F486790

General Info

Members Datasets Scaffolds Average Seq Length
958 496 908 171

Family's Representative Sequence

Representative Sequence 3300005563|Ga0068855_100139617|Ga0068855_1001396172
Length 184
Sequence MTSSTHHDTAPLAPSSPLRPAILERFAREVAKYPEAGKQSAVMACLAIVQQEEGFVSLQREREIAEYLGMAPIAVHEVTTFYNMYNQHPVGKFKLNVCTNLPCQLRDGVTALVHLEKKLGIKMGETTADGLFTLQQSECLGACADSPVMLVNDRTMCSFMSNEKLDQLIDGLRNAAPAAKGEAS

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
3 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
4 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
5 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
6 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
7 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
8 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
9 2643221658 Variovorax sp. Root411 Isolate Unclassified
10 2643221672 Variovorax sp. Root434 Isolate Unclassified
11 2643221683 Variovorax sp. Root473 Isolate Unclassified
12 2721755523 Delftia sp. HK171 Isolate Unclassified
13 2738541277 Variovorax sp. GV051 Isolate Unclassified
14 2738541307 Variovorax sp. GV008 Isolate Unclassified
15 2738543013 Variovorax sp. BT01 Isolate Unclassified
16 2738543019 Variovorax sp. GV040 Isolate Unclassified
17 2818991446 Variovorax sp. 1180 Isolate Unclassified
18 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
19 2831864461 Roseateles noduli HZ7 Isolate Nodule
20 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
21 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
22 2842677519 Variovorax sp. R-72495 Isolate Unclassified
23 2842733646 Variovorax sp. R-72446 Isolate Unclassified
24 2842747753 Variovorax sp. R-72060 Isolate Unclassified
25 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
26 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
27 2885198086 Variovorax sp. 679 Isolate Unclassified
28 2885211737 Variovorax sp. 553 Isolate Unclassified
29 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
30 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
31 2899924645 Variovorax sp. 369 Isolate Unclassified
32 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
33 2904456579 Variovorax sp. 2002 Isolate Unclassified
34 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
35 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
36 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
37 2928037797 Variovorax sp. 1126 Isolate Unclassified
38 2928044640 Variovorax sp. 1128 Isolate Unclassified
39 2928051484 Variovorax sp. 1133 Isolate Unclassified
40 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
41 2928070936 Variovorax gossypii 1167 Isolate Unclassified
42 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
43 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
44 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
45 2929520902 Variovorax beijingensis 502 Isolate Unclassified
46 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
47 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
48 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
49 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
50 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
51 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
52 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
53 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
54 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
55 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
56 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
57 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
58 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
59 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
60 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
61 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
62 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
63 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
64 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
65 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
66 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
67 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
68 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
69 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
70 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
71 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
72 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
73 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
74 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
75 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
76 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
77 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
78 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
79 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
80 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
81 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
82 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
83 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
84 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
85 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
86 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
87 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
88 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
89 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
90 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
91 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
92 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
93 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
94 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
95 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
96 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
97 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
98 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
99 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
100 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
101 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
102 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
103 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
104 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
105 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
106 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
107 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
108 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
109 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
110 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
111 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
112 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
113 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
114 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
115 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
116 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
117 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
118 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
119 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
120 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
121 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
122 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
123 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
124 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
125 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
126 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
127 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
128 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
129 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
130 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
131 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
132 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
133 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
134 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
135 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
136 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
137 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
138 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
139 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
140 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
141 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
142 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
143 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
144 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
145 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
146 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
147 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
148 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
149 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
150 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
151 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
152 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
153 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
154 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
155 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
156 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
157 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
158 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
159 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
160 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
161 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
162 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
163 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
164 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
165 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
166 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
167 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
168 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
169 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
170 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
171 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
172 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
173 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
174 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
175 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
176 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
177 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
178 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
179 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
180 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
181 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
182 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
183 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
184 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
185 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
186 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
187 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
188 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
189 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
190 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
191 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
192 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
193 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
194 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
195 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
196 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
197 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
198 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
199 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
200 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
201 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
202 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
203 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
204 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
205 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
206 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
207 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
247 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
254 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
255 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
256 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
257 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
258 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
259 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
260 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
261 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
262 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
263 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
264 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
265 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
266 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
268 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
269 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
270 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
271 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
272 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
273 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
274 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
275 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
276 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
277 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
278 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
279 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
280 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
281 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
282 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
283 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
284 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
285 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
286 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
287 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
288 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
289 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
290 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
291 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
292 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
293 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
294 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
295 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
296 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
297 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
298 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
299 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
300 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
301 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
302 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
303 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
304 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
305 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
306 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
307 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
308 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
309 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
310 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
311 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
312 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
313 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
314 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
315 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
316 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
317 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
318 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
319 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
320 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
321 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
322 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
323 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
324 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
325 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
326 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
327 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
328 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
329 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
330 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
331 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
332 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
333 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
334 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
335 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
336 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
337 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
338 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
339 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
340 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
341 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
342 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
343 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
344 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
345 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
346 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
347 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
348 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
349 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
350 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
351 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
352 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
353 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
354 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
355 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
356 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
357 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
358 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
359 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
360 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
361 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
362 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
363 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
364 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
365 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
366 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
367 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
368 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
369 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
370 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
371 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
372 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
373 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
374 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
375 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
376 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
377 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
378 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
379 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
380 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
381 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
382 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
383 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
384 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
385 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
386 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
387 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
388 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
389 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
390 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
391 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
392 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
393 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
394 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
395 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
396 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
397 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
398 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
399 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
400 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
401 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
402 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
403 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
404 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
405 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
406 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
407 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
408 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
409 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
410 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
411 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
412 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
413 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
414 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
415 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
416 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
417 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
418 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
419 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
420 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
421 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
422 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
423 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
424 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
425 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
426 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
427 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
428 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
429 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
430 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
431 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
432 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
433 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
434 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
435 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
436 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
437 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
438 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
439 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
440 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
441 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
442 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
443 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
444 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
445 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
446 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
447 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
448 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
449 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
450 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
451 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
452 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
453 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
454 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
455 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
456 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
457 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
458 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
459 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
460 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
461 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
462 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
463 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
464 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
465 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
466 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
467 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
468 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
469 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
470 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
471 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
472 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
473 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
474 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
475 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
476 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
477 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
478 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
479 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
480 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
481 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
482 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
483 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
484 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
485 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
486 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
487 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
488 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
489 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
490 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
491 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
492 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
493 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
494 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
495 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
496 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.74
Metatranscriptomes 1.04
Isolates 5.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 27.45
Nodule 1.04
Rhizoplane 2.82
Rhizosphere 58.25
Stem 0
Stem Tuber 0
Unclassified 10.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_556956 2162886007 Bacteria 1134
2 SwRhRL2b_contig_612720 2162886007 Bacteria 3259
3 JGI24741J21665_1011580 3300001915 Bacteria 1537
4 JGI24740J21852_10007552 3300001979 Bacteria 4404
5 JGI24739J22299_10103394 3300001989 Bacteria 858
6 JGI25155J39150_1000051 3300002704 Bacteria 76772
7 JGI25156J39149_1000196 3300002705 Bacteria 42272
8 JGI25156J39149_1002448 3300002705 Bacteria 6652
9 JGI25156J39149_1010889 3300002705 Bacteria 2101
10 JGI25156J39149_1016094 3300002705 Bacteria 1469
11 JGI25156J39149_1019551 3300002705 Bacteria 1216
12 JGI25156J39149_1034850 3300002705 Bacteria 726
13 JGI25154J39366_1000344 3300002738 Bacteria 26657
14 JGI25154J39366_1001442 3300002738 Bacteria 8427
15 JGI25158J39367_1008994 3300002739 Bacteria 1377
16 JGI25157J39369_1000091 3300002741 Bacteria 76837
17 JGI25157J39369_1000095 3300002741 Bacteria 74770
18 JGI25164J39214_1004101 3300002772 Bacteria 1718
19 JGI25152J39213_1037143 3300002773 Bacteria 708
20 JGI25150J39212_1003713 3300002774 Bacteria 3526
21 JGI25150J39212_1011607 3300002774 Bacteria 1589
22 JGI25159J45721_1006730 3300002987 Bacteria 3389
23 JGI25159J45721_1011402 3300002987 Bacteria 2181
24 JGI25159J45721_1011673 3300002987 Bacteria 2138
25 JGI25159J45721_1018912 3300002987 Bacteria 1373
26 JGI25151J46595_10007945 3300003187 Bacteria 5145
27 JGI25151J46595_10017803 3300003187 Bacteria 3068
28 JGI25151J46595_10029389 3300003187 Bacteria 2177
29 JGI25151J46595_10050766 3300003187 Bacteria 1409
30 JGI25151J46595_10112700 3300003187 Bacteria 708
31 rootH1_10052921 3300003316 Bacteria 1068
32 rootL2_10007894 3300003322 Bacteria 2706
33 rootH1_10045102 3300003323 Bacteria 1455
34 rootH1_10075206 3300003323 Bacteria 1108
35 JGI25160J50197_1000067 3300003354 Bacteria 113436
36 JGI25161J50226_1000035 3300003374 Bacteria 133666
37 JGI25161J50226_1006295 3300003374 Bacteria 2166
38 Ga0006562J51391_1178712 3300003578 Bacteria 1342
39 Ga0006562J51391_1178713 3300003578 Bacteria 1230
40 Ga0055539_1005506 3300003752 Bacteria 1644
41 Ga0055539_1005852 3300003752 Bacteria 1586
42 Ga0055539_1013569 3300003752 Bacteria 998
43 Ga0055533_1000100 3300003756 Bacteria 111692
44 Ga0055525_1000011 3300003759 Bacteria 503124
45 Ga0055527_1008701 3300003760 Bacteria 1207
46 Ga0055535_1000442 3300003761 Bacteria 38340
47 Ga0055535_1000863 3300003761 Bacteria 21397
48 Ga0055535_1005897 3300003761 Bacteria 2585
49 Ga0055535_1020685 3300003761 Bacteria 813
50 Ga0055542_1000052 3300003762 Bacteria 173583
51 Ga0055529_1001089 3300003763 Bacteria 12329
52 Ga0055526_1004349 3300003771 Bacteria 8557
53 Ga0055526_1008880 3300003771 Bacteria 4936
54 Ga0055526_1020588 3300003771 Bacteria 2338
55 Ga0055526_1065313 3300003771 Bacteria 758
56 Ga0055537_1000104 3300003773 Bacteria 63394
57 Ga0055537_1001588 3300003773 Bacteria 8587
58 Ga0055537_1008606 3300003773 Bacteria 2337
59 Ga0055524_1000006 3300003775 Bacteria 324702
60 Ga0055524_1003866 3300003775 Bacteria 7103
61 Ga0055524_1008425 3300003775 Bacteria 4284
62 Ga0055524_1067228 3300003775 Bacteria 708
63 Ga0055536_1004362 3300003781 Bacteria 7267
64 Ga0055536_1004691 3300003781 Bacteria 6890
65 Ga0055536_1025851 3300003781 Bacteria 1661
66 Ga0055536_1036860 3300003781 Bacteria 1204
67 Ga0055534_1000042 3300003784 Bacteria 99433
68 Ga0055534_1001777 3300003784 Bacteria 8128
69 Ga0055534_1008779 3300003784 Bacteria 2257
70 Ga0055528_1001140 3300003790 Bacteria 17289
71 Ga0055528_1002054 3300003790 Bacteria 11254
72 Ga0055528_1029635 3300003790 Bacteria 1475
73 Ga0055530_10004417 3300003791 Bacteria 7239
74 Ga0055530_10007775 3300003791 Bacteria 4439
75 Ga0055530_10035007 3300003791 Bacteria 1278
76 Ga0055540_1000005 3300003792 Bacteria 378126
77 Ga0055540_1002976 3300003792 Bacteria 8499
78 Ga0055540_1003651 3300003792 Bacteria 7330
79 Ga0055540_1016035 3300003792 Bacteria 2151
80 Ga0055540_1036359 3300003792 Bacteria 1094
81 Ga0055531_10001665 3300003794 Bacteria 16006
82 Ga0055531_10001799 3300003794 Bacteria 15235
83 Ga0055531_10022530 3300003794 Bacteria 2397
84 Ga0055543_1000829 3300004625 Bacteria 15064
85 Ga0055543_1011894 3300004625 Bacteria 1766
86 Ga0065165_1000652 3300005262 Bacteria 50081
87 Ga0065165_1041154 3300005262 Bacteria 1373
88 Ga0065165_1043890 3300005262 Bacteria 1310
89 Ga0065165_1115931 3300005262 Bacteria 654
90 Ga0065714_10014061 3300005288 Bacteria 1858
91 Ga0065714_10165842 3300005288 Bacteria 974
92 Ga0065704_10070938 3300005289 Bacteria 14403
93 Ga0065704_10133441 3300005289 Bacteria 1600
94 Ga0065704_10376822 3300005289 Bacteria 778
95 Ga0070658_10122431 3300005327 Bacteria 2162
96 Ga0070658_10222314 3300005327 Bacteria 1597
97 Ga0070658_10334877 3300005327 Bacteria 1294
98 Ga0070658_10411192 3300005327 Bacteria 1163
99 Ga0070658_10566352 3300005327 Bacteria 983
100 Ga0070658_10853035 3300005327 Bacteria 792
101 Ga0070690_100350952 3300005330 Bacteria 1071
102 Ga0068869_100447378 3300005334 Bacteria 1070
103 Ga0068869_100517225 3300005334 Bacteria 999
104 Ga0068869_100617051 3300005334 Bacteria 917
105 Ga0070666_10378579 3300005335 Bacteria 1016
106 Ga0070682_100641991 3300005337 Bacteria 844
107 Ga0068868_100095204 3300005338 Bacteria 2403
108 Ga0068868_100369826 3300005338 Bacteria 1231
109 Ga0070660_100039370 3300005339 Bacteria 3593
110 Ga0070660_100480338 3300005339 Bacteria 1032
111 Ga0070689_100442156 3300005340 Bacteria 1105
112 Ga0070661_100656584 3300005344 Bacteria 852
113 Ga0070669_100491563 3300005353 Bacteria 1017
114 Ga0070669_100971547 3300005353 Bacteria 728
115 Ga0070671_100614427 3300005355 Bacteria 940
116 Ga0070674_100776006 3300005356 Bacteria 826
117 Ga0070674_101093710 3300005356 Bacteria 704
118 Ga0070673_100123144 3300005364 Bacteria 2166
119 Ga0070659_100987932 3300005366 Bacteria 738
120 Ga0070659_100998626 3300005366 Bacteria 734
121 Ga0070667_100499833 3300005367 Bacteria 1114
122 Ga0070667_101452783 3300005367 Bacteria 644
123 Ga0070714_100995587 3300005435 Bacteria 816
124 Ga0070700_100772228 3300005441 Bacteria 771
125 Ga0070678_100101205 3300005456 Bacteria 2233
126 Ga0070678_100179788 3300005456 Bacteria 1730
127 Ga0070678_100691882 3300005456 Bacteria 918
128 Ga0070678_100692321 3300005456 Bacteria 918
129 Ga0070662_100083339 3300005457 Bacteria 2386
130 Ga0070681_10852971 3300005458 Bacteria 829
131 Ga0068867_100382438 3300005459 Bacteria 1183
132 Ga0070685_10278490 3300005466 Bacteria 1119
133 Ga0070698_100003836 3300005471 Bacteria 16525
134 Ga0070698_100589412 3300005471 Bacteria 1052
135 Ga0070679_100056638 3300005530 Bacteria 3906
136 Ga0070679_100216348 3300005530 Bacteria 1878
137 Ga0070684_100210194 3300005535 Bacteria 1773
138 Ga0068853_100029605 3300005539 Bacteria 4618
139 Ga0068853_100106808 3300005539 Bacteria 2482
140 Ga0068853_100189424 3300005539 Bacteria 1868
141 Ga0068853_100330909 3300005539 Bacteria 1413
142 Ga0068853_100345846 3300005539 Bacteria 1382
143 Ga0070672_100265667 3300005543 Bacteria 1448
144 Ga0070695_100272400 3300005545 Bacteria 1240
145 Ga0070665_100041269 3300005548 Bacteria 4638
146 Ga0070665_100172802 3300005548 Bacteria 2162
147 Ga0070665_100214987 3300005548 Bacteria 1923
148 Ga0068855_100139617 3300005563 Bacteria 2764
149 Ga0068855_100798393 3300005563 Bacteria 1003
150 Ga0068855_101642976 3300005563 Bacteria 656
151 Ga0070664_100014663 3300005564 Bacteria 6398
152 Ga0070664_101524211 3300005564 Bacteria 633
153 Ga0068857_100635888 3300005577 Bacteria 1010
154 Ga0068857_101475164 3300005577 Bacteria 662
155 Ga0068857_101543723 3300005577 Bacteria 647
156 Ga0068854_100073065 3300005578 Bacteria 2512
157 Ga0068854_100674651 3300005578 Bacteria 890
158 Ga0068856_100006504 3300005614 Bacteria 11461
159 Ga0068856_101091037 3300005614 Bacteria 816
160 Ga0068852_101024674 3300005616 Bacteria 844
161 Ga0068861_100073024 3300005719 Bacteria 2664
162 Ga0068861_101778945 3300005719 Bacteria 611
163 Ga0068851_10026307 3300005834 Bacteria 2858
164 Ga0068860_100695209 3300005843 Bacteria 1026
165 Ga0068860_101593280 3300005843 Bacteria 675
166 Ga0068862_101370927 3300005844 Bacteria 710
167 Ga0068862_101671402 3300005844 Bacteria 645
168 Ga0075365_10011063 3300006038 Bacteria 5290
169 Ga0075365_10034436 3300006038 Bacteria 3270
170 Ga0075365_10111680 3300006038 Bacteria 1879
171 Ga0075365_10543533 3300006038 Bacteria 822
172 Ga0075365_10568385 3300006038 Bacteria 802
173 Ga0075368_10160909 3300006042 Bacteria 940
174 Ga0075363_100119843 3300006048 Bacteria 1469
175 Ga0075363_100148455 3300006048 Bacteria 1322
176 Ga0075363_100346938 3300006048 Bacteria 866
177 Ga0075364_10153091 3300006051 Bacteria 1554
178 Ga0075364_10396410 3300006051 Bacteria 942
179 Ga0075432_10028199 3300006058 Bacteria 1936
180 Ga0075362_10106793 3300006177 Bacteria 1314
181 Ga0075362_10228974 3300006177 Bacteria 910
182 Ga0075362_10330189 3300006177 Bacteria 761
183 Ga0075367_10129178 3300006178 Bacteria 1561
184 Ga0075367_10362893 3300006178 Bacteria 915
185 Ga0075366_10000944 3300006195 Bacteria 14143
186 Ga0075366_10004207 3300006195 Bacteria 7714
187 Ga0075366_10051827 3300006195 Bacteria 2438
188 Ga0075366_10055916 3300006195 Bacteria 2343
189 Ga0075366_10104538 3300006195 Bacteria 1701
190 Ga0075366_10185080 3300006195 Bacteria 1265
191 Ga0075366_10248222 3300006195 Bacteria 1085
192 Ga0097621_100308339 3300006237 Bacteria 1400
193 Ga0097621_100798068 3300006237 Bacteria 875
194 Ga0075370_10005914 3300006353 Bacteria 6120
195 Ga0075370_10013218 3300006353 Bacteria 4381
196 Ga0075370_10015686 3300006353 Bacteria 4062
197 Ga0075370_10018343 3300006353 Bacteria 3797
198 Ga0075370_10051644 3300006353 Bacteria 2332
199 Ga0075370_10074826 3300006353 Bacteria 1941
200 Ga0075370_10089857 3300006353 Bacteria 1771
201 Ga0075370_10244587 3300006353 Bacteria 1062
202 Ga0075370_10292001 3300006353 Bacteria 969
203 Ga0075370_10308673 3300006353 Bacteria 941
204 Ga0075370_10363423 3300006353 Bacteria 866
205 Ga0075370_10681556 3300006353 Bacteria 624
206 Ga0068871_100114546 3300006358 Bacteria 2272
207 Ga0068871_101539474 3300006358 Bacteria 629
208 Ga0075431_100599986 3300006847 Bacteria 1085
209 Ga0075434_101182919 3300006871 Bacteria 777
210 Ga0099823_1002850 3300006944 Bacteria 15979
211 Ga0079104_1000002 3300006946 Bacteria 514469
212 Ga0079104_1019147 3300006946 Bacteria 1921
213 Ga0099826_10004379 3300006948 Bacteria 9886
214 Ga0105250_10000636 3300009092 Bacteria 22497
215 Ga0105240_10016601 3300009093 Bacteria 9961
216 Ga0105245_10109483 3300009098 Bacteria 2567
217 Ga0105245_10947068 3300009098 Bacteria 904
218 Ga0105245_11220745 3300009098 Bacteria 800
219 Ga0105243_10001518 3300009148 Bacteria 20292
220 Ga0105243_10196633 3300009148 Bacteria 1765
221 Ga0105243_10591726 3300009148 Bacteria 1067
222 Ga0105243_10724121 3300009148 Bacteria 972
223 Ga0105241_10312714 3300009174 Bacteria 1352
224 Ga0105242_11700010 3300009176 Bacteria 667
225 Ga0105248_10394621 3300009177 Bacteria 1558
226 Ga0105248_11168740 3300009177 Bacteria 870
227 Ga0105248_11234180 3300009177 Bacteria 845
228 Ga0105248_11611217 3300009177 Bacteria 735
229 Ga0105237_10071021 3300009545 Bacteria 3477
230 Ga0105237_10097733 3300009545 Bacteria 2927
231 Ga0105237_10914585 3300009545 Bacteria 884
232 Ga0105238_10210168 3300009551 Bacteria 1922
233 Ga0105238_10276401 3300009551 Bacteria 1660
234 Ga0105238_10402007 3300009551 Bacteria 1363
235 Ga0105238_10669857 3300009551 Bacteria 1048
236 Ga0105249_11226610 3300009553 Bacteria 821
237 Ga0105239_10694822 3300010375 Bacteria 1163
238 Ga0105239_11995128 3300010375 Bacteria 674
239 Ga0105246_10059447 3300011119 Bacteria 2652
240 Ga0105246_10174552 3300011119 Bacteria 1649
241 Ga0157319_1000006 3300012497 Bacteria 361506
242 Ga0157326_1001580 3300012513 Bacteria 2491
243 Ga0157373_10321126 3300013100 Bacteria 1101
244 Ga0157371_10270095 3300013102 Bacteria 1227
245 Ga0157370_10108200 3300013104 Bacteria 2600
246 Ga0157370_10484449 3300013104 Bacteria 1136
247 Ga0157370_10547057 3300013104 Bacteria 1061
248 Ga0157370_11264892 3300013104 Bacteria 665
249 Ga0157370_11524002 3300013104 Bacteria 601
250 Ga0157369_10052460 3300013105 Bacteria 4412
251 Ga0157369_10461227 3300013105 Bacteria 1315
252 Ga0157369_10721735 3300013105 Bacteria 1026
253 Ga0157378_10212374 3300013297 Bacteria 1836
254 Ga0157378_10329890 3300013297 Bacteria 1485
255 Ga0163162_10219614 3300013306 Bacteria 2031
256 Ga0163162_11141142 3300013306 Bacteria 884
257 Ga0157372_10374353 3300013307 Bacteria 1660
258 Ga0157375_10926408 3300013308 Bacteria 1014
259 Ga0157375_11901375 3300013308 Bacteria 706
260 Ga0157375_12543502 3300013308 Bacteria 611
261 Ga0157380_11822584 3300014326 Bacteria 668
262 Ga0182008_10006435 3300014497 Bacteria 6567
263 Ga0182008_10011458 3300014497 Bacteria 4714
264 Ga0182008_10088039 3300014497 Bacteria 1530
265 Ga0182008_10088370 3300014497 Bacteria 1527
266 Ga0182008_10545867 3300014497 Bacteria 643
267 Ga0157379_10932939 3300014968 Bacteria 825
268 Ga0157379_11050138 3300014968 Bacteria 778
269 Ga0157376_10027129 3300014969 Bacteria 4536
270 Ga0157376_10416763 3300014969 Bacteria 1302
271 Ga0157376_10540140 3300014969 Bacteria 1152
272 Ga0182006_1029973 3300015261 Bacteria 2202
273 Ga0182006_1079259 3300015261 Bacteria 1201
274 Ga0182006_1127620 3300015261 Bacteria 878
275 Ga0182007_10009741 3300015262 Bacteria 3847
276 Ga0182007_10056054 3300015262 Bacteria 1295
277 Ga0182007_10134829 3300015262 Bacteria 832
278 Ga0182005_1042568 3300015265 Bacteria 1234
279 Ga0183362_10003 3300015683 Bacteria 977584
280 Ga0163161_10113482 3300017792 Bacteria 2028
281 Ga0163161_10251236 3300017792 Bacteria 1378
282 Ga0163161_10350775 3300017792 Bacteria 1173
283 Ga0163161_10611348 3300017792 Bacteria 900
284 Ga0213872_10012343 3300021361 Bacteria 4020
285 Ga0209435_100062 3300025206 Bacteria 77288
286 Ga0209566_111698 3300025225 Bacteria 853
287 Ga0209674_100003 3300025226 Bacteria 2196646
288 Ga0209672_100633 3300025228 Bacteria 18178
289 Ga0209672_108077 3300025228 Bacteria 1580
290 Ga0209147_101695 3300025229 Bacteria 7189
291 Ga0209563_100005 3300025230 Bacteria 1774893
292 Ga0209563_100017 3300025230 Bacteria 796449
293 Ga0209563_112761 3300025230 Bacteria 1136
294 Ga0207427_100380 3300025231 Bacteria 26848
295 Ga0209258_100009 3300025242 Bacteria 996276
296 Ga0209258_100414 3300025242 Bacteria 51162
297 Ga0209258_104537 3300025242 Bacteria 2602
298 Ga0207425_1001373 3300025245 Bacteria 10310
299 Ga0207425_1013370 3300025245 Bacteria 1899
300 Ga0209646_1000001 3300025246 Bacteria 3092932
301 Ga0209646_1000271 3300025246 Bacteria 47713
302 Ga0209026_1000085 3300025250 Bacteria 185778
303 Ga0209026_1000224 3300025250 Bacteria 77298
304 Ga0209677_102048 3300025253 Bacteria 7978
305 Ga0209677_108757 3300025253 Bacteria 1908
306 Ga0209148_1000007 3300025254 Bacteria 1592273
307 Ga0209148_1003800 3300025254 Bacteria 3958
308 Ga0209759_1000013 3300025256 Bacteria 399300
309 Ga0209759_1000068 3300025256 Bacteria 183479
310 Ga0209759_1008209 3300025256 Bacteria 3276
311 Ga0209759_1014909 3300025256 Bacteria 2029
312 Ga0209759_1014925 3300025256 Bacteria 2028
313 Ga0209759_1038431 3300025256 Bacteria 850
314 Ga0209129_1000083 3300025258 Bacteria 183270
315 Ga0209129_1003940 3300025258 Bacteria 6154
316 Ga0209129_1018123 3300025258 Bacteria 1360
317 Ga0209565_1000083 3300025263 Bacteria 154007
318 Ga0209565_1001476 3300025263 Bacteria 10298
319 Ga0209565_1001861 3300025263 Bacteria 8433
320 Ga0209455_1000264 3300025272 Bacteria 60245
321 Ga0209673_1000043 3300025273 Bacteria 291503
322 Ga0209673_1000089 3300025273 Bacteria 202240
323 Ga0209673_1000323 3300025273 Bacteria 87588
324 Ga0209673_1001307 3300025273 Bacteria 25210
325 Ga0209673_1022593 3300025273 Bacteria 2166
326 Ga0209673_1027737 3300025273 Bacteria 1837
327 Ga0209130_1000241 3300025284 Bacteria 70093
328 Ga0209130_1001189 3300025284 Bacteria 18564
329 Ga0209130_1002203 3300025284 Bacteria 10241
330 Ga0209130_1008941 3300025284 Bacteria 2904
331 Ga0209130_1024873 3300025284 Bacteria 1303
332 Ga0209675_1000081 3300025291 Bacteria 154007
333 Ga0209675_1000832 3300025291 Bacteria 20310
334 Ga0209675_1002121 3300025291 Bacteria 10492
335 Ga0209675_1006532 3300025291 Bacteria 4655
336 Ga0209675_1006965 3300025291 Bacteria 4429
337 Ga0209675_1035958 3300025291 Bacteria 1125
338 Ga0209676_1000004 3300025292 Bacteria 1138360
339 Ga0209676_1000007 3300025292 Bacteria 1029371
340 Ga0209676_1002834 3300025292 Bacteria 11469
341 Ga0209676_1010599 3300025292 Bacteria 3813
342 Ga0209676_1014584 3300025292 Bacteria 2947
343 Ga0209025_1000133 3300025294 Bacteria 195885
344 Ga0209025_1001314 3300025294 Bacteria 33818
345 Ga0209025_1001691 3300025294 Bacteria 26944
346 Ga0209025_1003025 3300025294 Bacteria 16602
347 Ga0209025_1005532 3300025294 Bacteria 10255
348 Ga0209025_1032356 3300025294 Bacteria 2447
349 Ga0209025_1044212 3300025294 Bacteria 1865
350 Ga0209025_1046308 3300025294 Bacteria 1790
351 Ga0209564_1000003 3300025295 Bacteria 1585848
352 Ga0209564_1000285 3300025295 Bacteria 102585
353 Ga0209564_1000323 3300025295 Bacteria 93122
354 Ga0209564_1000332 3300025295 Bacteria 91674
355 Ga0209564_1000877 3300025295 Bacteria 40004
356 Ga0209564_1011461 3300025295 Bacteria 3970
357 Ga0209758_1000132 3300025297 Bacteria 183273
358 Ga0209758_1034699 3300025297 Bacteria 2002
359 Ga0209050_1000002 3300025298 Bacteria 1792849
360 Ga0209050_1000003 3300025298 Bacteria 1609245
361 Ga0209050_1003126 3300025298 Bacteria 12649
362 Ga0209050_1012163 3300025298 Bacteria 3983
363 Ga0209050_1024990 3300025298 Bacteria 2046
364 Ga0209050_1046448 3300025298 Bacteria 1141
365 Ga0209050_1054110 3300025298 Bacteria 992
366 Ga0209256_1000001 3300025299 Bacteria 2166974
367 Ga0209256_1000973 3300025299 Bacteria 34412
368 Ga0209256_1005250 3300025299 Bacteria 7568
369 Ga0209256_1005263 3300025299 Bacteria 7552
370 Ga0209256_1023182 3300025299 Bacteria 1858
371 Ga0207426_1000097 3300025302 Bacteria 265930
372 Ga0207426_1000247 3300025302 Bacteria 119659
373 Ga0207426_1000323 3300025302 Bacteria 91662
374 Ga0207426_1000584 3300025302 Bacteria 48547
375 Ga0209051_1000002 3300025303 Bacteria 1631846
376 Ga0209051_1000003 3300025303 Bacteria 1609245
377 Ga0209051_1000792 3300025303 Bacteria 33275
378 Ga0209051_1001375 3300025303 Bacteria 21010
379 Ga0209051_1001732 3300025303 Bacteria 17375
380 Ga0209051_1003281 3300025303 Bacteria 10730
381 Ga0209051_1003624 3300025303 Bacteria 10010
382 Ga0209051_1004724 3300025303 Bacteria 8261
383 Ga0209051_1024877 3300025303 Bacteria 2451
384 Ga0209051_1098509 3300025303 Bacteria 793
385 Ga0209257_1000002 3300025304 Bacteria 1767052
386 Ga0209257_1000020 3300025304 Bacteria 773356
387 Ga0209257_1000361 3300025304 Bacteria 92239
388 Ga0209257_1000396 3300025304 Bacteria 86000
389 Ga0209257_1002969 3300025304 Bacteria 15497
390 Ga0209257_1020159 3300025304 Bacteria 2477
391 Ga0209257_1061327 3300025304 Bacteria 1020
392 Ga0209257_1071107 3300025304 Bacteria 917
393 Ga0207696_1006799 3300025711 Bacteria 4559
394 Ga0207655_1001053 3300025728 Bacteria 27547
395 Ga0207688_10376841 3300025901 Bacteria 877
396 Ga0207680_10071484 3300025903 Bacteria 2151
397 Ga0207647_10307818 3300025904 Bacteria 901
398 Ga0207645_10448292 3300025907 Bacteria 871
399 Ga0207705_10073695 3300025909 Bacteria 2477
400 Ga0207705_10604773 3300025909 Bacteria 852
401 Ga0207705_10615649 3300025909 Bacteria 844
402 Ga0207705_10725700 3300025909 Bacteria 772
403 Ga0207684_10004749 3300025910 Bacteria 12735
404 Ga0207654_10256218 3300025911 Bacteria 1175
405 Ga0207695_10047646 3300025913 Bacteria 4533
406 Ga0207695_10065364 3300025913 Bacteria 3740
407 Ga0207671_10056734 3300025914 Bacteria 2902
408 Ga0207671_10116538 3300025914 Bacteria 2038
409 Ga0207657_10033997 3300025919 Bacteria 4591
410 Ga0207657_10162882 3300025919 Bacteria 1811
411 Ga0207649_10071923 3300025920 Bacteria 2211
412 Ga0207652_10122726 3300025921 Bacteria 2312
413 Ga0207652_10529203 3300025921 Bacteria 1060
414 Ga0207646_10106246 3300025922 Bacteria 2518
415 Ga0207681_10136776 3300025923 Bacteria 1819
416 Ga0207681_10474105 3300025923 Bacteria 1021
417 Ga0207650_10663105 3300025925 Bacteria 880
418 Ga0207664_10814602 3300025929 Bacteria 840
419 Ga0207644_10829721 3300025931 Bacteria 774
420 Ga0207690_10242705 3300025932 Bacteria 1388
421 Ga0207690_10413488 3300025932 Bacteria 1078
422 Ga0207690_11024363 3300025932 Bacteria 687
423 Ga0207690_11164369 3300025932 Bacteria 643
424 Ga0207706_10551472 3300025933 Bacteria 992
425 Ga0207686_10118183 3300025934 Bacteria 1800
426 Ga0207686_10153924 3300025934 Bacteria 1604
427 Ga0207709_10000015 3300025935 Bacteria 493221
428 Ga0207709_10001284 3300025935 Bacteria 17904
429 Ga0207709_10059162 3300025935 Bacteria 2384
430 Ga0207709_10073934 3300025935 Bacteria 2173
431 Ga0207670_10305361 3300025936 Bacteria 1247
432 Ga0207669_10053330 3300025937 Bacteria 2435
433 Ga0207669_11007170 3300025937 Bacteria 700
434 Ga0207691_10158961 3300025940 Bacteria 1983
435 Ga0207711_11415885 3300025941 Bacteria 638
436 Ga0207689_10073610 3300025942 Bacteria 2807
437 Ga0207689_10326122 3300025942 Bacteria 1274
438 Ga0207689_10407218 3300025942 Bacteria 1134
439 Ga0207661_11615580 3300025944 Bacteria 593
440 Ga0207667_10016760 3300025949 Bacteria 8267
441 Ga0207667_10125418 3300025949 Bacteria 2644
442 Ga0207667_10471167 3300025949 Bacteria 1275
443 Ga0207667_10528360 3300025949 Bacteria 1195
444 Ga0207667_10563607 3300025949 Bacteria 1151
445 Ga0207667_10590836 3300025949 Bacteria 1120
446 Ga0207651_10279236 3300025960 Bacteria 1379
447 Ga0207668_10437509 3300025972 Bacteria 1113
448 Ga0207640_10007957 3300025981 Bacteria 5853
449 Ga0207640_10497649 3300025981 Bacteria 1014
450 Ga0207658_10258800 3300025986 Bacteria 1482
451 Ga0207677_10271364 3300026023 Bacteria 1388
452 Ga0207703_10672871 3300026035 Bacteria 983
453 Ga0207639_10050722 3300026041 Bacteria 3152
454 Ga0207639_10133878 3300026041 Bacteria 2055
455 Ga0207639_10537257 3300026041 Bacteria 1072
456 Ga0207678_10366621 3300026067 Bacteria 1244
457 Ga0207702_10001691 3300026078 Bacteria 21798
458 Ga0207702_10125932 3300026078 Bacteria 2300
459 Ga0207641_10034600 3300026088 Bacteria 4204
460 Ga0207648_10347118 3300026089 Bacteria 1337
461 Ga0207648_10838308 3300026089 Bacteria 857
462 Ga0207676_10469654 3300026095 Bacteria 1189
463 Ga0207674_10012042 3300026116 Bacteria 9689
464 Ga0207674_10530439 3300026116 Bacteria 1137
465 Ga0207674_10688022 3300026116 Bacteria 987
466 Ga0207675_100198018 3300026118 Bacteria 1929
467 Ga0207683_10054906 3300026121 Bacteria 3493
468 Ga0207683_10332922 3300026121 Bacteria 1392
469 Ga0207683_10480400 3300026121 Bacteria 1147
470 Ga0207683_10580811 3300026121 Bacteria 1037
471 Ga0207683_10644338 3300026121 Bacteria 981
472 Ga0207683_10928040 3300026121 Bacteria 808
473 Ga0207683_10950920 3300026121 Bacteria 798
474 Ga0207698_10467936 3300026142 Bacteria 1220
475 Ga0207698_10647487 3300026142 Bacteria 1046
476 Ga0207698_11354366 3300026142 Bacteria 727
477 Ga0207698_11438385 3300026142 Bacteria 704
478 Ga0209281_1000007 3300027111 Bacteria 938265
479 Ga0209389_1054541 3300027296 Bacteria 2653
480 Ga0209371_1030410 3300027312 Bacteria 1183
481 Ga0209967_1031377 3300027364 Bacteria 795
482 Ga0209996_1019193 3300027395 Bacteria 954
483 Ga0209984_1008526 3300027424 Bacteria 1290
484 Ga0209968_1016556 3300027526 Bacteria 1172
485 Ga0209970_1004463 3300027614 Bacteria 2325
486 Ga0209983_1032617 3300027665 Bacteria 1113
487 Ga0209282_1001621 3300027666 Bacteria 12483
488 Ga0209971_1002849 3300027682 Bacteria 4132
489 Ga0209974_10008135 3300027876 Bacteria 3592
490 Ga0209974_10110487 3300027876 Bacteria 967
491 Ga0207428_10489967 3300027907 Bacteria 894
492 Ga0268266_10029582 3300028379 Bacteria 4656
493 Ga0268266_10371144 3300028379 Bacteria 1348
494 Ga0268265_10541893 3300028380 Bacteria 1103
495 Ga0268264_10368811 3300028381 Bacteria 1372
496 Ga0268264_10916109 3300028381 Bacteria 880
497 Ga0265334_10116263 3300028573 Bacteria 958
498 Ga0265336_10000044 3300028666 Bacteria 131932
499 Ga0307515_10000195 3300028794 Bacteria 148138
500 Ga0307515_10000515 3300028794 Bacteria 92187
501 Ga0307515_10162677 3300028794 Bacteria 2267
502 Ga0265324_10000446 3300029957 Bacteria 29338
503 Ga0268256_1012436 3300030500 Bacteria 2632
504 Ga0307511_10082309 3300030521 Bacteria 2252
505 Ga0316177_1051055 3300030731 Bacteria 6318
506 Ga0316176_1222992 3300030732 Bacteria 4114
507 Ga0316178_1083600 3300030735 Bacteria 5925
508 Ga0316180_1048969 3300030736 Bacteria 6728
509 Ga0316183_1136198 3300030742 Bacteria 1007
510 Ga0316181_1077794 3300030744 Bacteria 6128
511 Ga0265330_10000033 3300031235 Bacteria 126931
512 Ga0265332_10000001 3300031238 Bacteria 863783
513 Ga0265332_10000014 3300031238 Bacteria 249035
514 Ga0265332_10002998 3300031238 Bacteria 8283
515 Ga0265328_10037651 3300031239 Bacteria 1786
516 Ga0265325_10008684 3300031241 Bacteria 5978
517 Ga0265340_10006547 3300031247 Bacteria 6399
518 Ga0265327_10000425 3300031251 Bacteria 77143
519 Ga0265327_10053432 3300031251 Bacteria 2097
520 Ga0265327_10289466 3300031251 Bacteria 723
521 Ga0265316_10369743 3300031344 Bacteria 1036
522 Ga0307513_10000004 3300031456 Bacteria 558931
523 Ga0307513_10000054 3300031456 Bacteria 148887
524 Ga0307513_10160220 3300031456 Bacteria 2144
525 Ga0307513_10323610 3300031456 Bacteria 1299
526 Ga0307513_10353524 3300031456 Bacteria 1216
527 Ga0307509_10169060 3300031507 Bacteria 2069
528 Ga0307509_10242669 3300031507 Bacteria 1593
529 Ga0307408_100023297 3300031548 Bacteria 4215
530 Ga0307408_100320969 3300031548 Bacteria 1304
531 Ga0307408_100373619 3300031548 Bacteria 1217
532 Ga0307408_100543639 3300031548 Bacteria 1024
533 Ga0307408_101257891 3300031548 Bacteria 692
534 Ga0307514_10000529 3300031649 Bacteria 74752
535 Ga0307514_10161453 3300031649 Bacteria 1482
536 Ga0265314_10000022 3300031711 Bacteria 297299
537 Ga0265314_10001258 3300031711 Bacteria 28871
538 Ga0265342_10012278 3300031712 Bacteria 5808
539 Ga0307516_10039216 3300031730 Bacteria 4723
540 Ga0307516_10039984 3300031730 Bacteria 4670
541 Ga0307405_10228311 3300031731 Bacteria 1370
542 Ga0307405_10296381 3300031731 Bacteria 1224
543 Ga0307410_10498680 3300031852 Bacteria 1001
544 Ga0307406_10099212 3300031901 Bacteria 1979
545 Ga0307406_10173112 3300031901 Bacteria 1564
546 Ga0307406_10737544 3300031901 Bacteria 826
547 Ga0307406_11074864 3300031901 Bacteria 694
548 Ga0307412_10056316 3300031911 Bacteria 2619
549 Ga0307412_10083120 3300031911 Bacteria 2219
550 Ga0307412_10219336 3300031911 Bacteria 1457
551 Ga0307412_10288994 3300031911 Bacteria 1291
552 Ga0307412_10406145 3300031911 Bacteria 1110
553 Ga0307412_10504921 3300031911 Bacteria 1007
554 Ga0307412_10589239 3300031911 Bacteria 940
555 Ga0307412_10783085 3300031911 Bacteria 826
556 Ga0307412_11000778 3300031911 Bacteria 738
557 Ga0307416_100192452 3300032002 Bacteria 1925
558 Ga0307416_100769352 3300032002 Bacteria 1057
559 Ga0307416_101252644 3300032002 Bacteria 847
560 Ga0307414_10323491 3300032004 Bacteria 1313
561 Ga0307414_11216634 3300032004 Bacteria 698
562 Ga0307411_10160720 3300032005 Bacteria 1682
563 Ga0316593_10000144 3300032168 Bacteria 10105
564 Ga0316593_10000732 3300032168 Bacteria 6450
565 Ga0316596_1005126 3300033541 Bacteria 2979
566 Ga0373959_0017007 3300034820 Bacteria 1354
567 Ga0373934_0032944 3300035086 Bacteria 2034
568 Ga0373956_0310803 3300035119 Bacteria 751
569 Ga0316574_0079360 3300035398 Bacteria 2082
570 Ga0373931_0001569 3300035691 Bacteria 9864
571 Ga0373927_0261239 3300035695 Bacteria 1139
572 Ga0373937_0707607 3300036401 Bacteria 954
573 Ga0316582_0071388 3300036647 Bacteria 2249
574 Ga0316582_0420452 3300036647 Bacteria 921
575 Ga0316584_0005757 3300036712 Bacteria 8350
576 Ga0316584_0047614 3300036712 Bacteria 3203
577 Ga0395899_0001965 3300037312 Bacteria 16903
578 Ga0395899_0067138 3300037312 Bacteria 2632
579 Ga0395899_0285555 3300037312 Bacteria 1121
580 Ga0395899_0564282 3300037312 Bacteria 730
581 Ga0395900_0035029 3300037418 Bacteria 5170
582 Ga0395900_0051271 3300037418 Bacteria 4251
583 Ga0395900_0843447 3300037418 Bacteria 842
584 Ga0395900_0969594 3300037418 Bacteria 771
585 Ga0395898_0015164 3300037466 Bacteria 7910
586 Ga0395898_0026539 3300037466 Bacteria 5826
587 Ga0395898_0922804 3300037466 Bacteria 811
588 Ga0395905_0000125 3300037471 Bacteria 126341
589 Ga0395905_0004037 3300037471 Bacteria 15407
590 Ga0395905_0008037 3300037471 Bacteria 10422
591 Ga0395905_0013989 3300037471 Bacteria 7677
592 Ga0395905_0019808 3300037471 Bacteria 6377
593 Ga0395905_0057085 3300037471 Bacteria 3651
594 Ga0395905_0113321 3300037471 Bacteria 2547
595 Ga0395905_0133216 3300037471 Bacteria 2337
596 Ga0395905_0190926 3300037471 Bacteria 1921
597 Ga0395905_0287775 3300037471 Bacteria 1530
598 Ga0395905_0334305 3300037471 Bacteria 1405
599 Ga0395905_0842173 3300037471 Bacteria 820
600 Ga0395901_0011265 3300038443 Bacteria 9060
601 Ga0395901_0029516 3300038443 Bacteria 5647
602 Ga0395901_0321204 3300038443 Bacteria 1602
603 Ga0395901_0492984 3300038443 Bacteria 1248
604 Ga0395901_0673385 3300038443 Bacteria 1035
605 Ga0395901_0695043 3300038443 Bacteria 1015
606 Ga0395901_0861666 3300038443 Bacteria 890
607 Ga0436361_0240598 3300039447 Bacteria 30904
608 Ga0436361_0349482 3300039447 Bacteria 149171
609 Ga0436361_0677555 3300039447 Bacteria 1860
610 Ga0436361_0791561 3300039447 Bacteria 5319
611 Ga0439436_0017321 3300041404 Bacteria 2156
612 Ga0439436_0036469 3300041404 Bacteria 1418
613 Ga0439436_0047309 3300041404 Bacteria 1221
614 Ga0439436_0084864 3300041404 Bacteria 881
615 Ga0439438_033184 3300041405 Bacteria 1365
616 Ga0439439_0043331 3300041406 Bacteria 1170
617 Ga0439439_0057069 3300041406 Bacteria 1032
618 Ga0439461_0003310 3300041410 Bacteria 2645
619 Ga0439466_0043460 3300041411 Bacteria 1492
620 Ga0439466_0196802 3300041411 Bacteria 613
621 Ga0439465_0004945 3300041413 Bacteria 4283
622 Ga0439465_0012268 3300041413 Bacteria 2681
623 Ga0439465_0063356 3300041413 Bacteria 1228
624 Ga0451791_0718593 3300041451 Bacteria 878
625 Ga0451798_0727212 3300041458 Bacteria 579
626 Ga0451807_1602126 3300041486 Bacteria 1008
627 Ga0451839_0671410 3300041496 Bacteria 887
628 Ga0451841_0612739 3300041498 Bacteria 750
629 Ga0451853_3461985 3300041512 Bacteria 863
630 Ga0439431_0018496 3300041997 Bacteria 1649
631 Ga0439433_0006502 3300041999 Bacteria 2515
632 Ga0439433_0038722 3300041999 Bacteria 1106
633 Ga0439437_014647 3300042000 Bacteria 917
634 Ga0439442_008290 3300042002 Bacteria 2097
635 Ga0439442_010969 3300042002 Bacteria 1841
636 Ga0439442_036909 3300042002 Bacteria 1023
637 Ga0439445_0006877 3300042004 Bacteria 2626
638 Ga0439448_0125371 3300042005 Bacteria 883
639 Ga0439432_000644 3300042006 Bacteria 13066
640 Ga0439432_008235 3300042006 Bacteria 3665
641 Ga0439449_0000752 3300042007 Bacteria 12455
642 Ga0439449_0022143 3300042007 Bacteria 2378
643 Ga0439449_0027467 3300042007 Bacteria 2124
644 Ga0439449_0050000 3300042007 Bacteria 1546
645 Ga0439452_007471 3300042010 Bacteria 3345
646 Ga0439457_029307 3300042014 Bacteria 1219
647 Ga0439457_055990 3300042014 Bacteria 889
648 Ga0439462_0029579 3300042015 Bacteria 1449
649 Ga0450921_002961 3300042123 Bacteria 1167
650 Ga0450923_012556 3300042125 Bacteria 1544
651 Ga0450890_008872 3300042127 Bacteria 1286
652 Ga0450890_021028 3300042127 Bacteria 886
653 Ga0450897_000516 3300042128 Bacteria 2162
654 Ga0450894_004749 3300042131 Bacteria 1763
655 Ga0450896_002895 3300042133 Bacteria 2247
656 Ga0450898_003128 3300042134 Bacteria 2358
657 Ga0450899_010789 3300042135 Bacteria 1015
658 Ga0450906_026602 3300042145 Bacteria 1027
659 Ga0439446_0034759 3300042156 Bacteria 1468
660 Ga0439446_0106780 3300042156 Bacteria 890
661 Ga0450908_021205 3300042184 Bacteria 1141
662 Ga0439434_0023131 3300042435 Bacteria 1869
663 Ga0439434_0030058 3300042435 Bacteria 1648
664 Ga0439444_0022352 3300042437 Bacteria 1127
665 Ga0439459_0001649 3300042438 Bacteria 3326
666 Ga0439464_0027079 3300042439 Bacteria 1593
667 Ga0450918_001339 3300042531 Bacteria 4941
668 Ga0450918_041571 3300042531 Bacteria 826
669 Ga0451577_0005231 3300042876 Bacteria 13346
670 Ga0451577_0104198 3300042876 Bacteria 2535
671 Ga0451577_0282355 3300042876 Bacteria 1504
672 Ga0451577_0916257 3300042876 Bacteria 789
673 Ga0466969_0001251 3300044656 Bacteria 13703
674 Ga0466969_0194922 3300044656 Bacteria 925
675 Ga0466972_0023932 3300044658 Bacteria 3034
676 Ga0466972_0064731 3300044658 Bacteria 1749
677 Ga0466972_0118240 3300044658 Bacteria 1250
678 Ga0453683_0007492 3300044673 Bacteria 7398
679 Ga0466965_0000845 3300044683 Bacteria 11610
680 Ga0466965_0075812 3300044683 Bacteria 1696
681 Ga0466965_0088341 3300044683 Bacteria 1574
682 Ga0466966_0077415 3300044684 Bacteria 2075
683 Ga0466966_0123187 3300044684 Bacteria 1591
684 Ga0466966_0140415 3300044684 Bacteria 1476
685 Ga0466966_0241175 3300044684 Bacteria 1090
686 Ga0466961_0001077 3300044693 Bacteria 16828
687 Ga0466961_0113051 3300044693 Bacteria 1707
688 Ga0466961_0118257 3300044693 Bacteria 1665
689 Ga0466961_0174961 3300044693 Bacteria 1334
690 Ga0466963_0029557 3300044694 Bacteria 3529
691 Ga0466963_0385338 3300044694 Bacteria 988
692 Ga0466964_0007733 3300044706 Bacteria 4023
693 Ga0453684_0045142 3300044712 Bacteria 5883
694 Ga0453684_0127674 3300044712 Bacteria 3057
695 Ga0453684_0175174 3300044712 Bacteria 2524
696 Ga0453684_0258814 3300044712 Bacteria 1994
697 Ga0453684_0504094 3300044712 Bacteria 1340
698 Ga0466968_0065248 3300044735 Bacteria 1576
699 Ga0466970_0048862 3300044765 Bacteria 2256
700 Ga0466970_0281990 3300044765 Bacteria 934
701 Ga0466970_0391520 3300044765 Bacteria 792
702 Ga0466970_0713518 3300044765 Bacteria 585
703 Ga0466957_0043815 3300044842 Bacteria 2710
704 Ga0466957_0565863 3300044842 Bacteria 793
705 Ga0466960_0103735 3300044901 Bacteria 1468
706 Ga0466960_0109265 3300044901 Bacteria 1434
707 Ga0466960_0208918 3300044901 Bacteria 1069
708 Ga0466959_0041941 3300045049 Bacteria 3377
709 Ga0466959_0055275 3300045049 Bacteria 2898
710 Ga0466959_0323962 3300045049 Bacteria 1053
711 Ga0451576_0011443 3300045051 Bacteria 10080
712 Ga0451576_0142539 3300045051 Bacteria 2499
713 Ga0451576_0572666 3300045051 Bacteria 1186
714 Ga0466958_0053641 3300045836 Bacteria 2444
715 Ga0466967_0135326 3300045976 Bacteria 2291
716 Ga0466967_0724658 3300045976 Bacteria 986
717 Ga0495627_022181 3300046453 Bacteria 2092
718 Ga0495629_0425965 3300046459 Bacteria 900
719 Ga0495638_0104703 3300046460 Bacteria 1687
720 Ga0495651_0207609 3300046462 Bacteria 1366
721 Ga0495653_0238043 3300046463 Bacteria 1215
722 Ga0495650_0070989 3300046471 Bacteria 1366
723 Ga0495650_0292295 3300046471 Bacteria 547
724 Ga0495585_0018632 3300046492 Bacteria 4003
725 Ga0495607_0238780 3300046501 Bacteria 880
726 Ga0495583_0004321 3300046506 Bacteria 10256
727 Ga0495606_0006532 3300046507 Bacteria 10727
728 Ga0495606_0142292 3300046507 Bacteria 1415
729 Ga0495610_0034618 3300046512 Bacteria 2600
730 Ga0495616_0067004 3300046513 Bacteria 1746
731 Ga0495618_0094409 3300046514 Bacteria 1913
732 Ga0495620_0008493 3300046515 Bacteria 5510
733 Ga0495630_0703730 3300046517 Bacteria 773
734 Ga0495631_0066034 3300046518 Bacteria 1565
735 Ga0495637_0057927 3300046520 Bacteria 1598
736 Ga0495643_0121676 3300046522 Bacteria 1318
737 Ga0495663_0103779 3300046525 Bacteria 938
738 Ga0495652_0181604 3300046529 Bacteria 1614
739 Ga0495654_0024669 3300046530 Bacteria 3105
740 Ga0495609_0054040 3300046538 Bacteria 1784
741 Ga0495621_0125043 3300046539 Bacteria 997
742 Ga0495597_0003773 3300046542 Bacteria 8624
743 Ga0495622_0097092 3300046557 Bacteria 1352
744 Ga0495633_0048538 3300046558 Bacteria 2004
745 Ga0495633_0145159 3300046558 Bacteria 1097
746 Ga0495667_0218832 3300046559 Bacteria 1216
747 Ga0495668_0256532 3300046616 Bacteria 957
748 Ga0495625_0001775 3300046660 Bacteria 24896
749 Ga0495625_0101136 3300046660 Bacteria 1980
750 Ga0495625_0210708 3300046660 Bacteria 1277
751 Ga0495625_0344295 3300046660 Bacteria 944
752 Ga0495635_0473731 3300046663 Bacteria 826
753 Ga0495659_0252860 3300046664 Bacteria 735
754 Ga0495588_0099138 3300046674 Bacteria 1530
755 Ga0495588_0127654 3300046674 Bacteria 1341
756 Ga0495657_0268371 3300046675 Bacteria 1024
757 Ga0495646_0241794 3300046680 Bacteria 970
758 Ga0495658_0244956 3300046683 Bacteria 1126
759 Ga0495658_0322712 3300046683 Bacteria 979
760 Ga0495669_0088515 3300046684 Bacteria 1427
761 Ga0495669_0119414 3300046684 Bacteria 1235
762 Ga0495613_0237913 3300046689 Bacteria 1274
763 Ga0495670_0149527 3300046691 Bacteria 1224
764 Ga0495649_0004654 3300046694 Bacteria 8916
765 Ga0495589_0279592 3300046794 Bacteria 776
766 Ga0495636_0136448 3300047318 Bacteria 1094
767 Ga0495676_0002146 3300047321 Bacteria 17446
768 Ga0495680_0130852 3300047322 Bacteria 1844
769 Ga0495677_0142936 3300047445 Bacteria 919
770 Ga0495686_0014017 3300047472 Bacteria 5538
771 Ga0495686_0349667 3300047472 Bacteria 804
772 Ga0495593_0015848 3300047673 Bacteria 4258
773 Ga0495602_0340931 3300048088 Bacteria 1084
774 Ga0495602_0342412 3300048088 Bacteria 1081
775 Ga0495614_0050797 3300048089 Bacteria 1776
776 Ga0495615_0034462 3300048090 Bacteria 1232
777 Ga0496100_0082603 3300048903 Bacteria 2173
778 Ga0496101_0110727 3300048904 Bacteria 2066
779 Ga0496101_0179000 3300048904 Bacteria 1632
780 Ga0496101_0390349 3300048904 Bacteria 1096
781 Ga0496101_0520759 3300048904 Bacteria 940
782 Ga0496105_0048520 3300048908 Bacteria 3504
783 Ga0496106_0158058 3300048909 Bacteria 1791
784 Ga0496107_0349904 3300048910 Bacteria 1100
785 Ga0496107_0361318 3300048910 Bacteria 1080
786 Ga0496108_0410090 3300048911 Bacteria 1183
787 Ga0496108_0853079 3300048911 Bacteria 784
788 Ga0496109_0195299 3300048912 Bacteria 1902
789 Ga0496109_0294112 3300048912 Bacteria 1531
790 Ga0496110_0087171 3300048913 Bacteria 2788
791 Ga0496110_0494402 3300048913 Bacteria 1114
792 Ga0496110_0584156 3300048913 Bacteria 1014
793 Ga0496111_0116400 3300048914 Bacteria 1971
794 Ga0496113_0573842 3300048916 Bacteria 904
795 Ga0496114_0085708 3300048917 Bacteria 2668
796 Ga0496114_0247328 3300048917 Bacteria 1569
797 Ga0496114_0707743 3300048917 Bacteria 883
798 Ga0496116_0015563 3300048919 Bacteria 6008
799 Ga0496116_0098158 3300048919 Bacteria 1758
800 Ga0496117_0079964 3300048920 Bacteria 2151
801 Ga0496117_0223087 3300048920 Bacteria 1047
802 Ga0496117_0263167 3300048920 Bacteria 933
803 Ga0496118_0024461 3300048921 Bacteria 5209
804 Ga0496118_0257510 3300048921 Bacteria 987
805 Ga0496118_0292662 3300048921 Bacteria 899
806 Ga0496118_0325610 3300048921 Bacteria 832
807 Ga0496121_0016103 3300048924 Bacteria 7748
808 Ga0496121_0078542 3300048924 Bacteria 2623
809 Ga0496121_0219386 3300048924 Bacteria 1340
810 Ga0496122_0002216 3300048925 Bacteria 28363
811 Ga0496122_0060113 3300048925 Bacteria 2801
812 Ga0496122_0219784 3300048925 Bacteria 1091
813 Ga0496122_0266634 3300048925 Bacteria 946
814 Ga0496123_0000057 3300048926 Bacteria 228608
815 Ga0496123_0191249 3300048926 Bacteria 1058
816 Ga0496123_0252832 3300048926 Bacteria 868
817 Ga0496124_0102702 3300048927 Bacteria 2313
818 Ga0496124_0229273 3300048927 Bacteria 1390
819 Ga0496124_0286744 3300048927 Bacteria 1197
820 Ga0496124_0391648 3300048927 Bacteria 967
821 Ga0496125_0017536 3300048928 Bacteria 6821
822 Ga0496125_0021742 3300048928 Bacteria 5971
823 Ga0496125_0022543 3300048928 Bacteria 5843
824 Ga0496125_0042149 3300048928 Bacteria 3892
825 Ga0496125_0279360 3300048928 Bacteria 1035
826 Ga0496126_0339294 3300048929 Bacteria 1231
827 Ga0501303_014028 3300049526 Bacteria 788
828 Ga0501047_0263313 3300049581 Bacteria 1571
829 Ga0501047_0966694 3300049581 Bacteria 665
830 Ga0501243_061676 3300049675 Bacteria 697
831 Ga0501249_042127 3300049679 Bacteria 1037
832 Ga0501257_067667 3300049686 Bacteria 909
833 Ga0501225_0005645 3300049705 Bacteria 3668
834 Ga0501241_052477 3300049758 Bacteria 807
835 Ga0501262_004218 3300049759 Bacteria 1663
836 Ga0501044_0620980 3300049823 Bacteria 972
837 nmdc:mga03683_71105_c1 3300050489 Bacteria 1488
838 nmdc:mga03683_76352_c1 3300050489 Bacteria 1440
839 nmdc:mga00v17_365889_c1 3300050491 Bacteria 938
840 nmdc:mga0yw44_21402_c1 3300050492 Bacteria 3607
841 nmdc:mga0yw44_44978_c1 3300050492 Bacteria 2644
842 nmdc:mga0k408_110498_c1 3300050493 Bacteria 1625
843 nmdc:mga0k408_167210_c1 3300050493 Bacteria 1311
844 nmdc:mga0k408_199361_c1 3300050493 Bacteria 1195
845 nmdc:mga0k408_200838_c1 3300050493 Bacteria 1190
846 nmdc:mga0k408_302276_c1 3300050493 Bacteria 955
847 nmdc:mga0k408_30309_c1 3300050493 Bacteria 3084
848 nmdc:mga0k408_4382_c1 3300050493 Bacteria 7494
849 nmdc:mga0k408_52328_c1 3300050493 Bacteria 2367
850 nmdc:mga0k408_76703_c1 3300050493 Bacteria 1954
851 nmdc:mga0k408_98198_c1 3300050493 Bacteria 1726
852 nmdc:mga06z11_294382_c1 3300050494 Bacteria 964
853 nmdc:mga06z11_61412_c1 3300050494 Bacteria 1960
854 nmdc:mga07m45_126177_c1 3300050496 Bacteria 1480
855 nmdc:mga07m45_17376_c2 3300050496 Bacteria 2149
856 nmdc:mga07m45_185_c2 3300050496 Bacteria 20271
857 nmdc:mga07m45_35505_c1 3300050496 Bacteria 2773
858 nmdc:mga07m45_355643_c1 3300050496 Bacteria 851
859 nmdc:mga07m45_5824_c1 3300050496 Bacteria 6179
860 nmdc:mga07m45_65471_c1 3300050496 Bacteria 2064
861 nmdc:mga07m45_95341_c1 3300050496 Bacteria 1707
862 nmdc:mga0rr50_1249587_c1 3300050513 Bacteria 630
863 nmdc:mga08x19_450849_c1 3300050514 Bacteria 905
864 nmdc:mga0sz30_132695_c1 3300050516 Bacteria 1098
865 Ga0495601_0585512 3300053077 Bacteria 717
866 Ga0500610_0014525 3300053079 Bacteria 3697
867 Ga0500610_0069226 3300053079 Bacteria 1841
868 Ga0500635_0000850 3300053080 Bacteria 7502
869 Ga0500578_0194768 3300053086 Bacteria 1243
870 Ga0500643_039096 3300053087 Bacteria 1403
871 Ga0500644_0032531 3300053088 Bacteria 1667
872 Ga0500646_0126829 3300053090 Bacteria 826
873 Ga0500651_0000637 3300053093 Bacteria 17435
874 Ga0500651_0230849 3300053093 Bacteria 1082
875 Ga0500566_0007532 3300053094 Bacteria 6449
876 Ga0500562_060988 3300053108 Bacteria 1013
877 Ga0500571_003025 3300053110 Bacteria 8531
878 Ga0500593_001469 3300053117 Bacteria 8483
879 Ga0500593_001539 3300053117 Bacteria 8276
880 Ga0500594_0003737 3300053118 Bacteria 3353
881 Ga0500607_031799 3300053121 Bacteria 2901
882 Ga0500607_136146 3300053121 Bacteria 1163
883 Ga0500608_067319 3300053122 Bacteria 1706
884 Ga0500652_154133 3300053131 Bacteria 952
885 Ga0500655_019199 3300053133 Bacteria 1272
886 Ga0500658_0003701 3300053134 Bacteria 5764
887 Ga0500658_0007934 3300053134 Bacteria 3922
888 Ga0500559_0016822 3300053136 Bacteria 3089
889 Ga0500559_0019098 3300053136 Bacteria 2896
890 Ga0500559_0086415 3300053136 Bacteria 1431
891 Ga0500568_0002017 3300053139 Bacteria 12366
892 Ga0500573_0197587 3300053140 Bacteria 1070
893 Ga0500574_001946 3300053141 Bacteria 3253
894 Ga0500577_0129108 3300053142 Bacteria 1058
895 Ga0500604_0097367 3300053151 Bacteria 967
896 Ga0500627_0015591 3300053158 Bacteria 2942
897 Ga0500634_0174715 3300053161 Bacteria 974
898 Ga0500638_113832 3300053162 Bacteria 1246
899 Ga0500636_0155051 3300053177 Bacteria 1254
900 Ga0500636_0187416 3300053177 Bacteria 1105
901 Ga0500645_001223 3300053730 Bacteria 13536
902 Ga0500645_007710 3300053730 Bacteria 3727
903 Ga0587084_000313 3300059477 Bacteria 3564
904 Ga0587083_0007641 3300059505 Bacteria 1663
905 Ga0587072_002999 3300059643 Bacteria 2329
906 Ga0587072_030876 3300059643 Bacteria 1000
907 Ga0587076_041344 3300059645 Bacteria 863
908 Ga0466962_0002068 3300061719 Bacteria 9493

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300032168 Ga0316593_10000144 Ga0316593_100001443 144
2 3300009148 Ga0105243_10724121 Ga0105243_107241212 148
3 3300025935 Ga0207709_10073934 Ga0207709_100739342 148
4 3300032168 Ga0316593_10000732 Ga0316593_100007323 156
5 3300033541 Ga0316596_1005126 Ga0316596_10051262 156
6 3300035398 Ga0316574_0079360 Ga0316574_0079360_268_774 156
7 3300036647 Ga0316582_0071388 Ga0316582_0071388_437_943 156
8 3300036647 Ga0316582_0420452 Ga0316582_0420452_305_802 156
9 3300036712 Ga0316584_0005757 Ga0316584_0005757_3329_3835 156
10 3300036712 Ga0316584_0047614 Ga0316584_0047614_434_940 156
11 3300038443 Ga0395901_0321204 Ga0395901_0321204_403_894 156
12 3300042876 Ga0451577_0282355 Ga0451577_0282355_905_1423 156
13 3300044712 Ga0453684_0045142 Ga0453684_0045142_4110_4628 156
14 3300005339 Ga0070660_100039370 Ga0070660_1000393703 157
15 3300005435 Ga0070714_100995587 Ga0070714_1009955872 157
16 3300005530 Ga0070679_100056638 Ga0070679_1000566383 157
17 3300005543 Ga0070672_100265667 Ga0070672_1002656672 157
18 3300009093 Ga0105240_10016601 Ga0105240_100166018 157
19 3300009177 Ga0105248_11168740 Ga0105248_111687402 157
20 3300009551 Ga0105238_10210168 Ga0105238_102101682 157
21 3300013104 Ga0157370_11524002 Ga0157370_115240021 157
22 3300013306 Ga0163162_10219614 Ga0163162_102196142 157
23 3300014968 Ga0157379_11050138 Ga0157379_110501382 157
24 3300017792 Ga0163161_10611348 Ga0163161_106113482 157
25 3300025901 Ga0207688_10376841 Ga0207688_103768411 157
26 3300025909 Ga0207705_10725700 Ga0207705_107257002 157
27 3300025913 Ga0207695_10065364 Ga0207695_100653642 157
28 3300025921 Ga0207652_10122726 Ga0207652_101227262 157
29 3300025929 Ga0207664_10814602 Ga0207664_108146022 157
30 3300025940 Ga0207691_10158961 Ga0207691_101589612 157
31 3300025949 Ga0207667_10016760 Ga0207667_100167602 157
32 3300027364 Ga0209967_1031377 Ga0209967_10313772 157
33 3300038443 Ga0395901_0492984 Ga0395901_0492984_264_737 157
34 3300046525 Ga0495663_0103779 Ga0495663_0103779_154_669 157
35 3300053077 Ga0495601_0585512 Ga0495601_0585512_55_573 157
36 3300006177 Ga0075362_10106793 Ga0075362_101067932 158
37 3300006195 Ga0075366_10104538 Ga0075366_101045382 158
38 3300013297 Ga0157378_10329890 Ga0157378_103298902 158
39 3300026067 Ga0207678_10366621 Ga0207678_103666212 158
40 3300026142 Ga0207698_11354366 Ga0207698_113543662 158
41 3300030731 Ga0316177_1051055 Ga0316177_10510558 158
42 3300030742 Ga0316183_1136198 Ga0316183_11361982 158
43 3300036401 Ga0373937_0707607 Ga0373937_0707607_100_582 158
44 3300044712 Ga0453684_0127674 Ga0453684_0127674_1844_2326 158
45 3300048917 Ga0496114_0707743 Ga0496114_0707743_170_652 158
46 3300049679 Ga0501249_042127 Ga0501249_042127_330_878 158
47 3300049705 Ga0501225_0005645 Ga0501225_0005645_2511_3059 158
48 3300050514 nmdc:mga08x19_450849_c1 nmdc:mga08x19_450849_c1_317_865 158
49 iso_pu_bacteria 2886848708 2886850778 158
50 3300001915 JGI24741J21665_1011580 JGI24741J21665_10115802 159
51 3300001979 JGI24740J21852_10007552 JGI24740J21852_100075522 159
52 3300002739 JGI25158J39367_1008994 JGI25158J39367_10089942 159
53 3300002773 JGI25152J39213_1037143 JGI25152J39213_10371431 159
54 3300002774 JGI25150J39212_1011607 JGI25150J39212_10116072 159
55 3300002987 JGI25159J45721_1018912 JGI25159J45721_10189122 159
56 3300003187 JGI25151J46595_10112700 JGI25151J46595_101127001 159
57 3300003374 JGI25161J50226_1006295 JGI25161J50226_10062952 159
58 3300003578 Ga0006562J51391_1178712 Ga0006562J51391_11787122 159
59 3300003578 Ga0006562J51391_1178713 Ga0006562J51391_11787131 159
60 3300003773 Ga0055537_1000104 Ga0055537_100010410 159
61 3300003784 Ga0055534_1000042 Ga0055534_100004223 159
62 3300003790 Ga0055528_1002054 Ga0055528_10020542 159
63 3300003790 Ga0055528_1029635 Ga0055528_10296352 159
64 3300003792 Ga0055540_1036359 Ga0055540_10363591 159
65 3300005289 Ga0065704_10376822 Ga0065704_103768221 159
66 3300005471 Ga0070698_100003836 Ga0070698_1000038367 159
67 3300005539 Ga0068853_100029605 Ga0068853_1000296054 159
68 3300005545 Ga0070695_100272400 Ga0070695_1002724002 159
69 3300006051 Ga0075364_10153091 Ga0075364_101530912 159
70 3300006353 Ga0075370_10018343 Ga0075370_100183432 159
71 3300006353 Ga0075370_10308673 Ga0075370_103086731 159
72 3300006946 Ga0079104_1019147 Ga0079104_10191472 159
73 3300006948 Ga0099826_10004379 Ga0099826_1000437910 159
74 3300013104 Ga0157370_11264892 Ga0157370_112648921 159
75 3300025258 Ga0209129_1000083 Ga0209129_1000083142 159
76 3300025258 Ga0209129_1003940 Ga0209129_10039402 159
77 3300025263 Ga0209565_1000083 Ga0209565_100008324 159
78 3300025263 Ga0209565_1001476 Ga0209565_100147610 159
79 3300025273 Ga0209673_1000089 Ga0209673_1000089165 159
80 3300025273 Ga0209673_1000323 Ga0209673_100032321 159
81 3300025273 Ga0209673_1001307 Ga0209673_100130725 159
82 3300025284 Ga0209130_1001189 Ga0209130_10011894 159
83 3300025284 Ga0209130_1002203 Ga0209130_100220312 159
84 3300025291 Ga0209675_1000081 Ga0209675_100008124 159
85 3300025291 Ga0209675_1006532 Ga0209675_10065323 159
86 3300025292 Ga0209676_1000004 Ga0209676_1000004490 159
87 3300025294 Ga0209025_1001314 Ga0209025_100131418 159
88 3300025294 Ga0209025_1044212 Ga0209025_10442122 159
89 3300025295 Ga0209564_1000323 Ga0209564_100032318 159
90 3300025295 Ga0209564_1000332 Ga0209564_100033218 159
91 3300025297 Ga0209758_1000132 Ga0209758_1000132142 159
92 3300025298 Ga0209050_1000002 Ga0209050_10000021000 159
93 3300025299 Ga0209256_1000973 Ga0209256_10009734 159
94 3300025299 Ga0209256_1005263 Ga0209256_10052634 159
95 3300025302 Ga0207426_1000323 Ga0207426_100032370 159
96 3300025302 Ga0207426_1000584 Ga0207426_100058419 159
97 3300025303 Ga0209051_1000002 Ga0209051_1000002769 159
98 3300025303 Ga0209051_1004724 Ga0209051_10047243 159
99 3300025304 Ga0209257_1000002 Ga0209257_1000002910 159
100 3300025944 Ga0207661_11615580 Ga0207661_116155801 159
101 3300026116 Ga0207674_10530439 Ga0207674_105304392 159
102 3300027666 Ga0209282_1001621 Ga0209282_10016214 159
103 3300027907 Ga0207428_10489967 Ga0207428_104899672 159
104 3300030732 Ga0316176_1222992 Ga0316176_12229923 159
105 3300030735 Ga0316178_1083600 Ga0316178_10836004 159
106 3300030736 Ga0316180_1048969 Ga0316180_10489698 159
107 3300030744 Ga0316181_1077794 Ga0316181_10777948 159
108 3300031731 Ga0307405_10228311 Ga0307405_102283112 159
109 3300031911 Ga0307412_10056316 Ga0307412_100563163 159
110 3300048904 Ga0496101_0179000 Ga0496101_0179000_261_815 159
111 3300049526 Ga0501303_014028 Ga0501303_014028_25_591 159
112 3300049758 Ga0501241_052477 Ga0501241_052477_75_632 159
113 3300049759 Ga0501262_004218 Ga0501262_004218_654_1211 159
114 3300050492 nmdc:mga0yw44_21402_c1 nmdc:mga0yw44_21402_c1_1010_1567 159
115 3300050493 nmdc:mga0k408_30309_c1 nmdc:mga0k408_30309_c1_454_1011 159
116 3300050496 nmdc:mga07m45_5824_c1 nmdc:mga07m45_5824_c1_565_1113 159
117 3300050516 nmdc:mga0sz30_132695_c1 nmdc:mga0sz30_132695_c1_290_844 159
118 iso_pu_bacteria 2511231002 2511243437 159
119 iso_pu_bacteria 2721755523 2722882316 159
120 iso_pu_bacteria 2839138175 2839139938 159
121 iso_pu_bacteria 2894023352 2894024481 159
122 iso_pu_bacteria 2932422444 2932424563 159
123 3300002705 JGI25156J39149_1002448 JGI25156J39149_10024482 160
124 3300002705 JGI25156J39149_1010889 JGI25156J39149_10108892 160
125 3300002705 JGI25156J39149_1016094 JGI25156J39149_10160942 160
126 3300002705 JGI25156J39149_1019551 JGI25156J39149_10195512 160
127 3300002705 JGI25156J39149_1034850 JGI25156J39149_10348501 160
128 3300002738 JGI25154J39366_1001442 JGI25154J39366_10014423 160
129 3300002741 JGI25157J39369_1000095 JGI25157J39369_100009527 160
130 3300002772 JGI25164J39214_1004101 JGI25164J39214_10041012 160
131 3300003752 Ga0055539_1005506 Ga0055539_10055062 160
132 3300003752 Ga0055539_1005852 Ga0055539_10058521 160
133 3300003752 Ga0055539_1013569 Ga0055539_10135692 160
134 3300003756 Ga0055533_1000100 Ga0055533_100010066 160
135 3300003761 Ga0055535_1005897 Ga0055535_10058972 160
136 3300003761 Ga0055535_1020685 Ga0055535_10206851 160
137 3300003763 Ga0055529_1001089 Ga0055529_10010893 160
138 3300003771 Ga0055526_1020588 Ga0055526_10205881 160
139 3300003773 Ga0055537_1008606 Ga0055537_10086064 160
140 3300003775 Ga0055524_1067228 Ga0055524_10672281 160
141 3300003781 Ga0055536_1004691 Ga0055536_10046914 160
142 3300003791 Ga0055530_10035007 Ga0055530_100350072 160
143 3300003792 Ga0055540_1016035 Ga0055540_10160352 160
144 3300005327 Ga0070658_10222314 Ga0070658_102223142 160
145 3300005327 Ga0070658_10566352 Ga0070658_105663522 160
146 3300005330 Ga0070690_100350952 Ga0070690_1003509522 160
147 3300005334 Ga0068869_100517225 Ga0068869_1005172251 160
148 3300005335 Ga0070666_10378579 Ga0070666_103785792 160
149 3300005338 Ga0068868_100369826 Ga0068868_1003698262 160
150 3300005339 Ga0070660_100480338 Ga0070660_1004803382 160
151 3300005340 Ga0070689_100442156 Ga0070689_1004421562 160
152 3300005364 Ga0070673_100123144 Ga0070673_1001231442 160
153 3300005366 Ga0070659_100987932 Ga0070659_1009879322 160
154 3300005367 Ga0070667_101452783 Ga0070667_1014527831 160
155 3300005456 Ga0070678_100692321 Ga0070678_1006923212 160
156 3300005458 Ga0070681_10852971 Ga0070681_108529711 160
157 3300005459 Ga0068867_100382438 Ga0068867_1003824382 160
158 3300005466 Ga0070685_10278490 Ga0070685_102784902 160
159 3300005471 Ga0070698_100589412 Ga0070698_1005894122 160
160 3300005535 Ga0070684_100210194 Ga0070684_1002101942 160
161 3300005539 Ga0068853_100189424 Ga0068853_1001894242 160
162 3300005539 Ga0068853_100330909 Ga0068853_1003309092 160
163 3300005548 Ga0070665_100041269 Ga0070665_1000412698 160
164 3300005563 Ga0068855_100798393 Ga0068855_1007983932 160
165 3300005563 Ga0068855_101642976 Ga0068855_1016429761 160
166 3300005564 Ga0070664_101524211 Ga0070664_1015242111 160
167 3300005577 Ga0068857_100635888 Ga0068857_1006358882 160
168 3300005577 Ga0068857_101475164 Ga0068857_1014751641 160
169 3300005577 Ga0068857_101543723 Ga0068857_1015437231 160
170 3300005578 Ga0068854_100073065 Ga0068854_1000730652 160
171 3300005578 Ga0068854_100674651 Ga0068854_1006746511 160
172 3300005614 Ga0068856_100006504 Ga0068856_10000650410 160
173 3300005719 Ga0068861_100073024 Ga0068861_1000730243 160
174 3300005719 Ga0068861_101778945 Ga0068861_1017789452 160
175 3300005843 Ga0068860_100695209 Ga0068860_1006952092 160
176 3300005844 Ga0068862_101370927 Ga0068862_1013709271 160
177 3300006038 Ga0075365_10011063 Ga0075365_100110639 160
178 3300006048 Ga0075363_100346938 Ga0075363_1003469382 160
179 3300006058 Ga0075432_10028199 Ga0075432_100281992 160
180 3300006178 Ga0075367_10129178 Ga0075367_101291782 160
181 3300006195 Ga0075366_10055916 Ga0075366_100559162 160
182 3300006353 Ga0075370_10005914 Ga0075370_100059142 160
183 3300006353 Ga0075370_10051644 Ga0075370_100516443 160
184 3300006353 Ga0075370_10292001 Ga0075370_102920012 160
185 3300006353 Ga0075370_10363423 Ga0075370_103634231 160
186 3300006358 Ga0068871_101539474 Ga0068871_1015394741 160
187 3300006871 Ga0075434_101182919 Ga0075434_1011829191 160
188 3300009098 Ga0105245_11220745 Ga0105245_112207452 160
189 3300009174 Ga0105241_10312714 Ga0105241_103127142 160
190 3300009177 Ga0105248_10394621 Ga0105248_103946212 160
191 3300009177 Ga0105248_11611217 Ga0105248_116112172 160
192 3300009545 Ga0105237_10071021 Ga0105237_100710213 160
193 3300009545 Ga0105237_10914585 Ga0105237_109145852 160
194 3300009551 Ga0105238_10402007 Ga0105238_104020072 160
195 3300009553 Ga0105249_11226610 Ga0105249_112266102 160
196 3300010375 Ga0105239_10694822 Ga0105239_106948222 160
197 3300010375 Ga0105239_11995128 Ga0105239_119951282 160
198 3300011119 Ga0105246_10174552 Ga0105246_101745522 160
199 3300013102 Ga0157371_10270095 Ga0157371_102700952 160
200 3300013105 Ga0157369_10052460 Ga0157369_100524602 160
201 3300013105 Ga0157369_10721735 Ga0157369_107217351 160
202 3300013297 Ga0157378_10212374 Ga0157378_102123742 160
203 3300013308 Ga0157375_12543502 Ga0157375_125435021 160
204 3300014968 Ga0157379_10932939 Ga0157379_109329392 160
205 3300014969 Ga0157376_10416763 Ga0157376_104167632 160
206 3300015261 Ga0182006_1127620 Ga0182006_11276202 160
207 3300015262 Ga0182007_10056054 Ga0182007_100560542 160
208 3300015262 Ga0182007_10134829 Ga0182007_101348292 160
209 3300017792 Ga0163161_10113482 Ga0163161_101134822 160
210 3300025225 Ga0209566_111698 Ga0209566_1116982 160
211 3300025226 Ga0209674_100003 Ga0209674_1000031924 160
212 3300025228 Ga0209672_108077 Ga0209672_1080772 160
213 3300025230 Ga0209563_100017 Ga0209563_10001746 160
214 3300025230 Ga0209563_112761 Ga0209563_1127612 160
215 3300025231 Ga0207427_100380 Ga0207427_10038014 160
216 3300025242 Ga0209258_100414 Ga0209258_10041445 160
217 3300025242 Ga0209258_104537 Ga0209258_1045372 160
218 3300025246 Ga0209646_1000271 Ga0209646_10002712 160
219 3300025250 Ga0209026_1000085 Ga0209026_1000085132 160
220 3300025253 Ga0209677_102048 Ga0209677_10204810 160
221 3300025253 Ga0209677_108757 Ga0209677_1087572 160
222 3300025254 Ga0209148_1003800 Ga0209148_10038003 160
223 3300025256 Ga0209759_1000068 Ga0209759_1000068130 160
224 3300025256 Ga0209759_1008209 Ga0209759_10082092 160
225 3300025256 Ga0209759_1014909 Ga0209759_10149092 160
226 3300025256 Ga0209759_1014925 Ga0209759_10149252 160
227 3300025256 Ga0209759_1038431 Ga0209759_10384312 160
228 3300025272 Ga0209455_1000264 Ga0209455_100026412 160
229 3300025273 Ga0209673_1027737 Ga0209673_10277372 160
230 3300025291 Ga0209675_1000832 Ga0209675_100083214 160
231 3300025294 Ga0209025_1005532 Ga0209025_100553210 160
232 3300025298 Ga0209050_1046448 Ga0209050_10464481 160
233 3300025303 Ga0209051_1001375 Ga0209051_100137516 160
234 3300025304 Ga0209257_1071107 Ga0209257_10711071 160
235 3300025909 Ga0207705_10615649 Ga0207705_106156492 160
236 3300025910 Ga0207684_10004749 Ga0207684_100047494 160
237 3300025911 Ga0207654_10256218 Ga0207654_102562182 160
238 3300025913 Ga0207695_10047646 Ga0207695_100476462 160
239 3300025914 Ga0207671_10056734 Ga0207671_100567342 160
240 3300025919 Ga0207657_10033997 Ga0207657_100339972 160
241 3300025919 Ga0207657_10162882 Ga0207657_101628822 160
242 3300025920 Ga0207649_10071923 Ga0207649_100719232 160
243 3300025921 Ga0207652_10529203 Ga0207652_105292031 160
244 3300025925 Ga0207650_10663105 Ga0207650_106631052 160
245 3300025932 Ga0207690_10242705 Ga0207690_102427052 160
246 3300025932 Ga0207690_11024363 Ga0207690_110243632 160
247 3300025934 Ga0207686_10118183 Ga0207686_101181832 160
248 3300025936 Ga0207670_10305361 Ga0207670_103053612 160
249 3300025941 Ga0207711_11415885 Ga0207711_114158851 160
250 3300025942 Ga0207689_10326122 Ga0207689_103261222 160
251 3300025949 Ga0207667_10471167 Ga0207667_104711672 160
252 3300025949 Ga0207667_10563607 Ga0207667_105636072 160
253 3300025949 Ga0207667_10590836 Ga0207667_105908362 160
254 3300025960 Ga0207651_10279236 Ga0207651_102792362 160
255 3300025981 Ga0207640_10007957 Ga0207640_100079579 160
256 3300026023 Ga0207677_10271364 Ga0207677_102713642 160
257 3300026041 Ga0207639_10133878 Ga0207639_101338781 160
258 3300026041 Ga0207639_10537257 Ga0207639_105372572 160
259 3300026078 Ga0207702_10001691 Ga0207702_1000169118 160
260 3300026088 Ga0207641_10034600 Ga0207641_100346002 160
261 3300026089 Ga0207648_10347118 Ga0207648_103471182 160
262 3300026095 Ga0207676_10469654 Ga0207676_104696542 160
263 3300026116 Ga0207674_10012042 Ga0207674_100120428 160
264 3300026116 Ga0207674_10688022 Ga0207674_106880222 160
265 3300026118 Ga0207675_100198018 Ga0207675_1001980182 160
266 3300026121 Ga0207683_10580811 Ga0207683_105808112 160
267 3300026121 Ga0207683_10644338 Ga0207683_106443382 160
268 3300026142 Ga0207698_10467936 Ga0207698_104679362 160
269 3300026142 Ga0207698_11438385 Ga0207698_114383852 160
270 3300028379 Ga0268266_10029582 Ga0268266_100295822 160
271 3300028381 Ga0268264_10368811 Ga0268264_103688112 160
272 3300028666 Ga0265336_10000044 Ga0265336_1000004451 160
273 3300029957 Ga0265324_10000446 Ga0265324_1000044624 160
274 3300030521 Ga0307511_10082309 Ga0307511_100823093 160
275 3300031239 Ga0265328_10037651 Ga0265328_100376512 160
276 3300031507 Ga0307509_10169060 Ga0307509_101690602 160
277 3300031507 Ga0307509_10242669 Ga0307509_102426692 160
278 3300031649 Ga0307514_10161453 Ga0307514_101614532 160
279 3300031730 Ga0307516_10039984 Ga0307516_100399848 160
280 3300031852 Ga0307410_10498680 Ga0307410_104986802 160
281 3300031901 Ga0307406_10099212 Ga0307406_100992122 160
282 3300032004 Ga0307414_10323491 Ga0307414_103234912 160
283 3300034820 Ga0373959_0017007 Ga0373959_0017007_803_1312 160
284 3300035086 Ga0373934_0032944 Ga0373934_0032944_894_1403 160
285 3300035691 Ga0373931_0001569 Ga0373931_0001569_6583_7101 160
286 3300035695 Ga0373927_0261239 Ga0373927_0261239_496_1014 160
287 3300037312 Ga0395899_0285555 Ga0395899_0285555_337_855 160
288 3300037312 Ga0395899_0564282 Ga0395899_0564282_198_707 160
289 3300037466 Ga0395898_0026539 Ga0395898_0026539_3988_4497 160
290 3300037471 Ga0395905_0004037 Ga0395905_0004037_11763_12248 160
291 3300037471 Ga0395905_0842173 Ga0395905_0842173_143_652 160
292 3300038443 Ga0395901_0011265 Ga0395901_0011265_7076_7585 160
293 3300038443 Ga0395901_0673385 Ga0395901_0673385_261_746 160
294 3300039447 Ga0436361_0677555 Ga0436361_0677555_587_1105 160
295 3300039447 Ga0436361_0791561 Ga0436361_0791561_2373_2891 160
296 3300041404 Ga0439436_0047309 Ga0439436_0047309_188_745 160
297 3300041413 Ga0439465_0004945 Ga0439465_0004945_285_842 160
298 3300041486 Ga0451807_1602126 Ga0451807_1602126_214_771 160
299 3300041496 Ga0451839_0671410 Ga0451839_0671410_260_817 160
300 3300042002 Ga0439442_008290 Ga0439442_008290_858_1415 160
301 3300042005 Ga0439448_0125371 Ga0439448_0125371_163_672 160
302 3300042014 Ga0439457_055990 Ga0439457_055990_117_674 160
303 3300042123 Ga0450921_002961 Ga0450921_002961_155_712 160
304 3300042435 Ga0439434_0023131 Ga0439434_0023131_584_1141 160
305 3300042531 Ga0450918_001339 Ga0450918_001339_3552_4109 160
306 3300044656 Ga0466969_0001251 Ga0466969_0001251_12506_12994 160
307 3300044658 Ga0466972_0064731 Ga0466972_0064731_969_1457 160
308 3300044658 Ga0466972_0118240 Ga0466972_0118240_571_1059 160
309 3300044683 Ga0466965_0000845 Ga0466965_0000845_9193_9711 160
310 3300044683 Ga0466965_0075812 Ga0466965_0075812_690_1178 160
311 3300044684 Ga0466966_0077415 Ga0466966_0077415_423_941 160
312 3300044684 Ga0466966_0123187 Ga0466966_0123187_804_1292 160
313 3300044693 Ga0466961_0001077 Ga0466961_0001077_11563_12081 160
314 3300044693 Ga0466961_0118257 Ga0466961_0118257_792_1280 160
315 3300044694 Ga0466963_0029557 Ga0466963_0029557_2556_3074 160
316 3300044706 Ga0466964_0007733 Ga0466964_0007733_2111_2629 160
317 3300044735 Ga0466968_0065248 Ga0466968_0065248_662_1180 160
318 3300044765 Ga0466970_0281990 Ga0466970_0281990_20_538 160
319 3300044765 Ga0466970_0391520 Ga0466970_0391520_11_499 160
320 3300044765 Ga0466970_0713518 Ga0466970_0713518_77_565 160
321 3300044842 Ga0466957_0043815 Ga0466957_0043815_1150_1668 160
322 3300044901 Ga0466960_0103735 Ga0466960_0103735_155_667 160
323 3300044901 Ga0466960_0109265 Ga0466960_0109265_419_907 160
324 3300045049 Ga0466959_0055275 Ga0466959_0055275_1793_2281 160
325 3300045836 Ga0466958_0053641 Ga0466958_0053641_660_1178 160
326 3300045976 Ga0466967_0135326 Ga0466967_0135326_135_653 160
327 3300046471 Ga0495650_0070989 Ga0495650_0070989_168_683 160
328 3300046492 Ga0495585_0018632 Ga0495585_0018632_206_724 160
329 3300046506 Ga0495583_0004321 Ga0495583_0004321_8674_9183 160
330 3300046507 Ga0495606_0006532 Ga0495606_0006532_2924_3433 160
331 3300046507 Ga0495606_0142292 Ga0495606_0142292_613_1170 160
332 3300046517 Ga0495630_0703730 Ga0495630_0703730_120_638 160
333 3300046529 Ga0495652_0181604 Ga0495652_0181604_635_1153 160
334 3300046539 Ga0495621_0125043 Ga0495621_0125043_152_634 160
335 3300046616 Ga0495668_0256532 Ga0495668_0256532_296_814 160
336 3300046660 Ga0495625_0001775 Ga0495625_0001775_679_1236 160
337 3300046660 Ga0495625_0101136 Ga0495625_0101136_1277_1795 160
338 3300046660 Ga0495625_0344295 Ga0495625_0344295_151_669 160
339 3300046684 Ga0495669_0088515 Ga0495669_0088515_393_902 160
340 3300046694 Ga0495649_0004654 Ga0495649_0004654_6606_7115 160
341 3300046794 Ga0495589_0279592 Ga0495589_0279592_78_587 160
342 3300047318 Ga0495636_0136448 Ga0495636_0136448_305_787 160
343 3300047472 Ga0495686_0014017 Ga0495686_0014017_568_1083 160
344 3300048090 Ga0495615_0034462 Ga0495615_0034462_665_1147 160
345 3300048904 Ga0496101_0390349 Ga0496101_0390349_108_626 160
346 3300048904 Ga0496101_0520759 Ga0496101_0520759_22_507 160
347 3300048911 Ga0496108_0853079 Ga0496108_0853079_161_682 160
348 3300048912 Ga0496109_0294112 Ga0496109_0294112_802_1287 160
349 3300048913 Ga0496110_0584156 Ga0496110_0584156_157_642 160
350 3300048919 Ga0496116_0098158 Ga0496116_0098158_266_820 160
351 3300048920 Ga0496117_0263167 Ga0496117_0263167_105_659 160
352 3300048924 Ga0496121_0078542 Ga0496121_0078542_1620_2174 160
353 3300048925 Ga0496122_0219784 Ga0496122_0219784_351_905 160
354 3300048925 Ga0496122_0266634 Ga0496122_0266634_243_800 160
355 3300048926 Ga0496123_0191249 Ga0496123_0191249_69_626 160
356 3300048928 Ga0496125_0279360 Ga0496125_0279360_269_826 160
357 3300050491 nmdc:mga00v17_365889_c1 nmdc:mga00v17_365889_c1_290_847 160
358 3300050493 nmdc:mga0k408_110498_c1 nmdc:mga0k408_110498_c1_1070_1579 160
359 3300050493 nmdc:mga0k408_167210_c1 nmdc:mga0k408_167210_c1_671_1159 160
360 3300050493 nmdc:mga0k408_98198_c1 nmdc:mga0k408_98198_c1_734_1258 160
361 3300050494 nmdc:mga06z11_61412_c1 nmdc:mga06z11_61412_c1_90_614 160
362 3300050496 nmdc:mga07m45_185_c2 nmdc:mga07m45_185_c2_19106_19615 160
363 3300050496 nmdc:mga07m45_355643_c1 nmdc:mga07m45_355643_c1_86_610 160
364 3300050513 nmdc:mga0rr50_1249587_c1 nmdc:mga0rr50_1249587_c1_54_539 160
365 3300053080 Ga0500635_0000850 Ga0500635_0000850_1069_1584 160
366 3300053086 Ga0500578_0194768 Ga0500578_0194768_631_1140 160
367 3300053093 Ga0500651_0230849 Ga0500651_0230849_329_838 160
368 3300053131 Ga0500652_154133 Ga0500652_154133_158_667 160
369 3300053136 Ga0500559_0016822 Ga0500559_0016822_2241_2756 160
370 3300053177 Ga0500636_0155051 Ga0500636_0155051_277_786 160
371 3300059505 Ga0587083_0007641 Ga0587083_0007641_1076_1585 160
372 3300061719 Ga0466962_0002068 Ga0466962_0002068_7392_7910 160
373 3300003759 Ga0055525_1000011 Ga0055525_1000011177 161
374 3300003792 Ga0055540_1002976 Ga0055540_10029765 161
375 3300003792 Ga0055540_1003651 Ga0055540_10036512 161
376 3300003794 Ga0055531_10001799 Ga0055531_100017999 161
377 3300005288 Ga0065714_10165842 Ga0065714_101658422 161
378 3300005327 Ga0070658_10334877 Ga0070658_103348771 161
379 3300005530 Ga0070679_100216348 Ga0070679_1002163482 161
380 3300006038 Ga0075365_10111680 Ga0075365_101116802 161
381 3300006038 Ga0075365_10543533 Ga0075365_105435332 161
382 3300006038 Ga0075365_10568385 Ga0075365_105683852 161
383 3300006051 Ga0075364_10396410 Ga0075364_103964102 161
384 3300006178 Ga0075367_10362893 Ga0075367_103628932 161
385 3300006195 Ga0075366_10248222 Ga0075366_102482222 161
386 3300013306 Ga0163162_11141142 Ga0163162_111411422 161
387 3300014326 Ga0157380_11822584 Ga0157380_118225842 161
388 3300017792 Ga0163161_10251236 Ga0163161_102512362 161
389 3300025230 Ga0209563_100005 Ga0209563_100005502 161
390 3300025284 Ga0209130_1024873 Ga0209130_10248732 161
391 3300025303 Ga0209051_1000792 Ga0209051_10007928 161
392 3300025304 Ga0209257_1000396 Ga0209257_100039613 161
393 3300025907 Ga0207645_10448292 Ga0207645_104482922 161
394 3300026121 Ga0207683_10928040 Ga0207683_109280402 161
395 3300028379 Ga0268266_10371144 Ga0268266_103711442 161
396 3300031456 Ga0307513_10353524 Ga0307513_103535242 161
397 3300031548 Ga0307408_100543639 Ga0307408_1005436392 161
398 3300031901 Ga0307406_11074864 Ga0307406_110748641 161
399 3300031911 Ga0307412_10288994 Ga0307412_102889942 161
400 3300032002 Ga0307416_100769352 Ga0307416_1007693522 161
401 3300039447 Ga0436361_0349482 Ga0436361_0349482_77187_77690 161
402 3300041406 Ga0439439_0043331 Ga0439439_0043331_325_864 161
403 3300041411 Ga0439466_0196802 Ga0439466_0196802_48_533 161
404 3300041451 Ga0451791_0718593 Ga0451791_0718593_293_829 161
405 3300041458 Ga0451798_0727212 Ga0451798_0727212_25_510 161
406 3300042015 Ga0439462_0029579 Ga0439462_0029579_645_1130 161
407 3300042125 Ga0450923_012556 Ga0450923_012556_156_695 161
408 3300042435 Ga0439434_0030058 Ga0439434_0030058_909_1394 161
409 3300042439 Ga0439464_0027079 Ga0439464_0027079_660_1145 161
410 3300044673 Ga0453683_0007492 Ga0453683_0007492_3224_3721 161
411 3300045976 Ga0466967_0724658 Ga0466967_0724658_365_859 161
412 3300046501 Ga0495607_0238780 Ga0495607_0238780_281_811 161
413 3300046684 Ga0495669_0119414 Ga0495669_0119414_292_789 161
414 3300047445 Ga0495677_0142936 Ga0495677_0142936_133_618 161
415 3300049581 Ga0501047_0966694 Ga0501047_0966694_58_543 161
416 3300049675 Ga0501243_061676 Ga0501243_061676_146_631 161
417 3300049686 Ga0501257_067667 Ga0501257_067667_325_867 161
418 3300049823 Ga0501044_0620980 Ga0501044_0620980_475_960 161
419 3300050492 nmdc:mga0yw44_44978_c1 nmdc:mga0yw44_44978_c1_1552_2037 161
420 3300050493 nmdc:mga0k408_200838_c1 nmdc:mga0k408_200838_c1_519_1007 161
421 3300050494 nmdc:mga06z11_294382_c1 nmdc:mga06z11_294382_c1_276_761 161
422 3300059477 Ga0587084_000313 Ga0587084_000313_933_1460 161
423 3300059643 Ga0587072_030876 Ga0587072_030876_315_842 161
424 3300059645 Ga0587076_041344 Ga0587076_041344_158_685 161
425 3300001989 JGI24739J22299_10103394 JGI24739J22299_101033942 162
426 3300002987 JGI25159J45721_1006730 JGI25159J45721_10067304 162
427 3300003187 JGI25151J46595_10017803 JGI25151J46595_100178033 162
428 3300003323 rootH1_10075206 rootH1_100752062 162
429 3300003760 Ga0055527_1008701 Ga0055527_10087012 162
430 3300003761 Ga0055535_1000442 Ga0055535_10004427 162
431 3300003761 Ga0055535_1000863 Ga0055535_10008638 162
432 3300003762 Ga0055542_1000052 Ga0055542_1000052145 162
433 3300003781 Ga0055536_1025851 Ga0055536_10258512 162
434 3300003781 Ga0055536_1036860 Ga0055536_10368602 162
435 3300003784 Ga0055534_1008779 Ga0055534_10087792 162
436 3300003791 Ga0055530_10007775 Ga0055530_100077753 162
437 3300003794 Ga0055531_10022530 Ga0055531_100225303 162
438 3300005288 Ga0065714_10014061 Ga0065714_100140612 162
439 3300005327 Ga0070658_10122431 Ga0070658_101224313 162
440 3300005327 Ga0070658_10411192 Ga0070658_104111922 162
441 3300005334 Ga0068869_100447378 Ga0068869_1004473782 162
442 3300005337 Ga0070682_100641991 Ga0070682_1006419912 162
443 3300005344 Ga0070661_100656584 Ga0070661_1006565842 162
444 3300005353 Ga0070669_100491563 Ga0070669_1004915632 162
445 3300005355 Ga0070671_100614427 Ga0070671_1006144272 162
446 3300005366 Ga0070659_100998626 Ga0070659_1009986261 162
447 3300005367 Ga0070667_100499833 Ga0070667_1004998332 162
448 3300005456 Ga0070678_100101205 Ga0070678_1001012052 162
449 3300005456 Ga0070678_100179788 Ga0070678_1001797882 162
450 3300005457 Ga0070662_100083339 Ga0070662_1000833392 162
451 3300005539 Ga0068853_100345846 Ga0068853_1003458462 162
452 3300005548 Ga0070665_100172802 Ga0070665_1001728022 162
453 3300005548 Ga0070665_100214987 Ga0070665_1002149872 162
454 3300005564 Ga0070664_100014663 Ga0070664_1000146633 162
455 3300005834 Ga0068851_10026307 Ga0068851_100263073 162
456 3300005844 Ga0068862_101671402 Ga0068862_1016714021 162
457 3300006042 Ga0075368_10160909 Ga0075368_101609092 162
458 3300006048 Ga0075363_100148455 Ga0075363_1001484552 162
459 3300006177 Ga0075362_10330189 Ga0075362_103301892 162
460 3300006195 Ga0075366_10185080 Ga0075366_101850802 162
461 3300006237 Ga0097621_100308339 Ga0097621_1003083392 162
462 3300006353 Ga0075370_10013218 Ga0075370_100132184 162
463 3300006353 Ga0075370_10074826 Ga0075370_100748262 162
464 3300006353 Ga0075370_10089857 Ga0075370_100898572 162
465 3300006358 Ga0068871_100114546 Ga0068871_1001145463 162
466 3300009098 Ga0105245_10947068 Ga0105245_109470682 162
467 3300009148 Ga0105243_10196633 Ga0105243_101966333 162
468 3300009148 Ga0105243_10591726 Ga0105243_105917262 162
469 3300009176 Ga0105242_11700010 Ga0105242_117000101 162
470 3300009177 Ga0105248_11234180 Ga0105248_112341802 162
471 3300009551 Ga0105238_10276401 Ga0105238_102764012 162
472 3300009551 Ga0105238_10669857 Ga0105238_106698571 162
473 3300011119 Ga0105246_10059447 Ga0105246_100594472 162
474 3300013104 Ga0157370_10108200 Ga0157370_101082004 162
475 3300013104 Ga0157370_10547057 Ga0157370_105470572 162
476 3300013307 Ga0157372_10374353 Ga0157372_103743532 162
477 3300014497 Ga0182008_10011458 Ga0182008_100114582 162
478 3300014497 Ga0182008_10088039 Ga0182008_100880392 162
479 3300014497 Ga0182008_10088370 Ga0182008_100883702 162
480 3300015261 Ga0182006_1029973 Ga0182006_10299732 162
481 3300015261 Ga0182006_1079259 Ga0182006_10792592 162
482 3300015262 Ga0182007_10009741 Ga0182007_100097412 162
483 3300015265 Ga0182005_1042568 Ga0182005_10425682 162
484 3300015683 Ga0183362_10003 Ga0183362_10003197 162
485 3300017792 Ga0163161_10350775 Ga0163161_103507752 162
486 3300021361 Ga0213872_10012343 Ga0213872_100123433 162
487 3300025228 Ga0209672_100633 Ga0209672_10063313 162
488 3300025229 Ga0209147_101695 Ga0209147_1016952 162
489 3300025242 Ga0209258_100009 Ga0209258_10000920 162
490 3300025254 Ga0209148_1000007 Ga0209148_100000720 162
491 3300025284 Ga0209130_1008941 Ga0209130_10089411 162
492 3300025291 Ga0209675_1002121 Ga0209675_10021219 162
493 3300025292 Ga0209676_1002834 Ga0209676_10028343 162
494 3300025292 Ga0209676_1014584 Ga0209676_10145842 162
495 3300025294 Ga0209025_1000133 Ga0209025_1000133187 162
496 3300025294 Ga0209025_1001691 Ga0209025_100169122 162
497 3300025298 Ga0209050_1003126 Ga0209050_100312610 162
498 3300025298 Ga0209050_1054110 Ga0209050_10541102 162
499 3300025303 Ga0209051_1001732 Ga0209051_10017329 162
500 3300025303 Ga0209051_1003624 Ga0209051_10036248 162
501 3300025303 Ga0209051_1024877 Ga0209051_10248772 162
502 3300025304 Ga0209257_1000361 Ga0209257_100036170 162
503 3300025304 Ga0209257_1020159 Ga0209257_10201592 162
504 3300025728 Ga0207655_1001053 Ga0207655_10010533 162
505 3300025903 Ga0207680_10071484 Ga0207680_100714842 162
506 3300025904 Ga0207647_10307818 Ga0207647_103078182 162
507 3300025909 Ga0207705_10073695 Ga0207705_100736952 162
508 3300025922 Ga0207646_10106246 Ga0207646_101062461 162
509 3300025923 Ga0207681_10474105 Ga0207681_104741052 162
510 3300025932 Ga0207690_10413488 Ga0207690_104134882 162
511 3300025933 Ga0207706_10551472 Ga0207706_105514722 162
512 3300025934 Ga0207686_10153924 Ga0207686_101539242 162
513 3300025935 Ga0207709_10001284 Ga0207709_100012842 162
514 3300025935 Ga0207709_10059162 Ga0207709_100591622 162
515 3300025937 Ga0207669_10053330 Ga0207669_100533302 162
516 3300025942 Ga0207689_10407218 Ga0207689_104072182 162
517 3300025972 Ga0207668_10437509 Ga0207668_104375091 162
518 3300025986 Ga0207658_10258800 Ga0207658_102588002 162
519 3300026035 Ga0207703_10672871 Ga0207703_106728712 162
520 3300026089 Ga0207648_10838308 Ga0207648_108383082 162
521 3300026121 Ga0207683_10054906 Ga0207683_100549062 162
522 3300026121 Ga0207683_10480400 Ga0207683_104804002 162
523 3300026121 Ga0207683_10950920 Ga0207683_109509202 162
524 3300028380 Ga0268265_10541893 Ga0268265_105418932 162
525 3300028794 Ga0307515_10000195 Ga0307515_1000019599 162
526 3300028794 Ga0307515_10162677 Ga0307515_101626772 162
527 3300031238 Ga0265332_10000014 Ga0265332_1000001491 162
528 3300031251 Ga0265327_10000425 Ga0265327_100004259 162
529 3300031251 Ga0265327_10053432 Ga0265327_100534322 162
530 3300031251 Ga0265327_10289466 Ga0265327_102894662 162
531 3300031456 Ga0307513_10000004 Ga0307513_10000004398 162
532 3300031456 Ga0307513_10160220 Ga0307513_101602202 162
533 3300031548 Ga0307408_100023297 Ga0307408_1000232973 162
534 3300031548 Ga0307408_100373619 Ga0307408_1003736192 162
535 3300031731 Ga0307405_10296381 Ga0307405_102963812 162
536 3300031901 Ga0307406_10737544 Ga0307406_107375442 162
537 3300031911 Ga0307412_10504921 Ga0307412_105049212 162
538 3300031911 Ga0307412_10589239 Ga0307412_105892392 162
539 3300031911 Ga0307412_11000778 Ga0307412_110007781 162
540 3300032002 Ga0307416_100192452 Ga0307416_1001924522 162
541 3300032005 Ga0307411_10160720 Ga0307411_101607202 162
542 3300035119 Ga0373956_0310803 Ga0373956_0310803_206_700 162
543 3300037312 Ga0395899_0001965 Ga0395899_0001965_1194_1685 162
544 3300037312 Ga0395899_0067138 Ga0395899_0067138_779_1270 162
545 3300037418 Ga0395900_0051271 Ga0395900_0051271_160_651 162
546 3300037418 Ga0395900_0843447 Ga0395900_0843447_48_536 162
547 3300037418 Ga0395900_0969594 Ga0395900_0969594_172_663 162
548 3300037466 Ga0395898_0015164 Ga0395898_0015164_1124_1615 162
549 3300037471 Ga0395905_0008037 Ga0395905_0008037_3774_4265 162
550 3300037471 Ga0395905_0013989 Ga0395905_0013989_3988_4476 162
551 3300037471 Ga0395905_0057085 Ga0395905_0057085_2872_3369 162
552 3300037471 Ga0395905_0113321 Ga0395905_0113321_1477_1968 162
553 3300038443 Ga0395901_0029516 Ga0395901_0029516_172_663 162
554 3300038443 Ga0395901_0861666 Ga0395901_0861666_324_812 162
555 3300039447 Ga0436361_0240598 Ga0436361_0240598_1786_2274 162
556 3300041404 Ga0439436_0017321 Ga0439436_0017321_1338_1868 162
557 3300041404 Ga0439436_0036469 Ga0439436_0036469_700_1224 162
558 3300041404 Ga0439436_0084864 Ga0439436_0084864_239_727 162
559 3300041405 Ga0439438_033184 Ga0439438_033184_366_896 162
560 3300041406 Ga0439439_0057069 Ga0439439_0057069_214_738 162
561 3300041410 Ga0439461_0003310 Ga0439461_0003310_613_1143 162
562 3300041411 Ga0439466_0043460 Ga0439466_0043460_247_777 162
563 3300041413 Ga0439465_0012268 Ga0439465_0012268_1410_1934 162
564 3300041413 Ga0439465_0063356 Ga0439465_0063356_191_721 162
565 3300041498 Ga0451841_0612739 Ga0451841_0612739_60_602 162
566 3300041997 Ga0439431_0018496 Ga0439431_0018496_377_901 162
567 3300041999 Ga0439433_0006502 Ga0439433_0006502_1515_2039 162
568 3300041999 Ga0439433_0038722 Ga0439433_0038722_146_676 162
569 3300042002 Ga0439442_010969 Ga0439442_010969_658_1182 162
570 3300042002 Ga0439442_036909 Ga0439442_036909_297_827 162
571 3300042004 Ga0439445_0006877 Ga0439445_0006877_485_1021 162
572 3300042006 Ga0439432_000644 Ga0439432_000644_12252_12776 162
573 3300042006 Ga0439432_008235 Ga0439432_008235_1613_2143 162
574 3300042007 Ga0439449_0000752 Ga0439449_0000752_1487_2011 162
575 3300042007 Ga0439449_0022143 Ga0439449_0022143_1519_2049 162
576 3300042007 Ga0439449_0027467 Ga0439449_0027467_60_584 162
577 3300042007 Ga0439449_0050000 Ga0439449_0050000_681_1169 162
578 3300042010 Ga0439452_007471 Ga0439452_007471_2371_2895 162
579 3300042014 Ga0439457_029307 Ga0439457_029307_462_992 162
580 3300042128 Ga0450897_000516 Ga0450897_000516_510_1040 162
581 3300042131 Ga0450894_004749 Ga0450894_004749_441_971 162
582 3300042133 Ga0450896_002895 Ga0450896_002895_130_660 162
583 3300042135 Ga0450899_010789 Ga0450899_010789_197_727 162
584 3300042145 Ga0450906_026602 Ga0450906_026602_236_766 162
585 3300042156 Ga0439446_0034759 Ga0439446_0034759_258_782 162
586 3300042184 Ga0450908_021205 Ga0450908_021205_467_997 162
587 3300042531 Ga0450918_041571 Ga0450918_041571_41_571 162
588 3300042876 Ga0451577_0005231 Ga0451577_0005231_12691_13182 162
589 3300042876 Ga0451577_0916257 Ga0451577_0916257_190_678 162
590 3300044683 Ga0466965_0088341 Ga0466965_0088341_216_746 162
591 3300044712 Ga0453684_0175174 Ga0453684_0175174_19_507 162
592 3300044712 Ga0453684_0258814 Ga0453684_0258814_1339_1830 162
593 3300045051 Ga0451576_0011443 Ga0451576_0011443_7983_8474 162
594 3300045051 Ga0451576_0142539 Ga0451576_0142539_1670_2194 162
595 3300046453 Ga0495627_022181 Ga0495627_022181_860_1402 162
596 3300046459 Ga0495629_0425965 Ga0495629_0425965_141_689 162
597 3300046460 Ga0495638_0104703 Ga0495638_0104703_571_1110 162
598 3300046462 Ga0495651_0207609 Ga0495651_0207609_550_1083 162
599 3300046463 Ga0495653_0238043 Ga0495653_0238043_444_977 162
600 3300046471 Ga0495650_0292295 Ga0495650_0292295_32_529 162
601 3300046512 Ga0495610_0034618 Ga0495610_0034618_1546_2085 162
602 3300046513 Ga0495616_0067004 Ga0495616_0067004_522_1061 162
603 3300046514 Ga0495618_0094409 Ga0495618_0094409_597_1130 162
604 3300046515 Ga0495620_0008493 Ga0495620_0008493_439_981 162
605 3300046518 Ga0495631_0066034 Ga0495631_0066034_591_1130 162
606 3300046520 Ga0495637_0057927 Ga0495637_0057927_468_1013 162
607 3300046522 Ga0495643_0121676 Ga0495643_0121676_120_659 162
608 3300046538 Ga0495609_0054040 Ga0495609_0054040_870_1415 162
609 3300046557 Ga0495622_0097092 Ga0495622_0097092_83_631 162
610 3300046558 Ga0495633_0145159 Ga0495633_0145159_42_587 162
611 3300046559 Ga0495667_0218832 Ga0495667_0218832_279_812 162
612 3300046660 Ga0495625_0210708 Ga0495625_0210708_286_825 162
613 3300046663 Ga0495635_0473731 Ga0495635_0473731_117_650 162
614 3300046674 Ga0495588_0099138 Ga0495588_0099138_179_712 162
615 3300046674 Ga0495588_0127654 Ga0495588_0127654_474_1016 162
616 3300046675 Ga0495657_0268371 Ga0495657_0268371_360_893 162
617 3300046680 Ga0495646_0241794 Ga0495646_0241794_297_830 162
618 3300046683 Ga0495658_0244956 Ga0495658_0244956_276_824 162
619 3300046683 Ga0495658_0322712 Ga0495658_0322712_297_830 162
620 3300046689 Ga0495613_0237913 Ga0495613_0237913_492_1025 162
621 3300046691 Ga0495670_0149527 Ga0495670_0149527_267_806 162
622 3300047321 Ga0495676_0002146 Ga0495676_0002146_715_1263 162
623 3300047322 Ga0495680_0130852 Ga0495680_0130852_953_1486 162
624 3300047472 Ga0495686_0349667 Ga0495686_0349667_41_580 162
625 3300047673 Ga0495593_0015848 Ga0495593_0015848_2549_3097 162
626 3300048088 Ga0495602_0340931 Ga0495602_0340931_403_951 162
627 3300048088 Ga0495602_0342412 Ga0495602_0342412_103_636 162
628 3300048903 Ga0496100_0082603 Ga0496100_0082603_434_967 162
629 3300048904 Ga0496101_0110727 Ga0496101_0110727_877_1410 162
630 3300048908 Ga0496105_0048520 Ga0496105_0048520_1077_1610 162
631 3300048909 Ga0496106_0158058 Ga0496106_0158058_618_1151 162
632 3300048910 Ga0496107_0349904 Ga0496107_0349904_431_970 162
633 3300048910 Ga0496107_0361318 Ga0496107_0361318_70_603 162
634 3300048911 Ga0496108_0410090 Ga0496108_0410090_132_665 162
635 3300048912 Ga0496109_0195299 Ga0496109_0195299_141_674 162
636 3300048913 Ga0496110_0087171 Ga0496110_0087171_375_908 162
637 3300048913 Ga0496110_0494402 Ga0496110_0494402_155_649 162
638 3300048914 Ga0496111_0116400 Ga0496111_0116400_1075_1608 162
639 3300048916 Ga0496113_0573842 Ga0496113_0573842_148_681 162
640 3300048917 Ga0496114_0085708 Ga0496114_0085708_996_1529 162
641 3300048917 Ga0496114_0247328 Ga0496114_0247328_529_1059 162
642 3300048919 Ga0496116_0015563 Ga0496116_0015563_974_1468 162
643 3300048920 Ga0496117_0079964 Ga0496117_0079964_202_696 162
644 3300048920 Ga0496117_0223087 Ga0496117_0223087_340_843 162
645 3300048921 Ga0496118_0024461 Ga0496118_0024461_4561_5064 162
646 3300048921 Ga0496118_0325610 Ga0496118_0325610_60_602 162
647 3300048924 Ga0496121_0219386 Ga0496121_0219386_346_885 162
648 3300048928 Ga0496125_0042149 Ga0496125_0042149_432_935 162
649 3300050489 nmdc:mga03683_76352_c1 nmdc:mga03683_76352_c1_422_952 162
650 3300050493 nmdc:mga0k408_199361_c1 nmdc:mga0k408_199361_c1_288_818 162
651 3300050493 nmdc:mga0k408_302276_c1 nmdc:mga0k408_302276_c1_51_578 162
652 3300050496 nmdc:mga07m45_126177_c1 nmdc:mga07m45_126177_c1_324_869 162
653 3300050496 nmdc:mga07m45_65471_c1 nmdc:mga07m45_65471_c1_955_1482 162
654 3300050496 nmdc:mga07m45_95341_c1 nmdc:mga07m45_95341_c1_1040_1534 162
655 3300053079 Ga0500610_0014525 Ga0500610_0014525_1943_2485 162
656 3300053079 Ga0500610_0069226 Ga0500610_0069226_1213_1752 162
657 3300053087 Ga0500643_039096 Ga0500643_039096_485_1033 162
658 3300053093 Ga0500651_0000637 Ga0500651_0000637_16322_16870 162
659 3300053094 Ga0500566_0007532 Ga0500566_0007532_258_806 162
660 3300053108 Ga0500562_060988 Ga0500562_060988_92_631 162
661 3300053110 Ga0500571_003025 Ga0500571_003025_701_1249 162
662 3300053117 Ga0500593_001539 Ga0500593_001539_5721_6263 162
663 3300053118 Ga0500594_0003737 Ga0500594_0003737_2209_2748 162
664 3300053121 Ga0500607_031799 Ga0500607_031799_360_902 162
665 3300053122 Ga0500608_067319 Ga0500608_067319_490_1041 162
666 3300053133 Ga0500655_019199 Ga0500655_019199_498_1046 162
667 3300053134 Ga0500658_0003701 Ga0500658_0003701_2155_2694 162
668 3300053134 Ga0500658_0007934 Ga0500658_0007934_2105_2644 162
669 3300053136 Ga0500559_0086415 Ga0500559_0086415_639_1178 162
670 3300053139 Ga0500568_0002017 Ga0500568_0002017_7589_8128 162
671 3300053141 Ga0500574_001946 Ga0500574_001946_357_905 162
672 3300053142 Ga0500577_0129108 Ga0500577_0129108_375_872 162
673 3300053158 Ga0500627_0015591 Ga0500627_0015591_702_1244 162
674 3300053162 Ga0500638_113832 Ga0500638_113832_574_1122 162
675 3300053177 Ga0500636_0187416 Ga0500636_0187416_279_827 162
676 3300053730 Ga0500645_007710 Ga0500645_007710_2786_3286 162
677 3300059643 Ga0587072_002999 Ga0587072_002999_163_705 162
678 iso_pu_bacteria 2513020051 2513231355 162
679 iso_pu_bacteria 2643221672 2644400218 162
680 iso_pu_bacteria 2643221683 2644467606 162
681 iso_pu_bacteria 2738543013 2739252302 162
682 iso_pu_bacteria 2818991446 2819602281 162
683 iso_pu_bacteria 2885192300 2885196103 162
684 iso_pu_bacteria 2899924645 2899930560 162
685 iso_pu_bacteria 2904449895 2904456350 162
686 iso_pu_bacteria 2904456579 2904462859 162
687 iso_pu_bacteria 2904541872 2904546914 162
688 iso_pu_bacteria 2928037797 2928039674 162
689 iso_pu_bacteria 2928044640 2928044721 162
690 iso_pu_bacteria 2928051484 2928052521 162
691 iso_pu_bacteria 2928064002 2928064816 162
692 iso_pu_bacteria 2928084124 2928087148 162
693 iso_pu_bacteria 2929160207 2929164386 162
694 iso_pu_bacteria 2929520902 2929524390 162
695 iso_pu_bacteria 2945909444 2945910915 162
696 iso_pu_bacteria 2945945610 2945946776 162
697 iso_pu_bacteria 2945984333 2945986847 162
698 2162886007 SwRhRL2b_contig_556956 SwRhRL2b_0329.00008620 163
699 2162886007 SwRhRL2b_contig_612720 SwRhRL2b_0890.00003520 163
700 3300002704 JGI25155J39150_1000051 JGI25155J39150_100005159 163
701 3300002705 JGI25156J39149_1000196 JGI25156J39149_100019623 163
702 3300002738 JGI25154J39366_1000344 JGI25154J39366_100034423 163
703 3300002741 JGI25157J39369_1000091 JGI25157J39369_100009159 163
704 3300002774 JGI25150J39212_1003713 JGI25150J39212_10037132 163
705 3300002987 JGI25159J45721_1011402 JGI25159J45721_10114022 163
706 3300002987 JGI25159J45721_1011673 JGI25159J45721_10116732 163
707 3300003187 JGI25151J46595_10007945 JGI25151J46595_100079453 163
708 3300003187 JGI25151J46595_10029389 JGI25151J46595_100293893 163
709 3300003187 JGI25151J46595_10050766 JGI25151J46595_100507662 163
710 3300003316 rootH1_10052921 rootH1_100529213 163
711 3300003322 rootL2_10007894 rootL2_100078942 163
712 3300003323 rootH1_10045102 rootH1_100451022 163
713 3300003354 JGI25160J50197_1000067 JGI25160J50197_10000672 163
714 3300003374 JGI25161J50226_1000035 JGI25161J50226_100003523 163
715 3300003771 Ga0055526_1004349 Ga0055526_10043495 163
716 3300003771 Ga0055526_1008880 Ga0055526_10088802 163
717 3300003771 Ga0055526_1065313 Ga0055526_10653131 163
718 3300003773 Ga0055537_1001588 Ga0055537_10015885 163
719 3300003775 Ga0055524_1000006 Ga0055524_10000064 163
720 3300003775 Ga0055524_1003866 Ga0055524_10038666 163
721 3300003775 Ga0055524_1008425 Ga0055524_10084253 163
722 3300003781 Ga0055536_1004362 Ga0055536_10043622 163
723 3300003784 Ga0055534_1001777 Ga0055534_10017775 163
724 3300003790 Ga0055528_1001140 Ga0055528_10011408 163
725 3300003791 Ga0055530_10004417 Ga0055530_1000441710 163
726 3300003792 Ga0055540_1000005 Ga0055540_1000005308 163
727 3300003794 Ga0055531_10001665 Ga0055531_1000166513 163
728 3300004625 Ga0055543_1000829 Ga0055543_10008294 163
729 3300004625 Ga0055543_1011894 Ga0055543_10118941 163
730 3300005262 Ga0065165_1000652 Ga0065165_10006528 163
731 3300005262 Ga0065165_1041154 Ga0065165_10411542 163
732 3300005262 Ga0065165_1043890 Ga0065165_10438901 163
733 3300005262 Ga0065165_1115931 Ga0065165_11159311 163
734 3300005289 Ga0065704_10070938 Ga0065704_100709389 163
735 3300005289 Ga0065704_10133441 Ga0065704_101334412 163
736 3300005327 Ga0070658_10853035 Ga0070658_108530352 163
737 3300005334 Ga0068869_100617051 Ga0068869_1006170511 163
738 3300005338 Ga0068868_100095204 Ga0068868_1000952042 163
739 3300005353 Ga0070669_100971547 Ga0070669_1009715471 163
740 3300005356 Ga0070674_100776006 Ga0070674_1007760061 163
741 3300005356 Ga0070674_101093710 Ga0070674_1010937101 163
742 3300005441 Ga0070700_100772228 Ga0070700_1007722282 163
743 3300005456 Ga0070678_100691882 Ga0070678_1006918822 163
744 3300005539 Ga0068853_100106808 Ga0068853_1001068082 163
745 3300005563 Ga0068855_100139617 Ga0068855_1001396172 163
746 3300005614 Ga0068856_101091037 Ga0068856_1010910372 163
747 3300005616 Ga0068852_101024674 Ga0068852_1010246742 163
748 3300005843 Ga0068860_101593280 Ga0068860_1015932801 163
749 3300006038 Ga0075365_10034436 Ga0075365_100344362 163
750 3300006048 Ga0075363_100119843 Ga0075363_1001198432 163
751 3300006177 Ga0075362_10228974 Ga0075362_102289742 163
752 3300006195 Ga0075366_10000944 Ga0075366_1000094412 163
753 3300006195 Ga0075366_10004207 Ga0075366_100042072 163
754 3300006195 Ga0075366_10051827 Ga0075366_100518272 163
755 3300006237 Ga0097621_100798068 Ga0097621_1007980681 163
756 3300006353 Ga0075370_10015686 Ga0075370_100156862 163
757 3300006353 Ga0075370_10244587 Ga0075370_102445872 163
758 3300006353 Ga0075370_10681556 Ga0075370_106815561 163
759 3300006847 Ga0075431_100599986 Ga0075431_1005999862 163
760 3300006944 Ga0099823_1002850 Ga0099823_100285010 163
761 3300006946 Ga0079104_1000002 Ga0079104_1000002237 163
762 3300009092 Ga0105250_10000636 Ga0105250_100006362 163
763 3300009098 Ga0105245_10109483 Ga0105245_101094832 163
764 3300009148 Ga0105243_10001518 Ga0105243_100015189 163
765 3300009545 Ga0105237_10097733 Ga0105237_100977332 163
766 3300012497 Ga0157319_1000006 Ga0157319_100000650 163
767 3300012513 Ga0157326_1001580 Ga0157326_10015802 163
768 3300013100 Ga0157373_10321126 Ga0157373_103211262 163
769 3300013104 Ga0157370_10484449 Ga0157370_104844492 163
770 3300013105 Ga0157369_10461227 Ga0157369_104612272 163
771 3300013308 Ga0157375_10926408 Ga0157375_109264082 163
772 3300013308 Ga0157375_11901375 Ga0157375_119013752 163
773 3300014497 Ga0182008_10006435 Ga0182008_100064352 163
774 3300014497 Ga0182008_10545867 Ga0182008_105458671 163
775 3300014969 Ga0157376_10027129 Ga0157376_100271296 163
776 3300014969 Ga0157376_10540140 Ga0157376_105401402 163
777 3300025206 Ga0209435_100062 Ga0209435_10006223 163
778 3300025245 Ga0207425_1001373 Ga0207425_100137311 163
779 3300025245 Ga0207425_1013370 Ga0207425_10133702 163
780 3300025246 Ga0209646_1000001 Ga0209646_1000001312 163
781 3300025250 Ga0209026_1000224 Ga0209026_100022423 163
782 3300025256 Ga0209759_1000013 Ga0209759_1000013312 163
783 3300025258 Ga0209129_1018123 Ga0209129_10181232 163
784 3300025263 Ga0209565_1001861 Ga0209565_10018615 163
785 3300025273 Ga0209673_1000043 Ga0209673_100004395 163
786 3300025273 Ga0209673_1022593 Ga0209673_10225933 163
787 3300025284 Ga0209130_1000241 Ga0209130_10002412 163
788 3300025291 Ga0209675_1006965 Ga0209675_10069655 163
789 3300025291 Ga0209675_1035958 Ga0209675_10359582 163
790 3300025292 Ga0209676_1000007 Ga0209676_1000007391 163
791 3300025292 Ga0209676_1010599 Ga0209676_10105992 163
792 3300025294 Ga0209025_1003025 Ga0209025_10030252 163
793 3300025294 Ga0209025_1032356 Ga0209025_10323562 163
794 3300025294 Ga0209025_1046308 Ga0209025_10463082 163
795 3300025295 Ga0209564_1000003 Ga0209564_10000031270 163
796 3300025295 Ga0209564_1000285 Ga0209564_100028566 163
797 3300025295 Ga0209564_1000877 Ga0209564_10008775 163
798 3300025295 Ga0209564_1011461 Ga0209564_10114616 163
799 3300025297 Ga0209758_1034699 Ga0209758_10346992 163
800 3300025298 Ga0209050_1000003 Ga0209050_10000031117 163
801 3300025298 Ga0209050_1012163 Ga0209050_10121633 163
802 3300025298 Ga0209050_1024990 Ga0209050_10249902 163
803 3300025299 Ga0209256_1000001 Ga0209256_10000011124 163
804 3300025299 Ga0209256_1005250 Ga0209256_10052504 163
805 3300025299 Ga0209256_1023182 Ga0209256_10231822 163
806 3300025302 Ga0207426_1000097 Ga0207426_1000097271 163
807 3300025302 Ga0207426_1000247 Ga0207426_1000247116 163
808 3300025303 Ga0209051_1000003 Ga0209051_10000031117 163
809 3300025303 Ga0209051_1003281 Ga0209051_100328112 163
810 3300025303 Ga0209051_1098509 Ga0209051_10985091 163
811 3300025304 Ga0209257_1000020 Ga0209257_1000020391 163
812 3300025304 Ga0209257_1002969 Ga0209257_10029698 163
813 3300025304 Ga0209257_1061327 Ga0209257_10613272 163
814 3300025711 Ga0207696_1006799 Ga0207696_10067998 163
815 3300025909 Ga0207705_10604773 Ga0207705_106047731 163
816 3300025914 Ga0207671_10116538 Ga0207671_101165383 163
817 3300025923 Ga0207681_10136776 Ga0207681_101367762 163
818 3300025931 Ga0207644_10829721 Ga0207644_108297212 163
819 3300025932 Ga0207690_11164369 Ga0207690_111643692 163
820 3300025935 Ga0207709_10000015 Ga0207709_10000015232 163
821 3300025937 Ga0207669_11007170 Ga0207669_110071702 163
822 3300025942 Ga0207689_10073610 Ga0207689_100736102 163
823 3300025949 Ga0207667_10125418 Ga0207667_101254182 163
824 3300025949 Ga0207667_10528360 Ga0207667_105283602 163
825 3300025981 Ga0207640_10497649 Ga0207640_104976492 163
826 3300026041 Ga0207639_10050722 Ga0207639_100507223 163
827 3300026078 Ga0207702_10125932 Ga0207702_101259322 163
828 3300026121 Ga0207683_10332922 Ga0207683_103329222 163
829 3300026142 Ga0207698_10647487 Ga0207698_106474872 163
830 3300027111 Ga0209281_1000007 Ga0209281_1000007455 163
831 3300027296 Ga0209389_1054541 Ga0209389_10545413 163
832 3300027312 Ga0209371_1030410 Ga0209371_10304102 163
833 3300027395 Ga0209996_1019193 Ga0209996_10191931 163
834 3300027424 Ga0209984_1008526 Ga0209984_10085262 163
835 3300027526 Ga0209968_1016556 Ga0209968_10165562 163
836 3300027614 Ga0209970_1004463 Ga0209970_10044632 163
837 3300027665 Ga0209983_1032617 Ga0209983_10326172 163
838 3300027682 Ga0209971_1002849 Ga0209971_10028497 163
839 3300027876 Ga0209974_10008135 Ga0209974_100081353 163
840 3300027876 Ga0209974_10110487 Ga0209974_101104872 163
841 3300028381 Ga0268264_10916109 Ga0268264_109161092 163
842 3300028573 Ga0265334_10116263 Ga0265334_101162632 163
843 3300028794 Ga0307515_10000515 Ga0307515_1000051530 163
844 3300030500 Ga0268256_1012436 Ga0268256_10124362 163
845 3300031235 Ga0265330_10000033 Ga0265330_10000033108 163
846 3300031238 Ga0265332_10000001 Ga0265332_10000001232 163
847 3300031238 Ga0265332_10002998 Ga0265332_100029982 163
848 3300031241 Ga0265325_10008684 Ga0265325_100086844 163
849 3300031247 Ga0265340_10006547 Ga0265340_100065472 163
850 3300031344 Ga0265316_10369743 Ga0265316_103697432 163
851 3300031456 Ga0307513_10000054 Ga0307513_1000005423 163
852 3300031456 Ga0307513_10323610 Ga0307513_103236102 163
853 3300031548 Ga0307408_100320969 Ga0307408_1003209692 163
854 3300031548 Ga0307408_101257891 Ga0307408_1012578912 163
855 3300031649 Ga0307514_10000529 Ga0307514_1000052930 163
856 3300031711 Ga0265314_10000022 Ga0265314_10000022237 163
857 3300031711 Ga0265314_10001258 Ga0265314_1000125827 163
858 3300031712 Ga0265342_10012278 Ga0265342_100122786 163
859 3300031730 Ga0307516_10039216 Ga0307516_100392162 163
860 3300031901 Ga0307406_10173112 Ga0307406_101731122 163
861 3300031911 Ga0307412_10083120 Ga0307412_100831202 163
862 3300031911 Ga0307412_10219336 Ga0307412_102193361 163
863 3300031911 Ga0307412_10406145 Ga0307412_104061452 163
864 3300031911 Ga0307412_10783085 Ga0307412_107830852 163
865 3300032002 Ga0307416_101252644 Ga0307416_1012526442 163
866 3300032004 Ga0307414_11216634 Ga0307414_112166341 163
867 3300037418 Ga0395900_0035029 Ga0395900_0035029_1508_1999 163
868 3300037466 Ga0395898_0922804 Ga0395898_0922804_302_793 163
869 3300037471 Ga0395905_0000125 Ga0395905_0000125_125477_125971 163
870 3300037471 Ga0395905_0019808 Ga0395905_0019808_193_687 163
871 3300037471 Ga0395905_0133216 Ga0395905_0133216_378_872 163
872 3300037471 Ga0395905_0190926 Ga0395905_0190926_1000_1494 163
873 3300037471 Ga0395905_0287775 Ga0395905_0287775_399_890 163
874 3300037471 Ga0395905_0334305 Ga0395905_0334305_246_737 163
875 3300038443 Ga0395901_0695043 Ga0395901_0695043_195_692 163
876 3300041512 Ga0451853_3461985 Ga0451853_3461985_221_715 163
877 3300042000 Ga0439437_014647 Ga0439437_014647_334_849 163
878 3300042127 Ga0450890_008872 Ga0450890_008872_451_966 163
879 3300042127 Ga0450890_021028 Ga0450890_021028_89_589 163
880 3300042134 Ga0450898_003128 Ga0450898_003128_135_626 163
881 3300042156 Ga0439446_0106780 Ga0439446_0106780_40_537 163
882 3300042437 Ga0439444_0022352 Ga0439444_0022352_336_851 163
883 3300042438 Ga0439459_0001649 Ga0439459_0001649_1445_1960 163
884 3300042876 Ga0451577_0104198 Ga0451577_0104198_343_879 163
885 3300044656 Ga0466969_0194922 Ga0466969_0194922_300_797 163
886 3300044658 Ga0466972_0023932 Ga0466972_0023932_18_512 163
887 3300044684 Ga0466966_0140415 Ga0466966_0140415_853_1347 163
888 3300044684 Ga0466966_0241175 Ga0466966_0241175_435_926 163
889 3300044693 Ga0466961_0113051 Ga0466961_0113051_727_1221 163
890 3300044693 Ga0466961_0174961 Ga0466961_0174961_439_936 163
891 3300044694 Ga0466963_0385338 Ga0466963_0385338_322_837 163
892 3300044712 Ga0453684_0504094 Ga0453684_0504094_72_608 163
893 3300044765 Ga0466970_0048862 Ga0466970_0048862_319_813 163
894 3300044842 Ga0466957_0565863 Ga0466957_0565863_154_645 163
895 3300044901 Ga0466960_0208918 Ga0466960_0208918_409_903 163
896 3300045049 Ga0466959_0041941 Ga0466959_0041941_2477_2971 163
897 3300045049 Ga0466959_0323962 Ga0466959_0323962_144_641 163
898 3300045051 Ga0451576_0572666 Ga0451576_0572666_191_682 163
899 3300046530 Ga0495654_0024669 Ga0495654_0024669_755_1309 163
900 3300046542 Ga0495597_0003773 Ga0495597_0003773_7051_7542 163
901 3300046558 Ga0495633_0048538 Ga0495633_0048538_706_1197 163
902 3300046664 Ga0495659_0252860 Ga0495659_0252860_166_675 163
903 3300048089 Ga0495614_0050797 Ga0495614_0050797_493_1038 163
904 3300048921 Ga0496118_0257510 Ga0496118_0257510_95_649 163
905 3300048921 Ga0496118_0292662 Ga0496118_0292662_177_707 163
906 3300048924 Ga0496121_0016103 Ga0496121_0016103_288_824 163
907 3300048925 Ga0496122_0002216 Ga0496122_0002216_20738_21268 163
908 3300048925 Ga0496122_0060113 Ga0496122_0060113_293_784 163
909 3300048926 Ga0496123_0000057 Ga0496123_0000057_211897_212427 163
910 3300048926 Ga0496123_0252832 Ga0496123_0252832_20_511 163
911 3300048927 Ga0496124_0102702 Ga0496124_0102702_1152_1679 163
912 3300048927 Ga0496124_0229273 Ga0496124_0229273_663_1199 163
913 3300048927 Ga0496124_0286744 Ga0496124_0286744_261_791 163
914 3300048927 Ga0496124_0391648 Ga0496124_0391648_226_780 163
915 3300048928 Ga0496125_0017536 Ga0496125_0017536_507_998 163
916 3300048928 Ga0496125_0021742 Ga0496125_0021742_251_793 163
917 3300048928 Ga0496125_0022543 Ga0496125_0022543_5057_5593 163
918 3300048929 Ga0496126_0339294 Ga0496126_0339294_192_722 163
919 3300049581 Ga0501047_0263313 Ga0501047_0263313_519_1019 163
920 3300050489 nmdc:mga03683_71105_c1 nmdc:mga03683_71105_c1_748_1242 163
921 3300050493 nmdc:mga0k408_4382_c1 nmdc:mga0k408_4382_c1_5642_6145 163
922 3300050493 nmdc:mga0k408_52328_c1 nmdc:mga0k408_52328_c1_695_1210 163
923 3300050493 nmdc:mga0k408_76703_c1 nmdc:mga0k408_76703_c1_952_1482 163
924 3300050496 nmdc:mga07m45_17376_c2 nmdc:mga07m45_17376_c2_1121_1636 163
925 3300050496 nmdc:mga07m45_35505_c1 nmdc:mga07m45_35505_c1_1893_2423 163
926 3300053088 Ga0500644_0032531 Ga0500644_0032531_541_1035 163
927 3300053090 Ga0500646_0126829 Ga0500646_0126829_162_656 163
928 3300053117 Ga0500593_001469 Ga0500593_001469_6132_6626 163
929 3300053121 Ga0500607_136146 Ga0500607_136146_483_1037 163
930 3300053136 Ga0500559_0019098 Ga0500559_0019098_730_1260 163
931 3300053140 Ga0500573_0197587 Ga0500573_0197587_167_697 163
932 3300053151 Ga0500604_0097367 Ga0500604_0097367_231_725 163
933 3300053161 Ga0500634_0174715 Ga0500634_0174715_70_573 163
934 3300053730 Ga0500645_001223 Ga0500645_001223_7749_8243 163
935 iso_pu_bacteria 2599185214 2599622925 163
936 iso_pu_bacteria 2599185226 2599671404 163
937 iso_pu_bacteria 2599185227 2599679559 163
938 iso_pu_bacteria 2599185229 2599691575 163
939 iso_pu_bacteria 2643221628 2644162747 163
940 iso_pu_bacteria 2643221658 2644325054 163
941 iso_pu_bacteria 2738541277 2738718778 163
942 iso_pu_bacteria 2738541307 2738884964 163
943 iso_pu_bacteria 2738543019 2739280796 163
944 iso_pu_bacteria 2831265667 2831265757 163
945 iso_pu_bacteria 2831864461 2831870048 163
946 iso_pu_bacteria 2838054893 2838056471 163
947 iso_pu_bacteria 2842677519 2842681791 163
948 iso_pu_bacteria 2842733646 2842736189 163
949 iso_pu_bacteria 2842747753 2842748073 163
950 iso_pu_bacteria 2881101125 2881101622 163
951 iso_pu_bacteria 2885198086 2885203340 163
952 iso_pu_bacteria 2885211737 2885217310 163
953 iso_pu_bacteria 2919462493 2919463966 163
954 iso_pu_bacteria 2919704043 2919709047 163
955 iso_pu_bacteria 2928070936 2928074715 163
956 iso_pu_bacteria 2928115317 2928115339 163
957 iso_pu_bacteria 2945972063 2945976491 163
958 iso_pu_bacteria 2954767861 2954771515 163

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01257

2Fe-2S_thioredx

Thioredoxin-like [2Fe-2S] ferredoxin

26

173

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3iam-assembly1.cif.gz_2 crystal structure of the hydrophilic domain of respiratory complex i from thermus thermophilus, reduced, 2 mol/asu, with bound nadh 0.8869 7 158
6zjy-assembly1.cif.gz_2 respiratory complex i from thermus thermophilus, nad+ dataset, minor state 0.8825 7 159
8e9i-assembly1.cif.gz_E mycobacterial respiratory complex i, semi-inserted quinone 0.8818 2 157
7p7c-assembly1.cif.gz_E complex i from e. coli, ddm/lmng-purified, apo, open state 0.871 1 155
8gym-assembly1.cif.gz_v2 cryo-em structure of tetrahymena thermophila respiratory mega-complex mc iv2+(i+iii2+ii)2 0.8696 1 159
ID Description Score Start End Superfamily
af_Q6PBX8_48_121_1.10.10.1590 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;NADH-quinone oxidoreductase subunit E 0.9629 1 73 1.10.10.1590
af_Q9D6J6_126_223_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.954 74 159 3.40.30.10
3i9v201 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;NADH-quinone oxidoreductase subunit E 0.9462 7 73 1.10.10.1590
af_P0AFD1_13_82_1.10.10.1590 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;NADH-quinone oxidoreductase subunit E 0.9409 1 72 1.10.10.1590
af_Q6PBX8_48_121_1.10.10.1590 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;NADH-quinone oxidoreductase subunit E 0.9381 1 73 1.10.10.1590
ID Description Score Start End GO Terms
AF-A0A6I5CEV9-F1-model_v4 NADH-quinone oxidoreductase subunit NuoE (EC 1.6.5.11) 0.9117 5 159 GO:0003954
GO:0046872
GO:0051537
AF-A0A1Q7ADA8-F1-model_v4 NADH-quinone oxidoreductase subunit E 0.9024 1 161 GO:0003954
GO:0046872
GO:0051537
AF-A0A1F5VJ35-F1-model_v4 NADH dehydrogenase 0.9008 1 156 GO:0003954
GO:0046872
GO:0051537
AF-A0A538ERJ3-F1-model_v4 NADH-quinone oxidoreductase subunit NuoE (EC 1.6.5.11) 0.9006 5 159 GO:0003954
GO:0046872
GO:0051537
AF-A0A7Y5UVK4-F1-model_v4 NAD(P)H-dependent oxidoreductase subunit E 0.9001 1 156 GO:0003954
GO:0046872
GO:0051537

Feature Viewer

pLDDT pTM Quality
94.13 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map