 366
891 3300039447 Ga0436361_0143038 Ga0436361_0143038_327_1427 366
892 3300044684 Ga0466966_0001211 Ga0466966_0001211_1634_2734 366
893 3300044693 Ga0466961_0000122 Ga0466961_0000122_41667_42767 366
894 3300045049 Ga0466959_0059685 Ga0466959_0059685_1301_2401 366
895 3300046459 Ga0495629_0054618 Ga0495629_0054618_519_1619 366
896 3300046462 Ga0495651_0021716 Ga0495651_0021716_2134_3237 366
897 3300046529 Ga0495652_0042749 Ga0495652_0042749_2322_3425 366
898 3300046543 Ga0495645_0201583 Ga0495645_0201583_210_1313 366
899 3300046642 Ga0495634_0057587 Ga0495634_0057587_1254_2357 366
900 3300046675 Ga0495657_0059608 Ga0495657_0059608_842_1945 366
901 3300046678 Ga0495599_0113410 Ga0495599_0113410_296_1399 366
902 3300046679 Ga0495623_0103107 Ga0495623_0103107_59_1162 366
903 3300046689 Ga0495613_0067625 Ga0495613_0067625_965_2065 366
904 3300046809 Ga0495600_0007723 Ga0495600_0007723_3118_4221 366
905 3300046809 Ga0495600_0044751 Ga0495600_0044751_1342_2442 366
906 3300047315 Ga0495581_0038037 Ga0495581_0038037_560_1660 366
907 3300047317 Ga0495604_0033733 Ga0495604_0033733_2482_3585 366
908 3300047319 Ga0495674_0059592 Ga0495674_0059592_1790_2893 366
909 3300047321 Ga0495676_0144723 Ga0495676_0144723_424_1524 366
910 3300047322 Ga0495680_0025360 Ga0495680_0025360_3197_4300 366
911 3300047443 Ga0495687_032703 Ga0495687_032703_246_1346 366
912 3300047444 Ga0495675_0058306 Ga0495675_0058306_858_1961 366
913 3300047673 Ga0495593_0045016 Ga0495593_0045016_38_1138 366
914 3300048088 Ga0495602_0039507 Ga0495602_0039507_1128_2231 366
915 3300048091 Ga0495626_0064258 Ga0495626_0064258_178_1278 366
916 3300048905 Ga0496102_0043655 Ga0496102_0043655_802_1902 366
917 3300048906 Ga0496103_0004910 Ga0496103_0004910_4822_5922 366
918 3300048907 Ga0496104_0066433 Ga0496104_0066433_2006_3106 366
919 3300048908 Ga0496105_0124701 Ga0496105_0124701_189_1289 366
920 3300048908 Ga0496105_0177875 Ga0496105_0177875_242_1342 366
921 3300048909 Ga0496106_0001246 Ga0496106_0001246_15405_16511 366
922 3300048911 Ga0496108_0103104 Ga0496108_0103104_1244_2344 366
923 3300048912 Ga0496109_0037159 Ga0496109_0037159_1482_2582 366
924 3300048916 Ga0496113_0055605 Ga0496113_0055605_1594_2694 366
925 3300048918 Ga0496115_0082927 Ga0496115_0082927_68_1168 366
926 3300048920 Ga0496117_0015920 Ga0496117_0015920_3006_4112 366
927 3300048921 Ga0496118_0003356 Ga0496118_0003356_15579_16685 366
928 3300048922 Ga0496119_0063099 Ga0496119_0063099_308_1408 366
929 3300048924 Ga0496121_0000365 Ga0496121_0000365_89264_90367 366
930 3300048924 Ga0496121_0001293 Ga0496121_0001293_38763_39869 366
931 3300048924 Ga0496121_0205731 Ga0496121_0205731_266_1366 366
932 3300048926 Ga0496123_0082083 Ga0496123_0082083_608_1708 366
933 3300048927 Ga0496124_0008358 Ga0496124_0008358_4342_5448 366
934 3300048928 Ga0496125_0035399 Ga0496125_0035399_779_1879 366
935 3300048929 Ga0496126_0021615 Ga0496126_0021615_2472_3578 366
936 3300048929 Ga0496126_0119262 Ga0496126_0119262_276_1376 366
937 3300050493 nmdc:mga0k408_20123_c1 nmdc:mga0k408_20123_c1_265_1365 366
938 3300050512 nmdc:mga0n895_59665_c1 nmdc:mga0n895_59665_c1_577_1680 366
939 3300050516 nmdc:mga0sz30_4817_c1 nmdc:mga0sz30_4817_c1_2997_4097 366
940 3300053080 Ga0500635_0026631 Ga0500635_0026631_221_1372 366
941 3300053080 Ga0500635_0068446 Ga0500635_0068446_77_1180 366
942 3300053083 Ga0495655_0017646 Ga0495655_0017646_216_1316 366
943 3300053087 Ga0500643_000042 Ga0500643_000042_113381_114481 366
944 3300053092 Ga0500583_0033492 Ga0500583_0033492_347_1447 366
945 3300053094 Ga0500566_0000621 Ga0500566_0000621_9951_11054 366
946 3300053095 Ga0500640_033399 Ga0500640_033399_49_1152 366
947 3300053103 Ga0500555_009551 Ga0500555_009551_756_1856 366
948 3300053111 Ga0500572_010027 Ga0500572_010027_379_1482 366
949 3300053122 Ga0500608_088098 Ga0500608_088098_333_1436 366
950 3300053123 Ga0500614_005792 Ga0500614_005792_70_1173 366
951 3300053136 Ga0500559_0017592 Ga0500559_0017592_1161_2267 366
952 3300053136 Ga0500559_0031194 Ga0500559_0031194_110_1213 366
953 3300053150 Ga0500603_000230 Ga0500603_000230_2232_3335 366
954 3300053159 Ga0500630_002647 Ga0500630_002647_6435_7538 366
955 3300053162 Ga0500638_033382 Ga0500638_033382_1036_2139 366
956 3300053162 Ga0500638_045874 Ga0500638_045874_964_2070 366
957 3300053162 Ga0500638_083695 Ga0500638_083695_44_1144 366
958 3300053163 Ga0500639_000029 Ga0500639_000029_49223_50326 366
959 3300053177 Ga0500636_0038527 Ga0500636_0038527_333_1439 366
960 3300053735 Ga0500596_002346 Ga0500596_002346_2201_3304 366
961 3300053735 Ga0500596_003221 Ga0500596_003221_1592_2698 366

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00724

Oxidored_FMN

NADH:flavin oxidoreductase / NADH oxidase family

83

416

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
5epd-assembly1.cif.gz_A crystal structure of glycerol trinitrate reductase xdpb from agrobacterium sp. r89-1 (apo form) 0.9885 7 366
5epd-assembly1.cif.gz_A crystal structure of glycerol trinitrate reductase xdpb from agrobacterium sp. r89-1 (apo form) 0.9801 7 366
6s32-assembly1.cif.gz_A crystal structure of ene-reductase ctoye from chroococcidiopsis thermalis. 0.9791 6 360
4jip-assembly1.cif.gz_A crystal structure of glycerol trinitrate reductase nera from agrobacterium radiobacter in complex with 4-hydroxybenzaldehyde 0.979 5 360
6s32-assembly3.cif.gz_C crystal structure of ene-reductase ctoye from chroococcidiopsis thermalis. 0.9771 6 360
ID Description Score Start End Superfamily
4jicB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9802 5 360 3.20.20.70
4a3uA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9694 6 360 3.20.20.70
4a3uA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9641 6 360 3.20.20.70
4awuA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.961 6 359 3.20.20.70
af_P0DI08_1_267_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9604 3 257 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A164GDP6-F1-model_v4 NADH-dependent flavin oxidoreductase yqiG-like protein 1 161 256 GO:0005829
GO:0010181
GO:0016491
AF-A0A6L6JK14-F1-model_v4 Alkene reductase 0.9972 4 342 GO:0005829
GO:0010181
GO:0016491
AF-A0A7G7SLH2-F1-model_v4 deleted 0.9955 4 360
AF-A0A2D7YZG0-F1-model_v4 deleted 0.99 4 115
AF-Q5H1L7-F1-model_v4 GTN reductase 0.9898 3 360 GO:0005829
GO:0010181
GO:0016491

Feature Viewer

pLDDT pTM Quality
96.17 0.94 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map