F486790
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 958 | 496 | 908 | 171 |
Family's Representative Sequence
| Representative Sequence | 3300005563|Ga0068855_100139617|Ga0068855_1001396172 |
| Length | 184 |
| Sequence | MTSSTHHDTAPLAPSSPLRPAILERFAREVAKYPEAGKQSAVMACLAIVQQEEGFVSLQREREIAEYLGMAPIAVHEVTTFYNMYNQHPVGKFKLNVCTNLPCQLRDGVTALVHLEKKLGIKMGETTADGLFTLQQSECLGACADSPVMLVNDRTMCSFMSNEKLDQLIDGLRNAAPAAKGEAS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2511231002 | Polaromonas sp. CF318 | Isolate | Rhizosphere |
| 3 | 2513020051 | Variovorax sp. CF313 | Isolate | Rhizosphere |
| 4 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 5 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 6 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 7 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 8 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 9 | 2643221658 | Variovorax sp. Root411 | Isolate | Unclassified |
| 10 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 11 | 2643221683 | Variovorax sp. Root473 | Isolate | Unclassified |
| 12 | 2721755523 | Delftia sp. HK171 | Isolate | Unclassified |
| 13 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 14 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 15 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 16 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 17 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 18 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 19 | 2831864461 | Roseateles noduli HZ7 | Isolate | Nodule |
| 20 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 21 | 2839138175 | Delftia acidovorans B15 | Isolate | Rhizosphere |
| 22 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 23 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 24 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 25 | 2881101125 | Ramlibacter rhizophilus CCTCC AB2015357 | Isolate | Rhizosphere |
| 26 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 27 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 28 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 29 | 2886848708 | Mitsuaria sp. TWR114 | Isolate | Rhizosphere |
| 30 | 2894023352 | Diaphorobacter ruginosibacter DSM 27467 | Isolate | Nodule |
| 31 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 32 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 33 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 34 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 35 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 36 | 2919704043 | Hydrogenophaga palleronii 4249 | Isolate | Unclassified |
| 37 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 38 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 39 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 40 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 41 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 42 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 43 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 44 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 45 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 46 | 2932422444 | Comamonas sp. 4034 | Isolate | Rhizosphere |
| 47 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 48 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 49 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 50 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 51 | 2954767861 | Variovorax sp. TBS-050B | Isolate | Rhizosphere |
| 52 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 53 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 54 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 55 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 56 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 57 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 58 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 59 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 60 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 61 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 62 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 63 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 64 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 65 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 66 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 67 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 68 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 69 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 70 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 71 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 72 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 73 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 74 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 75 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 76 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 77 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 78 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 79 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 80 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 81 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 82 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 83 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 84 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 85 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 86 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 87 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 88 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 89 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 90 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 91 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 93 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 94 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 96 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 97 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 99 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 106 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 107 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 108 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 109 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 110 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 111 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 112 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 113 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 114 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 115 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 116 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 117 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 118 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 119 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 120 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 121 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 122 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 123 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 124 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 125 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 126 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 127 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 128 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 129 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 130 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 131 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 132 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 133 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 134 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 135 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 136 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 137 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 138 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 140 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 141 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 142 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 143 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 144 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 145 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 146 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 149 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 150 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 151 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 152 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 153 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 154 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 155 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 156 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 157 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 158 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 159 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 160 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 167 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 168 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 169 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 170 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 171 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 172 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 173 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 174 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 175 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 176 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 177 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 178 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 179 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 180 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 182 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 183 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 184 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 185 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 186 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 187 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 188 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 189 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 190 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 191 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 192 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 193 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 194 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 195 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 196 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 197 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 198 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 199 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 200 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 201 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 202 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 203 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 204 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 205 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 206 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 207 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 254 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 255 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 263 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 266 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 270 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 271 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 272 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 273 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 274 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 275 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 276 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 277 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 278 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 279 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 280 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 281 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 282 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 283 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 284 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 285 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 286 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 287 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 288 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 289 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 290 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 291 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 292 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 293 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 294 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 295 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 296 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 297 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 298 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 299 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 300 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 301 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 302 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 303 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 304 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 305 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 306 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 307 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 308 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 309 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 310 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 311 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 312 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 313 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 314 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 315 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 316 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 317 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 318 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 319 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 320 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 321 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 322 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 323 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 324 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 325 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 326 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 327 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 328 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 329 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 330 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 331 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 332 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 333 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 334 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 335 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 336 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 337 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 338 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 339 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 340 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 341 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 342 | 3300042123 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 | Metagenome | Rhizosphere |
| 343 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 344 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 345 | 3300042128 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 | Metagenome | Rhizosphere |
| 346 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 347 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 348 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 349 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 350 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 351 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 352 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 353 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 354 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 355 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 356 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 357 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 358 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 359 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 360 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 361 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 362 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 363 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 364 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 365 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 366 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 367 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 368 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 369 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 370 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 371 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 372 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 373 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 374 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 375 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 376 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 426 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 427 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 428 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 429 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 430 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 431 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 432 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 433 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 434 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 435 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 436 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 437 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 438 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 439 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 440 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 441 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 442 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 443 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 444 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 445 | 3300049526 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control | Metagenome | Rhizosphere |
| 446 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 447 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 448 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 449 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 450 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 451 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 452 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 453 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 454 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 455 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 456 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 457 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 458 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 459 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 460 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 461 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 462 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 463 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 464 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 465 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 466 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 467 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 468 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 469 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 470 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 471 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 472 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 473 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 474 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 475 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 476 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 477 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 478 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 479 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 480 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 481 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 482 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 483 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 484 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 485 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 486 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 487 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 488 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 489 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 490 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 491 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 492 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 493 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 494 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 495 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 496 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.74 |
| Metatranscriptomes | 1.04 |
| Isolates | 5.22 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 27.45 |
| Nodule | 1.04 |
| Rhizoplane | 2.82 |
| Rhizosphere | 58.25 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.44 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_556956 | 2162886007 | Bacteria | 1134 |
| 2 | SwRhRL2b_contig_612720 | 2162886007 | Bacteria | 3259 |
| 3 | JGI24741J21665_1011580 | 3300001915 | Bacteria | 1537 |
| 4 | JGI24740J21852_10007552 | 3300001979 | Bacteria | 4404 |
| 5 | JGI24739J22299_10103394 | 3300001989 | Bacteria | 858 |
| 6 | JGI25155J39150_1000051 | 3300002704 | Bacteria | 76772 |
| 7 | JGI25156J39149_1000196 | 3300002705 | Bacteria | 42272 |
| 8 | JGI25156J39149_1002448 | 3300002705 | Bacteria | 6652 |
| 9 | JGI25156J39149_1010889 | 3300002705 | Bacteria | 2101 |
| 10 | JGI25156J39149_1016094 | 3300002705 | Bacteria | 1469 |
| 11 | JGI25156J39149_1019551 | 3300002705 | Bacteria | 1216 |
| 12 | JGI25156J39149_1034850 | 3300002705 | Bacteria | 726 |
| 13 | JGI25154J39366_1000344 | 3300002738 | Bacteria | 26657 |
| 14 | JGI25154J39366_1001442 | 3300002738 | Bacteria | 8427 |
| 15 | JGI25158J39367_1008994 | 3300002739 | Bacteria | 1377 |
| 16 | JGI25157J39369_1000091 | 3300002741 | Bacteria | 76837 |
| 17 | JGI25157J39369_1000095 | 3300002741 | Bacteria | 74770 |
| 18 | JGI25164J39214_1004101 | 3300002772 | Bacteria | 1718 |
| 19 | JGI25152J39213_1037143 | 3300002773 | Bacteria | 708 |
| 20 | JGI25150J39212_1003713 | 3300002774 | Bacteria | 3526 |
| 21 | JGI25150J39212_1011607 | 3300002774 | Bacteria | 1589 |
| 22 | JGI25159J45721_1006730 | 3300002987 | Bacteria | 3389 |
| 23 | JGI25159J45721_1011402 | 3300002987 | Bacteria | 2181 |
| 24 | JGI25159J45721_1011673 | 3300002987 | Bacteria | 2138 |
| 25 | JGI25159J45721_1018912 | 3300002987 | Bacteria | 1373 |
| 26 | JGI25151J46595_10007945 | 3300003187 | Bacteria | 5145 |
| 27 | JGI25151J46595_10017803 | 3300003187 | Bacteria | 3068 |
| 28 | JGI25151J46595_10029389 | 3300003187 | Bacteria | 2177 |
| 29 | JGI25151J46595_10050766 | 3300003187 | Bacteria | 1409 |
| 30 | JGI25151J46595_10112700 | 3300003187 | Bacteria | 708 |
| 31 | rootH1_10052921 | 3300003316 | Bacteria | 1068 |
| 32 | rootL2_10007894 | 3300003322 | Bacteria | 2706 |
| 33 | rootH1_10045102 | 3300003323 | Bacteria | 1455 |
| 34 | rootH1_10075206 | 3300003323 | Bacteria | 1108 |
| 35 | JGI25160J50197_1000067 | 3300003354 | Bacteria | 113436 |
| 36 | JGI25161J50226_1000035 | 3300003374 | Bacteria | 133666 |
| 37 | JGI25161J50226_1006295 | 3300003374 | Bacteria | 2166 |
| 38 | Ga0006562J51391_1178712 | 3300003578 | Bacteria | 1342 |
| 39 | Ga0006562J51391_1178713 | 3300003578 | Bacteria | 1230 |
| 40 | Ga0055539_1005506 | 3300003752 | Bacteria | 1644 |
| 41 | Ga0055539_1005852 | 3300003752 | Bacteria | 1586 |
| 42 | Ga0055539_1013569 | 3300003752 | Bacteria | 998 |
| 43 | Ga0055533_1000100 | 3300003756 | Bacteria | 111692 |
| 44 | Ga0055525_1000011 | 3300003759 | Bacteria | 503124 |
| 45 | Ga0055527_1008701 | 3300003760 | Bacteria | 1207 |
| 46 | Ga0055535_1000442 | 3300003761 | Bacteria | 38340 |
| 47 | Ga0055535_1000863 | 3300003761 | Bacteria | 21397 |
| 48 | Ga0055535_1005897 | 3300003761 | Bacteria | 2585 |
| 49 | Ga0055535_1020685 | 3300003761 | Bacteria | 813 |
| 50 | Ga0055542_1000052 | 3300003762 | Bacteria | 173583 |
| 51 | Ga0055529_1001089 | 3300003763 | Bacteria | 12329 |
| 52 | Ga0055526_1004349 | 3300003771 | Bacteria | 8557 |
| 53 | Ga0055526_1008880 | 3300003771 | Bacteria | 4936 |
| 54 | Ga0055526_1020588 | 3300003771 | Bacteria | 2338 |
| 55 | Ga0055526_1065313 | 3300003771 | Bacteria | 758 |
| 56 | Ga0055537_1000104 | 3300003773 | Bacteria | 63394 |
| 57 | Ga0055537_1001588 | 3300003773 | Bacteria | 8587 |
| 58 | Ga0055537_1008606 | 3300003773 | Bacteria | 2337 |
| 59 | Ga0055524_1000006 | 3300003775 | Bacteria | 324702 |
| 60 | Ga0055524_1003866 | 3300003775 | Bacteria | 7103 |
| 61 | Ga0055524_1008425 | 3300003775 | Bacteria | 4284 |
| 62 | Ga0055524_1067228 | 3300003775 | Bacteria | 708 |
| 63 | Ga0055536_1004362 | 3300003781 | Bacteria | 7267 |
| 64 | Ga0055536_1004691 | 3300003781 | Bacteria | 6890 |
| 65 | Ga0055536_1025851 | 3300003781 | Bacteria | 1661 |
| 66 | Ga0055536_1036860 | 3300003781 | Bacteria | 1204 |
| 67 | Ga0055534_1000042 | 3300003784 | Bacteria | 99433 |
| 68 | Ga0055534_1001777 | 3300003784 | Bacteria | 8128 |
| 69 | Ga0055534_1008779 | 3300003784 | Bacteria | 2257 |
| 70 | Ga0055528_1001140 | 3300003790 | Bacteria | 17289 |
| 71 | Ga0055528_1002054 | 3300003790 | Bacteria | 11254 |
| 72 | Ga0055528_1029635 | 3300003790 | Bacteria | 1475 |
| 73 | Ga0055530_10004417 | 3300003791 | Bacteria | 7239 |
| 74 | Ga0055530_10007775 | 3300003791 | Bacteria | 4439 |
| 75 | Ga0055530_10035007 | 3300003791 | Bacteria | 1278 |
| 76 | Ga0055540_1000005 | 3300003792 | Bacteria | 378126 |
| 77 | Ga0055540_1002976 | 3300003792 | Bacteria | 8499 |
| 78 | Ga0055540_1003651 | 3300003792 | Bacteria | 7330 |
| 79 | Ga0055540_1016035 | 3300003792 | Bacteria | 2151 |
| 80 | Ga0055540_1036359 | 3300003792 | Bacteria | 1094 |
| 81 | Ga0055531_10001665 | 3300003794 | Bacteria | 16006 |
| 82 | Ga0055531_10001799 | 3300003794 | Bacteria | 15235 |
| 83 | Ga0055531_10022530 | 3300003794 | Bacteria | 2397 |
| 84 | Ga0055543_1000829 | 3300004625 | Bacteria | 15064 |
| 85 | Ga0055543_1011894 | 3300004625 | Bacteria | 1766 |
| 86 | Ga0065165_1000652 | 3300005262 | Bacteria | 50081 |
| 87 | Ga0065165_1041154 | 3300005262 | Bacteria | 1373 |
| 88 | Ga0065165_1043890 | 3300005262 | Bacteria | 1310 |
| 89 | Ga0065165_1115931 | 3300005262 | Bacteria | 654 |
| 90 | Ga0065714_10014061 | 3300005288 | Bacteria | 1858 |
| 91 | Ga0065714_10165842 | 3300005288 | Bacteria | 974 |
| 92 | Ga0065704_10070938 | 3300005289 | Bacteria | 14403 |
| 93 | Ga0065704_10133441 | 3300005289 | Bacteria | 1600 |
| 94 | Ga0065704_10376822 | 3300005289 | Bacteria | 778 |
| 95 | Ga0070658_10122431 | 3300005327 | Bacteria | 2162 |
| 96 | Ga0070658_10222314 | 3300005327 | Bacteria | 1597 |
| 97 | Ga0070658_10334877 | 3300005327 | Bacteria | 1294 |
| 98 | Ga0070658_10411192 | 3300005327 | Bacteria | 1163 |
| 99 | Ga0070658_10566352 | 3300005327 | Bacteria | 983 |
| 100 | Ga0070658_10853035 | 3300005327 | Bacteria | 792 |
| 101 | Ga0070690_100350952 | 3300005330 | Bacteria | 1071 |
| 102 | Ga0068869_100447378 | 3300005334 | Bacteria | 1070 |
| 103 | Ga0068869_100517225 | 3300005334 | Bacteria | 999 |
| 104 | Ga0068869_100617051 | 3300005334 | Bacteria | 917 |
| 105 | Ga0070666_10378579 | 3300005335 | Bacteria | 1016 |
| 106 | Ga0070682_100641991 | 3300005337 | Bacteria | 844 |
| 107 | Ga0068868_100095204 | 3300005338 | Bacteria | 2403 |
| 108 | Ga0068868_100369826 | 3300005338 | Bacteria | 1231 |
| 109 | Ga0070660_100039370 | 3300005339 | Bacteria | 3593 |
| 110 | Ga0070660_100480338 | 3300005339 | Bacteria | 1032 |
| 111 | Ga0070689_100442156 | 3300005340 | Bacteria | 1105 |
| 112 | Ga0070661_100656584 | 3300005344 | Bacteria | 852 |
| 113 | Ga0070669_100491563 | 3300005353 | Bacteria | 1017 |
| 114 | Ga0070669_100971547 | 3300005353 | Bacteria | 728 |
| 115 | Ga0070671_100614427 | 3300005355 | Bacteria | 940 |
| 116 | Ga0070674_100776006 | 3300005356 | Bacteria | 826 |
| 117 | Ga0070674_101093710 | 3300005356 | Bacteria | 704 |
| 118 | Ga0070673_100123144 | 3300005364 | Bacteria | 2166 |
| 119 | Ga0070659_100987932 | 3300005366 | Bacteria | 738 |
| 120 | Ga0070659_100998626 | 3300005366 | Bacteria | 734 |
| 121 | Ga0070667_100499833 | 3300005367 | Bacteria | 1114 |
| 122 | Ga0070667_101452783 | 3300005367 | Bacteria | 644 |
| 123 | Ga0070714_100995587 | 3300005435 | Bacteria | 816 |
| 124 | Ga0070700_100772228 | 3300005441 | Bacteria | 771 |
| 125 | Ga0070678_100101205 | 3300005456 | Bacteria | 2233 |
| 126 | Ga0070678_100179788 | 3300005456 | Bacteria | 1730 |
| 127 | Ga0070678_100691882 | 3300005456 | Bacteria | 918 |
| 128 | Ga0070678_100692321 | 3300005456 | Bacteria | 918 |
| 129 | Ga0070662_100083339 | 3300005457 | Bacteria | 2386 |
| 130 | Ga0070681_10852971 | 3300005458 | Bacteria | 829 |
| 131 | Ga0068867_100382438 | 3300005459 | Bacteria | 1183 |
| 132 | Ga0070685_10278490 | 3300005466 | Bacteria | 1119 |
| 133 | Ga0070698_100003836 | 3300005471 | Bacteria | 16525 |
| 134 | Ga0070698_100589412 | 3300005471 | Bacteria | 1052 |
| 135 | Ga0070679_100056638 | 3300005530 | Bacteria | 3906 |
| 136 | Ga0070679_100216348 | 3300005530 | Bacteria | 1878 |
| 137 | Ga0070684_100210194 | 3300005535 | Bacteria | 1773 |
| 138 | Ga0068853_100029605 | 3300005539 | Bacteria | 4618 |
| 139 | Ga0068853_100106808 | 3300005539 | Bacteria | 2482 |
| 140 | Ga0068853_100189424 | 3300005539 | Bacteria | 1868 |
| 141 | Ga0068853_100330909 | 3300005539 | Bacteria | 1413 |
| 142 | Ga0068853_100345846 | 3300005539 | Bacteria | 1382 |
| 143 | Ga0070672_100265667 | 3300005543 | Bacteria | 1448 |
| 144 | Ga0070695_100272400 | 3300005545 | Bacteria | 1240 |
| 145 | Ga0070665_100041269 | 3300005548 | Bacteria | 4638 |
| 146 | Ga0070665_100172802 | 3300005548 | Bacteria | 2162 |
| 147 | Ga0070665_100214987 | 3300005548 | Bacteria | 1923 |
| 148 | Ga0068855_100139617 | 3300005563 | Bacteria | 2764 |
| 149 | Ga0068855_100798393 | 3300005563 | Bacteria | 1003 |
| 150 | Ga0068855_101642976 | 3300005563 | Bacteria | 656 |
| 151 | Ga0070664_100014663 | 3300005564 | Bacteria | 6398 |
| 152 | Ga0070664_101524211 | 3300005564 | Bacteria | 633 |
| 153 | Ga0068857_100635888 | 3300005577 | Bacteria | 1010 |
| 154 | Ga0068857_101475164 | 3300005577 | Bacteria | 662 |
| 155 | Ga0068857_101543723 | 3300005577 | Bacteria | 647 |
| 156 | Ga0068854_100073065 | 3300005578 | Bacteria | 2512 |
| 157 | Ga0068854_100674651 | 3300005578 | Bacteria | 890 |
| 158 | Ga0068856_100006504 | 3300005614 | Bacteria | 11461 |
| 159 | Ga0068856_101091037 | 3300005614 | Bacteria | 816 |
| 160 | Ga0068852_101024674 | 3300005616 | Bacteria | 844 |
| 161 | Ga0068861_100073024 | 3300005719 | Bacteria | 2664 |
| 162 | Ga0068861_101778945 | 3300005719 | Bacteria | 611 |
| 163 | Ga0068851_10026307 | 3300005834 | Bacteria | 2858 |
| 164 | Ga0068860_100695209 | 3300005843 | Bacteria | 1026 |
| 165 | Ga0068860_101593280 | 3300005843 | Bacteria | 675 |
| 166 | Ga0068862_101370927 | 3300005844 | Bacteria | 710 |
| 167 | Ga0068862_101671402 | 3300005844 | Bacteria | 645 |
| 168 | Ga0075365_10011063 | 3300006038 | Bacteria | 5290 |
| 169 | Ga0075365_10034436 | 3300006038 | Bacteria | 3270 |
| 170 | Ga0075365_10111680 | 3300006038 | Bacteria | 1879 |
| 171 | Ga0075365_10543533 | 3300006038 | Bacteria | 822 |
| 172 | Ga0075365_10568385 | 3300006038 | Bacteria | 802 |
| 173 | Ga0075368_10160909 | 3300006042 | Bacteria | 940 |
| 174 | Ga0075363_100119843 | 3300006048 | Bacteria | 1469 |
| 175 | Ga0075363_100148455 | 3300006048 | Bacteria | 1322 |
| 176 | Ga0075363_100346938 | 3300006048 | Bacteria | 866 |
| 177 | Ga0075364_10153091 | 3300006051 | Bacteria | 1554 |
| 178 | Ga0075364_10396410 | 3300006051 | Bacteria | 942 |
| 179 | Ga0075432_10028199 | 3300006058 | Bacteria | 1936 |
| 180 | Ga0075362_10106793 | 3300006177 | Bacteria | 1314 |
| 181 | Ga0075362_10228974 | 3300006177 | Bacteria | 910 |
| 182 | Ga0075362_10330189 | 3300006177 | Bacteria | 761 |
| 183 | Ga0075367_10129178 | 3300006178 | Bacteria | 1561 |
| 184 | Ga0075367_10362893 | 3300006178 | Bacteria | 915 |
| 185 | Ga0075366_10000944 | 3300006195 | Bacteria | 14143 |
| 186 | Ga0075366_10004207 | 3300006195 | Bacteria | 7714 |
| 187 | Ga0075366_10051827 | 3300006195 | Bacteria | 2438 |
| 188 | Ga0075366_10055916 | 3300006195 | Bacteria | 2343 |
| 189 | Ga0075366_10104538 | 3300006195 | Bacteria | 1701 |
| 190 | Ga0075366_10185080 | 3300006195 | Bacteria | 1265 |
| 191 | Ga0075366_10248222 | 3300006195 | Bacteria | 1085 |
| 192 | Ga0097621_100308339 | 3300006237 | Bacteria | 1400 |
| 193 | Ga0097621_100798068 | 3300006237 | Bacteria | 875 |
| 194 | Ga0075370_10005914 | 3300006353 | Bacteria | 6120 |
| 195 | Ga0075370_10013218 | 3300006353 | Bacteria | 4381 |
| 196 | Ga0075370_10015686 | 3300006353 | Bacteria | 4062 |
| 197 | Ga0075370_10018343 | 3300006353 | Bacteria | 3797 |
| 198 | Ga0075370_10051644 | 3300006353 | Bacteria | 2332 |
| 199 | Ga0075370_10074826 | 3300006353 | Bacteria | 1941 |
| 200 | Ga0075370_10089857 | 3300006353 | Bacteria | 1771 |
| 201 | Ga0075370_10244587 | 3300006353 | Bacteria | 1062 |
| 202 | Ga0075370_10292001 | 3300006353 | Bacteria | 969 |
| 203 | Ga0075370_10308673 | 3300006353 | Bacteria | 941 |
| 204 | Ga0075370_10363423 | 3300006353 | Bacteria | 866 |
| 205 | Ga0075370_10681556 | 3300006353 | Bacteria | 624 |
| 206 | Ga0068871_100114546 | 3300006358 | Bacteria | 2272 |
| 207 | Ga0068871_101539474 | 3300006358 | Bacteria | 629 |
| 208 | Ga0075431_100599986 | 3300006847 | Bacteria | 1085 |
| 209 | Ga0075434_101182919 | 3300006871 | Bacteria | 777 |
| 210 | Ga0099823_1002850 | 3300006944 | Bacteria | 15979 |
| 211 | Ga0079104_1000002 | 3300006946 | Bacteria | 514469 |
| 212 | Ga0079104_1019147 | 3300006946 | Bacteria | 1921 |
| 213 | Ga0099826_10004379 | 3300006948 | Bacteria | 9886 |
| 214 | Ga0105250_10000636 | 3300009092 | Bacteria | 22497 |
| 215 | Ga0105240_10016601 | 3300009093 | Bacteria | 9961 |
| 216 | Ga0105245_10109483 | 3300009098 | Bacteria | 2567 |
| 217 | Ga0105245_10947068 | 3300009098 | Bacteria | 904 |
| 218 | Ga0105245_11220745 | 3300009098 | Bacteria | 800 |
| 219 | Ga0105243_10001518 | 3300009148 | Bacteria | 20292 |
| 220 | Ga0105243_10196633 | 3300009148 | Bacteria | 1765 |
| 221 | Ga0105243_10591726 | 3300009148 | Bacteria | 1067 |
| 222 | Ga0105243_10724121 | 3300009148 | Bacteria | 972 |
| 223 | Ga0105241_10312714 | 3300009174 | Bacteria | 1352 |
| 224 | Ga0105242_11700010 | 3300009176 | Bacteria | 667 |
| 225 | Ga0105248_10394621 | 3300009177 | Bacteria | 1558 |
| 226 | Ga0105248_11168740 | 3300009177 | Bacteria | 870 |
| 227 | Ga0105248_11234180 | 3300009177 | Bacteria | 845 |
| 228 | Ga0105248_11611217 | 3300009177 | Bacteria | 735 |
| 229 | Ga0105237_10071021 | 3300009545 | Bacteria | 3477 |
| 230 | Ga0105237_10097733 | 3300009545 | Bacteria | 2927 |
| 231 | Ga0105237_10914585 | 3300009545 | Bacteria | 884 |
| 232 | Ga0105238_10210168 | 3300009551 | Bacteria | 1922 |
| 233 | Ga0105238_10276401 | 3300009551 | Bacteria | 1660 |
| 234 | Ga0105238_10402007 | 3300009551 | Bacteria | 1363 |
| 235 | Ga0105238_10669857 | 3300009551 | Bacteria | 1048 |
| 236 | Ga0105249_11226610 | 3300009553 | Bacteria | 821 |
| 237 | Ga0105239_10694822 | 3300010375 | Bacteria | 1163 |
| 238 | Ga0105239_11995128 | 3300010375 | Bacteria | 674 |
| 239 | Ga0105246_10059447 | 3300011119 | Bacteria | 2652 |
| 240 | Ga0105246_10174552 | 3300011119 | Bacteria | 1649 |
| 241 | Ga0157319_1000006 | 3300012497 | Bacteria | 361506 |
| 242 | Ga0157326_1001580 | 3300012513 | Bacteria | 2491 |
| 243 | Ga0157373_10321126 | 3300013100 | Bacteria | 1101 |
| 244 | Ga0157371_10270095 | 3300013102 | Bacteria | 1227 |
| 245 | Ga0157370_10108200 | 3300013104 | Bacteria | 2600 |
| 246 | Ga0157370_10484449 | 3300013104 | Bacteria | 1136 |
| 247 | Ga0157370_10547057 | 3300013104 | Bacteria | 1061 |
| 248 | Ga0157370_11264892 | 3300013104 | Bacteria | 665 |
| 249 | Ga0157370_11524002 | 3300013104 | Bacteria | 601 |
| 250 | Ga0157369_10052460 | 3300013105 | Bacteria | 4412 |
| 251 | Ga0157369_10461227 | 3300013105 | Bacteria | 1315 |
| 252 | Ga0157369_10721735 | 3300013105 | Bacteria | 1026 |
| 253 | Ga0157378_10212374 | 3300013297 | Bacteria | 1836 |
| 254 | Ga0157378_10329890 | 3300013297 | Bacteria | 1485 |
| 255 | Ga0163162_10219614 | 3300013306 | Bacteria | 2031 |
| 256 | Ga0163162_11141142 | 3300013306 | Bacteria | 884 |
| 257 | Ga0157372_10374353 | 3300013307 | Bacteria | 1660 |
| 258 | Ga0157375_10926408 | 3300013308 | Bacteria | 1014 |
| 259 | Ga0157375_11901375 | 3300013308 | Bacteria | 706 |
| 260 | Ga0157375_12543502 | 3300013308 | Bacteria | 611 |
| 261 | Ga0157380_11822584 | 3300014326 | Bacteria | 668 |
| 262 | Ga0182008_10006435 | 3300014497 | Bacteria | 6567 |
| 263 | Ga0182008_10011458 | 3300014497 | Bacteria | 4714 |
| 264 | Ga0182008_10088039 | 3300014497 | Bacteria | 1530 |
| 265 | Ga0182008_10088370 | 3300014497 | Bacteria | 1527 |
| 266 | Ga0182008_10545867 | 3300014497 | Bacteria | 643 |
| 267 | Ga0157379_10932939 | 3300014968 | Bacteria | 825 |
| 268 | Ga0157379_11050138 | 3300014968 | Bacteria | 778 |
| 269 | Ga0157376_10027129 | 3300014969 | Bacteria | 4536 |
| 270 | Ga0157376_10416763 | 3300014969 | Bacteria | 1302 |
| 271 | Ga0157376_10540140 | 3300014969 | Bacteria | 1152 |
| 272 | Ga0182006_1029973 | 3300015261 | Bacteria | 2202 |
| 273 | Ga0182006_1079259 | 3300015261 | Bacteria | 1201 |
| 274 | Ga0182006_1127620 | 3300015261 | Bacteria | 878 |
| 275 | Ga0182007_10009741 | 3300015262 | Bacteria | 3847 |
| 276 | Ga0182007_10056054 | 3300015262 | Bacteria | 1295 |
| 277 | Ga0182007_10134829 | 3300015262 | Bacteria | 832 |
| 278 | Ga0182005_1042568 | 3300015265 | Bacteria | 1234 |
| 279 | Ga0183362_10003 | 3300015683 | Bacteria | 977584 |
| 280 | Ga0163161_10113482 | 3300017792 | Bacteria | 2028 |
| 281 | Ga0163161_10251236 | 3300017792 | Bacteria | 1378 |
| 282 | Ga0163161_10350775 | 3300017792 | Bacteria | 1173 |
| 283 | Ga0163161_10611348 | 3300017792 | Bacteria | 900 |
| 284 | Ga0213872_10012343 | 3300021361 | Bacteria | 4020 |
| 285 | Ga0209435_100062 | 3300025206 | Bacteria | 77288 |
| 286 | Ga0209566_111698 | 3300025225 | Bacteria | 853 |
| 287 | Ga0209674_100003 | 3300025226 | Bacteria | 2196646 |
| 288 | Ga0209672_100633 | 3300025228 | Bacteria | 18178 |
| 289 | Ga0209672_108077 | 3300025228 | Bacteria | 1580 |
| 290 | Ga0209147_101695 | 3300025229 | Bacteria | 7189 |
| 291 | Ga0209563_100005 | 3300025230 | Bacteria | 1774893 |
| 292 | Ga0209563_100017 | 3300025230 | Bacteria | 796449 |
| 293 | Ga0209563_112761 | 3300025230 | Bacteria | 1136 |
| 294 | Ga0207427_100380 | 3300025231 | Bacteria | 26848 |
| 295 | Ga0209258_100009 | 3300025242 | Bacteria | 996276 |
| 296 | Ga0209258_100414 | 3300025242 | Bacteria | 51162 |
| 297 | Ga0209258_104537 | 3300025242 | Bacteria | 2602 |
| 298 | Ga0207425_1001373 | 3300025245 | Bacteria | 10310 |
| 299 | Ga0207425_1013370 | 3300025245 | Bacteria | 1899 |
| 300 | Ga0209646_1000001 | 3300025246 | Bacteria | 3092932 |
| 301 | Ga0209646_1000271 | 3300025246 | Bacteria | 47713 |
| 302 | Ga0209026_1000085 | 3300025250 | Bacteria | 185778 |
| 303 | Ga0209026_1000224 | 3300025250 | Bacteria | 77298 |
| 304 | Ga0209677_102048 | 3300025253 | Bacteria | 7978 |
| 305 | Ga0209677_108757 | 3300025253 | Bacteria | 1908 |
| 306 | Ga0209148_1000007 | 3300025254 | Bacteria | 1592273 |
| 307 | Ga0209148_1003800 | 3300025254 | Bacteria | 3958 |
| 308 | Ga0209759_1000013 | 3300025256 | Bacteria | 399300 |
| 309 | Ga0209759_1000068 | 3300025256 | Bacteria | 183479 |
| 310 | Ga0209759_1008209 | 3300025256 | Bacteria | 3276 |
| 311 | Ga0209759_1014909 | 3300025256 | Bacteria | 2029 |
| 312 | Ga0209759_1014925 | 3300025256 | Bacteria | 2028 |
| 313 | Ga0209759_1038431 | 3300025256 | Bacteria | 850 |
| 314 | Ga0209129_1000083 | 3300025258 | Bacteria | 183270 |
| 315 | Ga0209129_1003940 | 3300025258 | Bacteria | 6154 |
| 316 | Ga0209129_1018123 | 3300025258 | Bacteria | 1360 |
| 317 | Ga0209565_1000083 | 3300025263 | Bacteria | 154007 |
| 318 | Ga0209565_1001476 | 3300025263 | Bacteria | 10298 |
| 319 | Ga0209565_1001861 | 3300025263 | Bacteria | 8433 |
| 320 | Ga0209455_1000264 | 3300025272 | Bacteria | 60245 |
| 321 | Ga0209673_1000043 | 3300025273 | Bacteria | 291503 |
| 322 | Ga0209673_1000089 | 3300025273 | Bacteria | 202240 |
| 323 | Ga0209673_1000323 | 3300025273 | Bacteria | 87588 |
| 324 | Ga0209673_1001307 | 3300025273 | Bacteria | 25210 |
| 325 | Ga0209673_1022593 | 3300025273 | Bacteria | 2166 |
| 326 | Ga0209673_1027737 | 3300025273 | Bacteria | 1837 |
| 327 | Ga0209130_1000241 | 3300025284 | Bacteria | 70093 |
| 328 | Ga0209130_1001189 | 3300025284 | Bacteria | 18564 |
| 329 | Ga0209130_1002203 | 3300025284 | Bacteria | 10241 |
| 330 | Ga0209130_1008941 | 3300025284 | Bacteria | 2904 |
| 331 | Ga0209130_1024873 | 3300025284 | Bacteria | 1303 |
| 332 | Ga0209675_1000081 | 3300025291 | Bacteria | 154007 |
| 333 | Ga0209675_1000832 | 3300025291 | Bacteria | 20310 |
| 334 | Ga0209675_1002121 | 3300025291 | Bacteria | 10492 |
| 335 | Ga0209675_1006532 | 3300025291 | Bacteria | 4655 |
| 336 | Ga0209675_1006965 | 3300025291 | Bacteria | 4429 |
| 337 | Ga0209675_1035958 | 3300025291 | Bacteria | 1125 |
| 338 | Ga0209676_1000004 | 3300025292 | Bacteria | 1138360 |
| 339 | Ga0209676_1000007 | 3300025292 | Bacteria | 1029371 |
| 340 | Ga0209676_1002834 | 3300025292 | Bacteria | 11469 |
| 341 | Ga0209676_1010599 | 3300025292 | Bacteria | 3813 |
| 342 | Ga0209676_1014584 | 3300025292 | Bacteria | 2947 |
| 343 | Ga0209025_1000133 | 3300025294 | Bacteria | 195885 |
| 344 | Ga0209025_1001314 | 3300025294 | Bacteria | 33818 |
| 345 | Ga0209025_1001691 | 3300025294 | Bacteria | 26944 |
| 346 | Ga0209025_1003025 | 3300025294 | Bacteria | 16602 |
| 347 | Ga0209025_1005532 | 3300025294 | Bacteria | 10255 |
| 348 | Ga0209025_1032356 | 3300025294 | Bacteria | 2447 |
| 349 | Ga0209025_1044212 | 3300025294 | Bacteria | 1865 |
| 350 | Ga0209025_1046308 | 3300025294 | Bacteria | 1790 |
| 351 | Ga0209564_1000003 | 3300025295 | Bacteria | 1585848 |
| 352 | Ga0209564_1000285 | 3300025295 | Bacteria | 102585 |
| 353 | Ga0209564_1000323 | 3300025295 | Bacteria | 93122 |
| 354 | Ga0209564_1000332 | 3300025295 | Bacteria | 91674 |
| 355 | Ga0209564_1000877 | 3300025295 | Bacteria | 40004 |
| 356 | Ga0209564_1011461 | 3300025295 | Bacteria | 3970 |
| 357 | Ga0209758_1000132 | 3300025297 | Bacteria | 183273 |
| 358 | Ga0209758_1034699 | 3300025297 | Bacteria | 2002 |
| 359 | Ga0209050_1000002 | 3300025298 | Bacteria | 1792849 |
| 360 | Ga0209050_1000003 | 3300025298 | Bacteria | 1609245 |
| 361 | Ga0209050_1003126 | 3300025298 | Bacteria | 12649 |
| 362 | Ga0209050_1012163 | 3300025298 | Bacteria | 3983 |
| 363 | Ga0209050_1024990 | 3300025298 | Bacteria | 2046 |
| 364 | Ga0209050_1046448 | 3300025298 | Bacteria | 1141 |
| 365 | Ga0209050_1054110 | 3300025298 | Bacteria | 992 |
| 366 | Ga0209256_1000001 | 3300025299 | Bacteria | 2166974 |
| 367 | Ga0209256_1000973 | 3300025299 | Bacteria | 34412 |
| 368 | Ga0209256_1005250 | 3300025299 | Bacteria | 7568 |
| 369 | Ga0209256_1005263 | 3300025299 | Bacteria | 7552 |
| 370 | Ga0209256_1023182 | 3300025299 | Bacteria | 1858 |
| 371 | Ga0207426_1000097 | 3300025302 | Bacteria | 265930 |
| 372 | Ga0207426_1000247 | 3300025302 | Bacteria | 119659 |
| 373 | Ga0207426_1000323 | 3300025302 | Bacteria | 91662 |
| 374 | Ga0207426_1000584 | 3300025302 | Bacteria | 48547 |
| 375 | Ga0209051_1000002 | 3300025303 | Bacteria | 1631846 |
| 376 | Ga0209051_1000003 | 3300025303 | Bacteria | 1609245 |
| 377 | Ga0209051_1000792 | 3300025303 | Bacteria | 33275 |
| 378 | Ga0209051_1001375 | 3300025303 | Bacteria | 21010 |
| 379 | Ga0209051_1001732 | 3300025303 | Bacteria | 17375 |
| 380 | Ga0209051_1003281 | 3300025303 | Bacteria | 10730 |
| 381 | Ga0209051_1003624 | 3300025303 | Bacteria | 10010 |
| 382 | Ga0209051_1004724 | 3300025303 | Bacteria | 8261 |
| 383 | Ga0209051_1024877 | 3300025303 | Bacteria | 2451 |
| 384 | Ga0209051_1098509 | 3300025303 | Bacteria | 793 |
| 385 | Ga0209257_1000002 | 3300025304 | Bacteria | 1767052 |
| 386 | Ga0209257_1000020 | 3300025304 | Bacteria | 773356 |
| 387 | Ga0209257_1000361 | 3300025304 | Bacteria | 92239 |
| 388 | Ga0209257_1000396 | 3300025304 | Bacteria | 86000 |
| 389 | Ga0209257_1002969 | 3300025304 | Bacteria | 15497 |
| 390 | Ga0209257_1020159 | 3300025304 | Bacteria | 2477 |
| 391 | Ga0209257_1061327 | 3300025304 | Bacteria | 1020 |
| 392 | Ga0209257_1071107 | 3300025304 | Bacteria | 917 |
| 393 | Ga0207696_1006799 | 3300025711 | Bacteria | 4559 |
| 394 | Ga0207655_1001053 | 3300025728 | Bacteria | 27547 |
| 395 | Ga0207688_10376841 | 3300025901 | Bacteria | 877 |
| 396 | Ga0207680_10071484 | 3300025903 | Bacteria | 2151 |
| 397 | Ga0207647_10307818 | 3300025904 | Bacteria | 901 |
| 398 | Ga0207645_10448292 | 3300025907 | Bacteria | 871 |
| 399 | Ga0207705_10073695 | 3300025909 | Bacteria | 2477 |
| 400 | Ga0207705_10604773 | 3300025909 | Bacteria | 852 |
| 401 | Ga0207705_10615649 | 3300025909 | Bacteria | 844 |
| 402 | Ga0207705_10725700 | 3300025909 | Bacteria | 772 |
| 403 | Ga0207684_10004749 | 3300025910 | Bacteria | 12735 |
| 404 | Ga0207654_10256218 | 3300025911 | Bacteria | 1175 |
| 405 | Ga0207695_10047646 | 3300025913 | Bacteria | 4533 |
| 406 | Ga0207695_10065364 | 3300025913 | Bacteria | 3740 |
| 407 | Ga0207671_10056734 | 3300025914 | Bacteria | 2902 |
| 408 | Ga0207671_10116538 | 3300025914 | Bacteria | 2038 |
| 409 | Ga0207657_10033997 | 3300025919 | Bacteria | 4591 |
| 410 | Ga0207657_10162882 | 3300025919 | Bacteria | 1811 |
| 411 | Ga0207649_10071923 | 3300025920 | Bacteria | 2211 |
| 412 | Ga0207652_10122726 | 3300025921 | Bacteria | 2312 |
| 413 | Ga0207652_10529203 | 3300025921 | Bacteria | 1060 |
| 414 | Ga0207646_10106246 | 3300025922 | Bacteria | 2518 |
| 415 | Ga0207681_10136776 | 3300025923 | Bacteria | 1819 |
| 416 | Ga0207681_10474105 | 3300025923 | Bacteria | 1021 |
| 417 | Ga0207650_10663105 | 3300025925 | Bacteria | 880 |
| 418 | Ga0207664_10814602 | 3300025929 | Bacteria | 840 |
| 419 | Ga0207644_10829721 | 3300025931 | Bacteria | 774 |
| 420 | Ga0207690_10242705 | 3300025932 | Bacteria | 1388 |
| 421 | Ga0207690_10413488 | 3300025932 | Bacteria | 1078 |
| 422 | Ga0207690_11024363 | 3300025932 | Bacteria | 687 |
| 423 | Ga0207690_11164369 | 3300025932 | Bacteria | 643 |
| 424 | Ga0207706_10551472 | 3300025933 | Bacteria | 992 |
| 425 | Ga0207686_10118183 | 3300025934 | Bacteria | 1800 |
| 426 | Ga0207686_10153924 | 3300025934 | Bacteria | 1604 |
| 427 | Ga0207709_10000015 | 3300025935 | Bacteria | 493221 |
| 428 | Ga0207709_10001284 | 3300025935 | Bacteria | 17904 |
| 429 | Ga0207709_10059162 | 3300025935 | Bacteria | 2384 |
| 430 | Ga0207709_10073934 | 3300025935 | Bacteria | 2173 |
| 431 | Ga0207670_10305361 | 3300025936 | Bacteria | 1247 |
| 432 | Ga0207669_10053330 | 3300025937 | Bacteria | 2435 |
| 433 | Ga0207669_11007170 | 3300025937 | Bacteria | 700 |
| 434 | Ga0207691_10158961 | 3300025940 | Bacteria | 1983 |
| 435 | Ga0207711_11415885 | 3300025941 | Bacteria | 638 |
| 436 | Ga0207689_10073610 | 3300025942 | Bacteria | 2807 |
| 437 | Ga0207689_10326122 | 3300025942 | Bacteria | 1274 |
| 438 | Ga0207689_10407218 | 3300025942 | Bacteria | 1134 |
| 439 | Ga0207661_11615580 | 3300025944 | Bacteria | 593 |
| 440 | Ga0207667_10016760 | 3300025949 | Bacteria | 8267 |
| 441 | Ga0207667_10125418 | 3300025949 | Bacteria | 2644 |
| 442 | Ga0207667_10471167 | 3300025949 | Bacteria | 1275 |
| 443 | Ga0207667_10528360 | 3300025949 | Bacteria | 1195 |
| 444 | Ga0207667_10563607 | 3300025949 | Bacteria | 1151 |
| 445 | Ga0207667_10590836 | 3300025949 | Bacteria | 1120 |
| 446 | Ga0207651_10279236 | 3300025960 | Bacteria | 1379 |
| 447 | Ga0207668_10437509 | 3300025972 | Bacteria | 1113 |
| 448 | Ga0207640_10007957 | 3300025981 | Bacteria | 5853 |
| 449 | Ga0207640_10497649 | 3300025981 | Bacteria | 1014 |
| 450 | Ga0207658_10258800 | 3300025986 | Bacteria | 1482 |
| 451 | Ga0207677_10271364 | 3300026023 | Bacteria | 1388 |
| 452 | Ga0207703_10672871 | 3300026035 | Bacteria | 983 |
| 453 | Ga0207639_10050722 | 3300026041 | Bacteria | 3152 |
| 454 | Ga0207639_10133878 | 3300026041 | Bacteria | 2055 |
| 455 | Ga0207639_10537257 | 3300026041 | Bacteria | 1072 |
| 456 | Ga0207678_10366621 | 3300026067 | Bacteria | 1244 |
| 457 | Ga0207702_10001691 | 3300026078 | Bacteria | 21798 |
| 458 | Ga0207702_10125932 | 3300026078 | Bacteria | 2300 |
| 459 | Ga0207641_10034600 | 3300026088 | Bacteria | 4204 |
| 460 | Ga0207648_10347118 | 3300026089 | Bacteria | 1337 |
| 461 | Ga0207648_10838308 | 3300026089 | Bacteria | 857 |
| 462 | Ga0207676_10469654 | 3300026095 | Bacteria | 1189 |
| 463 | Ga0207674_10012042 | 3300026116 | Bacteria | 9689 |
| 464 | Ga0207674_10530439 | 3300026116 | Bacteria | 1137 |
| 465 | Ga0207674_10688022 | 3300026116 | Bacteria | 987 |
| 466 | Ga0207675_100198018 | 3300026118 | Bacteria | 1929 |
| 467 | Ga0207683_10054906 | 3300026121 | Bacteria | 3493 |
| 468 | Ga0207683_10332922 | 3300026121 | Bacteria | 1392 |
| 469 | Ga0207683_10480400 | 3300026121 | Bacteria | 1147 |
| 470 | Ga0207683_10580811 | 3300026121 | Bacteria | 1037 |
| 471 | Ga0207683_10644338 | 3300026121 | Bacteria | 981 |
| 472 | Ga0207683_10928040 | 3300026121 | Bacteria | 808 |
| 473 | Ga0207683_10950920 | 3300026121 | Bacteria | 798 |
| 474 | Ga0207698_10467936 | 3300026142 | Bacteria | 1220 |
| 475 | Ga0207698_10647487 | 3300026142 | Bacteria | 1046 |
| 476 | Ga0207698_11354366 | 3300026142 | Bacteria | 727 |
| 477 | Ga0207698_11438385 | 3300026142 | Bacteria | 704 |
| 478 | Ga0209281_1000007 | 3300027111 | Bacteria | 938265 |
| 479 | Ga0209389_1054541 | 3300027296 | Bacteria | 2653 |
| 480 | Ga0209371_1030410 | 3300027312 | Bacteria | 1183 |
| 481 | Ga0209967_1031377 | 3300027364 | Bacteria | 795 |
| 482 | Ga0209996_1019193 | 3300027395 | Bacteria | 954 |
| 483 | Ga0209984_1008526 | 3300027424 | Bacteria | 1290 |
| 484 | Ga0209968_1016556 | 3300027526 | Bacteria | 1172 |
| 485 | Ga0209970_1004463 | 3300027614 | Bacteria | 2325 |
| 486 | Ga0209983_1032617 | 3300027665 | Bacteria | 1113 |
| 487 | Ga0209282_1001621 | 3300027666 | Bacteria | 12483 |
| 488 | Ga0209971_1002849 | 3300027682 | Bacteria | 4132 |
| 489 | Ga0209974_10008135 | 3300027876 | Bacteria | 3592 |
| 490 | Ga0209974_10110487 | 3300027876 | Bacteria | 967 |
| 491 | Ga0207428_10489967 | 3300027907 | Bacteria | 894 |
| 492 | Ga0268266_10029582 | 3300028379 | Bacteria | 4656 |
| 493 | Ga0268266_10371144 | 3300028379 | Bacteria | 1348 |
| 494 | Ga0268265_10541893 | 3300028380 | Bacteria | 1103 |
| 495 | Ga0268264_10368811 | 3300028381 | Bacteria | 1372 |
| 496 | Ga0268264_10916109 | 3300028381 | Bacteria | 880 |
| 497 | Ga0265334_10116263 | 3300028573 | Bacteria | 958 |
| 498 | Ga0265336_10000044 | 3300028666 | Bacteria | 131932 |
| 499 | Ga0307515_10000195 | 3300028794 | Bacteria | 148138 |
| 500 | Ga0307515_10000515 | 3300028794 | Bacteria | 92187 |
| 501 | Ga0307515_10162677 | 3300028794 | Bacteria | 2267 |
| 502 | Ga0265324_10000446 | 3300029957 | Bacteria | 29338 |
| 503 | Ga0268256_1012436 | 3300030500 | Bacteria | 2632 |
| 504 | Ga0307511_10082309 | 3300030521 | Bacteria | 2252 |
| 505 | Ga0316177_1051055 | 3300030731 | Bacteria | 6318 |
| 506 | Ga0316176_1222992 | 3300030732 | Bacteria | 4114 |
| 507 | Ga0316178_1083600 | 3300030735 | Bacteria | 5925 |
| 508 | Ga0316180_1048969 | 3300030736 | Bacteria | 6728 |
| 509 | Ga0316183_1136198 | 3300030742 | Bacteria | 1007 |
| 510 | Ga0316181_1077794 | 3300030744 | Bacteria | 6128 |
| 511 | Ga0265330_10000033 | 3300031235 | Bacteria | 126931 |
| 512 | Ga0265332_10000001 | 3300031238 | Bacteria | 863783 |
| 513 | Ga0265332_10000014 | 3300031238 | Bacteria | 249035 |
| 514 | Ga0265332_10002998 | 3300031238 | Bacteria | 8283 |
| 515 | Ga0265328_10037651 | 3300031239 | Bacteria | 1786 |
| 516 | Ga0265325_10008684 | 3300031241 | Bacteria | 5978 |
| 517 | Ga0265340_10006547 | 3300031247 | Bacteria | 6399 |
| 518 | Ga0265327_10000425 | 3300031251 | Bacteria | 77143 |
| 519 | Ga0265327_10053432 | 3300031251 | Bacteria | 2097 |
| 520 | Ga0265327_10289466 | 3300031251 | Bacteria | 723 |
| 521 | Ga0265316_10369743 | 3300031344 | Bacteria | 1036 |
| 522 | Ga0307513_10000004 | 3300031456 | Bacteria | 558931 |
| 523 | Ga0307513_10000054 | 3300031456 | Bacteria | 148887 |
| 524 | Ga0307513_10160220 | 3300031456 | Bacteria | 2144 |
| 525 | Ga0307513_10323610 | 3300031456 | Bacteria | 1299 |
| 526 | Ga0307513_10353524 | 3300031456 | Bacteria | 1216 |
| 527 | Ga0307509_10169060 | 3300031507 | Bacteria | 2069 |
| 528 | Ga0307509_10242669 | 3300031507 | Bacteria | 1593 |
| 529 | Ga0307408_100023297 | 3300031548 | Bacteria | 4215 |
| 530 | Ga0307408_100320969 | 3300031548 | Bacteria | 1304 |
| 531 | Ga0307408_100373619 | 3300031548 | Bacteria | 1217 |
| 532 | Ga0307408_100543639 | 3300031548 | Bacteria | 1024 |
| 533 | Ga0307408_101257891 | 3300031548 | Bacteria | 692 |
| 534 | Ga0307514_10000529 | 3300031649 | Bacteria | 74752 |
| 535 | Ga0307514_10161453 | 3300031649 | Bacteria | 1482 |
| 536 | Ga0265314_10000022 | 3300031711 | Bacteria | 297299 |
| 537 | Ga0265314_10001258 | 3300031711 | Bacteria | 28871 |
| 538 | Ga0265342_10012278 | 3300031712 | Bacteria | 5808 |
| 539 | Ga0307516_10039216 | 3300031730 | Bacteria | 4723 |
| 540 | Ga0307516_10039984 | 3300031730 | Bacteria | 4670 |
| 541 | Ga0307405_10228311 | 3300031731 | Bacteria | 1370 |
| 542 | Ga0307405_10296381 | 3300031731 | Bacteria | 1224 |
| 543 | Ga0307410_10498680 | 3300031852 | Bacteria | 1001 |
| 544 | Ga0307406_10099212 | 3300031901 | Bacteria | 1979 |
| 545 | Ga0307406_10173112 | 3300031901 | Bacteria | 1564 |
| 546 | Ga0307406_10737544 | 3300031901 | Bacteria | 826 |
| 547 | Ga0307406_11074864 | 3300031901 | Bacteria | 694 |
| 548 | Ga0307412_10056316 | 3300031911 | Bacteria | 2619 |
| 549 | Ga0307412_10083120 | 3300031911 | Bacteria | 2219 |
| 550 | Ga0307412_10219336 | 3300031911 | Bacteria | 1457 |
| 551 | Ga0307412_10288994 | 3300031911 | Bacteria | 1291 |
| 552 | Ga0307412_10406145 | 3300031911 | Bacteria | 1110 |
| 553 | Ga0307412_10504921 | 3300031911 | Bacteria | 1007 |
| 554 | Ga0307412_10589239 | 3300031911 | Bacteria | 940 |
| 555 | Ga0307412_10783085 | 3300031911 | Bacteria | 826 |
| 556 | Ga0307412_11000778 | 3300031911 | Bacteria | 738 |
| 557 | Ga0307416_100192452 | 3300032002 | Bacteria | 1925 |
| 558 | Ga0307416_100769352 | 3300032002 | Bacteria | 1057 |
| 559 | Ga0307416_101252644 | 3300032002 | Bacteria | 847 |
| 560 | Ga0307414_10323491 | 3300032004 | Bacteria | 1313 |
| 561 | Ga0307414_11216634 | 3300032004 | Bacteria | 698 |
| 562 | Ga0307411_10160720 | 3300032005 | Bacteria | 1682 |
| 563 | Ga0316593_10000144 | 3300032168 | Bacteria | 10105 |
| 564 | Ga0316593_10000732 | 3300032168 | Bacteria | 6450 |
| 565 | Ga0316596_1005126 | 3300033541 | Bacteria | 2979 |
| 566 | Ga0373959_0017007 | 3300034820 | Bacteria | 1354 |
| 567 | Ga0373934_0032944 | 3300035086 | Bacteria | 2034 |
| 568 | Ga0373956_0310803 | 3300035119 | Bacteria | 751 |
| 569 | Ga0316574_0079360 | 3300035398 | Bacteria | 2082 |
| 570 | Ga0373931_0001569 | 3300035691 | Bacteria | 9864 |
| 571 | Ga0373927_0261239 | 3300035695 | Bacteria | 1139 |
| 572 | Ga0373937_0707607 | 3300036401 | Bacteria | 954 |
| 573 | Ga0316582_0071388 | 3300036647 | Bacteria | 2249 |
| 574 | Ga0316582_0420452 | 3300036647 | Bacteria | 921 |
| 575 | Ga0316584_0005757 | 3300036712 | Bacteria | 8350 |
| 576 | Ga0316584_0047614 | 3300036712 | Bacteria | 3203 |
| 577 | Ga0395899_0001965 | 3300037312 | Bacteria | 16903 |
| 578 | Ga0395899_0067138 | 3300037312 | Bacteria | 2632 |
| 579 | Ga0395899_0285555 | 3300037312 | Bacteria | 1121 |
| 580 | Ga0395899_0564282 | 3300037312 | Bacteria | 730 |
| 581 | Ga0395900_0035029 | 3300037418 | Bacteria | 5170 |
| 582 | Ga0395900_0051271 | 3300037418 | Bacteria | 4251 |
| 583 | Ga0395900_0843447 | 3300037418 | Bacteria | 842 |
| 584 | Ga0395900_0969594 | 3300037418 | Bacteria | 771 |
| 585 | Ga0395898_0015164 | 3300037466 | Bacteria | 7910 |
| 586 | Ga0395898_0026539 | 3300037466 | Bacteria | 5826 |
| 587 | Ga0395898_0922804 | 3300037466 | Bacteria | 811 |
| 588 | Ga0395905_0000125 | 3300037471 | Bacteria | 126341 |
| 589 | Ga0395905_0004037 | 3300037471 | Bacteria | 15407 |
| 590 | Ga0395905_0008037 | 3300037471 | Bacteria | 10422 |
| 591 | Ga0395905_0013989 | 3300037471 | Bacteria | 7677 |
| 592 | Ga0395905_0019808 | 3300037471 | Bacteria | 6377 |
| 593 | Ga0395905_0057085 | 3300037471 | Bacteria | 3651 |
| 594 | Ga0395905_0113321 | 3300037471 | Bacteria | 2547 |
| 595 | Ga0395905_0133216 | 3300037471 | Bacteria | 2337 |
| 596 | Ga0395905_0190926 | 3300037471 | Bacteria | 1921 |
| 597 | Ga0395905_0287775 | 3300037471 | Bacteria | 1530 |
| 598 | Ga0395905_0334305 | 3300037471 | Bacteria | 1405 |
| 599 | Ga0395905_0842173 | 3300037471 | Bacteria | 820 |
| 600 | Ga0395901_0011265 | 3300038443 | Bacteria | 9060 |
| 601 | Ga0395901_0029516 | 3300038443 | Bacteria | 5647 |
| 602 | Ga0395901_0321204 | 3300038443 | Bacteria | 1602 |
| 603 | Ga0395901_0492984 | 3300038443 | Bacteria | 1248 |
| 604 | Ga0395901_0673385 | 3300038443 | Bacteria | 1035 |
| 605 | Ga0395901_0695043 | 3300038443 | Bacteria | 1015 |
| 606 | Ga0395901_0861666 | 3300038443 | Bacteria | 890 |
| 607 | Ga0436361_0240598 | 3300039447 | Bacteria | 30904 |
| 608 | Ga0436361_0349482 | 3300039447 | Bacteria | 149171 |
| 609 | Ga0436361_0677555 | 3300039447 | Bacteria | 1860 |
| 610 | Ga0436361_0791561 | 3300039447 | Bacteria | 5319 |
| 611 | Ga0439436_0017321 | 3300041404 | Bacteria | 2156 |
| 612 | Ga0439436_0036469 | 3300041404 | Bacteria | 1418 |
| 613 | Ga0439436_0047309 | 3300041404 | Bacteria | 1221 |
| 614 | Ga0439436_0084864 | 3300041404 | Bacteria | 881 |
| 615 | Ga0439438_033184 | 3300041405 | Bacteria | 1365 |
| 616 | Ga0439439_0043331 | 3300041406 | Bacteria | 1170 |
| 617 | Ga0439439_0057069 | 3300041406 | Bacteria | 1032 |
| 618 | Ga0439461_0003310 | 3300041410 | Bacteria | 2645 |
| 619 | Ga0439466_0043460 | 3300041411 | Bacteria | 1492 |
| 620 | Ga0439466_0196802 | 3300041411 | Bacteria | 613 |
| 621 | Ga0439465_0004945 | 3300041413 | Bacteria | 4283 |
| 622 | Ga0439465_0012268 | 3300041413 | Bacteria | 2681 |
| 623 | Ga0439465_0063356 | 3300041413 | Bacteria | 1228 |
| 624 | Ga0451791_0718593 | 3300041451 | Bacteria | 878 |
| 625 | Ga0451798_0727212 | 3300041458 | Bacteria | 579 |
| 626 | Ga0451807_1602126 | 3300041486 | Bacteria | 1008 |
| 627 | Ga0451839_0671410 | 3300041496 | Bacteria | 887 |
| 628 | Ga0451841_0612739 | 3300041498 | Bacteria | 750 |
| 629 | Ga0451853_3461985 | 3300041512 | Bacteria | 863 |
| 630 | Ga0439431_0018496 | 3300041997 | Bacteria | 1649 |
| 631 | Ga0439433_0006502 | 3300041999 | Bacteria | 2515 |
| 632 | Ga0439433_0038722 | 3300041999 | Bacteria | 1106 |
| 633 | Ga0439437_014647 | 3300042000 | Bacteria | 917 |
| 634 | Ga0439442_008290 | 3300042002 | Bacteria | 2097 |
| 635 | Ga0439442_010969 | 3300042002 | Bacteria | 1841 |
| 636 | Ga0439442_036909 | 3300042002 | Bacteria | 1023 |
| 637 | Ga0439445_0006877 | 3300042004 | Bacteria | 2626 |
| 638 | Ga0439448_0125371 | 3300042005 | Bacteria | 883 |
| 639 | Ga0439432_000644 | 3300042006 | Bacteria | 13066 |
| 640 | Ga0439432_008235 | 3300042006 | Bacteria | 3665 |
| 641 | Ga0439449_0000752 | 3300042007 | Bacteria | 12455 |
| 642 | Ga0439449_0022143 | 3300042007 | Bacteria | 2378 |
| 643 | Ga0439449_0027467 | 3300042007 | Bacteria | 2124 |
| 644 | Ga0439449_0050000 | 3300042007 | Bacteria | 1546 |
| 645 | Ga0439452_007471 | 3300042010 | Bacteria | 3345 |
| 646 | Ga0439457_029307 | 3300042014 | Bacteria | 1219 |
| 647 | Ga0439457_055990 | 3300042014 | Bacteria | 889 |
| 648 | Ga0439462_0029579 | 3300042015 | Bacteria | 1449 |
| 649 | Ga0450921_002961 | 3300042123 | Bacteria | 1167 |
| 650 | Ga0450923_012556 | 3300042125 | Bacteria | 1544 |
| 651 | Ga0450890_008872 | 3300042127 | Bacteria | 1286 |
| 652 | Ga0450890_021028 | 3300042127 | Bacteria | 886 |
| 653 | Ga0450897_000516 | 3300042128 | Bacteria | 2162 |
| 654 | Ga0450894_004749 | 3300042131 | Bacteria | 1763 |
| 655 | Ga0450896_002895 | 3300042133 | Bacteria | 2247 |
| 656 | Ga0450898_003128 | 3300042134 | Bacteria | 2358 |
| 657 | Ga0450899_010789 | 3300042135 | Bacteria | 1015 |
| 658 | Ga0450906_026602 | 3300042145 | Bacteria | 1027 |
| 659 | Ga0439446_0034759 | 3300042156 | Bacteria | 1468 |
| 660 | Ga0439446_0106780 | 3300042156 | Bacteria | 890 |
| 661 | Ga0450908_021205 | 3300042184 | Bacteria | 1141 |
| 662 | Ga0439434_0023131 | 3300042435 | Bacteria | 1869 |
| 663 | Ga0439434_0030058 | 3300042435 | Bacteria | 1648 |
| 664 | Ga0439444_0022352 | 3300042437 | Bacteria | 1127 |
| 665 | Ga0439459_0001649 | 3300042438 | Bacteria | 3326 |
| 666 | Ga0439464_0027079 | 3300042439 | Bacteria | 1593 |
| 667 | Ga0450918_001339 | 3300042531 | Bacteria | 4941 |
| 668 | Ga0450918_041571 | 3300042531 | Bacteria | 826 |
| 669 | Ga0451577_0005231 | 3300042876 | Bacteria | 13346 |
| 670 | Ga0451577_0104198 | 3300042876 | Bacteria | 2535 |
| 671 | Ga0451577_0282355 | 3300042876 | Bacteria | 1504 |
| 672 | Ga0451577_0916257 | 3300042876 | Bacteria | 789 |
| 673 | Ga0466969_0001251 | 3300044656 | Bacteria | 13703 |
| 674 | Ga0466969_0194922 | 3300044656 | Bacteria | 925 |
| 675 | Ga0466972_0023932 | 3300044658 | Bacteria | 3034 |
| 676 | Ga0466972_0064731 | 3300044658 | Bacteria | 1749 |
| 677 | Ga0466972_0118240 | 3300044658 | Bacteria | 1250 |
| 678 | Ga0453683_0007492 | 3300044673 | Bacteria | 7398 |
| 679 | Ga0466965_0000845 | 3300044683 | Bacteria | 11610 |
| 680 | Ga0466965_0075812 | 3300044683 | Bacteria | 1696 |
| 681 | Ga0466965_0088341 | 3300044683 | Bacteria | 1574 |
| 682 | Ga0466966_0077415 | 3300044684 | Bacteria | 2075 |
| 683 | Ga0466966_0123187 | 3300044684 | Bacteria | 1591 |
| 684 | Ga0466966_0140415 | 3300044684 | Bacteria | 1476 |
| 685 | Ga0466966_0241175 | 3300044684 | Bacteria | 1090 |
| 686 | Ga0466961_0001077 | 3300044693 | Bacteria | 16828 |
| 687 | Ga0466961_0113051 | 3300044693 | Bacteria | 1707 |
| 688 | Ga0466961_0118257 | 3300044693 | Bacteria | 1665 |
| 689 | Ga0466961_0174961 | 3300044693 | Bacteria | 1334 |
| 690 | Ga0466963_0029557 | 3300044694 | Bacteria | 3529 |
| 691 | Ga0466963_0385338 | 3300044694 | Bacteria | 988 |
| 692 | Ga0466964_0007733 | 3300044706 | Bacteria | 4023 |
| 693 | Ga0453684_0045142 | 3300044712 | Bacteria | 5883 |
| 694 | Ga0453684_0127674 | 3300044712 | Bacteria | 3057 |
| 695 | Ga0453684_0175174 | 3300044712 | Bacteria | 2524 |
| 696 | Ga0453684_0258814 | 3300044712 | Bacteria | 1994 |
| 697 | Ga0453684_0504094 | 3300044712 | Bacteria | 1340 |
| 698 | Ga0466968_0065248 | 3300044735 | Bacteria | 1576 |
| 699 | Ga0466970_0048862 | 3300044765 | Bacteria | 2256 |
| 700 | Ga0466970_0281990 | 3300044765 | Bacteria | 934 |
| 701 | Ga0466970_0391520 | 3300044765 | Bacteria | 792 |
| 702 | Ga0466970_0713518 | 3300044765 | Bacteria | 585 |
| 703 | Ga0466957_0043815 | 3300044842 | Bacteria | 2710 |
| 704 | Ga0466957_0565863 | 3300044842 | Bacteria | 793 |
| 705 | Ga0466960_0103735 | 3300044901 | Bacteria | 1468 |
| 706 | Ga0466960_0109265 | 3300044901 | Bacteria | 1434 |
| 707 | Ga0466960_0208918 | 3300044901 | Bacteria | 1069 |
| 708 | Ga0466959_0041941 | 3300045049 | Bacteria | 3377 |
| 709 | Ga0466959_0055275 | 3300045049 | Bacteria | 2898 |
| 710 | Ga0466959_0323962 | 3300045049 | Bacteria | 1053 |
| 711 | Ga0451576_0011443 | 3300045051 | Bacteria | 10080 |
| 712 | Ga0451576_0142539 | 3300045051 | Bacteria | 2499 |
| 713 | Ga0451576_0572666 | 3300045051 | Bacteria | 1186 |
| 714 | Ga0466958_0053641 | 3300045836 | Bacteria | 2444 |
| 715 | Ga0466967_0135326 | 3300045976 | Bacteria | 2291 |
| 716 | Ga0466967_0724658 | 3300045976 | Bacteria | 986 |
| 717 | Ga0495627_022181 | 3300046453 | Bacteria | 2092 |
| 718 | Ga0495629_0425965 | 3300046459 | Bacteria | 900 |
| 719 | Ga0495638_0104703 | 3300046460 | Bacteria | 1687 |
| 720 | Ga0495651_0207609 | 3300046462 | Bacteria | 1366 |
| 721 | Ga0495653_0238043 | 3300046463 | Bacteria | 1215 |
| 722 | Ga0495650_0070989 | 3300046471 | Bacteria | 1366 |
| 723 | Ga0495650_0292295 | 3300046471 | Bacteria | 547 |
| 724 | Ga0495585_0018632 | 3300046492 | Bacteria | 4003 |
| 725 | Ga0495607_0238780 | 3300046501 | Bacteria | 880 |
| 726 | Ga0495583_0004321 | 3300046506 | Bacteria | 10256 |
| 727 | Ga0495606_0006532 | 3300046507 | Bacteria | 10727 |
| 728 | Ga0495606_0142292 | 3300046507 | Bacteria | 1415 |
| 729 | Ga0495610_0034618 | 3300046512 | Bacteria | 2600 |
| 730 | Ga0495616_0067004 | 3300046513 | Bacteria | 1746 |
| 731 | Ga0495618_0094409 | 3300046514 | Bacteria | 1913 |
| 732 | Ga0495620_0008493 | 3300046515 | Bacteria | 5510 |
| 733 | Ga0495630_0703730 | 3300046517 | Bacteria | 773 |
| 734 | Ga0495631_0066034 | 3300046518 | Bacteria | 1565 |
| 735 | Ga0495637_0057927 | 3300046520 | Bacteria | 1598 |
| 736 | Ga0495643_0121676 | 3300046522 | Bacteria | 1318 |
| 737 | Ga0495663_0103779 | 3300046525 | Bacteria | 938 |
| 738 | Ga0495652_0181604 | 3300046529 | Bacteria | 1614 |
| 739 | Ga0495654_0024669 | 3300046530 | Bacteria | 3105 |
| 740 | Ga0495609_0054040 | 3300046538 | Bacteria | 1784 |
| 741 | Ga0495621_0125043 | 3300046539 | Bacteria | 997 |
| 742 | Ga0495597_0003773 | 3300046542 | Bacteria | 8624 |
| 743 | Ga0495622_0097092 | 3300046557 | Bacteria | 1352 |
| 744 | Ga0495633_0048538 | 3300046558 | Bacteria | 2004 |
| 745 | Ga0495633_0145159 | 3300046558 | Bacteria | 1097 |
| 746 | Ga0495667_0218832 | 3300046559 | Bacteria | 1216 |
| 747 | Ga0495668_0256532 | 3300046616 | Bacteria | 957 |
| 748 | Ga0495625_0001775 | 3300046660 | Bacteria | 24896 |
| 749 | Ga0495625_0101136 | 3300046660 | Bacteria | 1980 |
| 750 | Ga0495625_0210708 | 3300046660 | Bacteria | 1277 |
| 751 | Ga0495625_0344295 | 3300046660 | Bacteria | 944 |
| 752 | Ga0495635_0473731 | 3300046663 | Bacteria | 826 |
| 753 | Ga0495659_0252860 | 3300046664 | Bacteria | 735 |
| 754 | Ga0495588_0099138 | 3300046674 | Bacteria | 1530 |
| 755 | Ga0495588_0127654 | 3300046674 | Bacteria | 1341 |
| 756 | Ga0495657_0268371 | 3300046675 | Bacteria | 1024 |
| 757 | Ga0495646_0241794 | 3300046680 | Bacteria | 970 |
| 758 | Ga0495658_0244956 | 3300046683 | Bacteria | 1126 |
| 759 | Ga0495658_0322712 | 3300046683 | Bacteria | 979 |
| 760 | Ga0495669_0088515 | 3300046684 | Bacteria | 1427 |
| 761 | Ga0495669_0119414 | 3300046684 | Bacteria | 1235 |
| 762 | Ga0495613_0237913 | 3300046689 | Bacteria | 1274 |
| 763 | Ga0495670_0149527 | 3300046691 | Bacteria | 1224 |
| 764 | Ga0495649_0004654 | 3300046694 | Bacteria | 8916 |
| 765 | Ga0495589_0279592 | 3300046794 | Bacteria | 776 |
| 766 | Ga0495636_0136448 | 3300047318 | Bacteria | 1094 |
| 767 | Ga0495676_0002146 | 3300047321 | Bacteria | 17446 |
| 768 | Ga0495680_0130852 | 3300047322 | Bacteria | 1844 |
| 769 | Ga0495677_0142936 | 3300047445 | Bacteria | 919 |
| 770 | Ga0495686_0014017 | 3300047472 | Bacteria | 5538 |
| 771 | Ga0495686_0349667 | 3300047472 | Bacteria | 804 |
| 772 | Ga0495593_0015848 | 3300047673 | Bacteria | 4258 |
| 773 | Ga0495602_0340931 | 3300048088 | Bacteria | 1084 |
| 774 | Ga0495602_0342412 | 3300048088 | Bacteria | 1081 |
| 775 | Ga0495614_0050797 | 3300048089 | Bacteria | 1776 |
| 776 | Ga0495615_0034462 | 3300048090 | Bacteria | 1232 |
| 777 | Ga0496100_0082603 | 3300048903 | Bacteria | 2173 |
| 778 | Ga0496101_0110727 | 3300048904 | Bacteria | 2066 |
| 779 | Ga0496101_0179000 | 3300048904 | Bacteria | 1632 |
| 780 | Ga0496101_0390349 | 3300048904 | Bacteria | 1096 |
| 781 | Ga0496101_0520759 | 3300048904 | Bacteria | 940 |
| 782 | Ga0496105_0048520 | 3300048908 | Bacteria | 3504 |
| 783 | Ga0496106_0158058 | 3300048909 | Bacteria | 1791 |
| 784 | Ga0496107_0349904 | 3300048910 | Bacteria | 1100 |
| 785 | Ga0496107_0361318 | 3300048910 | Bacteria | 1080 |
| 786 | Ga0496108_0410090 | 3300048911 | Bacteria | 1183 |
| 787 | Ga0496108_0853079 | 3300048911 | Bacteria | 784 |
| 788 | Ga0496109_0195299 | 3300048912 | Bacteria | 1902 |
| 789 | Ga0496109_0294112 | 3300048912 | Bacteria | 1531 |
| 790 | Ga0496110_0087171 | 3300048913 | Bacteria | 2788 |
| 791 | Ga0496110_0494402 | 3300048913 | Bacteria | 1114 |
| 792 | Ga0496110_0584156 | 3300048913 | Bacteria | 1014 |
| 793 | Ga0496111_0116400 | 3300048914 | Bacteria | 1971 |
| 794 | Ga0496113_0573842 | 3300048916 | Bacteria | 904 |
| 795 | Ga0496114_0085708 | 3300048917 | Bacteria | 2668 |
| 796 | Ga0496114_0247328 | 3300048917 | Bacteria | 1569 |
| 797 | Ga0496114_0707743 | 3300048917 | Bacteria | 883 |
| 798 | Ga0496116_0015563 | 3300048919 | Bacteria | 6008 |
| 799 | Ga0496116_0098158 | 3300048919 | Bacteria | 1758 |
| 800 | Ga0496117_0079964 | 3300048920 | Bacteria | 2151 |
| 801 | Ga0496117_0223087 | 3300048920 | Bacteria | 1047 |
| 802 | Ga0496117_0263167 | 3300048920 | Bacteria | 933 |
| 803 | Ga0496118_0024461 | 3300048921 | Bacteria | 5209 |
| 804 | Ga0496118_0257510 | 3300048921 | Bacteria | 987 |
| 805 | Ga0496118_0292662 | 3300048921 | Bacteria | 899 |
| 806 | Ga0496118_0325610 | 3300048921 | Bacteria | 832 |
| 807 | Ga0496121_0016103 | 3300048924 | Bacteria | 7748 |
| 808 | Ga0496121_0078542 | 3300048924 | Bacteria | 2623 |
| 809 | Ga0496121_0219386 | 3300048924 | Bacteria | 1340 |
| 810 | Ga0496122_0002216 | 3300048925 | Bacteria | 28363 |
| 811 | Ga0496122_0060113 | 3300048925 | Bacteria | 2801 |
| 812 | Ga0496122_0219784 | 3300048925 | Bacteria | 1091 |
| 813 | Ga0496122_0266634 | 3300048925 | Bacteria | 946 |
| 814 | Ga0496123_0000057 | 3300048926 | Bacteria | 228608 |
| 815 | Ga0496123_0191249 | 3300048926 | Bacteria | 1058 |
| 816 | Ga0496123_0252832 | 3300048926 | Bacteria | 868 |
| 817 | Ga0496124_0102702 | 3300048927 | Bacteria | 2313 |
| 818 | Ga0496124_0229273 | 3300048927 | Bacteria | 1390 |
| 819 | Ga0496124_0286744 | 3300048927 | Bacteria | 1197 |
| 820 | Ga0496124_0391648 | 3300048927 | Bacteria | 967 |
| 821 | Ga0496125_0017536 | 3300048928 | Bacteria | 6821 |
| 822 | Ga0496125_0021742 | 3300048928 | Bacteria | 5971 |
| 823 | Ga0496125_0022543 | 3300048928 | Bacteria | 5843 |
| 824 | Ga0496125_0042149 | 3300048928 | Bacteria | 3892 |
| 825 | Ga0496125_0279360 | 3300048928 | Bacteria | 1035 |
| 826 | Ga0496126_0339294 | 3300048929 | Bacteria | 1231 |
| 827 | Ga0501303_014028 | 3300049526 | Bacteria | 788 |
| 828 | Ga0501047_0263313 | 3300049581 | Bacteria | 1571 |
| 829 | Ga0501047_0966694 | 3300049581 | Bacteria | 665 |
| 830 | Ga0501243_061676 | 3300049675 | Bacteria | 697 |
| 831 | Ga0501249_042127 | 3300049679 | Bacteria | 1037 |
| 832 | Ga0501257_067667 | 3300049686 | Bacteria | 909 |
| 833 | Ga0501225_0005645 | 3300049705 | Bacteria | 3668 |
| 834 | Ga0501241_052477 | 3300049758 | Bacteria | 807 |
| 835 | Ga0501262_004218 | 3300049759 | Bacteria | 1663 |
| 836 | Ga0501044_0620980 | 3300049823 | Bacteria | 972 |
| 837 | nmdc:mga03683_71105_c1 | 3300050489 | Bacteria | 1488 |
| 838 | nmdc:mga03683_76352_c1 | 3300050489 | Bacteria | 1440 |
| 839 | nmdc:mga00v17_365889_c1 | 3300050491 | Bacteria | 938 |
| 840 | nmdc:mga0yw44_21402_c1 | 3300050492 | Bacteria | 3607 |
| 841 | nmdc:mga0yw44_44978_c1 | 3300050492 | Bacteria | 2644 |
| 842 | nmdc:mga0k408_110498_c1 | 3300050493 | Bacteria | 1625 |
| 843 | nmdc:mga0k408_167210_c1 | 3300050493 | Bacteria | 1311 |
| 844 | nmdc:mga0k408_199361_c1 | 3300050493 | Bacteria | 1195 |
| 845 | nmdc:mga0k408_200838_c1 | 3300050493 | Bacteria | 1190 |
| 846 | nmdc:mga0k408_302276_c1 | 3300050493 | Bacteria | 955 |
| 847 | nmdc:mga0k408_30309_c1 | 3300050493 | Bacteria | 3084 |
| 848 | nmdc:mga0k408_4382_c1 | 3300050493 | Bacteria | 7494 |
| 849 | nmdc:mga0k408_52328_c1 | 3300050493 | Bacteria | 2367 |
| 850 | nmdc:mga0k408_76703_c1 | 3300050493 | Bacteria | 1954 |
| 851 | nmdc:mga0k408_98198_c1 | 3300050493 | Bacteria | 1726 |
| 852 | nmdc:mga06z11_294382_c1 | 3300050494 | Bacteria | 964 |
| 853 | nmdc:mga06z11_61412_c1 | 3300050494 | Bacteria | 1960 |
| 854 | nmdc:mga07m45_126177_c1 | 3300050496 | Bacteria | 1480 |
| 855 | nmdc:mga07m45_17376_c2 | 3300050496 | Bacteria | 2149 |
| 856 | nmdc:mga07m45_185_c2 | 3300050496 | Bacteria | 20271 |
| 857 | nmdc:mga07m45_35505_c1 | 3300050496 | Bacteria | 2773 |
| 858 | nmdc:mga07m45_355643_c1 | 3300050496 | Bacteria | 851 |
| 859 | nmdc:mga07m45_5824_c1 | 3300050496 | Bacteria | 6179 |
| 860 | nmdc:mga07m45_65471_c1 | 3300050496 | Bacteria | 2064 |
| 861 | nmdc:mga07m45_95341_c1 | 3300050496 | Bacteria | 1707 |
| 862 | nmdc:mga0rr50_1249587_c1 | 3300050513 | Bacteria | 630 |
| 863 | nmdc:mga08x19_450849_c1 | 3300050514 | Bacteria | 905 |
| 864 | nmdc:mga0sz30_132695_c1 | 3300050516 | Bacteria | 1098 |
| 865 | Ga0495601_0585512 | 3300053077 | Bacteria | 717 |
| 866 | Ga0500610_0014525 | 3300053079 | Bacteria | 3697 |
| 867 | Ga0500610_0069226 | 3300053079 | Bacteria | 1841 |
| 868 | Ga0500635_0000850 | 3300053080 | Bacteria | 7502 |
| 869 | Ga0500578_0194768 | 3300053086 | Bacteria | 1243 |
| 870 | Ga0500643_039096 | 3300053087 | Bacteria | 1403 |
| 871 | Ga0500644_0032531 | 3300053088 | Bacteria | 1667 |
| 872 | Ga0500646_0126829 | 3300053090 | Bacteria | 826 |
| 873 | Ga0500651_0000637 | 3300053093 | Bacteria | 17435 |
| 874 | Ga0500651_0230849 | 3300053093 | Bacteria | 1082 |
| 875 | Ga0500566_0007532 | 3300053094 | Bacteria | 6449 |
| 876 | Ga0500562_060988 | 3300053108 | Bacteria | 1013 |
| 877 | Ga0500571_003025 | 3300053110 | Bacteria | 8531 |
| 878 | Ga0500593_001469 | 3300053117 | Bacteria | 8483 |
| 879 | Ga0500593_001539 | 3300053117 | Bacteria | 8276 |
| 880 | Ga0500594_0003737 | 3300053118 | Bacteria | 3353 |
| 881 | Ga0500607_031799 | 3300053121 | Bacteria | 2901 |
| 882 | Ga0500607_136146 | 3300053121 | Bacteria | 1163 |
| 883 | Ga0500608_067319 | 3300053122 | Bacteria | 1706 |
| 884 | Ga0500652_154133 | 3300053131 | Bacteria | 952 |
| 885 | Ga0500655_019199 | 3300053133 | Bacteria | 1272 |
| 886 | Ga0500658_0003701 | 3300053134 | Bacteria | 5764 |
| 887 | Ga0500658_0007934 | 3300053134 | Bacteria | 3922 |
| 888 | Ga0500559_0016822 | 3300053136 | Bacteria | 3089 |
| 889 | Ga0500559_0019098 | 3300053136 | Bacteria | 2896 |
| 890 | Ga0500559_0086415 | 3300053136 | Bacteria | 1431 |
| 891 | Ga0500568_0002017 | 3300053139 | Bacteria | 12366 |
| 892 | Ga0500573_0197587 | 3300053140 | Bacteria | 1070 |
| 893 | Ga0500574_001946 | 3300053141 | Bacteria | 3253 |
| 894 | Ga0500577_0129108 | 3300053142 | Bacteria | 1058 |
| 895 | Ga0500604_0097367 | 3300053151 | Bacteria | 967 |
| 896 | Ga0500627_0015591 | 3300053158 | Bacteria | 2942 |
| 897 | Ga0500634_0174715 | 3300053161 | Bacteria | 974 |
| 898 | Ga0500638_113832 | 3300053162 | Bacteria | 1246 |
| 899 | Ga0500636_0155051 | 3300053177 | Bacteria | 1254 |
| 900 | Ga0500636_0187416 | 3300053177 | Bacteria | 1105 |
| 901 | Ga0500645_001223 | 3300053730 | Bacteria | 13536 |
| 902 | Ga0500645_007710 | 3300053730 | Bacteria | 3727 |
| 903 | Ga0587084_000313 | 3300059477 | Bacteria | 3564 |
| 904 | Ga0587083_0007641 | 3300059505 | Bacteria | 1663 |
| 905 | Ga0587072_002999 | 3300059643 | Bacteria | 2329 |
| 906 | Ga0587072_030876 | 3300059643 | Bacteria | 1000 |
| 907 | Ga0587076_041344 | 3300059645 | Bacteria | 863 |
| 908 | Ga0466962_0002068 | 3300061719 | Bacteria | 9493 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300032168 | Ga0316593_10000144 | Ga0316593_100001443 | 144 |
| 2 | 3300009148 | Ga0105243_10724121 | Ga0105243_107241212 | 148 |
| 3 | 3300025935 | Ga0207709_10073934 | Ga0207709_100739342 | 148 |
| 4 | 3300032168 | Ga0316593_10000732 | Ga0316593_100007323 | 156 |
| 5 | 3300033541 | Ga0316596_1005126 | Ga0316596_10051262 | 156 |
| 6 | 3300035398 | Ga0316574_0079360 | Ga0316574_0079360_268_774 | 156 |
| 7 | 3300036647 | Ga0316582_0071388 | Ga0316582_0071388_437_943 | 156 |
| 8 | 3300036647 | Ga0316582_0420452 | Ga0316582_0420452_305_802 | 156 |
| 9 | 3300036712 | Ga0316584_0005757 | Ga0316584_0005757_3329_3835 | 156 |
| 10 | 3300036712 | Ga0316584_0047614 | Ga0316584_0047614_434_940 | 156 |
| 11 | 3300038443 | Ga0395901_0321204 | Ga0395901_0321204_403_894 | 156 |
| 12 | 3300042876 | Ga0451577_0282355 | Ga0451577_0282355_905_1423 | 156 |
| 13 | 3300044712 | Ga0453684_0045142 | Ga0453684_0045142_4110_4628 | 156 |
| 14 | 3300005339 | Ga0070660_100039370 | Ga0070660_1000393703 | 157 |
| 15 | 3300005435 | Ga0070714_100995587 | Ga0070714_1009955872 | 157 |
| 16 | 3300005530 | Ga0070679_100056638 | Ga0070679_1000566383 | 157 |
| 17 | 3300005543 | Ga0070672_100265667 | Ga0070672_1002656672 | 157 |
| 18 | 3300009093 | Ga0105240_10016601 | Ga0105240_100166018 | 157 |
| 19 | 3300009177 | Ga0105248_11168740 | Ga0105248_111687402 | 157 |
| 20 | 3300009551 | Ga0105238_10210168 | Ga0105238_102101682 | 157 |
| 21 | 3300013104 | Ga0157370_11524002 | Ga0157370_115240021 | 157 |
| 22 | 3300013306 | Ga0163162_10219614 | Ga0163162_102196142 | 157 |
| 23 | 3300014968 | Ga0157379_11050138 | Ga0157379_110501382 | 157 |
| 24 | 3300017792 | Ga0163161_10611348 | Ga0163161_106113482 | 157 |
| 25 | 3300025901 | Ga0207688_10376841 | Ga0207688_103768411 | 157 |
| 26 | 3300025909 | Ga0207705_10725700 | Ga0207705_107257002 | 157 |
| 27 | 3300025913 | Ga0207695_10065364 | Ga0207695_100653642 | 157 |
| 28 | 3300025921 | Ga0207652_10122726 | Ga0207652_101227262 | 157 |
| 29 | 3300025929 | Ga0207664_10814602 | Ga0207664_108146022 | 157 |
| 30 | 3300025940 | Ga0207691_10158961 | Ga0207691_101589612 | 157 |
| 31 | 3300025949 | Ga0207667_10016760 | Ga0207667_100167602 | 157 |
| 32 | 3300027364 | Ga0209967_1031377 | Ga0209967_10313772 | 157 |
| 33 | 3300038443 | Ga0395901_0492984 | Ga0395901_0492984_264_737 | 157 |
| 34 | 3300046525 | Ga0495663_0103779 | Ga0495663_0103779_154_669 | 157 |
| 35 | 3300053077 | Ga0495601_0585512 | Ga0495601_0585512_55_573 | 157 |
| 36 | 3300006177 | Ga0075362_10106793 | Ga0075362_101067932 | 158 |
| 37 | 3300006195 | Ga0075366_10104538 | Ga0075366_101045382 | 158 |
| 38 | 3300013297 | Ga0157378_10329890 | Ga0157378_103298902 | 158 |
| 39 | 3300026067 | Ga0207678_10366621 | Ga0207678_103666212 | 158 |
| 40 | 3300026142 | Ga0207698_11354366 | Ga0207698_113543662 | 158 |
| 41 | 3300030731 | Ga0316177_1051055 | Ga0316177_10510558 | 158 |
| 42 | 3300030742 | Ga0316183_1136198 | Ga0316183_11361982 | 158 |
| 43 | 3300036401 | Ga0373937_0707607 | Ga0373937_0707607_100_582 | 158 |
| 44 | 3300044712 | Ga0453684_0127674 | Ga0453684_0127674_1844_2326 | 158 |
| 45 | 3300048917 | Ga0496114_0707743 | Ga0496114_0707743_170_652 | 158 |
| 46 | 3300049679 | Ga0501249_042127 | Ga0501249_042127_330_878 | 158 |
| 47 | 3300049705 | Ga0501225_0005645 | Ga0501225_0005645_2511_3059 | 158 |
| 48 | 3300050514 | nmdc:mga08x19_450849_c1 | nmdc:mga08x19_450849_c1_317_865 | 158 |
| 49 | iso_pu_bacteria | 2886848708 | 2886850778 | 158 |
| 50 | 3300001915 | JGI24741J21665_1011580 | JGI24741J21665_10115802 | 159 |
| 51 | 3300001979 | JGI24740J21852_10007552 | JGI24740J21852_100075522 | 159 |
| 52 | 3300002739 | JGI25158J39367_1008994 | JGI25158J39367_10089942 | 159 |
| 53 | 3300002773 | JGI25152J39213_1037143 | JGI25152J39213_10371431 | 159 |
| 54 | 3300002774 | JGI25150J39212_1011607 | JGI25150J39212_10116072 | 159 |
| 55 | 3300002987 | JGI25159J45721_1018912 | JGI25159J45721_10189122 | 159 |
| 56 | 3300003187 | JGI25151J46595_10112700 | JGI25151J46595_101127001 | 159 |
| 57 | 3300003374 | JGI25161J50226_1006295 | JGI25161J50226_10062952 | 159 |
| 58 | 3300003578 | Ga0006562J51391_1178712 | Ga0006562J51391_11787122 | 159 |
| 59 | 3300003578 | Ga0006562J51391_1178713 | Ga0006562J51391_11787131 | 159 |
| 60 | 3300003773 | Ga0055537_1000104 | Ga0055537_100010410 | 159 |
| 61 | 3300003784 | Ga0055534_1000042 | Ga0055534_100004223 | 159 |
| 62 | 3300003790 | Ga0055528_1002054 | Ga0055528_10020542 | 159 |
| 63 | 3300003790 | Ga0055528_1029635 | Ga0055528_10296352 | 159 |
| 64 | 3300003792 | Ga0055540_1036359 | Ga0055540_10363591 | 159 |
| 65 | 3300005289 | Ga0065704_10376822 | Ga0065704_103768221 | 159 |
| 66 | 3300005471 | Ga0070698_100003836 | Ga0070698_1000038367 | 159 |
| 67 | 3300005539 | Ga0068853_100029605 | Ga0068853_1000296054 | 159 |
| 68 | 3300005545 | Ga0070695_100272400 | Ga0070695_1002724002 | 159 |
| 69 | 3300006051 | Ga0075364_10153091 | Ga0075364_101530912 | 159 |
| 70 | 3300006353 | Ga0075370_10018343 | Ga0075370_100183432 | 159 |
| 71 | 3300006353 | Ga0075370_10308673 | Ga0075370_103086731 | 159 |
| 72 | 3300006946 | Ga0079104_1019147 | Ga0079104_10191472 | 159 |
| 73 | 3300006948 | Ga0099826_10004379 | Ga0099826_1000437910 | 159 |
| 74 | 3300013104 | Ga0157370_11264892 | Ga0157370_112648921 | 159 |
| 75 | 3300025258 | Ga0209129_1000083 | Ga0209129_1000083142 | 159 |
| 76 | 3300025258 | Ga0209129_1003940 | Ga0209129_10039402 | 159 |
| 77 | 3300025263 | Ga0209565_1000083 | Ga0209565_100008324 | 159 |
| 78 | 3300025263 | Ga0209565_1001476 | Ga0209565_100147610 | 159 |
| 79 | 3300025273 | Ga0209673_1000089 | Ga0209673_1000089165 | 159 |
| 80 | 3300025273 | Ga0209673_1000323 | Ga0209673_100032321 | 159 |
| 81 | 3300025273 | Ga0209673_1001307 | Ga0209673_100130725 | 159 |
| 82 | 3300025284 | Ga0209130_1001189 | Ga0209130_10011894 | 159 |
| 83 | 3300025284 | Ga0209130_1002203 | Ga0209130_100220312 | 159 |
| 84 | 3300025291 | Ga0209675_1000081 | Ga0209675_100008124 | 159 |
| 85 | 3300025291 | Ga0209675_1006532 | Ga0209675_10065323 | 159 |
| 86 | 3300025292 | Ga0209676_1000004 | Ga0209676_1000004490 | 159 |
| 87 | 3300025294 | Ga0209025_1001314 | Ga0209025_100131418 | 159 |
| 88 | 3300025294 | Ga0209025_1044212 | Ga0209025_10442122 | 159 |
| 89 | 3300025295 | Ga0209564_1000323 | Ga0209564_100032318 | 159 |
| 90 | 3300025295 | Ga0209564_1000332 | Ga0209564_100033218 | 159 |
| 91 | 3300025297 | Ga0209758_1000132 | Ga0209758_1000132142 | 159 |
| 92 | 3300025298 | Ga0209050_1000002 | Ga0209050_10000021000 | 159 |
| 93 | 3300025299 | Ga0209256_1000973 | Ga0209256_10009734 | 159 |
| 94 | 3300025299 | Ga0209256_1005263 | Ga0209256_10052634 | 159 |
| 95 | 3300025302 | Ga0207426_1000323 | Ga0207426_100032370 | 159 |
| 96 | 3300025302 | Ga0207426_1000584 | Ga0207426_100058419 | 159 |
| 97 | 3300025303 | Ga0209051_1000002 | Ga0209051_1000002769 | 159 |
| 98 | 3300025303 | Ga0209051_1004724 | Ga0209051_10047243 | 159 |
| 99 | 3300025304 | Ga0209257_1000002 | Ga0209257_1000002910 | 159 |
| 100 | 3300025944 | Ga0207661_11615580 | Ga0207661_116155801 | 159 |
| 101 | 3300026116 | Ga0207674_10530439 | Ga0207674_105304392 | 159 |
| 102 | 3300027666 | Ga0209282_1001621 | Ga0209282_10016214 | 159 |
| 103 | 3300027907 | Ga0207428_10489967 | Ga0207428_104899672 | 159 |
| 104 | 3300030732 | Ga0316176_1222992 | Ga0316176_12229923 | 159 |
| 105 | 3300030735 | Ga0316178_1083600 | Ga0316178_10836004 | 159 |
| 106 | 3300030736 | Ga0316180_1048969 | Ga0316180_10489698 | 159 |
| 107 | 3300030744 | Ga0316181_1077794 | Ga0316181_10777948 | 159 |
| 108 | 3300031731 | Ga0307405_10228311 | Ga0307405_102283112 | 159 |
| 109 | 3300031911 | Ga0307412_10056316 | Ga0307412_100563163 | 159 |
| 110 | 3300048904 | Ga0496101_0179000 | Ga0496101_0179000_261_815 | 159 |
| 111 | 3300049526 | Ga0501303_014028 | Ga0501303_014028_25_591 | 159 |
| 112 | 3300049758 | Ga0501241_052477 | Ga0501241_052477_75_632 | 159 |
| 113 | 3300049759 | Ga0501262_004218 | Ga0501262_004218_654_1211 | 159 |
| 114 | 3300050492 | nmdc:mga0yw44_21402_c1 | nmdc:mga0yw44_21402_c1_1010_1567 | 159 |
| 115 | 3300050493 | nmdc:mga0k408_30309_c1 | nmdc:mga0k408_30309_c1_454_1011 | 159 |
| 116 | 3300050496 | nmdc:mga07m45_5824_c1 | nmdc:mga07m45_5824_c1_565_1113 | 159 |
| 117 | 3300050516 | nmdc:mga0sz30_132695_c1 | nmdc:mga0sz30_132695_c1_290_844 | 159 |
| 118 | iso_pu_bacteria | 2511231002 | 2511243437 | 159 |
| 119 | iso_pu_bacteria | 2721755523 | 2722882316 | 159 |
| 120 | iso_pu_bacteria | 2839138175 | 2839139938 | 159 |
| 121 | iso_pu_bacteria | 2894023352 | 2894024481 | 159 |
| 122 | iso_pu_bacteria | 2932422444 | 2932424563 | 159 |
| 123 | 3300002705 | JGI25156J39149_1002448 | JGI25156J39149_10024482 | 160 |
| 124 | 3300002705 | JGI25156J39149_1010889 | JGI25156J39149_10108892 | 160 |
| 125 | 3300002705 | JGI25156J39149_1016094 | JGI25156J39149_10160942 | 160 |
| 126 | 3300002705 | JGI25156J39149_1019551 | JGI25156J39149_10195512 | 160 |
| 127 | 3300002705 | JGI25156J39149_1034850 | JGI25156J39149_10348501 | 160 |
| 128 | 3300002738 | JGI25154J39366_1001442 | JGI25154J39366_10014423 | 160 |
| 129 | 3300002741 | JGI25157J39369_1000095 | JGI25157J39369_100009527 | 160 |
| 130 | 3300002772 | JGI25164J39214_1004101 | JGI25164J39214_10041012 | 160 |
| 131 | 3300003752 | Ga0055539_1005506 | Ga0055539_10055062 | 160 |
| 132 | 3300003752 | Ga0055539_1005852 | Ga0055539_10058521 | 160 |
| 133 | 3300003752 | Ga0055539_1013569 | Ga0055539_10135692 | 160 |
| 134 | 3300003756 | Ga0055533_1000100 | Ga0055533_100010066 | 160 |
| 135 | 3300003761 | Ga0055535_1005897 | Ga0055535_10058972 | 160 |
| 136 | 3300003761 | Ga0055535_1020685 | Ga0055535_10206851 | 160 |
| 137 | 3300003763 | Ga0055529_1001089 | Ga0055529_10010893 | 160 |
| 138 | 3300003771 | Ga0055526_1020588 | Ga0055526_10205881 | 160 |
| 139 | 3300003773 | Ga0055537_1008606 | Ga0055537_10086064 | 160 |
| 140 | 3300003775 | Ga0055524_1067228 | Ga0055524_10672281 | 160 |
| 141 | 3300003781 | Ga0055536_1004691 | Ga0055536_10046914 | 160 |
| 142 | 3300003791 | Ga0055530_10035007 | Ga0055530_100350072 | 160 |
| 143 | 3300003792 | Ga0055540_1016035 | Ga0055540_10160352 | 160 |
| 144 | 3300005327 | Ga0070658_10222314 | Ga0070658_102223142 | 160 |
| 145 | 3300005327 | Ga0070658_10566352 | Ga0070658_105663522 | 160 |
| 146 | 3300005330 | Ga0070690_100350952 | Ga0070690_1003509522 | 160 |
| 147 | 3300005334 | Ga0068869_100517225 | Ga0068869_1005172251 | 160 |
| 148 | 3300005335 | Ga0070666_10378579 | Ga0070666_103785792 | 160 |
| 149 | 3300005338 | Ga0068868_100369826 | Ga0068868_1003698262 | 160 |
| 150 | 3300005339 | Ga0070660_100480338 | Ga0070660_1004803382 | 160 |
| 151 | 3300005340 | Ga0070689_100442156 | Ga0070689_1004421562 | 160 |
| 152 | 3300005364 | Ga0070673_100123144 | Ga0070673_1001231442 | 160 |
| 153 | 3300005366 | Ga0070659_100987932 | Ga0070659_1009879322 | 160 |
| 154 | 3300005367 | Ga0070667_101452783 | Ga0070667_1014527831 | 160 |
| 155 | 3300005456 | Ga0070678_100692321 | Ga0070678_1006923212 | 160 |
| 156 | 3300005458 | Ga0070681_10852971 | Ga0070681_108529711 | 160 |
| 157 | 3300005459 | Ga0068867_100382438 | Ga0068867_1003824382 | 160 |
| 158 | 3300005466 | Ga0070685_10278490 | Ga0070685_102784902 | 160 |
| 159 | 3300005471 | Ga0070698_100589412 | Ga0070698_1005894122 | 160 |
| 160 | 3300005535 | Ga0070684_100210194 | Ga0070684_1002101942 | 160 |
| 161 | 3300005539 | Ga0068853_100189424 | Ga0068853_1001894242 | 160 |
| 162 | 3300005539 | Ga0068853_100330909 | Ga0068853_1003309092 | 160 |
| 163 | 3300005548 | Ga0070665_100041269 | Ga0070665_1000412698 | 160 |
| 164 | 3300005563 | Ga0068855_100798393 | Ga0068855_1007983932 | 160 |
| 165 | 3300005563 | Ga0068855_101642976 | Ga0068855_1016429761 | 160 |
| 166 | 3300005564 | Ga0070664_101524211 | Ga0070664_1015242111 | 160 |
| 167 | 3300005577 | Ga0068857_100635888 | Ga0068857_1006358882 | 160 |
| 168 | 3300005577 | Ga0068857_101475164 | Ga0068857_1014751641 | 160 |
| 169 | 3300005577 | Ga0068857_101543723 | Ga0068857_1015437231 | 160 |
| 170 | 3300005578 | Ga0068854_100073065 | Ga0068854_1000730652 | 160 |
| 171 | 3300005578 | Ga0068854_100674651 | Ga0068854_1006746511 | 160 |
| 172 | 3300005614 | Ga0068856_100006504 | Ga0068856_10000650410 | 160 |
| 173 | 3300005719 | Ga0068861_100073024 | Ga0068861_1000730243 | 160 |
| 174 | 3300005719 | Ga0068861_101778945 | Ga0068861_1017789452 | 160 |
| 175 | 3300005843 | Ga0068860_100695209 | Ga0068860_1006952092 | 160 |
| 176 | 3300005844 | Ga0068862_101370927 | Ga0068862_1013709271 | 160 |
| 177 | 3300006038 | Ga0075365_10011063 | Ga0075365_100110639 | 160 |
| 178 | 3300006048 | Ga0075363_100346938 | Ga0075363_1003469382 | 160 |
| 179 | 3300006058 | Ga0075432_10028199 | Ga0075432_100281992 | 160 |
| 180 | 3300006178 | Ga0075367_10129178 | Ga0075367_101291782 | 160 |
| 181 | 3300006195 | Ga0075366_10055916 | Ga0075366_100559162 | 160 |
| 182 | 3300006353 | Ga0075370_10005914 | Ga0075370_100059142 | 160 |
| 183 | 3300006353 | Ga0075370_10051644 | Ga0075370_100516443 | 160 |
| 184 | 3300006353 | Ga0075370_10292001 | Ga0075370_102920012 | 160 |
| 185 | 3300006353 | Ga0075370_10363423 | Ga0075370_103634231 | 160 |
| 186 | 3300006358 | Ga0068871_101539474 | Ga0068871_1015394741 | 160 |
| 187 | 3300006871 | Ga0075434_101182919 | Ga0075434_1011829191 | 160 |
| 188 | 3300009098 | Ga0105245_11220745 | Ga0105245_112207452 | 160 |
| 189 | 3300009174 | Ga0105241_10312714 | Ga0105241_103127142 | 160 |
| 190 | 3300009177 | Ga0105248_10394621 | Ga0105248_103946212 | 160 |
| 191 | 3300009177 | Ga0105248_11611217 | Ga0105248_116112172 | 160 |
| 192 | 3300009545 | Ga0105237_10071021 | Ga0105237_100710213 | 160 |
| 193 | 3300009545 | Ga0105237_10914585 | Ga0105237_109145852 | 160 |
| 194 | 3300009551 | Ga0105238_10402007 | Ga0105238_104020072 | 160 |
| 195 | 3300009553 | Ga0105249_11226610 | Ga0105249_112266102 | 160 |
| 196 | 3300010375 | Ga0105239_10694822 | Ga0105239_106948222 | 160 |
| 197 | 3300010375 | Ga0105239_11995128 | Ga0105239_119951282 | 160 |
| 198 | 3300011119 | Ga0105246_10174552 | Ga0105246_101745522 | 160 |
| 199 | 3300013102 | Ga0157371_10270095 | Ga0157371_102700952 | 160 |
| 200 | 3300013105 | Ga0157369_10052460 | Ga0157369_100524602 | 160 |
| 201 | 3300013105 | Ga0157369_10721735 | Ga0157369_107217351 | 160 |
| 202 | 3300013297 | Ga0157378_10212374 | Ga0157378_102123742 | 160 |
| 203 | 3300013308 | Ga0157375_12543502 | Ga0157375_125435021 | 160 |
| 204 | 3300014968 | Ga0157379_10932939 | Ga0157379_109329392 | 160 |
| 205 | 3300014969 | Ga0157376_10416763 | Ga0157376_104167632 | 160 |
| 206 | 3300015261 | Ga0182006_1127620 | Ga0182006_11276202 | 160 |
| 207 | 3300015262 | Ga0182007_10056054 | Ga0182007_100560542 | 160 |
| 208 | 3300015262 | Ga0182007_10134829 | Ga0182007_101348292 | 160 |
| 209 | 3300017792 | Ga0163161_10113482 | Ga0163161_101134822 | 160 |
| 210 | 3300025225 | Ga0209566_111698 | Ga0209566_1116982 | 160 |
| 211 | 3300025226 | Ga0209674_100003 | Ga0209674_1000031924 | 160 |
| 212 | 3300025228 | Ga0209672_108077 | Ga0209672_1080772 | 160 |
| 213 | 3300025230 | Ga0209563_100017 | Ga0209563_10001746 | 160 |
| 214 | 3300025230 | Ga0209563_112761 | Ga0209563_1127612 | 160 |
| 215 | 3300025231 | Ga0207427_100380 | Ga0207427_10038014 | 160 |
| 216 | 3300025242 | Ga0209258_100414 | Ga0209258_10041445 | 160 |
| 217 | 3300025242 | Ga0209258_104537 | Ga0209258_1045372 | 160 |
| 218 | 3300025246 | Ga0209646_1000271 | Ga0209646_10002712 | 160 |
| 219 | 3300025250 | Ga0209026_1000085 | Ga0209026_1000085132 | 160 |
| 220 | 3300025253 | Ga0209677_102048 | Ga0209677_10204810 | 160 |
| 221 | 3300025253 | Ga0209677_108757 | Ga0209677_1087572 | 160 |
| 222 | 3300025254 | Ga0209148_1003800 | Ga0209148_10038003 | 160 |
| 223 | 3300025256 | Ga0209759_1000068 | Ga0209759_1000068130 | 160 |
| 224 | 3300025256 | Ga0209759_1008209 | Ga0209759_10082092 | 160 |
| 225 | 3300025256 | Ga0209759_1014909 | Ga0209759_10149092 | 160 |
| 226 | 3300025256 | Ga0209759_1014925 | Ga0209759_10149252 | 160 |
| 227 | 3300025256 | Ga0209759_1038431 | Ga0209759_10384312 | 160 |
| 228 | 3300025272 | Ga0209455_1000264 | Ga0209455_100026412 | 160 |
| 229 | 3300025273 | Ga0209673_1027737 | Ga0209673_10277372 | 160 |
| 230 | 3300025291 | Ga0209675_1000832 | Ga0209675_100083214 | 160 |
| 231 | 3300025294 | Ga0209025_1005532 | Ga0209025_100553210 | 160 |
| 232 | 3300025298 | Ga0209050_1046448 | Ga0209050_10464481 | 160 |
| 233 | 3300025303 | Ga0209051_1001375 | Ga0209051_100137516 | 160 |
| 234 | 3300025304 | Ga0209257_1071107 | Ga0209257_10711071 | 160 |
| 235 | 3300025909 | Ga0207705_10615649 | Ga0207705_106156492 | 160 |
| 236 | 3300025910 | Ga0207684_10004749 | Ga0207684_100047494 | 160 |
| 237 | 3300025911 | Ga0207654_10256218 | Ga0207654_102562182 | 160 |
| 238 | 3300025913 | Ga0207695_10047646 | Ga0207695_100476462 | 160 |
| 239 | 3300025914 | Ga0207671_10056734 | Ga0207671_100567342 | 160 |
| 240 | 3300025919 | Ga0207657_10033997 | Ga0207657_100339972 | 160 |
| 241 | 3300025919 | Ga0207657_10162882 | Ga0207657_101628822 | 160 |
| 242 | 3300025920 | Ga0207649_10071923 | Ga0207649_100719232 | 160 |
| 243 | 3300025921 | Ga0207652_10529203 | Ga0207652_105292031 | 160 |
| 244 | 3300025925 | Ga0207650_10663105 | Ga0207650_106631052 | 160 |
| 245 | 3300025932 | Ga0207690_10242705 | Ga0207690_102427052 | 160 |
| 246 | 3300025932 | Ga0207690_11024363 | Ga0207690_110243632 | 160 |
| 247 | 3300025934 | Ga0207686_10118183 | Ga0207686_101181832 | 160 |
| 248 | 3300025936 | Ga0207670_10305361 | Ga0207670_103053612 | 160 |
| 249 | 3300025941 | Ga0207711_11415885 | Ga0207711_114158851 | 160 |
| 250 | 3300025942 | Ga0207689_10326122 | Ga0207689_103261222 | 160 |
| 251 | 3300025949 | Ga0207667_10471167 | Ga0207667_104711672 | 160 |
| 252 | 3300025949 | Ga0207667_10563607 | Ga0207667_105636072 | 160 |
| 253 | 3300025949 | Ga0207667_10590836 | Ga0207667_105908362 | 160 |
| 254 | 3300025960 | Ga0207651_10279236 | Ga0207651_102792362 | 160 |
| 255 | 3300025981 | Ga0207640_10007957 | Ga0207640_100079579 | 160 |
| 256 | 3300026023 | Ga0207677_10271364 | Ga0207677_102713642 | 160 |
| 257 | 3300026041 | Ga0207639_10133878 | Ga0207639_101338781 | 160 |
| 258 | 3300026041 | Ga0207639_10537257 | Ga0207639_105372572 | 160 |
| 259 | 3300026078 | Ga0207702_10001691 | Ga0207702_1000169118 | 160 |
| 260 | 3300026088 | Ga0207641_10034600 | Ga0207641_100346002 | 160 |
| 261 | 3300026089 | Ga0207648_10347118 | Ga0207648_103471182 | 160 |
| 262 | 3300026095 | Ga0207676_10469654 | Ga0207676_104696542 | 160 |
| 263 | 3300026116 | Ga0207674_10012042 | Ga0207674_100120428 | 160 |
| 264 | 3300026116 | Ga0207674_10688022 | Ga0207674_106880222 | 160 |
| 265 | 3300026118 | Ga0207675_100198018 | Ga0207675_1001980182 | 160 |
| 266 | 3300026121 | Ga0207683_10580811 | Ga0207683_105808112 | 160 |
| 267 | 3300026121 | Ga0207683_10644338 | Ga0207683_106443382 | 160 |
| 268 | 3300026142 | Ga0207698_10467936 | Ga0207698_104679362 | 160 |
| 269 | 3300026142 | Ga0207698_11438385 | Ga0207698_114383852 | 160 |
| 270 | 3300028379 | Ga0268266_10029582 | Ga0268266_100295822 | 160 |
| 271 | 3300028381 | Ga0268264_10368811 | Ga0268264_103688112 | 160 |
| 272 | 3300028666 | Ga0265336_10000044 | Ga0265336_1000004451 | 160 |
| 273 | 3300029957 | Ga0265324_10000446 | Ga0265324_1000044624 | 160 |
| 274 | 3300030521 | Ga0307511_10082309 | Ga0307511_100823093 | 160 |
| 275 | 3300031239 | Ga0265328_10037651 | Ga0265328_100376512 | 160 |
| 276 | 3300031507 | Ga0307509_10169060 | Ga0307509_101690602 | 160 |
| 277 | 3300031507 | Ga0307509_10242669 | Ga0307509_102426692 | 160 |
| 278 | 3300031649 | Ga0307514_10161453 | Ga0307514_101614532 | 160 |
| 279 | 3300031730 | Ga0307516_10039984 | Ga0307516_100399848 | 160 |
| 280 | 3300031852 | Ga0307410_10498680 | Ga0307410_104986802 | 160 |
| 281 | 3300031901 | Ga0307406_10099212 | Ga0307406_100992122 | 160 |
| 282 | 3300032004 | Ga0307414_10323491 | Ga0307414_103234912 | 160 |
| 283 | 3300034820 | Ga0373959_0017007 | Ga0373959_0017007_803_1312 | 160 |
| 284 | 3300035086 | Ga0373934_0032944 | Ga0373934_0032944_894_1403 | 160 |
| 285 | 3300035691 | Ga0373931_0001569 | Ga0373931_0001569_6583_7101 | 160 |
| 286 | 3300035695 | Ga0373927_0261239 | Ga0373927_0261239_496_1014 | 160 |
| 287 | 3300037312 | Ga0395899_0285555 | Ga0395899_0285555_337_855 | 160 |
| 288 | 3300037312 | Ga0395899_0564282 | Ga0395899_0564282_198_707 | 160 |
| 289 | 3300037466 | Ga0395898_0026539 | Ga0395898_0026539_3988_4497 | 160 |
| 290 | 3300037471 | Ga0395905_0004037 | Ga0395905_0004037_11763_12248 | 160 |
| 291 | 3300037471 | Ga0395905_0842173 | Ga0395905_0842173_143_652 | 160 |
| 292 | 3300038443 | Ga0395901_0011265 | Ga0395901_0011265_7076_7585 | 160 |
| 293 | 3300038443 | Ga0395901_0673385 | Ga0395901_0673385_261_746 | 160 |
| 294 | 3300039447 | Ga0436361_0677555 | Ga0436361_0677555_587_1105 | 160 |
| 295 | 3300039447 | Ga0436361_0791561 | Ga0436361_0791561_2373_2891 | 160 |
| 296 | 3300041404 | Ga0439436_0047309 | Ga0439436_0047309_188_745 | 160 |
| 297 | 3300041413 | Ga0439465_0004945 | Ga0439465_0004945_285_842 | 160 |
| 298 | 3300041486 | Ga0451807_1602126 | Ga0451807_1602126_214_771 | 160 |
| 299 | 3300041496 | Ga0451839_0671410 | Ga0451839_0671410_260_817 | 160 |
| 300 | 3300042002 | Ga0439442_008290 | Ga0439442_008290_858_1415 | 160 |
| 301 | 3300042005 | Ga0439448_0125371 | Ga0439448_0125371_163_672 | 160 |
| 302 | 3300042014 | Ga0439457_055990 | Ga0439457_055990_117_674 | 160 |
| 303 | 3300042123 | Ga0450921_002961 | Ga0450921_002961_155_712 | 160 |
| 304 | 3300042435 | Ga0439434_0023131 | Ga0439434_0023131_584_1141 | 160 |
| 305 | 3300042531 | Ga0450918_001339 | Ga0450918_001339_3552_4109 | 160 |
| 306 | 3300044656 | Ga0466969_0001251 | Ga0466969_0001251_12506_12994 | 160 |
| 307 | 3300044658 | Ga0466972_0064731 | Ga0466972_0064731_969_1457 | 160 |
| 308 | 3300044658 | Ga0466972_0118240 | Ga0466972_0118240_571_1059 | 160 |
| 309 | 3300044683 | Ga0466965_0000845 | Ga0466965_0000845_9193_9711 | 160 |
| 310 | 3300044683 | Ga0466965_0075812 | Ga0466965_0075812_690_1178 | 160 |
| 311 | 3300044684 | Ga0466966_0077415 | Ga0466966_0077415_423_941 | 160 |
| 312 | 3300044684 | Ga0466966_0123187 | Ga0466966_0123187_804_1292 | 160 |
| 313 | 3300044693 | Ga0466961_0001077 | Ga0466961_0001077_11563_12081 | 160 |
| 314 | 3300044693 | Ga0466961_0118257 | Ga0466961_0118257_792_1280 | 160 |
| 315 | 3300044694 | Ga0466963_0029557 | Ga0466963_0029557_2556_3074 | 160 |
| 316 | 3300044706 | Ga0466964_0007733 | Ga0466964_0007733_2111_2629 | 160 |
| 317 | 3300044735 | Ga0466968_0065248 | Ga0466968_0065248_662_1180 | 160 |
| 318 | 3300044765 | Ga0466970_0281990 | Ga0466970_0281990_20_538 | 160 |
| 319 | 3300044765 | Ga0466970_0391520 | Ga0466970_0391520_11_499 | 160 |
| 320 | 3300044765 | Ga0466970_0713518 | Ga0466970_0713518_77_565 | 160 |
| 321 | 3300044842 | Ga0466957_0043815 | Ga0466957_0043815_1150_1668 | 160 |
| 322 | 3300044901 | Ga0466960_0103735 | Ga0466960_0103735_155_667 | 160 |
| 323 | 3300044901 | Ga0466960_0109265 | Ga0466960_0109265_419_907 | 160 |
| 324 | 3300045049 | Ga0466959_0055275 | Ga0466959_0055275_1793_2281 | 160 |
| 325 | 3300045836 | Ga0466958_0053641 | Ga0466958_0053641_660_1178 | 160 |
| 326 | 3300045976 | Ga0466967_0135326 | Ga0466967_0135326_135_653 | 160 |
| 327 | 3300046471 | Ga0495650_0070989 | Ga0495650_0070989_168_683 | 160 |
| 328 | 3300046492 | Ga0495585_0018632 | Ga0495585_0018632_206_724 | 160 |
| 329 | 3300046506 | Ga0495583_0004321 | Ga0495583_0004321_8674_9183 | 160 |
| 330 | 3300046507 | Ga0495606_0006532 | Ga0495606_0006532_2924_3433 | 160 |
| 331 | 3300046507 | Ga0495606_0142292 | Ga0495606_0142292_613_1170 | 160 |
| 332 | 3300046517 | Ga0495630_0703730 | Ga0495630_0703730_120_638 | 160 |
| 333 | 3300046529 | Ga0495652_0181604 | Ga0495652_0181604_635_1153 | 160 |
| 334 | 3300046539 | Ga0495621_0125043 | Ga0495621_0125043_152_634 | 160 |
| 335 | 3300046616 | Ga0495668_0256532 | Ga0495668_0256532_296_814 | 160 |
| 336 | 3300046660 | Ga0495625_0001775 | Ga0495625_0001775_679_1236 | 160 |
| 337 | 3300046660 | Ga0495625_0101136 | Ga0495625_0101136_1277_1795 | 160 |
| 338 | 3300046660 | Ga0495625_0344295 | Ga0495625_0344295_151_669 | 160 |
| 339 | 3300046684 | Ga0495669_0088515 | Ga0495669_0088515_393_902 | 160 |
| 340 | 3300046694 | Ga0495649_0004654 | Ga0495649_0004654_6606_7115 | 160 |
| 341 | 3300046794 | Ga0495589_0279592 | Ga0495589_0279592_78_587 | 160 |
| 342 | 3300047318 | Ga0495636_0136448 | Ga0495636_0136448_305_787 | 160 |
| 343 | 3300047472 | Ga0495686_0014017 | Ga0495686_0014017_568_1083 | 160 |
| 344 | 3300048090 | Ga0495615_0034462 | Ga0495615_0034462_665_1147 | 160 |
| 345 | 3300048904 | Ga0496101_0390349 | Ga0496101_0390349_108_626 | 160 |
| 346 | 3300048904 | Ga0496101_0520759 | Ga0496101_0520759_22_507 | 160 |
| 347 | 3300048911 | Ga0496108_0853079 | Ga0496108_0853079_161_682 | 160 |
| 348 | 3300048912 | Ga0496109_0294112 | Ga0496109_0294112_802_1287 | 160 |
| 349 | 3300048913 | Ga0496110_0584156 | Ga0496110_0584156_157_642 | 160 |
| 350 | 3300048919 | Ga0496116_0098158 | Ga0496116_0098158_266_820 | 160 |
| 351 | 3300048920 | Ga0496117_0263167 | Ga0496117_0263167_105_659 | 160 |
| 352 | 3300048924 | Ga0496121_0078542 | Ga0496121_0078542_1620_2174 | 160 |
| 353 | 3300048925 | Ga0496122_0219784 | Ga0496122_0219784_351_905 | 160 |
| 354 | 3300048925 | Ga0496122_0266634 | Ga0496122_0266634_243_800 | 160 |
| 355 | 3300048926 | Ga0496123_0191249 | Ga0496123_0191249_69_626 | 160 |
| 356 | 3300048928 | Ga0496125_0279360 | Ga0496125_0279360_269_826 | 160 |
| 357 | 3300050491 | nmdc:mga00v17_365889_c1 | nmdc:mga00v17_365889_c1_290_847 | 160 |
| 358 | 3300050493 | nmdc:mga0k408_110498_c1 | nmdc:mga0k408_110498_c1_1070_1579 | 160 |
| 359 | 3300050493 | nmdc:mga0k408_167210_c1 | nmdc:mga0k408_167210_c1_671_1159 | 160 |
| 360 | 3300050493 | nmdc:mga0k408_98198_c1 | nmdc:mga0k408_98198_c1_734_1258 | 160 |
| 361 | 3300050494 | nmdc:mga06z11_61412_c1 | nmdc:mga06z11_61412_c1_90_614 | 160 |
| 362 | 3300050496 | nmdc:mga07m45_185_c2 | nmdc:mga07m45_185_c2_19106_19615 | 160 |
| 363 | 3300050496 | nmdc:mga07m45_355643_c1 | nmdc:mga07m45_355643_c1_86_610 | 160 |
| 364 | 3300050513 | nmdc:mga0rr50_1249587_c1 | nmdc:mga0rr50_1249587_c1_54_539 | 160 |
| 365 | 3300053080 | Ga0500635_0000850 | Ga0500635_0000850_1069_1584 | 160 |
| 366 | 3300053086 | Ga0500578_0194768 | Ga0500578_0194768_631_1140 | 160 |
| 367 | 3300053093 | Ga0500651_0230849 | Ga0500651_0230849_329_838 | 160 |
| 368 | 3300053131 | Ga0500652_154133 | Ga0500652_154133_158_667 | 160 |
| 369 | 3300053136 | Ga0500559_0016822 | Ga0500559_0016822_2241_2756 | 160 |
| 370 | 3300053177 | Ga0500636_0155051 | Ga0500636_0155051_277_786 | 160 |
| 371 | 3300059505 | Ga0587083_0007641 | Ga0587083_0007641_1076_1585 | 160 |
| 372 | 3300061719 | Ga0466962_0002068 | Ga0466962_0002068_7392_7910 | 160 |
| 373 | 3300003759 | Ga0055525_1000011 | Ga0055525_1000011177 | 161 |
| 374 | 3300003792 | Ga0055540_1002976 | Ga0055540_10029765 | 161 |
| 375 | 3300003792 | Ga0055540_1003651 | Ga0055540_10036512 | 161 |
| 376 | 3300003794 | Ga0055531_10001799 | Ga0055531_100017999 | 161 |
| 377 | 3300005288 | Ga0065714_10165842 | Ga0065714_101658422 | 161 |
| 378 | 3300005327 | Ga0070658_10334877 | Ga0070658_103348771 | 161 |
| 379 | 3300005530 | Ga0070679_100216348 | Ga0070679_1002163482 | 161 |
| 380 | 3300006038 | Ga0075365_10111680 | Ga0075365_101116802 | 161 |
| 381 | 3300006038 | Ga0075365_10543533 | Ga0075365_105435332 | 161 |
| 382 | 3300006038 | Ga0075365_10568385 | Ga0075365_105683852 | 161 |
| 383 | 3300006051 | Ga0075364_10396410 | Ga0075364_103964102 | 161 |
| 384 | 3300006178 | Ga0075367_10362893 | Ga0075367_103628932 | 161 |
| 385 | 3300006195 | Ga0075366_10248222 | Ga0075366_102482222 | 161 |
| 386 | 3300013306 | Ga0163162_11141142 | Ga0163162_111411422 | 161 |
| 387 | 3300014326 | Ga0157380_11822584 | Ga0157380_118225842 | 161 |
| 388 | 3300017792 | Ga0163161_10251236 | Ga0163161_102512362 | 161 |
| 389 | 3300025230 | Ga0209563_100005 | Ga0209563_100005502 | 161 |
| 390 | 3300025284 | Ga0209130_1024873 | Ga0209130_10248732 | 161 |
| 391 | 3300025303 | Ga0209051_1000792 | Ga0209051_10007928 | 161 |
| 392 | 3300025304 | Ga0209257_1000396 | Ga0209257_100039613 | 161 |
| 393 | 3300025907 | Ga0207645_10448292 | Ga0207645_104482922 | 161 |
| 394 | 3300026121 | Ga0207683_10928040 | Ga0207683_109280402 | 161 |
| 395 | 3300028379 | Ga0268266_10371144 | Ga0268266_103711442 | 161 |
| 396 | 3300031456 | Ga0307513_10353524 | Ga0307513_103535242 | 161 |
| 397 | 3300031548 | Ga0307408_100543639 | Ga0307408_1005436392 | 161 |
| 398 | 3300031901 | Ga0307406_11074864 | Ga0307406_110748641 | 161 |
| 399 | 3300031911 | Ga0307412_10288994 | Ga0307412_102889942 | 161 |
| 400 | 3300032002 | Ga0307416_100769352 | Ga0307416_1007693522 | 161 |
| 401 | 3300039447 | Ga0436361_0349482 | Ga0436361_0349482_77187_77690 | 161 |
| 402 | 3300041406 | Ga0439439_0043331 | Ga0439439_0043331_325_864 | 161 |
| 403 | 3300041411 | Ga0439466_0196802 | Ga0439466_0196802_48_533 | 161 |
| 404 | 3300041451 | Ga0451791_0718593 | Ga0451791_0718593_293_829 | 161 |
| 405 | 3300041458 | Ga0451798_0727212 | Ga0451798_0727212_25_510 | 161 |
| 406 | 3300042015 | Ga0439462_0029579 | Ga0439462_0029579_645_1130 | 161 |
| 407 | 3300042125 | Ga0450923_012556 | Ga0450923_012556_156_695 | 161 |
| 408 | 3300042435 | Ga0439434_0030058 | Ga0439434_0030058_909_1394 | 161 |
| 409 | 3300042439 | Ga0439464_0027079 | Ga0439464_0027079_660_1145 | 161 |
| 410 | 3300044673 | Ga0453683_0007492 | Ga0453683_0007492_3224_3721 | 161 |
| 411 | 3300045976 | Ga0466967_0724658 | Ga0466967_0724658_365_859 | 161 |
| 412 | 3300046501 | Ga0495607_0238780 | Ga0495607_0238780_281_811 | 161 |
| 413 | 3300046684 | Ga0495669_0119414 | Ga0495669_0119414_292_789 | 161 |
| 414 | 3300047445 | Ga0495677_0142936 | Ga0495677_0142936_133_618 | 161 |
| 415 | 3300049581 | Ga0501047_0966694 | Ga0501047_0966694_58_543 | 161 |
| 416 | 3300049675 | Ga0501243_061676 | Ga0501243_061676_146_631 | 161 |
| 417 | 3300049686 | Ga0501257_067667 | Ga0501257_067667_325_867 | 161 |
| 418 | 3300049823 | Ga0501044_0620980 | Ga0501044_0620980_475_960 | 161 |
| 419 | 3300050492 | nmdc:mga0yw44_44978_c1 | nmdc:mga0yw44_44978_c1_1552_2037 | 161 |
| 420 | 3300050493 | nmdc:mga0k408_200838_c1 | nmdc:mga0k408_200838_c1_519_1007 | 161 |
| 421 | 3300050494 | nmdc:mga06z11_294382_c1 | nmdc:mga06z11_294382_c1_276_761 | 161 |
| 422 | 3300059477 | Ga0587084_000313 | Ga0587084_000313_933_1460 | 161 |
| 423 | 3300059643 | Ga0587072_030876 | Ga0587072_030876_315_842 | 161 |
| 424 | 3300059645 | Ga0587076_041344 | Ga0587076_041344_158_685 | 161 |
| 425 | 3300001989 | JGI24739J22299_10103394 | JGI24739J22299_101033942 | 162 |
| 426 | 3300002987 | JGI25159J45721_1006730 | JGI25159J45721_10067304 | 162 |
| 427 | 3300003187 | JGI25151J46595_10017803 | JGI25151J46595_100178033 | 162 |
| 428 | 3300003323 | rootH1_10075206 | rootH1_100752062 | 162 |
| 429 | 3300003760 | Ga0055527_1008701 | Ga0055527_10087012 | 162 |
| 430 | 3300003761 | Ga0055535_1000442 | Ga0055535_10004427 | 162 |
| 431 | 3300003761 | Ga0055535_1000863 | Ga0055535_10008638 | 162 |
| 432 | 3300003762 | Ga0055542_1000052 | Ga0055542_1000052145 | 162 |
| 433 | 3300003781 | Ga0055536_1025851 | Ga0055536_10258512 | 162 |
| 434 | 3300003781 | Ga0055536_1036860 | Ga0055536_10368602 | 162 |
| 435 | 3300003784 | Ga0055534_1008779 | Ga0055534_10087792 | 162 |
| 436 | 3300003791 | Ga0055530_10007775 | Ga0055530_100077753 | 162 |
| 437 | 3300003794 | Ga0055531_10022530 | Ga0055531_100225303 | 162 |
| 438 | 3300005288 | Ga0065714_10014061 | Ga0065714_100140612 | 162 |
| 439 | 3300005327 | Ga0070658_10122431 | Ga0070658_101224313 | 162 |
| 440 | 3300005327 | Ga0070658_10411192 | Ga0070658_104111922 | 162 |
| 441 | 3300005334 | Ga0068869_100447378 | Ga0068869_1004473782 | 162 |
| 442 | 3300005337 | Ga0070682_100641991 | Ga0070682_1006419912 | 162 |
| 443 | 3300005344 | Ga0070661_100656584 | Ga0070661_1006565842 | 162 |
| 444 | 3300005353 | Ga0070669_100491563 | Ga0070669_1004915632 | 162 |
| 445 | 3300005355 | Ga0070671_100614427 | Ga0070671_1006144272 | 162 |
| 446 | 3300005366 | Ga0070659_100998626 | Ga0070659_1009986261 | 162 |
| 447 | 3300005367 | Ga0070667_100499833 | Ga0070667_1004998332 | 162 |
| 448 | 3300005456 | Ga0070678_100101205 | Ga0070678_1001012052 | 162 |
| 449 | 3300005456 | Ga0070678_100179788 | Ga0070678_1001797882 | 162 |
| 450 | 3300005457 | Ga0070662_100083339 | Ga0070662_1000833392 | 162 |
| 451 | 3300005539 | Ga0068853_100345846 | Ga0068853_1003458462 | 162 |
| 452 | 3300005548 | Ga0070665_100172802 | Ga0070665_1001728022 | 162 |
| 453 | 3300005548 | Ga0070665_100214987 | Ga0070665_1002149872 | 162 |
| 454 | 3300005564 | Ga0070664_100014663 | Ga0070664_1000146633 | 162 |
| 455 | 3300005834 | Ga0068851_10026307 | Ga0068851_100263073 | 162 |
| 456 | 3300005844 | Ga0068862_101671402 | Ga0068862_1016714021 | 162 |
| 457 | 3300006042 | Ga0075368_10160909 | Ga0075368_101609092 | 162 |
| 458 | 3300006048 | Ga0075363_100148455 | Ga0075363_1001484552 | 162 |
| 459 | 3300006177 | Ga0075362_10330189 | Ga0075362_103301892 | 162 |
| 460 | 3300006195 | Ga0075366_10185080 | Ga0075366_101850802 | 162 |
| 461 | 3300006237 | Ga0097621_100308339 | Ga0097621_1003083392 | 162 |
| 462 | 3300006353 | Ga0075370_10013218 | Ga0075370_100132184 | 162 |
| 463 | 3300006353 | Ga0075370_10074826 | Ga0075370_100748262 | 162 |
| 464 | 3300006353 | Ga0075370_10089857 | Ga0075370_100898572 | 162 |
| 465 | 3300006358 | Ga0068871_100114546 | Ga0068871_1001145463 | 162 |
| 466 | 3300009098 | Ga0105245_10947068 | Ga0105245_109470682 | 162 |
| 467 | 3300009148 | Ga0105243_10196633 | Ga0105243_101966333 | 162 |
| 468 | 3300009148 | Ga0105243_10591726 | Ga0105243_105917262 | 162 |
| 469 | 3300009176 | Ga0105242_11700010 | Ga0105242_117000101 | 162 |
| 470 | 3300009177 | Ga0105248_11234180 | Ga0105248_112341802 | 162 |
| 471 | 3300009551 | Ga0105238_10276401 | Ga0105238_102764012 | 162 |
| 472 | 3300009551 | Ga0105238_10669857 | Ga0105238_106698571 | 162 |
| 473 | 3300011119 | Ga0105246_10059447 | Ga0105246_100594472 | 162 |
| 474 | 3300013104 | Ga0157370_10108200 | Ga0157370_101082004 | 162 |
| 475 | 3300013104 | Ga0157370_10547057 | Ga0157370_105470572 | 162 |
| 476 | 3300013307 | Ga0157372_10374353 | Ga0157372_103743532 | 162 |
| 477 | 3300014497 | Ga0182008_10011458 | Ga0182008_100114582 | 162 |
| 478 | 3300014497 | Ga0182008_10088039 | Ga0182008_100880392 | 162 |
| 479 | 3300014497 | Ga0182008_10088370 | Ga0182008_100883702 | 162 |
| 480 | 3300015261 | Ga0182006_1029973 | Ga0182006_10299732 | 162 |
| 481 | 3300015261 | Ga0182006_1079259 | Ga0182006_10792592 | 162 |
| 482 | 3300015262 | Ga0182007_10009741 | Ga0182007_100097412 | 162 |
| 483 | 3300015265 | Ga0182005_1042568 | Ga0182005_10425682 | 162 |
| 484 | 3300015683 | Ga0183362_10003 | Ga0183362_10003197 | 162 |
| 485 | 3300017792 | Ga0163161_10350775 | Ga0163161_103507752 | 162 |
| 486 | 3300021361 | Ga0213872_10012343 | Ga0213872_100123433 | 162 |
| 487 | 3300025228 | Ga0209672_100633 | Ga0209672_10063313 | 162 |
| 488 | 3300025229 | Ga0209147_101695 | Ga0209147_1016952 | 162 |
| 489 | 3300025242 | Ga0209258_100009 | Ga0209258_10000920 | 162 |
| 490 | 3300025254 | Ga0209148_1000007 | Ga0209148_100000720 | 162 |
| 491 | 3300025284 | Ga0209130_1008941 | Ga0209130_10089411 | 162 |
| 492 | 3300025291 | Ga0209675_1002121 | Ga0209675_10021219 | 162 |
| 493 | 3300025292 | Ga0209676_1002834 | Ga0209676_10028343 | 162 |
| 494 | 3300025292 | Ga0209676_1014584 | Ga0209676_10145842 | 162 |
| 495 | 3300025294 | Ga0209025_1000133 | Ga0209025_1000133187 | 162 |
| 496 | 3300025294 | Ga0209025_1001691 | Ga0209025_100169122 | 162 |
| 497 | 3300025298 | Ga0209050_1003126 | Ga0209050_100312610 | 162 |
| 498 | 3300025298 | Ga0209050_1054110 | Ga0209050_10541102 | 162 |
| 499 | 3300025303 | Ga0209051_1001732 | Ga0209051_10017329 | 162 |
| 500 | 3300025303 | Ga0209051_1003624 | Ga0209051_10036248 | 162 |
| 501 | 3300025303 | Ga0209051_1024877 | Ga0209051_10248772 | 162 |
| 502 | 3300025304 | Ga0209257_1000361 | Ga0209257_100036170 | 162 |
| 503 | 3300025304 | Ga0209257_1020159 | Ga0209257_10201592 | 162 |
| 504 | 3300025728 | Ga0207655_1001053 | Ga0207655_10010533 | 162 |
| 505 | 3300025903 | Ga0207680_10071484 | Ga0207680_100714842 | 162 |
| 506 | 3300025904 | Ga0207647_10307818 | Ga0207647_103078182 | 162 |
| 507 | 3300025909 | Ga0207705_10073695 | Ga0207705_100736952 | 162 |
| 508 | 3300025922 | Ga0207646_10106246 | Ga0207646_101062461 | 162 |
| 509 | 3300025923 | Ga0207681_10474105 | Ga0207681_104741052 | 162 |
| 510 | 3300025932 | Ga0207690_10413488 | Ga0207690_104134882 | 162 |
| 511 | 3300025933 | Ga0207706_10551472 | Ga0207706_105514722 | 162 |
| 512 | 3300025934 | Ga0207686_10153924 | Ga0207686_101539242 | 162 |
| 513 | 3300025935 | Ga0207709_10001284 | Ga0207709_100012842 | 162 |
| 514 | 3300025935 | Ga0207709_10059162 | Ga0207709_100591622 | 162 |
| 515 | 3300025937 | Ga0207669_10053330 | Ga0207669_100533302 | 162 |
| 516 | 3300025942 | Ga0207689_10407218 | Ga0207689_104072182 | 162 |
| 517 | 3300025972 | Ga0207668_10437509 | Ga0207668_104375091 | 162 |
| 518 | 3300025986 | Ga0207658_10258800 | Ga0207658_102588002 | 162 |
| 519 | 3300026035 | Ga0207703_10672871 | Ga0207703_106728712 | 162 |
| 520 | 3300026089 | Ga0207648_10838308 | Ga0207648_108383082 | 162 |
| 521 | 3300026121 | Ga0207683_10054906 | Ga0207683_100549062 | 162 |
| 522 | 3300026121 | Ga0207683_10480400 | Ga0207683_104804002 | 162 |
| 523 | 3300026121 | Ga0207683_10950920 | Ga0207683_109509202 | 162 |
| 524 | 3300028380 | Ga0268265_10541893 | Ga0268265_105418932 | 162 |
| 525 | 3300028794 | Ga0307515_10000195 | Ga0307515_1000019599 | 162 |
| 526 | 3300028794 | Ga0307515_10162677 | Ga0307515_101626772 | 162 |
| 527 | 3300031238 | Ga0265332_10000014 | Ga0265332_1000001491 | 162 |
| 528 | 3300031251 | Ga0265327_10000425 | Ga0265327_100004259 | 162 |
| 529 | 3300031251 | Ga0265327_10053432 | Ga0265327_100534322 | 162 |
| 530 | 3300031251 | Ga0265327_10289466 | Ga0265327_102894662 | 162 |
| 531 | 3300031456 | Ga0307513_10000004 | Ga0307513_10000004398 | 162 |
| 532 | 3300031456 | Ga0307513_10160220 | Ga0307513_101602202 | 162 |
| 533 | 3300031548 | Ga0307408_100023297 | Ga0307408_1000232973 | 162 |
| 534 | 3300031548 | Ga0307408_100373619 | Ga0307408_1003736192 | 162 |
| 535 | 3300031731 | Ga0307405_10296381 | Ga0307405_102963812 | 162 |
| 536 | 3300031901 | Ga0307406_10737544 | Ga0307406_107375442 | 162 |
| 537 | 3300031911 | Ga0307412_10504921 | Ga0307412_105049212 | 162 |
| 538 | 3300031911 | Ga0307412_10589239 | Ga0307412_105892392 | 162 |
| 539 | 3300031911 | Ga0307412_11000778 | Ga0307412_110007781 | 162 |
| 540 | 3300032002 | Ga0307416_100192452 | Ga0307416_1001924522 | 162 |
| 541 | 3300032005 | Ga0307411_10160720 | Ga0307411_101607202 | 162 |
| 542 | 3300035119 | Ga0373956_0310803 | Ga0373956_0310803_206_700 | 162 |
| 543 | 3300037312 | Ga0395899_0001965 | Ga0395899_0001965_1194_1685 | 162 |
| 544 | 3300037312 | Ga0395899_0067138 | Ga0395899_0067138_779_1270 | 162 |
| 545 | 3300037418 | Ga0395900_0051271 | Ga0395900_0051271_160_651 | 162 |
| 546 | 3300037418 | Ga0395900_0843447 | Ga0395900_0843447_48_536 | 162 |
| 547 | 3300037418 | Ga0395900_0969594 | Ga0395900_0969594_172_663 | 162 |
| 548 | 3300037466 | Ga0395898_0015164 | Ga0395898_0015164_1124_1615 | 162 |
| 549 | 3300037471 | Ga0395905_0008037 | Ga0395905_0008037_3774_4265 | 162 |
| 550 | 3300037471 | Ga0395905_0013989 | Ga0395905_0013989_3988_4476 | 162 |
| 551 | 3300037471 | Ga0395905_0057085 | Ga0395905_0057085_2872_3369 | 162 |
| 552 | 3300037471 | Ga0395905_0113321 | Ga0395905_0113321_1477_1968 | 162 |
| 553 | 3300038443 | Ga0395901_0029516 | Ga0395901_0029516_172_663 | 162 |
| 554 | 3300038443 | Ga0395901_0861666 | Ga0395901_0861666_324_812 | 162 |
| 555 | 3300039447 | Ga0436361_0240598 | Ga0436361_0240598_1786_2274 | 162 |
| 556 | 3300041404 | Ga0439436_0017321 | Ga0439436_0017321_1338_1868 | 162 |
| 557 | 3300041404 | Ga0439436_0036469 | Ga0439436_0036469_700_1224 | 162 |
| 558 | 3300041404 | Ga0439436_0084864 | Ga0439436_0084864_239_727 | 162 |
| 559 | 3300041405 | Ga0439438_033184 | Ga0439438_033184_366_896 | 162 |
| 560 | 3300041406 | Ga0439439_0057069 | Ga0439439_0057069_214_738 | 162 |
| 561 | 3300041410 | Ga0439461_0003310 | Ga0439461_0003310_613_1143 | 162 |
| 562 | 3300041411 | Ga0439466_0043460 | Ga0439466_0043460_247_777 | 162 |
| 563 | 3300041413 | Ga0439465_0012268 | Ga0439465_0012268_1410_1934 | 162 |
| 564 | 3300041413 | Ga0439465_0063356 | Ga0439465_0063356_191_721 | 162 |
| 565 | 3300041498 | Ga0451841_0612739 | Ga0451841_0612739_60_602 | 162 |
| 566 | 3300041997 | Ga0439431_0018496 | Ga0439431_0018496_377_901 | 162 |
| 567 | 3300041999 | Ga0439433_0006502 | Ga0439433_0006502_1515_2039 | 162 |
| 568 | 3300041999 | Ga0439433_0038722 | Ga0439433_0038722_146_676 | 162 |
| 569 | 3300042002 | Ga0439442_010969 | Ga0439442_010969_658_1182 | 162 |
| 570 | 3300042002 | Ga0439442_036909 | Ga0439442_036909_297_827 | 162 |
| 571 | 3300042004 | Ga0439445_0006877 | Ga0439445_0006877_485_1021 | 162 |
| 572 | 3300042006 | Ga0439432_000644 | Ga0439432_000644_12252_12776 | 162 |
| 573 | 3300042006 | Ga0439432_008235 | Ga0439432_008235_1613_2143 | 162 |
| 574 | 3300042007 | Ga0439449_0000752 | Ga0439449_0000752_1487_2011 | 162 |
| 575 | 3300042007 | Ga0439449_0022143 | Ga0439449_0022143_1519_2049 | 162 |
| 576 | 3300042007 | Ga0439449_0027467 | Ga0439449_0027467_60_584 | 162 |
| 577 | 3300042007 | Ga0439449_0050000 | Ga0439449_0050000_681_1169 | 162 |
| 578 | 3300042010 | Ga0439452_007471 | Ga0439452_007471_2371_2895 | 162 |
| 579 | 3300042014 | Ga0439457_029307 | Ga0439457_029307_462_992 | 162 |
| 580 | 3300042128 | Ga0450897_000516 | Ga0450897_000516_510_1040 | 162 |
| 581 | 3300042131 | Ga0450894_004749 | Ga0450894_004749_441_971 | 162 |
| 582 | 3300042133 | Ga0450896_002895 | Ga0450896_002895_130_660 | 162 |
| 583 | 3300042135 | Ga0450899_010789 | Ga0450899_010789_197_727 | 162 |
| 584 | 3300042145 | Ga0450906_026602 | Ga0450906_026602_236_766 | 162 |
| 585 | 3300042156 | Ga0439446_0034759 | Ga0439446_0034759_258_782 | 162 |
| 586 | 3300042184 | Ga0450908_021205 | Ga0450908_021205_467_997 | 162 |
| 587 | 3300042531 | Ga0450918_041571 | Ga0450918_041571_41_571 | 162 |
| 588 | 3300042876 | Ga0451577_0005231 | Ga0451577_0005231_12691_13182 | 162 |
| 589 | 3300042876 | Ga0451577_0916257 | Ga0451577_0916257_190_678 | 162 |
| 590 | 3300044683 | Ga0466965_0088341 | Ga0466965_0088341_216_746 | 162 |
| 591 | 3300044712 | Ga0453684_0175174 | Ga0453684_0175174_19_507 | 162 |
| 592 | 3300044712 | Ga0453684_0258814 | Ga0453684_0258814_1339_1830 | 162 |
| 593 | 3300045051 | Ga0451576_0011443 | Ga0451576_0011443_7983_8474 | 162 |
| 594 | 3300045051 | Ga0451576_0142539 | Ga0451576_0142539_1670_2194 | 162 |
| 595 | 3300046453 | Ga0495627_022181 | Ga0495627_022181_860_1402 | 162 |
| 596 | 3300046459 | Ga0495629_0425965 | Ga0495629_0425965_141_689 | 162 |
| 597 | 3300046460 | Ga0495638_0104703 | Ga0495638_0104703_571_1110 | 162 |
| 598 | 3300046462 | Ga0495651_0207609 | Ga0495651_0207609_550_1083 | 162 |
| 599 | 3300046463 | Ga0495653_0238043 | Ga0495653_0238043_444_977 | 162 |
| 600 | 3300046471 | Ga0495650_0292295 | Ga0495650_0292295_32_529 | 162 |
| 601 | 3300046512 | Ga0495610_0034618 | Ga0495610_0034618_1546_2085 | 162 |
| 602 | 3300046513 | Ga0495616_0067004 | Ga0495616_0067004_522_1061 | 162 |
| 603 | 3300046514 | Ga0495618_0094409 | Ga0495618_0094409_597_1130 | 162 |
| 604 | 3300046515 | Ga0495620_0008493 | Ga0495620_0008493_439_981 | 162 |
| 605 | 3300046518 | Ga0495631_0066034 | Ga0495631_0066034_591_1130 | 162 |
| 606 | 3300046520 | Ga0495637_0057927 | Ga0495637_0057927_468_1013 | 162 |
| 607 | 3300046522 | Ga0495643_0121676 | Ga0495643_0121676_120_659 | 162 |
| 608 | 3300046538 | Ga0495609_0054040 | Ga0495609_0054040_870_1415 | 162 |
| 609 | 3300046557 | Ga0495622_0097092 | Ga0495622_0097092_83_631 | 162 |
| 610 | 3300046558 | Ga0495633_0145159 | Ga0495633_0145159_42_587 | 162 |
| 611 | 3300046559 | Ga0495667_0218832 | Ga0495667_0218832_279_812 | 162 |
| 612 | 3300046660 | Ga0495625_0210708 | Ga0495625_0210708_286_825 | 162 |
| 613 | 3300046663 | Ga0495635_0473731 | Ga0495635_0473731_117_650 | 162 |
| 614 | 3300046674 | Ga0495588_0099138 | Ga0495588_0099138_179_712 | 162 |
| 615 | 3300046674 | Ga0495588_0127654 | Ga0495588_0127654_474_1016 | 162 |
| 616 | 3300046675 | Ga0495657_0268371 | Ga0495657_0268371_360_893 | 162 |
| 617 | 3300046680 | Ga0495646_0241794 | Ga0495646_0241794_297_830 | 162 |
| 618 | 3300046683 | Ga0495658_0244956 | Ga0495658_0244956_276_824 | 162 |
| 619 | 3300046683 | Ga0495658_0322712 | Ga0495658_0322712_297_830 | 162 |
| 620 | 3300046689 | Ga0495613_0237913 | Ga0495613_0237913_492_1025 | 162 |
| 621 | 3300046691 | Ga0495670_0149527 | Ga0495670_0149527_267_806 | 162 |
| 622 | 3300047321 | Ga0495676_0002146 | Ga0495676_0002146_715_1263 | 162 |
| 623 | 3300047322 | Ga0495680_0130852 | Ga0495680_0130852_953_1486 | 162 |
| 624 | 3300047472 | Ga0495686_0349667 | Ga0495686_0349667_41_580 | 162 |
| 625 | 3300047673 | Ga0495593_0015848 | Ga0495593_0015848_2549_3097 | 162 |
| 626 | 3300048088 | Ga0495602_0340931 | Ga0495602_0340931_403_951 | 162 |
| 627 | 3300048088 | Ga0495602_0342412 | Ga0495602_0342412_103_636 | 162 |
| 628 | 3300048903 | Ga0496100_0082603 | Ga0496100_0082603_434_967 | 162 |
| 629 | 3300048904 | Ga0496101_0110727 | Ga0496101_0110727_877_1410 | 162 |
| 630 | 3300048908 | Ga0496105_0048520 | Ga0496105_0048520_1077_1610 | 162 |
| 631 | 3300048909 | Ga0496106_0158058 | Ga0496106_0158058_618_1151 | 162 |
| 632 | 3300048910 | Ga0496107_0349904 | Ga0496107_0349904_431_970 | 162 |
| 633 | 3300048910 | Ga0496107_0361318 | Ga0496107_0361318_70_603 | 162 |
| 634 | 3300048911 | Ga0496108_0410090 | Ga0496108_0410090_132_665 | 162 |
| 635 | 3300048912 | Ga0496109_0195299 | Ga0496109_0195299_141_674 | 162 |
| 636 | 3300048913 | Ga0496110_0087171 | Ga0496110_0087171_375_908 | 162 |
| 637 | 3300048913 | Ga0496110_0494402 | Ga0496110_0494402_155_649 | 162 |
| 638 | 3300048914 | Ga0496111_0116400 | Ga0496111_0116400_1075_1608 | 162 |
| 639 | 3300048916 | Ga0496113_0573842 | Ga0496113_0573842_148_681 | 162 |
| 640 | 3300048917 | Ga0496114_0085708 | Ga0496114_0085708_996_1529 | 162 |
| 641 | 3300048917 | Ga0496114_0247328 | Ga0496114_0247328_529_1059 | 162 |
| 642 | 3300048919 | Ga0496116_0015563 | Ga0496116_0015563_974_1468 | 162 |
| 643 | 3300048920 | Ga0496117_0079964 | Ga0496117_0079964_202_696 | 162 |
| 644 | 3300048920 | Ga0496117_0223087 | Ga0496117_0223087_340_843 | 162 |
| 645 | 3300048921 | Ga0496118_0024461 | Ga0496118_0024461_4561_5064 | 162 |
| 646 | 3300048921 | Ga0496118_0325610 | Ga0496118_0325610_60_602 | 162 |
| 647 | 3300048924 | Ga0496121_0219386 | Ga0496121_0219386_346_885 | 162 |
| 648 | 3300048928 | Ga0496125_0042149 | Ga0496125_0042149_432_935 | 162 |
| 649 | 3300050489 | nmdc:mga03683_76352_c1 | nmdc:mga03683_76352_c1_422_952 | 162 |
| 650 | 3300050493 | nmdc:mga0k408_199361_c1 | nmdc:mga0k408_199361_c1_288_818 | 162 |
| 651 | 3300050493 | nmdc:mga0k408_302276_c1 | nmdc:mga0k408_302276_c1_51_578 | 162 |
| 652 | 3300050496 | nmdc:mga07m45_126177_c1 | nmdc:mga07m45_126177_c1_324_869 | 162 |
| 653 | 3300050496 | nmdc:mga07m45_65471_c1 | nmdc:mga07m45_65471_c1_955_1482 | 162 |
| 654 | 3300050496 | nmdc:mga07m45_95341_c1 | nmdc:mga07m45_95341_c1_1040_1534 | 162 |
| 655 | 3300053079 | Ga0500610_0014525 | Ga0500610_0014525_1943_2485 | 162 |
| 656 | 3300053079 | Ga0500610_0069226 | Ga0500610_0069226_1213_1752 | 162 |
| 657 | 3300053087 | Ga0500643_039096 | Ga0500643_039096_485_1033 | 162 |
| 658 | 3300053093 | Ga0500651_0000637 | Ga0500651_0000637_16322_16870 | 162 |
| 659 | 3300053094 | Ga0500566_0007532 | Ga0500566_0007532_258_806 | 162 |
| 660 | 3300053108 | Ga0500562_060988 | Ga0500562_060988_92_631 | 162 |
| 661 | 3300053110 | Ga0500571_003025 | Ga0500571_003025_701_1249 | 162 |
| 662 | 3300053117 | Ga0500593_001539 | Ga0500593_001539_5721_6263 | 162 |
| 663 | 3300053118 | Ga0500594_0003737 | Ga0500594_0003737_2209_2748 | 162 |
| 664 | 3300053121 | Ga0500607_031799 | Ga0500607_031799_360_902 | 162 |
| 665 | 3300053122 | Ga0500608_067319 | Ga0500608_067319_490_1041 | 162 |
| 666 | 3300053133 | Ga0500655_019199 | Ga0500655_019199_498_1046 | 162 |
| 667 | 3300053134 | Ga0500658_0003701 | Ga0500658_0003701_2155_2694 | 162 |
| 668 | 3300053134 | Ga0500658_0007934 | Ga0500658_0007934_2105_2644 | 162 |
| 669 | 3300053136 | Ga0500559_0086415 | Ga0500559_0086415_639_1178 | 162 |
| 670 | 3300053139 | Ga0500568_0002017 | Ga0500568_0002017_7589_8128 | 162 |
| 671 | 3300053141 | Ga0500574_001946 | Ga0500574_001946_357_905 | 162 |
| 672 | 3300053142 | Ga0500577_0129108 | Ga0500577_0129108_375_872 | 162 |
| 673 | 3300053158 | Ga0500627_0015591 | Ga0500627_0015591_702_1244 | 162 |
| 674 | 3300053162 | Ga0500638_113832 | Ga0500638_113832_574_1122 | 162 |
| 675 | 3300053177 | Ga0500636_0187416 | Ga0500636_0187416_279_827 | 162 |
| 676 | 3300053730 | Ga0500645_007710 | Ga0500645_007710_2786_3286 | 162 |
| 677 | 3300059643 | Ga0587072_002999 | Ga0587072_002999_163_705 | 162 |
| 678 | iso_pu_bacteria | 2513020051 | 2513231355 | 162 |
| 679 | iso_pu_bacteria | 2643221672 | 2644400218 | 162 |
| 680 | iso_pu_bacteria | 2643221683 | 2644467606 | 162 |
| 681 | iso_pu_bacteria | 2738543013 | 2739252302 | 162 |
| 682 | iso_pu_bacteria | 2818991446 | 2819602281 | 162 |
| 683 | iso_pu_bacteria | 2885192300 | 2885196103 | 162 |
| 684 | iso_pu_bacteria | 2899924645 | 2899930560 | 162 |
| 685 | iso_pu_bacteria | 2904449895 | 2904456350 | 162 |
| 686 | iso_pu_bacteria | 2904456579 | 2904462859 | 162 |
| 687 | iso_pu_bacteria | 2904541872 | 2904546914 | 162 |
| 688 | iso_pu_bacteria | 2928037797 | 2928039674 | 162 |
| 689 | iso_pu_bacteria | 2928044640 | 2928044721 | 162 |
| 690 | iso_pu_bacteria | 2928051484 | 2928052521 | 162 |
| 691 | iso_pu_bacteria | 2928064002 | 2928064816 | 162 |
| 692 | iso_pu_bacteria | 2928084124 | 2928087148 | 162 |
| 693 | iso_pu_bacteria | 2929160207 | 2929164386 | 162 |
| 694 | iso_pu_bacteria | 2929520902 | 2929524390 | 162 |
| 695 | iso_pu_bacteria | 2945909444 | 2945910915 | 162 |
| 696 | iso_pu_bacteria | 2945945610 | 2945946776 | 162 |
| 697 | iso_pu_bacteria | 2945984333 | 2945986847 | 162 |
| 698 | 2162886007 | SwRhRL2b_contig_556956 | SwRhRL2b_0329.00008620 | 163 |
| 699 | 2162886007 | SwRhRL2b_contig_612720 | SwRhRL2b_0890.00003520 | 163 |
| 700 | 3300002704 | JGI25155J39150_1000051 | JGI25155J39150_100005159 | 163 |
| 701 | 3300002705 | JGI25156J39149_1000196 | JGI25156J39149_100019623 | 163 |
| 702 | 3300002738 | JGI25154J39366_1000344 | JGI25154J39366_100034423 | 163 |
| 703 | 3300002741 | JGI25157J39369_1000091 | JGI25157J39369_100009159 | 163 |
| 704 | 3300002774 | JGI25150J39212_1003713 | JGI25150J39212_10037132 | 163 |
| 705 | 3300002987 | JGI25159J45721_1011402 | JGI25159J45721_10114022 | 163 |
| 706 | 3300002987 | JGI25159J45721_1011673 | JGI25159J45721_10116732 | 163 |
| 707 | 3300003187 | JGI25151J46595_10007945 | JGI25151J46595_100079453 | 163 |
| 708 | 3300003187 | JGI25151J46595_10029389 | JGI25151J46595_100293893 | 163 |
| 709 | 3300003187 | JGI25151J46595_10050766 | JGI25151J46595_100507662 | 163 |
| 710 | 3300003316 | rootH1_10052921 | rootH1_100529213 | 163 |
| 711 | 3300003322 | rootL2_10007894 | rootL2_100078942 | 163 |
| 712 | 3300003323 | rootH1_10045102 | rootH1_100451022 | 163 |
| 713 | 3300003354 | JGI25160J50197_1000067 | JGI25160J50197_10000672 | 163 |
| 714 | 3300003374 | JGI25161J50226_1000035 | JGI25161J50226_100003523 | 163 |
| 715 | 3300003771 | Ga0055526_1004349 | Ga0055526_10043495 | 163 |
| 716 | 3300003771 | Ga0055526_1008880 | Ga0055526_10088802 | 163 |
| 717 | 3300003771 | Ga0055526_1065313 | Ga0055526_10653131 | 163 |
| 718 | 3300003773 | Ga0055537_1001588 | Ga0055537_10015885 | 163 |
| 719 | 3300003775 | Ga0055524_1000006 | Ga0055524_10000064 | 163 |
| 720 | 3300003775 | Ga0055524_1003866 | Ga0055524_10038666 | 163 |
| 721 | 3300003775 | Ga0055524_1008425 | Ga0055524_10084253 | 163 |
| 722 | 3300003781 | Ga0055536_1004362 | Ga0055536_10043622 | 163 |
| 723 | 3300003784 | Ga0055534_1001777 | Ga0055534_10017775 | 163 |
| 724 | 3300003790 | Ga0055528_1001140 | Ga0055528_10011408 | 163 |
| 725 | 3300003791 | Ga0055530_10004417 | Ga0055530_1000441710 | 163 |
| 726 | 3300003792 | Ga0055540_1000005 | Ga0055540_1000005308 | 163 |
| 727 | 3300003794 | Ga0055531_10001665 | Ga0055531_1000166513 | 163 |
| 728 | 3300004625 | Ga0055543_1000829 | Ga0055543_10008294 | 163 |
| 729 | 3300004625 | Ga0055543_1011894 | Ga0055543_10118941 | 163 |
| 730 | 3300005262 | Ga0065165_1000652 | Ga0065165_10006528 | 163 |
| 731 | 3300005262 | Ga0065165_1041154 | Ga0065165_10411542 | 163 |
| 732 | 3300005262 | Ga0065165_1043890 | Ga0065165_10438901 | 163 |
| 733 | 3300005262 | Ga0065165_1115931 | Ga0065165_11159311 | 163 |
| 734 | 3300005289 | Ga0065704_10070938 | Ga0065704_100709389 | 163 |
| 735 | 3300005289 | Ga0065704_10133441 | Ga0065704_101334412 | 163 |
| 736 | 3300005327 | Ga0070658_10853035 | Ga0070658_108530352 | 163 |
| 737 | 3300005334 | Ga0068869_100617051 | Ga0068869_1006170511 | 163 |
| 738 | 3300005338 | Ga0068868_100095204 | Ga0068868_1000952042 | 163 |
| 739 | 3300005353 | Ga0070669_100971547 | Ga0070669_1009715471 | 163 |
| 740 | 3300005356 | Ga0070674_100776006 | Ga0070674_1007760061 | 163 |
| 741 | 3300005356 | Ga0070674_101093710 | Ga0070674_1010937101 | 163 |
| 742 | 3300005441 | Ga0070700_100772228 | Ga0070700_1007722282 | 163 |
| 743 | 3300005456 | Ga0070678_100691882 | Ga0070678_1006918822 | 163 |
| 744 | 3300005539 | Ga0068853_100106808 | Ga0068853_1001068082 | 163 |
| 745 | 3300005563 | Ga0068855_100139617 | Ga0068855_1001396172 | 163 |
| 746 | 3300005614 | Ga0068856_101091037 | Ga0068856_1010910372 | 163 |
| 747 | 3300005616 | Ga0068852_101024674 | Ga0068852_1010246742 | 163 |
| 748 | 3300005843 | Ga0068860_101593280 | Ga0068860_1015932801 | 163 |
| 749 | 3300006038 | Ga0075365_10034436 | Ga0075365_100344362 | 163 |
| 750 | 3300006048 | Ga0075363_100119843 | Ga0075363_1001198432 | 163 |
| 751 | 3300006177 | Ga0075362_10228974 | Ga0075362_102289742 | 163 |
| 752 | 3300006195 | Ga0075366_10000944 | Ga0075366_1000094412 | 163 |
| 753 | 3300006195 | Ga0075366_10004207 | Ga0075366_100042072 | 163 |
| 754 | 3300006195 | Ga0075366_10051827 | Ga0075366_100518272 | 163 |
| 755 | 3300006237 | Ga0097621_100798068 | Ga0097621_1007980681 | 163 |
| 756 | 3300006353 | Ga0075370_10015686 | Ga0075370_100156862 | 163 |
| 757 | 3300006353 | Ga0075370_10244587 | Ga0075370_102445872 | 163 |
| 758 | 3300006353 | Ga0075370_10681556 | Ga0075370_106815561 | 163 |
| 759 | 3300006847 | Ga0075431_100599986 | Ga0075431_1005999862 | 163 |
| 760 | 3300006944 | Ga0099823_1002850 | Ga0099823_100285010 | 163 |
| 761 | 3300006946 | Ga0079104_1000002 | Ga0079104_1000002237 | 163 |
| 762 | 3300009092 | Ga0105250_10000636 | Ga0105250_100006362 | 163 |
| 763 | 3300009098 | Ga0105245_10109483 | Ga0105245_101094832 | 163 |
| 764 | 3300009148 | Ga0105243_10001518 | Ga0105243_100015189 | 163 |
| 765 | 3300009545 | Ga0105237_10097733 | Ga0105237_100977332 | 163 |
| 766 | 3300012497 | Ga0157319_1000006 | Ga0157319_100000650 | 163 |
| 767 | 3300012513 | Ga0157326_1001580 | Ga0157326_10015802 | 163 |
| 768 | 3300013100 | Ga0157373_10321126 | Ga0157373_103211262 | 163 |
| 769 | 3300013104 | Ga0157370_10484449 | Ga0157370_104844492 | 163 |
| 770 | 3300013105 | Ga0157369_10461227 | Ga0157369_104612272 | 163 |
| 771 | 3300013308 | Ga0157375_10926408 | Ga0157375_109264082 | 163 |
| 772 | 3300013308 | Ga0157375_11901375 | Ga0157375_119013752 | 163 |
| 773 | 3300014497 | Ga0182008_10006435 | Ga0182008_100064352 | 163 |
| 774 | 3300014497 | Ga0182008_10545867 | Ga0182008_105458671 | 163 |
| 775 | 3300014969 | Ga0157376_10027129 | Ga0157376_100271296 | 163 |
| 776 | 3300014969 | Ga0157376_10540140 | Ga0157376_105401402 | 163 |
| 777 | 3300025206 | Ga0209435_100062 | Ga0209435_10006223 | 163 |
| 778 | 3300025245 | Ga0207425_1001373 | Ga0207425_100137311 | 163 |
| 779 | 3300025245 | Ga0207425_1013370 | Ga0207425_10133702 | 163 |
| 780 | 3300025246 | Ga0209646_1000001 | Ga0209646_1000001312 | 163 |
| 781 | 3300025250 | Ga0209026_1000224 | Ga0209026_100022423 | 163 |
| 782 | 3300025256 | Ga0209759_1000013 | Ga0209759_1000013312 | 163 |
| 783 | 3300025258 | Ga0209129_1018123 | Ga0209129_10181232 | 163 |
| 784 | 3300025263 | Ga0209565_1001861 | Ga0209565_10018615 | 163 |
| 785 | 3300025273 | Ga0209673_1000043 | Ga0209673_100004395 | 163 |
| 786 | 3300025273 | Ga0209673_1022593 | Ga0209673_10225933 | 163 |
| 787 | 3300025284 | Ga0209130_1000241 | Ga0209130_10002412 | 163 |
| 788 | 3300025291 | Ga0209675_1006965 | Ga0209675_10069655 | 163 |
| 789 | 3300025291 | Ga0209675_1035958 | Ga0209675_10359582 | 163 |
| 790 | 3300025292 | Ga0209676_1000007 | Ga0209676_1000007391 | 163 |
| 791 | 3300025292 | Ga0209676_1010599 | Ga0209676_10105992 | 163 |
| 792 | 3300025294 | Ga0209025_1003025 | Ga0209025_10030252 | 163 |
| 793 | 3300025294 | Ga0209025_1032356 | Ga0209025_10323562 | 163 |
| 794 | 3300025294 | Ga0209025_1046308 | Ga0209025_10463082 | 163 |
| 795 | 3300025295 | Ga0209564_1000003 | Ga0209564_10000031270 | 163 |
| 796 | 3300025295 | Ga0209564_1000285 | Ga0209564_100028566 | 163 |
| 797 | 3300025295 | Ga0209564_1000877 | Ga0209564_10008775 | 163 |
| 798 | 3300025295 | Ga0209564_1011461 | Ga0209564_10114616 | 163 |
| 799 | 3300025297 | Ga0209758_1034699 | Ga0209758_10346992 | 163 |
| 800 | 3300025298 | Ga0209050_1000003 | Ga0209050_10000031117 | 163 |
| 801 | 3300025298 | Ga0209050_1012163 | Ga0209050_10121633 | 163 |
| 802 | 3300025298 | Ga0209050_1024990 | Ga0209050_10249902 | 163 |
| 803 | 3300025299 | Ga0209256_1000001 | Ga0209256_10000011124 | 163 |
| 804 | 3300025299 | Ga0209256_1005250 | Ga0209256_10052504 | 163 |
| 805 | 3300025299 | Ga0209256_1023182 | Ga0209256_10231822 | 163 |
| 806 | 3300025302 | Ga0207426_1000097 | Ga0207426_1000097271 | 163 |
| 807 | 3300025302 | Ga0207426_1000247 | Ga0207426_1000247116 | 163 |
| 808 | 3300025303 | Ga0209051_1000003 | Ga0209051_10000031117 | 163 |
| 809 | 3300025303 | Ga0209051_1003281 | Ga0209051_100328112 | 163 |
| 810 | 3300025303 | Ga0209051_1098509 | Ga0209051_10985091 | 163 |
| 811 | 3300025304 | Ga0209257_1000020 | Ga0209257_1000020391 | 163 |
| 812 | 3300025304 | Ga0209257_1002969 | Ga0209257_10029698 | 163 |
| 813 | 3300025304 | Ga0209257_1061327 | Ga0209257_10613272 | 163 |
| 814 | 3300025711 | Ga0207696_1006799 | Ga0207696_10067998 | 163 |
| 815 | 3300025909 | Ga0207705_10604773 | Ga0207705_106047731 | 163 |
| 816 | 3300025914 | Ga0207671_10116538 | Ga0207671_101165383 | 163 |
| 817 | 3300025923 | Ga0207681_10136776 | Ga0207681_101367762 | 163 |
| 818 | 3300025931 | Ga0207644_10829721 | Ga0207644_108297212 | 163 |
| 819 | 3300025932 | Ga0207690_11164369 | Ga0207690_111643692 | 163 |
| 820 | 3300025935 | Ga0207709_10000015 | Ga0207709_10000015232 | 163 |
| 821 | 3300025937 | Ga0207669_11007170 | Ga0207669_110071702 | 163 |
| 822 | 3300025942 | Ga0207689_10073610 | Ga0207689_100736102 | 163 |
| 823 | 3300025949 | Ga0207667_10125418 | Ga0207667_101254182 | 163 |
| 824 | 3300025949 | Ga0207667_10528360 | Ga0207667_105283602 | 163 |
| 825 | 3300025981 | Ga0207640_10497649 | Ga0207640_104976492 | 163 |
| 826 | 3300026041 | Ga0207639_10050722 | Ga0207639_100507223 | 163 |
| 827 | 3300026078 | Ga0207702_10125932 | Ga0207702_101259322 | 163 |
| 828 | 3300026121 | Ga0207683_10332922 | Ga0207683_103329222 | 163 |
| 829 | 3300026142 | Ga0207698_10647487 | Ga0207698_106474872 | 163 |
| 830 | 3300027111 | Ga0209281_1000007 | Ga0209281_1000007455 | 163 |
| 831 | 3300027296 | Ga0209389_1054541 | Ga0209389_10545413 | 163 |
| 832 | 3300027312 | Ga0209371_1030410 | Ga0209371_10304102 | 163 |
| 833 | 3300027395 | Ga0209996_1019193 | Ga0209996_10191931 | 163 |
| 834 | 3300027424 | Ga0209984_1008526 | Ga0209984_10085262 | 163 |
| 835 | 3300027526 | Ga0209968_1016556 | Ga0209968_10165562 | 163 |
| 836 | 3300027614 | Ga0209970_1004463 | Ga0209970_10044632 | 163 |
| 837 | 3300027665 | Ga0209983_1032617 | Ga0209983_10326172 | 163 |
| 838 | 3300027682 | Ga0209971_1002849 | Ga0209971_10028497 | 163 |
| 839 | 3300027876 | Ga0209974_10008135 | Ga0209974_100081353 | 163 |
| 840 | 3300027876 | Ga0209974_10110487 | Ga0209974_101104872 | 163 |
| 841 | 3300028381 | Ga0268264_10916109 | Ga0268264_109161092 | 163 |
| 842 | 3300028573 | Ga0265334_10116263 | Ga0265334_101162632 | 163 |
| 843 | 3300028794 | Ga0307515_10000515 | Ga0307515_1000051530 | 163 |
| 844 | 3300030500 | Ga0268256_1012436 | Ga0268256_10124362 | 163 |
| 845 | 3300031235 | Ga0265330_10000033 | Ga0265330_10000033108 | 163 |
| 846 | 3300031238 | Ga0265332_10000001 | Ga0265332_10000001232 | 163 |
| 847 | 3300031238 | Ga0265332_10002998 | Ga0265332_100029982 | 163 |
| 848 | 3300031241 | Ga0265325_10008684 | Ga0265325_100086844 | 163 |
| 849 | 3300031247 | Ga0265340_10006547 | Ga0265340_100065472 | 163 |
| 850 | 3300031344 | Ga0265316_10369743 | Ga0265316_103697432 | 163 |
| 851 | 3300031456 | Ga0307513_10000054 | Ga0307513_1000005423 | 163 |
| 852 | 3300031456 | Ga0307513_10323610 | Ga0307513_103236102 | 163 |
| 853 | 3300031548 | Ga0307408_100320969 | Ga0307408_1003209692 | 163 |
| 854 | 3300031548 | Ga0307408_101257891 | Ga0307408_1012578912 | 163 |
| 855 | 3300031649 | Ga0307514_10000529 | Ga0307514_1000052930 | 163 |
| 856 | 3300031711 | Ga0265314_10000022 | Ga0265314_10000022237 | 163 |
| 857 | 3300031711 | Ga0265314_10001258 | Ga0265314_1000125827 | 163 |
| 858 | 3300031712 | Ga0265342_10012278 | Ga0265342_100122786 | 163 |
| 859 | 3300031730 | Ga0307516_10039216 | Ga0307516_100392162 | 163 |
| 860 | 3300031901 | Ga0307406_10173112 | Ga0307406_101731122 | 163 |
| 861 | 3300031911 | Ga0307412_10083120 | Ga0307412_100831202 | 163 |
| 862 | 3300031911 | Ga0307412_10219336 | Ga0307412_102193361 | 163 |
| 863 | 3300031911 | Ga0307412_10406145 | Ga0307412_104061452 | 163 |
| 864 | 3300031911 | Ga0307412_10783085 | Ga0307412_107830852 | 163 |
| 865 | 3300032002 | Ga0307416_101252644 | Ga0307416_1012526442 | 163 |
| 866 | 3300032004 | Ga0307414_11216634 | Ga0307414_112166341 | 163 |
| 867 | 3300037418 | Ga0395900_0035029 | Ga0395900_0035029_1508_1999 | 163 |
| 868 | 3300037466 | Ga0395898_0922804 | Ga0395898_0922804_302_793 | 163 |
| 869 | 3300037471 | Ga0395905_0000125 | Ga0395905_0000125_125477_125971 | 163 |
| 870 | 3300037471 | Ga0395905_0019808 | Ga0395905_0019808_193_687 | 163 |
| 871 | 3300037471 | Ga0395905_0133216 | Ga0395905_0133216_378_872 | 163 |
| 872 | 3300037471 | Ga0395905_0190926 | Ga0395905_0190926_1000_1494 | 163 |
| 873 | 3300037471 | Ga0395905_0287775 | Ga0395905_0287775_399_890 | 163 |
| 874 | 3300037471 | Ga0395905_0334305 | Ga0395905_0334305_246_737 | 163 |
| 875 | 3300038443 | Ga0395901_0695043 | Ga0395901_0695043_195_692 | 163 |
| 876 | 3300041512 | Ga0451853_3461985 | Ga0451853_3461985_221_715 | 163 |
| 877 | 3300042000 | Ga0439437_014647 | Ga0439437_014647_334_849 | 163 |
| 878 | 3300042127 | Ga0450890_008872 | Ga0450890_008872_451_966 | 163 |
| 879 | 3300042127 | Ga0450890_021028 | Ga0450890_021028_89_589 | 163 |
| 880 | 3300042134 | Ga0450898_003128 | Ga0450898_003128_135_626 | 163 |
| 881 | 3300042156 | Ga0439446_0106780 | Ga0439446_0106780_40_537 | 163 |
| 882 | 3300042437 | Ga0439444_0022352 | Ga0439444_0022352_336_851 | 163 |
| 883 | 3300042438 | Ga0439459_0001649 | Ga0439459_0001649_1445_1960 | 163 |
| 884 | 3300042876 | Ga0451577_0104198 | Ga0451577_0104198_343_879 | 163 |
| 885 | 3300044656 | Ga0466969_0194922 | Ga0466969_0194922_300_797 | 163 |
| 886 | 3300044658 | Ga0466972_0023932 | Ga0466972_0023932_18_512 | 163 |
| 887 | 3300044684 | Ga0466966_0140415 | Ga0466966_0140415_853_1347 | 163 |
| 888 | 3300044684 | Ga0466966_0241175 | Ga0466966_0241175_435_926 | 163 |
| 889 | 3300044693 | Ga0466961_0113051 | Ga0466961_0113051_727_1221 | 163 |
| 890 | 3300044693 | Ga0466961_0174961 | Ga0466961_0174961_439_936 | 163 |
| 891 | 3300044694 | Ga0466963_0385338 | Ga0466963_0385338_322_837 | 163 |
| 892 | 3300044712 | Ga0453684_0504094 | Ga0453684_0504094_72_608 | 163 |
| 893 | 3300044765 | Ga0466970_0048862 | Ga0466970_0048862_319_813 | 163 |
| 894 | 3300044842 | Ga0466957_0565863 | Ga0466957_0565863_154_645 | 163 |
| 895 | 3300044901 | Ga0466960_0208918 | Ga0466960_0208918_409_903 | 163 |
| 896 | 3300045049 | Ga0466959_0041941 | Ga0466959_0041941_2477_2971 | 163 |
| 897 | 3300045049 | Ga0466959_0323962 | Ga0466959_0323962_144_641 | 163 |
| 898 | 3300045051 | Ga0451576_0572666 | Ga0451576_0572666_191_682 | 163 |
| 899 | 3300046530 | Ga0495654_0024669 | Ga0495654_0024669_755_1309 | 163 |
| 900 | 3300046542 | Ga0495597_0003773 | Ga0495597_0003773_7051_7542 | 163 |
| 901 | 3300046558 | Ga0495633_0048538 | Ga0495633_0048538_706_1197 | 163 |
| 902 | 3300046664 | Ga0495659_0252860 | Ga0495659_0252860_166_675 | 163 |
| 903 | 3300048089 | Ga0495614_0050797 | Ga0495614_0050797_493_1038 | 163 |
| 904 | 3300048921 | Ga0496118_0257510 | Ga0496118_0257510_95_649 | 163 |
| 905 | 3300048921 | Ga0496118_0292662 | Ga0496118_0292662_177_707 | 163 |
| 906 | 3300048924 | Ga0496121_0016103 | Ga0496121_0016103_288_824 | 163 |
| 907 | 3300048925 | Ga0496122_0002216 | Ga0496122_0002216_20738_21268 | 163 |
| 908 | 3300048925 | Ga0496122_0060113 | Ga0496122_0060113_293_784 | 163 |
| 909 | 3300048926 | Ga0496123_0000057 | Ga0496123_0000057_211897_212427 | 163 |
| 910 | 3300048926 | Ga0496123_0252832 | Ga0496123_0252832_20_511 | 163 |
| 911 | 3300048927 | Ga0496124_0102702 | Ga0496124_0102702_1152_1679 | 163 |
| 912 | 3300048927 | Ga0496124_0229273 | Ga0496124_0229273_663_1199 | 163 |
| 913 | 3300048927 | Ga0496124_0286744 | Ga0496124_0286744_261_791 | 163 |
| 914 | 3300048927 | Ga0496124_0391648 | Ga0496124_0391648_226_780 | 163 |
| 915 | 3300048928 | Ga0496125_0017536 | Ga0496125_0017536_507_998 | 163 |
| 916 | 3300048928 | Ga0496125_0021742 | Ga0496125_0021742_251_793 | 163 |
| 917 | 3300048928 | Ga0496125_0022543 | Ga0496125_0022543_5057_5593 | 163 |
| 918 | 3300048929 | Ga0496126_0339294 | Ga0496126_0339294_192_722 | 163 |
| 919 | 3300049581 | Ga0501047_0263313 | Ga0501047_0263313_519_1019 | 163 |
| 920 | 3300050489 | nmdc:mga03683_71105_c1 | nmdc:mga03683_71105_c1_748_1242 | 163 |
| 921 | 3300050493 | nmdc:mga0k408_4382_c1 | nmdc:mga0k408_4382_c1_5642_6145 | 163 |
| 922 | 3300050493 | nmdc:mga0k408_52328_c1 | nmdc:mga0k408_52328_c1_695_1210 | 163 |
| 923 | 3300050493 | nmdc:mga0k408_76703_c1 | nmdc:mga0k408_76703_c1_952_1482 | 163 |
| 924 | 3300050496 | nmdc:mga07m45_17376_c2 | nmdc:mga07m45_17376_c2_1121_1636 | 163 |
| 925 | 3300050496 | nmdc:mga07m45_35505_c1 | nmdc:mga07m45_35505_c1_1893_2423 | 163 |
| 926 | 3300053088 | Ga0500644_0032531 | Ga0500644_0032531_541_1035 | 163 |
| 927 | 3300053090 | Ga0500646_0126829 | Ga0500646_0126829_162_656 | 163 |
| 928 | 3300053117 | Ga0500593_001469 | Ga0500593_001469_6132_6626 | 163 |
| 929 | 3300053121 | Ga0500607_136146 | Ga0500607_136146_483_1037 | 163 |
| 930 | 3300053136 | Ga0500559_0019098 | Ga0500559_0019098_730_1260 | 163 |
| 931 | 3300053140 | Ga0500573_0197587 | Ga0500573_0197587_167_697 | 163 |
| 932 | 3300053151 | Ga0500604_0097367 | Ga0500604_0097367_231_725 | 163 |
| 933 | 3300053161 | Ga0500634_0174715 | Ga0500634_0174715_70_573 | 163 |
| 934 | 3300053730 | Ga0500645_001223 | Ga0500645_001223_7749_8243 | 163 |
| 935 | iso_pu_bacteria | 2599185214 | 2599622925 | 163 |
| 936 | iso_pu_bacteria | 2599185226 | 2599671404 | 163 |
| 937 | iso_pu_bacteria | 2599185227 | 2599679559 | 163 |
| 938 | iso_pu_bacteria | 2599185229 | 2599691575 | 163 |
| 939 | iso_pu_bacteria | 2643221628 | 2644162747 | 163 |
| 940 | iso_pu_bacteria | 2643221658 | 2644325054 | 163 |
| 941 | iso_pu_bacteria | 2738541277 | 2738718778 | 163 |
| 942 | iso_pu_bacteria | 2738541307 | 2738884964 | 163 |
| 943 | iso_pu_bacteria | 2738543019 | 2739280796 | 163 |
| 944 | iso_pu_bacteria | 2831265667 | 2831265757 | 163 |
| 945 | iso_pu_bacteria | 2831864461 | 2831870048 | 163 |
| 946 | iso_pu_bacteria | 2838054893 | 2838056471 | 163 |
| 947 | iso_pu_bacteria | 2842677519 | 2842681791 | 163 |
| 948 | iso_pu_bacteria | 2842733646 | 2842736189 | 163 |
| 949 | iso_pu_bacteria | 2842747753 | 2842748073 | 163 |
| 950 | iso_pu_bacteria | 2881101125 | 2881101622 | 163 |
| 951 | iso_pu_bacteria | 2885198086 | 2885203340 | 163 |
| 952 | iso_pu_bacteria | 2885211737 | 2885217310 | 163 |
| 953 | iso_pu_bacteria | 2919462493 | 2919463966 | 163 |
| 954 | iso_pu_bacteria | 2919704043 | 2919709047 | 163 |
| 955 | iso_pu_bacteria | 2928070936 | 2928074715 | 163 |
| 956 | iso_pu_bacteria | 2928115317 | 2928115339 | 163 |
| 957 | iso_pu_bacteria | 2945972063 | 2945976491 | 163 |
| 958 | iso_pu_bacteria | 2954767861 | 2954771515 | 163 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3iam-assembly1.cif.gz_2 | crystal structure of the hydrophilic domain of respiratory complex i from thermus thermophilus, reduced, 2 mol/asu, with bound nadh | 0.8869 | 7 | 158 |
| 6zjy-assembly1.cif.gz_2 | respiratory complex i from thermus thermophilus, nad+ dataset, minor state | 0.8825 | 7 | 159 |
| 8e9i-assembly1.cif.gz_E | mycobacterial respiratory complex i, semi-inserted quinone | 0.8818 | 2 | 157 |
| 7p7c-assembly1.cif.gz_E | complex i from e. coli, ddm/lmng-purified, apo, open state | 0.871 | 1 | 155 |
| 8gym-assembly1.cif.gz_v2 | cryo-em structure of tetrahymena thermophila respiratory mega-complex mc iv2+(i+iii2+ii)2 | 0.8696 | 1 | 159 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q6PBX8_48_121_1.10.10.1590 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;NADH-quinone oxidoreductase subunit E | 0.9629 | 1 | 73 | 1.10.10.1590 |
| af_Q9D6J6_126_223_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.954 | 74 | 159 | 3.40.30.10 |
| 3i9v201 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;NADH-quinone oxidoreductase subunit E | 0.9462 | 7 | 73 | 1.10.10.1590 |
| af_P0AFD1_13_82_1.10.10.1590 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;NADH-quinone oxidoreductase subunit E | 0.9409 | 1 | 72 | 1.10.10.1590 |
| af_Q6PBX8_48_121_1.10.10.1590 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;NADH-quinone oxidoreductase subunit E | 0.9381 | 1 | 73 | 1.10.10.1590 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6I5CEV9-F1-model_v4 | NADH-quinone oxidoreductase subunit NuoE (EC 1.6.5.11) | 0.9117 | 5 | 159 |
GO:0003954
GO:0046872 GO:0051537 |
| AF-A0A1Q7ADA8-F1-model_v4 | NADH-quinone oxidoreductase subunit E | 0.9024 | 1 | 161 |
GO:0003954
GO:0046872 GO:0051537 |
| AF-A0A1F5VJ35-F1-model_v4 | NADH dehydrogenase | 0.9008 | 1 | 156 |
GO:0003954
GO:0046872 GO:0051537 |
| AF-A0A538ERJ3-F1-model_v4 | NADH-quinone oxidoreductase subunit NuoE (EC 1.6.5.11) | 0.9006 | 5 | 159 |
GO:0003954
GO:0046872 GO:0051537 |
| AF-A0A7Y5UVK4-F1-model_v4 | NAD(P)H-dependent oxidoreductase subunit E | 0.9001 | 1 | 156 |
GO:0003954
GO:0046872 GO:0051537 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar