F486669

General Info

Members Datasets Scaffolds Average Seq Length
953 598 1906 282

Family's Representative Sequence

Representative Sequence 3300053078|Ga0495612_0040408|Ga0495612_0040408_197_1147
Length 316
Sequence LDGTPSATPQTIGGIGATNTRAHDDDQEPTAMNVWKLRISRRPVAVAAVLVGMVSLAIGAHAALNKRALETAKAIATEQDSDPAKQATKVALVIGNGHYPDASAPLTQPINDARALSAALRRDGFDVDVVEDASKDDMRRAVARLRSKVRPNSVVMLFFGGYGVQVGRESYMIPVDAAIWKASDVRRDGLSVEKVLEIMTGRGARAKLVVIDASRRNPYERRFRTFSHGLAPIDTPDNTLILSSATPGKVVDDSSGPYSVLVTELLNNLNSRAGAEAAFNKTRGAVARASEGEQVPSVSSSLLDDVQFGSDDKAGS

Samples

Sample ID Description Type Environment
1 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
9 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
10 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
11 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
12 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
65 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
66 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
67 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
68 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
69 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
70 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
71 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
72 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
73 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
74 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
75 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
76 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
77 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
84 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
85 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
86 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
87 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
88 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
92 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
93 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
96 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
101 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
102 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
103 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
104 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
105 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
108 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
109 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
110 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
111 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
112 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
113 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
114 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
118 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
120 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
121 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
122 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
123 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
124 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
173 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
174 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
175 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
176 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
177 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
181 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
182 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
183 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
184 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
185 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
186 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
187 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
188 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
189 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
190 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
191 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
192 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
193 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
194 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
195 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
196 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
197 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
198 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
199 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
200 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
201 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
202 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
203 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
204 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
205 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
206 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
207 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
208 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
209 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
210 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
211 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
212 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
213 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
214 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
215 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
216 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
217 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
218 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
219 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
220 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
221 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
222 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
223 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
224 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
225 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
226 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
227 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
228 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
229 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
230 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
231 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
232 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
233 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
234 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
235 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
236 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
237 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
238 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
239 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
240 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
241 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
242 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
243 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
244 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
245 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
246 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
247 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
248 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
249 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
250 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
251 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
252 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
253 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
254 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
255 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
256 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
257 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
258 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
259 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
260 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
261 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
262 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
263 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
264 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
265 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
266 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
267 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
268 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
269 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
270 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
271 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
272 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
273 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
274 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
275 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
276 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
277 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
278 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
279 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
280 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
281 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
282 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
283 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
284 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
285 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
286 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
287 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
288 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
289 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
290 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
291 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
292 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
293 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
294 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
295 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
296 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
297 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
298 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
299 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
300 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
301 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
302 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
303 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
304 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
305 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
306 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
307 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
308 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
309 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
310 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
311 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
312 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
313 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
314 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
315 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
316 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
317 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
318 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
319 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
320 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
321 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
322 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
323 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
324 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
325 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
326 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
327 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
328 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
329 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
330 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
331 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
332 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
333 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
334 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
335 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
336 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
337 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
338 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
339 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
340 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
341 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
342 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
343 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
344 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
345 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
346 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
347 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
348 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
349 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
350 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
351 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
352 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
353 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
354 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
355 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
356 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
357 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
358 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
359 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
360 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
361 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
362 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
363 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
364 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
365 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
366 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
367 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
368 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
369 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
370 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
371 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
372 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
373 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
374 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
375 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
376 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
377 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
378 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
379 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
380 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
381 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
382 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
383 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
384 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
385 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
386 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
387 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
388 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
389 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
390 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
391 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
392 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
393 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
394 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
395 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
396 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
397 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
398 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
399 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
400 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
401 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
402 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
403 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
404 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
405 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
406 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
407 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
408 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
409 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
410 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
411 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
412 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
413 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
414 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
415 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
416 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
417 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
418 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
419 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
420 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
421 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
422 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
423 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
424 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
425 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
426 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
427 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
428 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
429 2791355199
430 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
431 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
432 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
433 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
434 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
435 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
436 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
437 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
438 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
439 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
440 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
441 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
442 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
443 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
444 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
445 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
446 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
447 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
448 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
449 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
450 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
451 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
452 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
453 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
454 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
455 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
456 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
457 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
458 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
459 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
460 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
461 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
462 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
463 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
464 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
465 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
466 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
467 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
468 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
469 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
470 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
471 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
472 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
473 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
474 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
475 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
476 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
477 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
478 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
479 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
480 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
481 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
482 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
483 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
484 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
485 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
486 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
487 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
488 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
489 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
490 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
491 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
492 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
493 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
494 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
495 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
496 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
497 2922368715
498 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
499 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
500 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
501 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
502 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
503 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
504 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
505 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
506 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
507 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
508 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
509 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
510 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
511 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
512 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
513 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
514 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
515 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
516 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
517 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
518 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
519 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
520 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
521 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
522 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
523 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
524 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
525 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
526 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
527 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
528 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
529 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
530 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
531 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
532 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
533 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
534 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
535 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
536 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
537 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
538 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
539 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
540 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
541 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
542 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
543 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
544 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
545 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
546 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
547 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
548 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
549 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
550 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
551 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
552 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
553 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
554 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
555 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
556 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
557 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
558 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
559 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
560 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
561 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
562 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
563 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
564 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
565 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
566 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
567 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
568 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
569 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
570 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
571 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
572 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
573 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
574 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
575 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
576 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
577 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
578 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
579 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
580 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
581 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
582 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
583 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
584 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
585 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
586 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
587 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
588 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
589 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
590 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
591 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
592 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
593 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
594 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
595 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
596 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
597 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
598 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 79.92
Metatranscriptomes 0
Isolates 20.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.11
Nodule 16.16
Rhizoplane 5.25
Rhizosphere 53.31
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495612_0040408 3300053078 Bacteria 1900
2 JGI24740J21852_10002775 3300001979 Bacteria 7835
3 JGI24739J22299_10002309 3300001989 Bacteria 7346
4 JGI24737J22298_10004739 3300001990 Bacteria 4722
5 JGI24735J21928_10012575 3300002067 Bacteria 2673
6 JGI25406J46586_10000028 3300003203 Bacteria 70247
7 JGI25153J46596_10003050 3300003215 Bacteria 9463
8 JGI25153J46596_10016116 3300003215 Bacteria 3012
9 JGI25160J50197_1020801 3300003354 Bacteria 1969
10 JGI25404J52841_10006237 3300003659 Bacteria 2487
11 JGI25404J52841_10019883 3300003659 Bacteria 1455
12 Ga0055542_1013059 3300003762 Bacteria 1412
13 Ga0055531_10002912 3300003794 Bacteria 11136
14 Ga0065165_1001658 3300005262 Bacteria 22527
15 Ga0065165_1002539 3300005262 Bacteria 15148
16 Ga0065165_1009643 3300005262 Bacteria 4294
17 Ga0065165_1021321 3300005262 Bacteria 2254
18 Ga0065707_10213402 3300005295 Bacteria 1246
19 Ga0070658_10061193 3300005327 Bacteria 3067
20 Ga0070658_10434781 3300005327 Bacteria 1130
21 Ga0070676_10086763 3300005328 Bacteria 1909
22 Ga0070683_100060921 3300005329 Bacteria 3508
23 Ga0070670_100091626 3300005331 Bacteria 2613
24 Ga0070670_100203704 3300005331 Bacteria 1719
25 Ga0070670_100347181 3300005331 Bacteria 1303
26 Ga0068869_100029780 3300005334 Bacteria 3828
27 Ga0070666_10260783 3300005335 Bacteria 1229
28 Ga0070680_100128436 3300005336 Bacteria 2119
29 Ga0070682_100204915 3300005337 Bacteria 1394
30 Ga0070682_100369016 3300005337 Bacteria 1076
31 Ga0068868_100116542 3300005338 Bacteria 2175
32 Ga0068868_100227479 3300005338 Bacteria 1564
33 Ga0070660_100086218 3300005339 Bacteria 2470
34 Ga0070660_100194504 3300005339 Bacteria 1643
35 Ga0070660_100357335 3300005339 Bacteria 1203
36 Ga0070661_100164320 3300005344 Bacteria 1683
37 Ga0070661_100206412 3300005344 Bacteria 1503
38 Ga0070668_100042271 3300005347 Bacteria 3493
39 Ga0070668_100092823 3300005347 Bacteria 2381
40 Ga0070668_100531001 3300005347 Bacteria 1022
41 Ga0070671_100006814 3300005355 Bacteria 9145
42 Ga0070671_100111784 3300005355 Bacteria 2295
43 Ga0070671_100127642 3300005355 Bacteria 2142
44 Ga0070673_100023991 3300005364 Bacteria 4464
45 Ga0070673_100116893 3300005364 Bacteria 2219
46 Ga0070673_100585423 3300005364 Bacteria 1016
47 Ga0070688_100091779 3300005365 Bacteria 1985
48 Ga0070667_100111312 3300005367 Bacteria 2375
49 Ga0070667_100350437 3300005367 Bacteria 1336
50 Ga0070667_100489587 3300005367 Bacteria 1126
51 Ga0070709_10006151 3300005434 Bacteria 6530
52 Ga0070709_10110366 3300005434 Bacteria 1848
53 Ga0070713_100124772 3300005436 Bacteria 2263
54 Ga0070700_100111767 3300005441 Bacteria 1817
55 Ga0070700_100257710 3300005441 Bacteria 1254
56 Ga0070694_100082382 3300005444 Bacteria 2240
57 Ga0070663_100012870 3300005455 Bacteria 5311
58 Ga0070663_100040757 3300005455 Bacteria 3253
59 Ga0070663_100047051 3300005455 Bacteria 3055
60 Ga0070663_100071021 3300005455 Bacteria 2533
61 Ga0070663_100143113 3300005455 Bacteria 1827
62 Ga0070663_100372835 3300005455 Bacteria 1160
63 Ga0070678_100074644 3300005456 Bacteria 2549
64 Ga0070678_100201233 3300005456 Bacteria 1644
65 Ga0070662_100276247 3300005457 Bacteria 1358
66 Ga0070681_10086743 3300005458 Bacteria 3083
67 Ga0070681_10210931 3300005458 Bacteria 1858
68 Ga0068867_100149465 3300005459 Bacteria 1833
69 Ga0070698_100061475 3300005471 Bacteria 3790
70 Ga0070698_100120768 3300005471 Bacteria 2581
71 Ga0070699_100131862 3300005518 Bacteria 2203
72 Ga0070679_100010467 3300005530 Bacteria 8798
73 Ga0070679_100028320 3300005530 Bacteria 5522
74 Ga0070679_100142163 3300005530 Bacteria 2378
75 Ga0070684_100088294 3300005535 Bacteria 2754
76 Ga0070684_100104773 3300005535 Bacteria 2530
77 Ga0070684_100415417 3300005535 Bacteria 1241
78 Ga0070697_100146818 3300005536 Bacteria 1986
79 Ga0068853_100006003 3300005539 Bacteria 9605
80 Ga0068853_100022705 3300005539 Bacteria 5243
81 Ga0068853_100033191 3300005539 Bacteria 4378
82 Ga0068853_100575083 3300005539 Bacteria 1069
83 Ga0070672_100173016 3300005543 Bacteria 1796
84 Ga0070672_100214432 3300005543 Bacteria 1613
85 Ga0070693_100073171 3300005547 Bacteria 2024
86 Ga0070665_100045881 3300005548 Bacteria 4389
87 Ga0070665_100114851 3300005548 Bacteria 2695
88 Ga0070665_100141038 3300005548 Bacteria 2413
89 Ga0070665_100247365 3300005548 Bacteria 1783
90 Ga0070704_100082824 3300005549 Bacteria 2367
91 Ga0068855_100026044 3300005563 Bacteria 6996
92 Ga0068855_100041378 3300005563 Bacteria 5461
93 Ga0068855_100083059 3300005563 Bacteria 3711
94 Ga0068855_100121610 3300005563 Bacteria 2987
95 Ga0068855_100131366 3300005563 Bacteria 2860
96 Ga0068855_100220611 3300005563 Bacteria 2126
97 Ga0070664_100686020 3300005564 Bacteria 954
98 Ga0068857_100004592 3300005577 Bacteria 11693
99 Ga0068854_100007858 3300005578 Bacteria 6823
100 Ga0068854_100022706 3300005578 Bacteria 4280
101 Ga0068854_100234749 3300005578 Bacteria 1457
102 Ga0068854_100309068 3300005578 Bacteria 1281
103 Ga0068856_100004838 3300005614 Bacteria 13349
104 Ga0068856_100044451 3300005614 Bacteria 4372
105 Ga0070702_100031200 3300005615 Bacteria 2914
106 Ga0070702_100151378 3300005615 Bacteria 1489
107 Ga0068852_100096760 3300005616 Bacteria 2654
108 Ga0068859_100208720 3300005617 Bacteria 2039
109 Ga0068864_100196643 3300005618 Bacteria 1851
110 Ga0068866_10110881 3300005718 Bacteria 1530
111 Ga0068861_100026735 3300005719 Bacteria 4198
112 Ga0068861_100030485 3300005719 Bacteria 3953
113 Ga0068861_100329877 3300005719 Bacteria 1332
114 Ga0068863_100252284 3300005841 Bacteria 1704
115 Ga0068858_100027102 3300005842 Bacteria 5323
116 Ga0068858_100662482 3300005842 Bacteria 1014
117 Ga0068860_100224734 3300005843 Bacteria 1823
118 Ga0068860_100309216 3300005843 Bacteria 1549
119 Ga0068862_100174773 3300005844 Bacteria 1925
120 Ga0068862_100250066 3300005844 Bacteria 1615
121 Ga0081455_10110070 3300005937 Bacteria 2191
122 Ga0081455_10115083 3300005937 Bacteria 2130
123 Ga0081538_10082255 3300005981 Bacteria 1708
124 Ga0081540_1001921 3300005983 Bacteria 17417
125 Ga0081540_1003396 3300005983 Bacteria 12619
126 Ga0081540_1007987 3300005983 Bacteria 7452
127 Ga0081540_1009443 3300005983 Bacteria 6723
128 Ga0081540_1017248 3300005983 Bacteria 4477
129 Ga0081540_1034255 3300005983 Bacteria 2743
130 Ga0081540_1049479 3300005983 Bacteria 2096
131 Ga0081539_10056488 3300005985 Bacteria 2178
132 Ga0075365_10016158 3300006038 Bacteria 4532
133 Ga0075365_10032979 3300006038 Bacteria 3333
134 Ga0075365_10177206 3300006038 Bacteria 1490
135 Ga0075368_10005979 3300006042 Bacteria 4219
136 Ga0075368_10043474 3300006042 Bacteria 1770
137 Ga0075363_100036488 3300006048 Bacteria 2578
138 Ga0075363_100040613 3300006048 Bacteria 2452
139 Ga0075363_100146864 3300006048 Bacteria 1329
140 Ga0075363_100173275 3300006048 Bacteria 1225
141 Ga0075364_10107191 3300006051 Bacteria 1862
142 Ga0070712_100100235 3300006175 Bacteria 2140
143 Ga0075362_10068078 3300006177 Bacteria 1621
144 Ga0075362_10184940 3300006177 Bacteria 1010
145 Ga0075367_10032535 3300006178 Bacteria 3002
146 Ga0075367_10035027 3300006178 Bacteria 2903
147 Ga0075367_10170515 3300006178 Bacteria 1355
148 Ga0075367_10282106 3300006178 Bacteria 1044
149 Ga0075369_10013604 3300006186 Bacteria 3235
150 Ga0075369_10123240 3300006186 Bacteria 1174
151 Ga0075366_10002151 3300006195 Bacteria 10037
152 Ga0075366_10071871 3300006195 Bacteria 2061
153 Ga0075370_10031669 3300006353 Bacteria 2953
154 Ga0075370_10041150 3300006353 Bacteria 2608
155 Ga0075370_10069913 3300006353 Bacteria 2007
156 Ga0068871_100139279 3300006358 Bacteria 2062
157 Ga0075428_100079362 3300006844 Bacteria 3582
158 Ga0075434_100434586 3300006871 Bacteria 1334
159 Ga0068865_100130933 3300006881 Bacteria 1879
160 Ga0068865_100461699 3300006881 Bacteria 1052
161 Ga0097620_100208684 3300006931 Bacteria 2039
162 Ga0099825_1025865 3300006941 Bacteria 3206
163 Ga0099824_1010583 3300006942 Bacteria 10799
164 Ga0099823_1015049 3300006944 Bacteria 7703
165 Ga0099794_10001147 3300007265 Bacteria 9086
166 Ga0099794_10068519 3300007265 Bacteria 1735
167 Ga0099795_10023785 3300007788 Bacteria 2036
168 Ga0105250_10011083 3300009092 Bacteria 3745
169 Ga0105240_10008105 3300009093 Bacteria 15085
170 Ga0105240_10011019 3300009093 Bacteria 12649
171 Ga0105240_10013429 3300009093 Bacteria 11247
172 Ga0105240_10033042 3300009093 Bacteria 6689
173 Ga0105240_10175575 3300009093 Bacteria 2533
174 Ga0105240_10253023 3300009093 Bacteria 2036
175 Ga0105245_10005724 3300009098 Bacteria 10914
176 Ga0105245_10086597 3300009098 Bacteria 2873
177 Ga0105247_10080290 3300009101 Bacteria 2054
178 Ga0105241_10010528 3300009174 Bacteria 6785
179 Ga0105242_10162138 3300009176 Bacteria 1958
180 Ga0105242_10357731 3300009176 Bacteria 1350
181 Ga0105242_10389230 3300009176 Bacteria 1298
182 Ga0105248_10280705 3300009177 Bacteria 1875
183 Ga0105248_10944064 3300009177 Bacteria 974
184 Ga0105237_10035226 3300009545 Bacteria 5066
185 Ga0105237_10045542 3300009545 Bacteria 4414
186 Ga0105237_10058315 3300009545 Bacteria 3864
187 Ga0105237_10127842 3300009545 Bacteria 2535
188 Ga0105237_10201402 3300009545 Bacteria 1991
189 Ga0105237_10240170 3300009545 Bacteria 1813
190 Ga0105237_10473525 3300009545 Bacteria 1258
191 Ga0105237_10484162 3300009545 Bacteria 1243
192 Ga0105238_10006857 3300009551 Bacteria 11373
193 Ga0105238_10007282 3300009551 Bacteria 11078
194 Ga0105238_10109350 3300009551 Bacteria 2746
195 Ga0105238_10219145 3300009551 Bacteria 1879
196 Ga0105249_10285789 3300009553 Bacteria 1649
197 Ga0099796_10032274 3300010159 Bacteria 1715
198 Ga0105239_10009574 3300010375 Bacteria 10900
199 Ga0105239_10056889 3300010375 Bacteria 4289
200 Ga0105239_10140111 3300010375 Bacteria 2695
201 Ga0105239_10155208 3300010375 Bacteria 2556
202 Ga0105239_10208931 3300010375 Bacteria 2188
203 Ga0105239_10216777 3300010375 Bacteria 2146
204 Ga0105239_10258541 3300010375 Bacteria 1957
205 Ga0105239_10340544 3300010375 Bacteria 1692
206 Ga0105239_10491731 3300010375 Bacteria 1394
207 Ga0105246_10087033 3300011119 Bacteria 2241
208 Ga0157370_10102676 3300013104 Bacteria 2677
209 Ga0157370_10158361 3300013104 Bacteria 2107
210 Ga0157369_10055291 3300013105 Bacteria 4285
211 Ga0157369_10102738 3300013105 Bacteria 3045
212 Ga0157369_10111483 3300013105 Bacteria 2907
213 Ga0157369_10252399 3300013105 Bacteria 1841
214 Ga0157369_10339641 3300013105 Bacteria 1560
215 Ga0157374_10391971 3300013296 Bacteria 1384
216 Ga0157378_10002347 3300013297 Bacteria 16816
217 Ga0157378_10141521 3300013297 Bacteria 2234
218 Ga0157378_10286296 3300013297 Bacteria 1590
219 Ga0157378_10412526 3300013297 Bacteria 1333
220 Ga0163162_10027636 3300013306 Bacteria 5611
221 Ga0163162_10253630 3300013306 Bacteria 1891
222 Ga0163162_10411080 3300013306 Bacteria 1486
223 Ga0163162_10438974 3300013306 Bacteria 1437
224 Ga0157375_10064201 3300013308 Bacteria 3655
225 Ga0157375_10265043 3300013308 Bacteria 1880
226 Ga0157375_10273738 3300013308 Bacteria 1851
227 Ga0157375_10942952 3300013308 Bacteria 1005
228 Ga0157376_10004117 3300014969 Bacteria 10073
229 Ga0214544_1000344 3300021320 Bacteria 81005
230 Ga0214542_1000018 3300021321 Bacteria 202226
231 Ga0214545_1000009 3300021324 Bacteria 202915
232 Ga0214543_1000037 3300021327 Bacteria 182113
233 Ga0213876_10198700 3300021384 Bacteria 1066
234 Ga0213875_10030890 3300021388 Bacteria 2536
235 Ga0209563_100910 3300025230 Bacteria 8728
236 Ga0209677_100221 3300025253 Bacteria 40837
237 Ga0209677_101663 3300025253 Bacteria 9342
238 Ga0209148_1000874 3300025254 Bacteria 20915
239 Ga0209148_1016446 3300025254 Bacteria 1273
240 Ga0209233_1005748 3300025261 Bacteria 4085
241 Ga0209233_1006468 3300025261 Bacteria 3772
242 Ga0209455_1001252 3300025272 Bacteria 11942
243 Ga0209455_1009126 3300025272 Bacteria 2630
244 Ga0209130_1018638 3300025284 Bacteria 1624
245 Ga0209564_1011043 3300025295 Bacteria 4084
246 Ga0209564_1020586 3300025295 Bacteria 2410
247 Ga0209758_1000030 3300025297 Bacteria 509217
248 Ga0209758_1001325 3300025297 Bacteria 30050
249 Ga0209758_1001470 3300025297 Bacteria 27657
250 Ga0209758_1004933 3300025297 Bacteria 10722
251 Ga0209758_1006222 3300025297 Bacteria 8712
252 Ga0209256_1003245 3300025299 Bacteria 11704
253 Ga0207426_1001228 3300025302 Bacteria 22610
254 Ga0207426_1002362 3300025302 Bacteria 12255
255 Ga0207426_1006808 3300025302 Bacteria 4889
256 Ga0209051_1040791 3300025303 Bacteria 1659
257 Ga0209257_1001531 3300025304 Bacteria 26953
258 Ga0207697_10158407 3300025315 Bacteria 987
259 Ga0207656_10002343 3300025321 Bacteria 6358
260 Ga0207688_10020083 3300025901 Bacteria 3645
261 Ga0207688_10023576 3300025901 Bacteria 3371
262 Ga0207688_10039041 3300025901 Bacteria 2637
263 Ga0207680_10026482 3300025903 Bacteria 3215
264 Ga0207680_10338198 3300025903 Bacteria 1055
265 Ga0207647_10002062 3300025904 Bacteria 15355
266 Ga0207647_10005745 3300025904 Bacteria 9057
267 Ga0207647_10080742 3300025904 Bacteria 1950
268 Ga0207647_10129605 3300025904 Bacteria 1483
269 Ga0207647_10134165 3300025904 Bacteria 1454
270 Ga0207647_10166912 3300025904 Bacteria 1283
271 Ga0207647_10182620 3300025904 Bacteria 1218
272 Ga0207699_10116229 3300025906 Bacteria 1722
273 Ga0207645_10141867 3300025907 Bacteria 1566
274 Ga0207705_10029330 3300025909 Bacteria 3922
275 Ga0207705_10083874 3300025909 Bacteria 2326
276 Ga0207654_10022640 3300025911 Bacteria 3355
277 Ga0207654_10032732 3300025911 Bacteria 2876
278 Ga0207654_10063513 3300025911 Bacteria 2167
279 Ga0207707_10011368 3300025912 Bacteria 7751
280 Ga0207707_10021300 3300025912 Bacteria 5667
281 Ga0207707_10050580 3300025912 Bacteria 3619
282 Ga0207695_10001156 3300025913 Bacteria 45753
283 Ga0207695_10009228 3300025913 Bacteria 12223
284 Ga0207695_10043156 3300025913 Bacteria 4808
285 Ga0207695_10052025 3300025913 Bacteria 4294
286 Ga0207695_10304363 3300025913 Bacteria 1485
287 Ga0207695_10323776 3300025913 Bacteria 1431
288 Ga0207671_10015783 3300025914 Bacteria 5897
289 Ga0207671_10071745 3300025914 Bacteria 2583
290 Ga0207671_10084384 3300025914 Bacteria 2386
291 Ga0207671_10320807 3300025914 Bacteria 1226
292 Ga0207693_10093027 3300025915 Bacteria 2363
293 Ga0207660_10097543 3300025917 Bacteria 2190
294 Ga0207662_10098486 3300025918 Bacteria 1809
295 Ga0207657_10001022 3300025919 Bacteria 29697
296 Ga0207657_10035217 3300025919 Bacteria 4492
297 Ga0207657_10059839 3300025919 Bacteria 3271
298 Ga0207649_10219344 3300025920 Bacteria 1354
299 Ga0207652_10007516 3300025921 Bacteria 8772
300 Ga0207652_10132457 3300025921 Bacteria 2224
301 Ga0207652_10420230 3300025921 Bacteria 1206
302 Ga0207652_10425597 3300025921 Bacteria 1197
303 Ga0207681_10054052 3300025923 Bacteria 2729
304 Ga0207694_10000106 3300025924 Bacteria 88467
305 Ga0207694_10037092 3300025924 Bacteria 3741
306 Ga0207694_10161183 3300025924 Bacteria 1812
307 Ga0207687_10423130 3300025927 Bacteria 1099
308 Ga0207644_10227705 3300025931 Bacteria 1480
309 Ga0207644_10598350 3300025931 Bacteria 915
310 Ga0207706_10056794 3300025933 Bacteria 3450
311 Ga0207706_10395266 3300025933 Bacteria 1199
312 Ga0207706_10578867 3300025933 Bacteria 965
313 Ga0207686_10129456 3300025934 Bacteria 1729
314 Ga0207665_10196924 3300025939 Bacteria 1466
315 Ga0207691_10132697 3300025940 Bacteria 2199
316 Ga0207691_10467823 3300025940 Bacteria 1072
317 Ga0207711_10061776 3300025941 Bacteria 3230
318 Ga0207711_10316102 3300025941 Bacteria 1442
319 Ga0207661_10056406 3300025944 Bacteria 3154
320 Ga0207661_10382121 3300025944 Bacteria 1275
321 Ga0207679_10172514 3300025945 Bacteria 1782
322 Ga0207667_10001923 3300025949 Bacteria 26058
323 Ga0207667_10053674 3300025949 Bacteria 4240
324 Ga0207667_10101264 3300025949 Bacteria 2972
325 Ga0207651_10227134 3300025960 Bacteria 1513
326 Ga0207651_10277243 3300025960 Bacteria 1384
327 Ga0207712_10050278 3300025961 Bacteria 2910
328 Ga0207712_10406968 3300025961 Bacteria 1145
329 Ga0207668_10074949 3300025972 Bacteria 2431
330 Ga0207668_10092234 3300025972 Bacteria 2228
331 Ga0207668_10114332 3300025972 Bacteria 2031
332 Ga0207668_10118849 3300025972 Bacteria 1998
333 Ga0207640_10166973 3300025981 Bacteria 1635
334 Ga0207640_10388318 3300025981 Bacteria 1133
335 Ga0207677_10023485 3300026023 Bacteria 3811
336 Ga0207703_10089690 3300026035 Bacteria 2582
337 Ga0207703_10254533 3300026035 Bacteria 1584
338 Ga0207703_10371266 3300026035 Bacteria 1321
339 Ga0207639_10002263 3300026041 Bacteria 12934
340 Ga0207639_10003429 3300026041 Bacteria 10664
341 Ga0207639_10628988 3300026041 Bacteria 992
342 Ga0207678_10018579 3300026067 Bacteria 6104
343 Ga0207678_10035809 3300026067 Bacteria 4321
344 Ga0207678_10063188 3300026067 Bacteria 3181
345 Ga0207678_10067534 3300026067 Bacteria 3069
346 Ga0207702_10000004 3300026078 Bacteria 422182
347 Ga0207702_10030606 3300026078 Bacteria 4485
348 Ga0207641_10317147 3300026088 Bacteria 1477
349 Ga0207648_10124767 3300026089 Bacteria 2264
350 Ga0207676_10040592 3300026095 Bacteria 3567
351 Ga0207674_10015117 3300026116 Bacteria 8493
352 Ga0207675_100039887 3300026118 Bacteria 4381
353 Ga0207675_100433530 3300026118 Bacteria 1300
354 Ga0207675_100562941 3300026118 Bacteria 1140
355 Ga0207683_10101723 3300026121 Bacteria 2566
356 Ga0207683_10130918 3300026121 Bacteria 2257
357 Ga0207683_10319874 3300026121 Bacteria 1421
358 Ga0207698_10130519 3300026142 Bacteria 2146
359 Ga0207698_10388831 3300026142 Bacteria 1329
360 Ga0207698_10755682 3300026142 Bacteria 971
361 Ga0209389_1000104 3300027296 Bacteria 75132
362 Ga0209389_1000163 3300027296 Bacteria 55041
363 Ga0209589_1000159 3300027357 Bacteria 75132
364 Ga0209489_100194 3300027361 Bacteria 97679
365 Ga0209489_101100 3300027361 Bacteria 55041
366 Ga0209700_100014 3300027363 Bacteria 299349
367 Ga0209813_10005151 3300027866 Bacteria 3160
368 Ga0268266_10002006 3300028379 Bacteria 22754
369 Ga0268266_10063466 3300028379 Bacteria 3188
370 Ga0268266_10131659 3300028379 Bacteria 2237
371 Ga0268266_10268827 3300028379 Bacteria 1582
372 Ga0268265_10047585 3300028380 Bacteria 3214
373 Ga0268265_10117473 3300028380 Bacteria 2184
374 Ga0268265_10556673 3300028380 Bacteria 1089
375 Ga0268264_10178566 3300028381 Bacteria 1926
376 Ga0265326_10008766 3300028558 Bacteria 3037
377 Ga0265334_10041816 3300028573 Bacteria 1789
378 Ga0265336_10000980 3300028666 Bacteria 14077
379 Ga0265338_10001041 3300028800 Bacteria 46363
380 Ga0265330_10093136 3300031235 Bacteria 1292
381 Ga0307509_10110146 3300031507 Bacteria 2760
382 Ga0307408_100692352 3300031548 Bacteria 915
383 Ga0307508_10000154 3300031616 Bacteria 82824
384 Ga0307508_10334894 3300031616 Bacteria 1105
385 Ga0265314_10009663 3300031711 Bacteria 8122
386 Ga0265314_10183893 3300031711 Bacteria 1249
387 Ga0265342_10068335 3300031712 Bacteria 2077
388 Ga0307516_10004488 3300031730 Bacteria 17173
389 Ga0307516_10060076 3300031730 Bacteria 3694
390 Ga0307516_10061525 3300031730 Bacteria 3642
391 Ga0307405_10149081 3300031731 Bacteria 1642
392 Ga0307413_10183281 3300031824 Bacteria 1495
393 Ga0307406_10064780 3300031901 Bacteria 2373
394 Ga0307406_10384946 3300031901 Bacteria 1107
395 Ga0307412_10095303 3300031911 Bacteria 2092
396 Ga0307409_100194775 3300031995 Bacteria 1807
397 Ga0307416_100229443 3300032002 Bacteria 1788
398 Ga0307415_100110013 3300032126 Bacteria 2042
399 Ga0307507_10138570 3300033179 Bacteria 1874
400 Ga0307510_10008029 3300033180 Bacteria 12562
401 Ga0373944_0006526 3300035089 Bacteria 3098
402 Ga0373936_0033128 3300035113 Bacteria 2047
403 Ga0373936_0092188 3300035113 Bacteria 1271
404 Ga0373936_0119309 3300035113 Bacteria 1125
405 Ga0373945_0017637 3300035116 Bacteria 2419
406 Ga0373946_0060095 3300035171 Bacteria 1615
407 Ga0373931_0036556 3300035691 Bacteria 2560
408 Ga0373927_0069143 3300035695 Bacteria 2285
409 Ga0373947_0031358 3300035725 Bacteria 3128
410 Ga0373937_0152150 3300036401 Bacteria 2167
411 Ga0395900_0007996 3300037418 Bacteria 10883
412 Ga0395900_0176641 3300037418 Bacteria 2172
413 Ga0395900_0262821 3300037418 Bacteria 1723
414 Ga0395900_0570564 3300037418 Bacteria 1074
415 Ga0395898_0002246 3300037466 Bacteria 23479
416 Ga0395898_0115038 3300037466 Bacteria 2577
417 Ga0395898_0246382 3300037466 Bacteria 1704
418 Ga0395905_0037661 3300037471 Bacteria 4539
419 Ga0395905_0087476 3300037471 Bacteria 2921
420 Ga0436364_0714615 3300037853 Bacteria 13367
421 Ga0395901_0025305 3300038443 Bacteria 6093
422 Ga0395901_0159235 3300038443 Bacteria 2371
423 Ga0436365_1030582 3300039437 Bacteria 2111
424 Ga0436362_0082387 3300039453 Bacteria 5863
425 Ga0439465_0074790 3300041413 Bacteria 1140
426 Ga0451791_1085100 3300041451 Bacteria 1636
427 Ga0451793_0920747 3300041452 Bacteria 1511
428 Ga0451839_1094415 3300041496 Bacteria 2259
429 Ga0451853_0446900 3300041512 Bacteria 1590
430 Ga0466969_0150582 3300044656 Bacteria 1072
431 Ga0466972_0000234 3300044658 Bacteria 38265
432 Ga0466972_0000868 3300044658 Bacteria 14515
433 Ga0466972_0125329 3300044658 Bacteria 1210
434 Ga0466965_0125451 3300044683 Bacteria 1328
435 Ga0466966_0001271 3300044684 Bacteria 16152
436 Ga0466961_0000185 3300044693 Bacteria 41899
437 Ga0466963_0226487 3300044694 Bacteria 1310
438 Ga0466964_0020319 3300044706 Bacteria 2557
439 Ga0466964_0038060 3300044706 Bacteria 1933
440 Ga0466968_0014023 3300044735 Bacteria 3161
441 Ga0466968_0039204 3300044735 Bacteria 1994
442 Ga0466968_0139221 3300044735 Bacteria 1109
443 Ga0466970_0044226 3300044765 Bacteria 2371
444 Ga0466957_0021614 3300044842 Bacteria 3793
445 Ga0466957_0185529 3300044842 Bacteria 1360
446 Ga0466957_0263356 3300044842 Bacteria 1149
447 Ga0466960_0031321 3300044901 Bacteria 2453
448 Ga0466960_0133587 3300044901 Bacteria 1312
449 Ga0466959_0011281 3300045049 Bacteria 6414
450 Ga0466959_0025221 3300045049 Bacteria 4405
451 Ga0466959_0040805 3300045049 Bacteria 3428
452 Ga0466958_0313425 3300045836 Bacteria 1008
453 Ga0466967_0334808 3300045976 Bacteria 1462
454 Ga0495617_012424 3300046452 Bacteria 2902
455 Ga0495592_0061763 3300046454 Bacteria 2753
456 Ga0495603_0023043 3300046455 Bacteria 3770
457 Ga0495603_0045707 3300046455 Bacteria 2610
458 Ga0495603_0131218 3300046455 Bacteria 1459
459 Ga0495603_0270021 3300046455 Bacteria 978
460 Ga0495590_0021125 3300046457 Bacteria 2309
461 Ga0495638_0023960 3300046460 Bacteria 3985
462 Ga0495638_0073277 3300046460 Bacteria 2090
463 Ga0495638_0154549 3300046460 Bacteria 1328
464 Ga0495641_0052600 3300046461 Bacteria 1856
465 Ga0495651_0006591 3300046462 Bacteria 8866
466 Ga0495582_0129678 3300046473 Bacteria 1424
467 Ga0495582_0151163 3300046473 Bacteria 1318
468 Ga0495605_0092079 3300046474 Bacteria 1404
469 Ga0495639_0007091 3300046475 Bacteria 4813
470 Ga0495639_0008391 3300046475 Bacteria 4430
471 Ga0495664_0069103 3300046477 Bacteria 2108
472 Ga0495584_0073551 3300046491 Bacteria 1717
473 Ga0495585_0058975 3300046492 Bacteria 2116
474 Ga0495585_0086124 3300046492 Bacteria 1697
475 Ga0495594_0030942 3300046499 Bacteria 2899
476 Ga0495594_0034333 3300046499 Bacteria 2759
477 Ga0495596_0030118 3300046500 Bacteria 2173
478 Ga0495607_0160878 3300046501 Bacteria 1141
479 Ga0495606_0001566 3300046507 Bacteria 29975
480 Ga0495606_0054830 3300046507 Bacteria 2580
481 Ga0495606_0071330 3300046507 Bacteria 2188
482 Ga0495606_0077131 3300046507 Bacteria 2081
483 Ga0495606_0163816 3300046507 Bacteria 1295
484 Ga0495610_0048623 3300046512 Bacteria 2081
485 Ga0495616_0046456 3300046513 Bacteria 2191
486 Ga0495628_0061253 3300046516 Bacteria 2951
487 Ga0495631_0016952 3300046518 Bacteria 3457
488 Ga0495631_0096510 3300046518 Bacteria 1272
489 Ga0495632_0044837 3300046519 Bacteria 2205
490 Ga0495632_0081863 3300046519 Bacteria 1539
491 Ga0495637_0057784 3300046520 Bacteria 1601
492 Ga0495643_0009563 3300046522 Bacteria 6017
493 Ga0495643_0106171 3300046522 Bacteria 1433
494 Ga0495648_0056148 3300046524 Bacteria 2370
495 Ga0495648_0160196 3300046524 Bacteria 1164
496 Ga0495666_0181743 3300046526 Bacteria 971
497 Ga0495642_0097004 3300046528 Bacteria 1252
498 Ga0495642_0098661 3300046528 Bacteria 1242
499 Ga0495652_0061608 3300046529 Bacteria 3166
500 Ga0495654_0024580 3300046530 Bacteria 3111
501 Ga0495640_0007978 3300046533 Bacteria 8322
502 Ga0495640_0039395 3300046533 Bacteria 3316
503 Ga0495587_0011475 3300046536 Bacteria 5612
504 Ga0495609_0032714 3300046538 Bacteria 2361
505 Ga0495597_0043845 3300046542 Bacteria 1990
506 Ga0495645_0036888 3300046543 Bacteria 3563
507 Ga0495622_0071788 3300046557 Bacteria 1597
508 Ga0495667_0316423 3300046559 Bacteria 988
509 Ga0495656_0005444 3300046615 Bacteria 4396
510 Ga0495668_0097665 3300046616 Bacteria 1607
511 Ga0495634_0076946 3300046642 Bacteria 2189
512 Ga0495611_0121208 3300046648 Bacteria 1219
513 Ga0495625_0096867 3300046660 Bacteria 2031
514 Ga0495625_0173465 3300046660 Bacteria 1438
515 Ga0495635_0004147 3300046663 Bacteria 10049
516 Ga0495635_0052854 3300046663 Bacteria 2798
517 Ga0495659_0012022 3300046664 Bacteria 2796
518 Ga0495661_0089240 3300046665 Bacteria 1758
519 Ga0495588_0003602 3300046674 Bacteria 6768
520 Ga0495588_0004592 3300046674 Bacteria 6100
521 Ga0495588_0164961 3300046674 Bacteria 1171
522 Ga0495657_0007510 3300046675 Bacteria 8423
523 Ga0495623_0015656 3300046679 Bacteria 4902
524 Ga0495623_0192632 3300046679 Bacteria 1177
525 Ga0495646_0021082 3300046680 Bacteria 4119
526 Ga0495647_0043311 3300046681 Bacteria 1722
527 Ga0495669_0103906 3300046684 Bacteria 1321
528 Ga0495669_0138903 3300046684 Bacteria 1147
529 Ga0495669_0140560 3300046684 Bacteria 1140
530 Ga0495613_0054694 3300046689 Bacteria 2934
531 Ga0495624_0012055 3300046690 Bacteria 5923
532 Ga0495624_0063031 3300046690 Bacteria 2318
533 Ga0495670_0023060 3300046691 Bacteria 3073
534 Ga0495671_0061439 3300046692 Bacteria 1853
535 Ga0495671_0062954 3300046692 Bacteria 1827
536 Ga0495649_0034861 3300046694 Bacteria 2768
537 Ga0495649_0069672 3300046694 Bacteria 1886
538 Ga0495649_0117562 3300046694 Bacteria 1407
539 Ga0495600_0058204 3300046809 Bacteria 2524
540 Ga0495600_0279878 3300046809 Bacteria 1056
541 Ga0495660_0076316 3300046810 Bacteria 1766
542 Ga0495581_0014380 3300047315 Bacteria 4591
543 Ga0495581_0056366 3300047315 Bacteria 2268
544 Ga0495604_0050014 3300047317 Bacteria 3246
545 Ga0495636_0100476 3300047318 Bacteria 1264
546 Ga0495674_0017339 3300047319 Bacteria 6701
547 Ga0495672_0003454 3300047320 Bacteria 13522
548 Ga0495676_0016597 3300047321 Bacteria 6527
549 Ga0495676_0055212 3300047321 Bacteria 3151
550 Ga0495676_0180870 3300047321 Bacteria 1478
551 Ga0495680_0003339 3300047322 Bacteria 15869
552 Ga0495683_0119387 3300047323 Bacteria 1252
553 Ga0495687_006133 3300047443 Bacteria 7454
554 Ga0495675_0017126 3300047444 Bacteria 4588
555 Ga0495679_047950 3300047446 Bacteria 1294
556 Ga0495684_0119901 3300047471 Bacteria 1982
557 Ga0495686_0037857 3300047472 Bacteria 3088
558 Ga0495686_0077377 3300047472 Bacteria 2037
559 Ga0495686_0118778 3300047472 Bacteria 1578
560 Ga0495686_0124975 3300047472 Bacteria 1530
561 Ga0495686_0157222 3300047472 Bacteria 1331
562 Ga0496100_0020485 3300048903 Bacteria 3966
563 Ga0496101_0018497 3300048904 Bacteria 4739
564 Ga0496101_0380445 3300048904 Bacteria 1111
565 Ga0496101_0470243 3300048904 Bacteria 992
566 Ga0496102_0003779 3300048905 Bacteria 12802
567 Ga0496103_0030234 3300048906 Bacteria 3295
568 Ga0496103_0109504 3300048906 Bacteria 1754
569 Ga0496103_0135346 3300048906 Bacteria 1574
570 Ga0496104_0034559 3300048907 Bacteria 4715
571 Ga0496104_0099320 3300048907 Bacteria 2786
572 Ga0496104_0120835 3300048907 Bacteria 2515
573 Ga0496105_0017158 3300048908 Bacteria 5798
574 Ga0496105_0043112 3300048908 Bacteria 3721
575 Ga0496105_0129115 3300048908 Bacteria 2084
576 Ga0496106_0005145 3300048909 Bacteria 9694
577 Ga0496106_0036989 3300048909 Bacteria 3651
578 Ga0496106_0283254 3300048909 Bacteria 1328
579 Ga0496107_0001223 3300048910 Bacteria 15659
580 Ga0496107_0069849 3300048910 Bacteria 2550
581 Ga0496108_0001270 3300048911 Bacteria 19743
582 Ga0496108_0100461 3300048911 Bacteria 2467
583 Ga0496109_0001572 3300048912 Bacteria 19042
584 Ga0496109_0010849 3300048912 Bacteria 7799
585 Ga0496109_0014731 3300048912 Bacteria 6803
586 Ga0496109_0082659 3300048912 Bacteria 2960
587 Ga0496110_0073037 3300048913 Bacteria 3044
588 Ga0496110_0111561 3300048913 Bacteria 2458
589 Ga0496110_0121571 3300048913 Bacteria 2353
590 Ga0496110_0204914 3300048913 Bacteria 1792
591 Ga0496111_0021439 3300048914 Bacteria 4512
592 Ga0496111_0041783 3300048914 Bacteria 3291
593 Ga0496111_0058870 3300048914 Bacteria 2782
594 Ga0496112_0000351 3300048915 Bacteria 30029
595 Ga0496112_0001047 3300048915 Bacteria 20382
596 Ga0496112_0005591 3300048915 Bacteria 10897
597 Ga0496112_0068342 3300048915 Bacteria 3508
598 Ga0496112_0287464 3300048915 Bacteria 1590
599 Ga0496112_0366997 3300048915 Bacteria 1381
600 Ga0496112_0510280 3300048915 Bacteria 1137
601 Ga0496113_0008705 3300048916 Bacteria 6625
602 Ga0496113_0142212 3300048916 Bacteria 1888
603 Ga0496114_0010530 3300048917 Bacteria 7359
604 Ga0496114_0013061 3300048917 Bacteria 6655
605 Ga0496114_0051247 3300048917 Bacteria 3436
606 Ga0496114_0073406 3300048917 Bacteria 2879
607 Ga0496115_0018670 3300048918 Bacteria 5330
608 Ga0496115_0049125 3300048918 Bacteria 3376
609 Ga0496115_0049495 3300048918 Bacteria 3364
610 Ga0496116_0040605 3300048919 Bacteria 3202
611 Ga0496116_0134511 3300048919 Bacteria 1403
612 Ga0496117_0096190 3300048920 Bacteria 1890
613 Ga0496118_0021638 3300048921 Bacteria 5653
614 Ga0496118_0022292 3300048921 Bacteria 5544
615 Ga0496119_0013227 3300048922 Bacteria 6596
616 Ga0496119_0049478 3300048922 Bacteria 2598
617 Ga0496119_0093352 3300048922 Bacteria 1705
618 Ga0496120_0056955 3300048923 Bacteria 2203
619 Ga0496121_0002920 3300048924 Bacteria 25047
620 Ga0496121_0030134 3300048924 Bacteria 4991
621 Ga0496121_0057739 3300048924 Bacteria 3214
622 Ga0496121_0078600 3300048924 Bacteria 2622
623 Ga0496121_0079206 3300048924 Bacteria 2609
624 Ga0496121_0092061 3300048924 Bacteria 2364
625 Ga0496121_0094653 3300048924 Bacteria 2323
626 Ga0496121_0131897 3300048924 Bacteria 1868
627 Ga0496121_0196379 3300048924 Bacteria 1442
628 Ga0496121_0240582 3300048924 Bacteria 1261
629 Ga0496122_0028429 3300048925 Bacteria 4744
630 Ga0496122_0190670 3300048925 Bacteria 1211
631 Ga0496124_0053471 3300048927 Bacteria 3422
632 Ga0496124_0068821 3300048927 Bacteria 2941
633 Ga0496124_0077220 3300048927 Bacteria 2747
634 Ga0496125_0166530 3300048928 Bacteria 1488
635 Ga0496126_0014679 3300048929 Bacteria 7907
636 Ga0496126_0033603 3300048929 Bacteria 4823
637 Ga0496126_0033972 3300048929 Bacteria 4795
638 Ga0496126_0067686 3300048929 Bacteria 3190
639 Ga0496126_0092160 3300048929 Bacteria 2663
640 Ga0496126_0126667 3300048929 Bacteria 2210
641 Ga0496126_0138784 3300048929 Bacteria 2094
642 Ga0495678_035968 3300049459 Bacteria 2025
643 Ga0495682_0049670 3300049460 Bacteria 1528
644 Ga0501033_0022528 3300049570 Bacteria 4753
645 Ga0501034_0457617 3300049571 Bacteria 1193
646 Ga0501036_0070003 3300049572 Bacteria 2966
647 Ga0501037_0043926 3300049573 Bacteria 3284
648 Ga0501038_0027436 3300049574 Bacteria 5066
649 Ga0501038_0310104 3300049574 Bacteria 1237
650 Ga0501039_0208650 3300049575 Bacteria 1536
651 Ga0501043_0017220 3300049579 Bacteria 5668
652 Ga0501047_0081861 3300049581 Bacteria 3103
653 Ga0501047_0253299 3300049581 Bacteria 1609
654 Ga0501047_0496174 3300049581 Bacteria 1048
655 Ga0501048_0054419 3300049582 Bacteria 2843
656 Ga0501069_0018082 3300049585 Bacteria 3803
657 Ga0501070_0099078 3300049586 Bacteria 2411
658 Ga0501070_0375816 3300049586 Bacteria 1151
659 Ga0501071_0223108 3300049587 Bacteria 1419
660 Ga0501076_0148567 3300049592 Bacteria 1906
661 Ga0501079_0363272 3300049741 Bacteria 1135
662 Ga0501035_0058887 3300049822 Bacteria 3421
663 Ga0501035_0120149 3300049822 Bacteria 2298
664 Ga0501044_0098540 3300049823 Bacteria 2943
665 Ga0501044_0138682 3300049823 Bacteria 2421
666 nmdc:mga03683_55793_c1 3300050489 Bacteria 1660
667 nmdc:mga00v17_101167_c1 3300050491 Bacteria 1819
668 nmdc:mga00v17_158319_c1 3300050491 Bacteria 1457
669 nmdc:mga00v17_31877_c1 3300050491 Bacteria 3111
670 nmdc:mga00v17_63048_c1 3300050491 Bacteria 2282
671 nmdc:mga0yw44_14925_c2 3300050492 Bacteria 3235
672 nmdc:mga0yw44_166848_c1 3300050492 Bacteria 1444
673 nmdc:mga0yw44_207572_c1 3300050492 Bacteria 1295
674 nmdc:mga0yw44_221865_c1 3300050492 Bacteria 1253
675 nmdc:mga0yw44_2357_c1 3300050492 Bacteria 8013
676 nmdc:mga0yw44_292328_c1 3300050492 Bacteria 1091
677 nmdc:mga0yw44_30412_c1 3300050492 Bacteria 3129
678 nmdc:mga0yw44_47858_c1 3300050492 Bacteria 2576
679 nmdc:mga0k408_3134_c1 3300050493 Bacteria 8762
680 nmdc:mga0k408_59371_c1 3300050493 Bacteria 2222
681 nmdc:mga06z11_18233_c1 3300050494 Bacteria 3202
682 nmdc:mga06z11_29051_c1 3300050494 Bacteria 2660
683 nmdc:mga06z11_86320_c1 3300050494 Bacteria 1695
684 nmdc:mga04h51_3032_c1 3300050495 Bacteria 4044
685 nmdc:mga07m45_133124_c1 3300050496 Bacteria 1439
686 nmdc:mga07m45_31998_c1 3300050496 Bacteria 2916
687 nmdc:mga07m45_53306_c1 3300050496 Bacteria 2285
688 nmdc:mga05p37_117263_c1 3300050507 Bacteria 3272
689 nmdc:mga0n895_229083_c1 3300050512 Bacteria 1886
690 nmdc:mga0sz30_13284_c1 3300050516 Bacteria 3222
691 nmdc:mga0sz30_21814_c1 3300050516 Bacteria 2595
692 nmdc:mga0sz30_5711_c1 3300050516 Bacteria 4579
693 Ga0495601_0145822 3300053077 Bacteria 1545
694 Ga0500635_0016984 3300053080 Bacteria 2173
695 Ga0495619_0011385 3300053085 Bacteria 5601
696 Ga0495619_0224582 3300053085 Bacteria 1301
697 Ga0500578_0095536 3300053086 Bacteria 1885
698 Ga0500643_000160 3300053087 Bacteria 66845
699 Ga0500643_017325 3300053087 Bacteria 2414
700 Ga0500644_0004497 3300053088 Bacteria 3494
701 Ga0500647_0028580 3300053091 Bacteria 2640
702 Ga0500583_0011441 3300053092 Bacteria 3344
703 Ga0500651_0120370 3300053093 Bacteria 1594
704 Ga0500651_0120487 3300053093 Bacteria 1593
705 Ga0500566_0000022 3300053094 Bacteria 81784
706 Ga0500566_0001625 3300053094 Bacteria 13231
707 Ga0500641_0048955 3300053096 Bacteria 1732
708 Ga0500554_009786 3300053102 Bacteria 2308
709 Ga0500555_020861 3300053103 Bacteria 1887
710 Ga0500557_000026 3300053105 Bacteria 81867
711 Ga0500562_005063 3300053108 Bacteria 3312
712 Ga0500562_029451 3300053108 Bacteria 1444
713 Ga0500572_000057 3300053111 Bacteria 33904
714 Ga0500572_005930 3300053111 Bacteria 2781
715 Ga0500591_023855 3300053115 Bacteria 2969
716 Ga0500592_008258 3300053116 Bacteria 1652
717 Ga0500595_000095 3300053119 Bacteria 61248
718 Ga0500595_002800 3300053119 Bacteria 8394
719 Ga0500595_010862 3300053119 Bacteria 3595
720 Ga0500608_104750 3300053122 Bacteria 1305
721 Ga0500614_005827 3300053123 Bacteria 2587
722 Ga0500614_012364 3300053123 Bacteria 1861
723 Ga0500642_0000914 3300053130 Bacteria 8573
724 Ga0500642_0077870 3300053130 Bacteria 1518
725 Ga0500642_0162251 3300053130 Bacteria 1047
726 Ga0500652_036285 3300053131 Bacteria 1962
727 Ga0500655_009321 3300053133 Bacteria 1769
728 Ga0500559_0000529 3300053136 Bacteria 26608
729 Ga0500559_0039886 3300053136 Bacteria 2043
730 Ga0500564_092607 3300053138 Bacteria 1343
731 Ga0500568_0042372 3300053139 Bacteria 1824
732 Ga0500568_0056453 3300053139 Bacteria 1530
733 Ga0500589_031529 3300053147 Bacteria 2469
734 Ga0500589_072401 3300053147 Bacteria 1556
735 Ga0500590_047136 3300053148 Bacteria 2201
736 Ga0500603_008784 3300053150 Bacteria 2252
737 Ga0500604_0020714 3300053151 Bacteria 1853
738 Ga0500616_0074405 3300053153 Bacteria 1722
739 Ga0500619_050593 3300053154 Bacteria 1343
740 Ga0500622_0045742 3300053156 Bacteria 2265
741 Ga0500627_0031949 3300053158 Bacteria 2215
742 Ga0500627_0081453 3300053158 Bacteria 1443
743 Ga0500634_0051219 3300053161 Bacteria 2221
744 Ga0500638_003349 3300053162 Bacteria 5915
745 Ga0500638_013255 3300053162 Bacteria 3721
746 Ga0500639_017618 3300053163 Bacteria 3769
747 Ga0500639_036859 3300053163 Bacteria 2578
748 Ga0500636_0001690 3300053177 Bacteria 12085
749 Ga0500637_0000168 3300053178 Bacteria 24363
750 Ga0500637_0075693 3300053178 Bacteria 1940
751 Ga0500576_098930 3300053725 Bacteria 1195
752 Ga0500611_007972 3300053727 Bacteria 1618
753 Ga0500625_001446 3300053729 Bacteria 8142
754 Ga0500609_018516 3300053731 Bacteria 948
755 Ga0500596_000300 3300053735 Bacteria 8794
756 Ga0500599_005197 3300053736 Bacteria 1629
757 Ga0500601_000043 3300053737 Bacteria 25667
758 Ga0500661_000448 3300055283 Bacteria 7611
759 Ga0466962_0024843 3300061719 Bacteria 2877
760 Ga0466962_0096975 3300061719 Bacteria 1414
761 2507505522 2507262055 Bacteria 8048963
762 2508539406 2508501009 Bacteria 7784016
763 2508695737 2508501042 Bacteria 8719808
764 2511397397 2511231028 Bacteria 8046582
765 2513624825 2513237092 Bacteria 8341956
766 2513642371 2513237094 Bacteria 8789602
767 2513652599 2513237095 Bacteria 8976980
768 2513695036 2513237101 Bacteria 7952346
769 2513704691 2513237102 Bacteria 7703324
770 2513721896 2513237104 Bacteria 10034502
771 2513879279 2513237139 Bacteria 8737671
772 2514016890 2513237161 Bacteria 8871253
773 2515630182 2515154112 Bacteria 8294334
774 2517107605 2517093001 Bacteria 9002274
775 2524441961 2524023205 Bacteria 8918781
776 2524468110 2524023210 Bacteria 9029266
777 2528851886 2528768022 Bacteria 10457665
778 2617353700 2617270735 Bacteria 9163226
779 2617377394 2617270741 Bacteria 8201522
780 2723841898 2721755755 Bacteria 8322773
781 2745082760 2744054633 Bacteria 8678936
782 2793065703 2791355196 Bacteria 7323613
783 2793079167
784 2805921573 2802429603 Bacteria 8777136
785 2818239040 2816332527 Bacteria 8933356
786 2824608372 2824600985 Bacteria 8488197
787 2824616733 2824609381 Bacteria 8672835
788 2824624874 2824617872 Bacteria 8814715
789 2824633781 2824626560 Bacteria 8813858
790 2824640922 2824635225 Bacteria 8785348
791 2824651548 2824644064 Bacteria 8743947
792 2824660405 2824653114 Bacteria 8493680
793 2824668122 2824661429 Bacteria 9877870
794 2824678494 2824671348 Bacteria 8369588
795 2824686830 2824679649 Bacteria 8248951
796 2824695328 2824687955 Bacteria 8360029
797 2824703246 2824696289 Bacteria 8335049
798 2824709787 2824704595 Bacteria 9667483
799 2824721614 2824714736 Bacteria 8717648
800 2824731402 2824723954 Bacteria 8758240
801 2824738426 2824732956 Bacteria 7810675
802 2824751613 2824746037 Bacteria 7911610
803 2824761384 2824753945 Bacteria 9787441
804 2824768543 2824763712 Bacteria 9792355
805 2824780411 2824773399 Bacteria 8360218
806 2838130172 2838122688 Bacteria 8803140
807 2841947849 2841941048 Bacteria 8688029
808 2841956975 2841949485 Bacteria 8680857
809 2841965024 2841957949 Bacteria 8652217
810 2841972674 2841966195 Bacteria 8673214
811 2841977407 2841974524 Bacteria 8931498
812 2841990694 2841983080 Bacteria 8395090
813 2842041254 2842038055 Bacteria 8002051
814 2842049296 2842045827 Bacteria 8006841
815 2844315734 2844315083 Bacteria 8138177
816 2847931324 2847930680 Bacteria 9342022
817 2847942417 2847939898 Bacteria 8606328
818 2849083285 2849076700 Bacteria 7039503
819 2857516446 2857509624 Bacteria 7472071
820 2874592597 2874590934 Bacteria 8299676
821 2874610502 2874604998 Bacteria 7834745
822 2874619229 2874612657 Bacteria 8252029
823 2874623001 2874620515 Bacteria 8290088
824 2874636874 2874628541 Bacteria 8630250
825 2874647421 2874645413 Bacteria 8214782
826 2876763758 2876761206 Bacteria 10111113
827 2876772721 2876771140 Bacteria 8287509
828 2876820054 2876818435 Bacteria 8274608
829 2879076559 2879074833 Bacteria 8279565
830 2879087635 2879083081 Bacteria 8587928
831 2879103324 2879099564 Bacteria 10442239
832 2879106823 2879099564 Bacteria 10442239
833 2879115144 2879110137 Bacteria 8907982
834 2879129192 2879127579 Bacteria 8294491
835 2879144831 2879142872 Bacteria 8267021
836 2881365418 2881364244 Bacteria 7710352
837 2881666467 2881665667 Bacteria 8175609
838 2885368567 2885366525 Bacteria 8326213
839 2885410256 2885409591 Bacteria 9235467
840 2888379314 2888378607 Bacteria 9652610
841 2888390426 2888388044 Bacteria 7304136
842 2888420004 2888419890 Bacteria 7857137
843 2889035183 2889033259 Bacteria 9099371
844 2903730966 2903727486 Bacteria 8281579
845 2904668937 2904666416 Bacteria 8226587
846 2904714044 2904711408 Bacteria 9771557
847 2906608446 2906602504 Bacteria 8295279
848 2906631612 2906626472 Bacteria 8826946
849 2906652086 2906643746 Bacteria 8722424
850 2908775922 2908775508 Bacteria 8092255
851 2922363289 2922361189 Bacteria 7436256
852 2922369218
853 2922388786 2922386360 Bacteria 7017218
854 2922398060 2922393267 Bacteria 8285685
855 2929630959 2929624759 Bacteria 9339455
856 2932788914 2932784394 Bacteria 9704911
857 2932800032 2932794094 Bacteria 7915132
858 2932809042 2932801729 Bacteria 7987968
859 2932817929 2932809354 Bacteria 9135765
860 2932820560 2932818245 Bacteria 9955613
861 2932834607 2932828146 Bacteria 9745859
862 2933580408 2933577622 Bacteria 9116884
863 2935614577 2935608549 Bacteria 8203142
864 2935624381 2935616580 Bacteria 9032984
865 2935645979 2935638405 Bacteria 10015038
866 2935654740 2935648319 Bacteria 8801166
867 2935663620 2935656913 Bacteria 8965014
868 2935674522 2935665750 Bacteria 9571747
869 2935682714 2935675223 Bacteria 9928132
870 2935686672 2935684952 Bacteria 9590419
871 2935701650 2935694250 Bacteria 9291695
872 2935712835 2935703347 Bacteria 10242284
873 2935716360 2935713505 Bacteria 9608509
874 2935723515 2935722832 Bacteria 9608746
875 2935735071 2935732158 Bacteria 9706831
876 2935744138 2935741537 Bacteria 9707219
877 2935752638 2935750917 Bacteria 9590372
878 2935764932 2935760218 Bacteria 9817913
879 2935774215 2935769743 Bacteria 7878163
880 2935782321 2935777560 Bacteria 8077691
881 2935789069 2935785616 Bacteria 7962367
882 2935796819 2935793552 Bacteria 8012592
883 2935806020 2935801545 Bacteria 9301974
884 2935816836 2935810662 Bacteria 9401221
885 2935826391 2935819856 Bacteria 8261050
886 2935835120 2935827899 Bacteria 10038562
887 2935841491 2935837841 Bacteria 9454360
888 2935853878 2935847175 Bacteria 8228321
889 2935863100 2935855204 Bacteria 9035059
890 2935873037 2935864058 Bacteria 9784707
891 2935880192 2935873716 Bacteria 9632195
892 2935888248 2935883170 Bacteria 7964738
893 2935915420 2935908558 Bacteria 8568796
894 2935925104 2935916978 Bacteria 9113783
895 2935933315 2935926038 Bacteria 8601059
896 2935941407 2935934488 Bacteria 8602579
897 2935949534 2935942939 Bacteria 8599779
898 2935958291 2935951376 Bacteria 8602333
899 2935966542 2935959822 Bacteria 7869783
900 2935974879 2935967501 Bacteria 8603075
901 2935983141 2935975950 Bacteria 8347125
902 2935985231 2935984226 Bacteria 8302647
903 2936000807 2935992306 Bacteria 9802711
904 2936010397 2936002035 Bacteria 9362176
905 2936017776 2936011229 Bacteria 8801034
906 2936026279 2936019824 Bacteria 8804134
907 2936035026 2936028420 Bacteria 8965941
908 2936043827 2936037263 Bacteria 9446081
909 2936053217 2936046547 Bacteria 8903709
910 2936057007 2936055302 Bacteria 8785755
911 2940558551 2940556831 Bacteria 9590747
912 2941537959 2941531003 Bacteria 7653939
913 2941543717 2941538514 Bacteria 9402094
914 3005489296 3005483717 Bacteria 7877331
915 3005511470 3005506211 Bacteria 6943378
916 3005592324 3005587118 Bacteria 7794411
917 3005595318 3005594810 Bacteria 8716512
918 3005711273 3005710791 Bacteria 7622528
919 3005718560 3005718088 Bacteria 8283608
920 8006930273 8006926726 Bacteria 6749210
921 8006969403 8006964411 Bacteria 8966052
922 8006988451 8006984368 Bacteria 9651211
923 8007000698 8006994254 Bacteria 8309700
924 8016525934 8016522445 Bacteria 8156687
925 8016539535 8016530956 Bacteria 8155261
926 8016543828 8016539877 Bacteria 8155419
927 8016549471 8016548790 Bacteria 8155074
928 8016557894 8016557553 Bacteria 8154380
929 8016581864 8016575299 Bacteria 8154085
930 8016586068 8016583857 Bacteria 10421953
931 8016595911 8016595262 Bacteria 8149947
932 8016618681 8016613128 Bacteria 8794220
933 8016622841 8016622563 Bacteria 7999408
934 8016635349 8016630954 Bacteria 9217207
935 8017058742 8017057580 Bacteria 10023680
936 8019540764 8019538911 Bacteria 7872763
937 8019549844 8019547302 Bacteria 7996444
938 8019576912 8019576017 Bacteria 10049540
939 8019594974 8019586578 Bacteria 10212056
940 8019606766 8019597564 Bacteria 10041141
941 8019611741 8019608314 Bacteria 10042931
942 8019623245 8019619141 Bacteria 9218857
943 8019629851 8019629233 Bacteria 8687553
944 8019652119 8019648815 Bacteria 10014479
945 8019666689 8019659431 Bacteria 8577854
946 8019676451 8019668869 Bacteria 8791617
947 8019679542 8019678201 Bacteria 8863603
948 8019695971 8019687851 Bacteria 8712826
949 8055742731 8055742211 Bacteria 9226248
950 8056678585 8056673599 Bacteria 7871253
951 8056687328 8056681323 Bacteria 8472857
952 8056691893 8056689827 Bacteria 6712655
953 8056975775 8056967851 Bacteria 9038162
954 Ga0495612_0040408
955 JGI24740J21852_10002775
956 JGI24739J22299_10002309
957 JGI24737J22298_10004739
958 JGI24735J21928_10012575
959 JGI25406J46586_10000028
960 JGI25153J46596_10003050
961 JGI25153J46596_10016116
962 JGI25160J50197_1020801
963 JGI25404J52841_10006237
964 JGI25404J52841_10019883
965 Ga0055542_1013059
966 Ga0055531_10002912
967 Ga0065165_1001658
968 Ga0065165_1002539
969 Ga0065165_1009643
970 Ga0065165_1021321
971 Ga0065707_10213402
972 Ga0070658_10061193
973 Ga0070658_10434781
974 Ga0070676_10086763
975 Ga0070683_100060921
976 Ga0070670_100091626
977 Ga0070670_100203704
978 Ga0070670_100347181
979 Ga0068869_100029780
980 Ga0070666_10260783
981 Ga0070680_100128436
982 Ga0070682_100204915
983 Ga0070682_100369016
984 Ga0068868_100116542
985 Ga0068868_100227479
986 Ga0070660_100086218
987 Ga0070660_100194504
988 Ga0070660_100357335
989 Ga0070661_100164320
990 Ga0070661_100206412
991 Ga0070668_100042271
992 Ga0070668_100092823
993 Ga0070668_100531001
994 Ga0070671_100006814
995 Ga0070671_100111784
996 Ga0070671_100127642
997 Ga0070673_100023991
998 Ga0070673_100116893
999 Ga0070673_100585423
1000 Ga0070688_100091779
1001 Ga0070667_100111312
1002 Ga0070667_100350437
1003 Ga0070667_100489587
1004 Ga0070709_10006151
1005 Ga0070709_10110366
1006 Ga0070713_100124772
1007 Ga0070700_100111767
1008 Ga0070700_100257710
1009 Ga0070694_100082382
1010 Ga0070663_100012870
1011 Ga0070663_100040757
1012 Ga0070663_100047051
1013 Ga0070663_100071021
1014 Ga0070663_100143113
1015 Ga0070663_100372835
1016 Ga0070678_100074644
1017 Ga0070678_100201233
1018 Ga0070662_100276247
1019 Ga0070681_10086743
1020 Ga0070681_10210931
1021 Ga0068867_100149465
1022 Ga0070698_100061475
1023 Ga0070698_100120768
1024 Ga0070699_100131862
1025 Ga0070679_100010467
1026 Ga0070679_100028320
1027 Ga0070679_100142163
1028 Ga0070684_100088294
1029 Ga0070684_100104773
1030 Ga0070684_100415417
1031 Ga0070697_100146818
1032 Ga0068853_100006003
1033 Ga0068853_100022705
1034 Ga0068853_100033191
1035 Ga0068853_100575083
1036 Ga0070672_100173016
1037 Ga0070672_100214432
1038 Ga0070693_100073171
1039 Ga0070665_100045881
1040 Ga0070665_100114851
1041 Ga0070665_100141038
1042 Ga0070665_100247365
1043 Ga0070704_100082824
1044 Ga0068855_100026044
1045 Ga0068855_100041378
1046 Ga0068855_100083059
1047 Ga0068855_100121610
1048 Ga0068855_100131366
1049 Ga0068855_100220611
1050 Ga0070664_100686020
1051 Ga0068857_100004592
1052 Ga0068854_100007858
1053 Ga0068854_100022706
1054 Ga0068854_100234749
1055 Ga0068854_100309068
1056 Ga0068856_100004838
1057 Ga0068856_100044451
1058 Ga0070702_100031200
1059 Ga0070702_100151378
1060 Ga0068852_100096760
1061 Ga0068859_100208720
1062 Ga0068864_100196643
1063 Ga0068866_10110881
1064 Ga0068861_100026735
1065 Ga0068861_100030485
1066 Ga0068861_100329877
1067 Ga0068863_100252284
1068 Ga0068858_100027102
1069 Ga0068858_100662482
1070 Ga0068860_100224734
1071 Ga0068860_100309216
1072 Ga0068862_100174773
1073 Ga0068862_100250066
1074 Ga0081455_10110070
1075 Ga0081455_10115083
1076 Ga0081538_10082255
1077 Ga0081540_1001921
1078 Ga0081540_1003396
1079 Ga0081540_1007987
1080 Ga0081540_1009443
1081 Ga0081540_1017248
1082 Ga0081540_1034255
1083 Ga0081540_1049479
1084 Ga0081539_10056488
1085 Ga0075365_10016158
1086 Ga0075365_10032979
1087 Ga0075365_10177206
1088 Ga0075368_10005979
1089 Ga0075368_10043474
1090 Ga0075363_100036488
1091 Ga0075363_100040613
1092 Ga0075363_100146864
1093 Ga0075363_100173275
1094 Ga0075364_10107191
1095 Ga0070712_100100235
1096 Ga0075362_10068078
1097 Ga0075362_10184940
1098 Ga0075367_10032535
1099 Ga0075367_10035027
1100 Ga0075367_10170515
1101 Ga0075367_10282106
1102 Ga0075369_10013604
1103 Ga0075369_10123240
1104 Ga0075366_10002151
1105 Ga0075366_10071871
1106 Ga0075370_10031669
1107 Ga0075370_10041150
1108 Ga0075370_10069913
1109 Ga0068871_100139279
1110 Ga0075428_100079362
1111 Ga0075434_100434586
1112 Ga0068865_100130933
1113 Ga0068865_100461699
1114 Ga0097620_100208684
1115 Ga0099825_1025865
1116 Ga0099824_1010583
1117 Ga0099823_1015049
1118 Ga0099794_10001147
1119 Ga0099794_10068519
1120 Ga0099795_10023785
1121 Ga0105250_10011083
1122 Ga0105240_10008105
1123 Ga0105240_10011019
1124 Ga0105240_10013429
1125 Ga0105240_10033042
1126 Ga0105240_10175575
1127 Ga0105240_10253023
1128 Ga0105245_10005724
1129 Ga0105245_10086597
1130 Ga0105247_10080290
1131 Ga0105241_10010528
1132 Ga0105242_10162138
1133 Ga0105242_10357731
1134 Ga0105242_10389230
1135 Ga0105248_10280705
1136 Ga0105248_10944064
1137 Ga0105237_10035226
1138 Ga0105237_10045542
1139 Ga0105237_10058315
1140 Ga0105237_10127842
1141 Ga0105237_10201402
1142 Ga0105237_10240170
1143 Ga0105237_10473525
1144 Ga0105237_10484162
1145 Ga0105238_10006857
1146 Ga0105238_10007282
1147 Ga0105238_10109350
1148 Ga0105238_10219145
1149 Ga0105249_10285789
1150 Ga0099796_10032274
1151 Ga0105239_10009574
1152 Ga0105239_10056889
1153 Ga0105239_10140111
1154 Ga0105239_10155208
1155 Ga0105239_10208931
1156 Ga0105239_10216777
1157 Ga0105239_10258541
1158 Ga0105239_10340544
1159 Ga0105239_10491731
1160 Ga0105246_10087033
1161 Ga0157370_10102676
1162 Ga0157370_10158361
1163 Ga0157369_10055291
1164 Ga0157369_10102738
1165 Ga0157369_10111483
1166 Ga0157369_10252399
1167 Ga0157369_10339641
1168 Ga0157374_10391971
1169 Ga0157378_10002347
1170 Ga0157378_10141521
1171 Ga0157378_10286296
1172 Ga0157378_10412526
1173 Ga0163162_10027636
1174 Ga0163162_10253630
1175 Ga0163162_10411080
1176 Ga0163162_10438974
1177 Ga0157375_10064201
1178 Ga0157375_10265043
1179 Ga0157375_10273738
1180 Ga0157375_10942952
1181 Ga0157376_10004117
1182 Ga0214544_1000344
1183 Ga0214542_1000018
1184 Ga0214545_1000009
1185 Ga0214543_1000037
1186 Ga0213876_10198700
1187 Ga0213875_10030890
1188 Ga0209563_100910
1189 Ga0209677_100221
1190 Ga0209677_101663
1191 Ga0209148_1000874
1192 Ga0209148_1016446
1193 Ga0209233_1005748
1194 Ga0209233_1006468
1195 Ga0209455_1001252
1196 Ga0209455_1009126
1197 Ga0209130_1018638
1198 Ga0209564_1011043
1199 Ga0209564_1020586
1200 Ga0209758_1000030
1201 Ga0209758_1001325
1202 Ga0209758_1001470
1203 Ga0209758_1004933
1204 Ga0209758_1006222
1205 Ga0209256_1003245
1206 Ga0207426_1001228
1207 Ga0207426_1002362
1208 Ga0207426_1006808
1209 Ga0209051_1040791
1210 Ga0209257_1001531
1211 Ga0207697_10158407
1212 Ga0207656_10002343
1213 Ga0207688_10020083
1214 Ga0207688_10023576
1215 Ga0207688_10039041
1216 Ga0207680_10026482
1217 Ga0207680_10338198
1218 Ga0207647_10002062
1219 Ga0207647_10005745
1220 Ga0207647_10080742
1221 Ga0207647_10129605
1222 Ga0207647_10134165
1223 Ga0207647_10166912
1224 Ga0207647_10182620
1225 Ga0207699_10116229
1226 Ga0207645_10141867
1227 Ga0207705_10029330
1228 Ga0207705_10083874
1229 Ga0207654_10022640
1230 Ga0207654_10032732
1231 Ga0207654_10063513
1232 Ga0207707_10011368
1233 Ga0207707_10021300
1234 Ga0207707_10050580
1235 Ga0207695_10001156
1236 Ga0207695_10009228
1237 Ga0207695_10043156
1238 Ga0207695_10052025
1239 Ga0207695_10304363
1240 Ga0207695_10323776
1241 Ga0207671_10015783
1242 Ga0207671_10071745
1243 Ga0207671_10084384
1244 Ga0207671_10320807
1245 Ga0207693_10093027
1246 Ga0207660_10097543
1247 Ga0207662_10098486
1248 Ga0207657_10001022
1249 Ga0207657_10035217
1250 Ga0207657_10059839
1251 Ga0207649_10219344
1252 Ga0207652_10007516
1253 Ga0207652_10132457
1254 Ga0207652_10420230
1255 Ga0207652_10425597
1256 Ga0207681_10054052
1257 Ga0207694_10000106
1258 Ga0207694_10037092
1259 Ga0207694_10161183
1260 Ga0207687_10423130
1261 Ga0207644_10227705
1262 Ga0207644_10598350
1263 Ga0207706_10056794
1264 Ga0207706_10395266
1265 Ga0207706_10578867
1266 Ga0207686_10129456
1267 Ga0207665_10196924
1268 Ga0207691_10132697
1269 Ga0207691_10467823
1270 Ga0207711_10061776
1271 Ga0207711_10316102
1272 Ga0207661_10056406
1273 Ga0207661_10382121
1274 Ga0207679_10172514
1275 Ga0207667_10001923
1276 Ga0207667_10053674
1277 Ga0207667_10101264
1278 Ga0207651_10227134
1279 Ga0207651_10277243
1280 Ga0207712_10050278
1281 Ga0207712_10406968
1282 Ga0207668_10074949
1283 Ga0207668_10092234
1284 Ga0207668_10114332
1285 Ga0207668_10118849
1286 Ga0207640_10166973
1287 Ga0207640_10388318
1288 Ga0207677_10023485
1289 Ga0207703_10089690
1290 Ga0207703_10254533
1291 Ga0207703_10371266
1292 Ga0207639_10002263
1293 Ga0207639_10003429
1294 Ga0207639_10628988
1295 Ga0207678_10018579
1296 Ga0207678_10035809
1297 Ga0207678_10063188
1298 Ga0207678_10067534
1299 Ga0207702_10000004
1300 Ga0207702_10030606
1301 Ga0207641_10317147
1302 Ga0207648_10124767
1303 Ga0207676_10040592
1304 Ga0207674_10015117
1305 Ga0207675_100039887
1306 Ga0207675_100433530
1307 Ga0207675_100562941
1308 Ga0207683_10101723
1309 Ga0207683_10130918
1310 Ga0207683_10319874
1311 Ga0207698_10130519
1312 Ga0207698_10388831
1313 Ga0207698_10755682
1314 Ga0209389_1000104
1315 Ga0209389_1000163
1316 Ga0209589_1000159
1317 Ga0209489_100194
1318 Ga0209489_101100
1319 Ga0209700_100014
1320 Ga0209813_10005151
1321 Ga0268266_10002006
1322 Ga0268266_10063466
1323 Ga0268266_10131659
1324 Ga0268266_10268827
1325 Ga0268265_10047585
1326 Ga0268265_10117473
1327 Ga0268265_10556673
1328 Ga0268264_10178566
1329 Ga0265326_10008766
1330 Ga0265334_10041816
1331 Ga0265336_10000980
1332 Ga0265338_10001041
1333 Ga0265330_10093136
1334 Ga0307509_10110146
1335 Ga0307408_100692352
1336 Ga0307508_10000154
1337 Ga0307508_10334894
1338 Ga0265314_10009663
1339 Ga0265314_10183893
1340 Ga0265342_10068335
1341 Ga0307516_10004488
1342 Ga0307516_10060076
1343 Ga0307516_10061525
1344 Ga0307405_10149081
1345 Ga0307413_10183281
1346 Ga0307406_10064780
1347 Ga0307406_10384946
1348 Ga0307412_10095303
1349 Ga0307409_100194775
1350 Ga0307416_100229443
1351 Ga0307415_100110013
1352 Ga0307507_10138570
1353 Ga0307510_10008029
1354 Ga0373944_0006526
1355 Ga0373936_0033128
1356 Ga0373936_0092188
1357 Ga0373936_0119309
1358 Ga0373945_0017637
1359 Ga0373946_0060095
1360 Ga0373931_0036556
1361 Ga0373927_0069143
1362 Ga0373947_0031358
1363 Ga0373937_0152150
1364 Ga0395900_0007996
1365 Ga0395900_0176641
1366 Ga0395900_0262821
1367 Ga0395900_0570564
1368 Ga0395898_0002246
1369 Ga0395898_0115038
1370 Ga0395898_0246382
1371 Ga0395905_0037661
1372 Ga0395905_0087476
1373 Ga0436364_0714615
1374 Ga0395901_0025305
1375 Ga0395901_0159235
1376 Ga0436365_1030582
1377 Ga0436362_0082387
1378 Ga0439465_0074790
1379 Ga0451791_1085100
1380 Ga0451793_0920747
1381 Ga0451839_1094415
1382 Ga0451853_0446900
1383 Ga0466969_0150582
1384 Ga0466972_0000234
1385 Ga0466972_0000868
1386 Ga0466972_0125329
1387 Ga0466965_0125451
1388 Ga0466966_0001271
1389 Ga0466961_0000185
1390 Ga0466963_0226487
1391 Ga0466964_0020319
1392 Ga0466964_0038060
1393 Ga0466968_0014023
1394 Ga0466968_0039204
1395 Ga0466968_0139221
1396 Ga0466970_0044226
1397 Ga0466957_0021614
1398 Ga0466957_0185529
1399 Ga0466957_0263356
1400 Ga0466960_0031321
1401 Ga0466960_0133587
1402 Ga0466959_0011281
1403 Ga0466959_0025221
1404 Ga0466959_0040805
1405 Ga0466958_0313425
1406 Ga0466967_0334808
1407 Ga0495617_012424
1408 Ga0495592_0061763
1409 Ga0495603_0023043
1410 Ga0495603_0045707
1411 Ga0495603_0131218
1412 Ga0495603_0270021
1413 Ga0495590_0021125
1414 Ga0495638_0023960
1415 Ga0495638_0073277
1416 Ga0495638_0154549
1417 Ga0495641_0052600
1418 Ga0495651_0006591
1419 Ga0495582_0129678
1420 Ga0495582_0151163
1421 Ga0495605_0092079
1422 Ga0495639_0007091
1423 Ga0495639_0008391
1424 Ga0495664_0069103
1425 Ga0495584_0073551
1426 Ga0495585_0058975
1427 Ga0495585_0086124
1428 Ga0495594_0030942
1429 Ga0495594_0034333
1430 Ga0495596_0030118
1431 Ga0495607_0160878
1432 Ga0495606_0001566
1433 Ga0495606_0054830
1434 Ga0495606_0071330
1435 Ga0495606_0077131
1436 Ga0495606_0163816
1437 Ga0495610_0048623
1438 Ga0495616_0046456
1439 Ga0495628_0061253
1440 Ga0495631_0016952
1441 Ga0495631_0096510
1442 Ga0495632_0044837
1443 Ga0495632_0081863
1444 Ga0495637_0057784
1445 Ga0495643_0009563
1446 Ga0495643_0106171
1447 Ga0495648_0056148
1448 Ga0495648_0160196
1449 Ga0495666_0181743
1450 Ga0495642_0097004
1451 Ga0495642_0098661
1452 Ga0495652_0061608
1453 Ga0495654_0024580
1454 Ga0495640_0007978
1455 Ga0495640_0039395
1456 Ga0495587_0011475
1457 Ga0495609_0032714
1458 Ga0495597_0043845
1459 Ga0495645_0036888
1460 Ga0495622_0071788
1461 Ga0495667_0316423
1462 Ga0495656_0005444
1463 Ga0495668_0097665
1464 Ga0495634_0076946
1465 Ga0495611_0121208
1466 Ga0495625_0096867
1467 Ga0495625_0173465
1468 Ga0495635_0004147
1469 Ga0495635_0052854
1470 Ga0495659_0012022
1471 Ga0495661_0089240
1472 Ga0495588_0003602
1473 Ga0495588_0004592
1474 Ga0495588_0164961
1475 Ga0495657_0007510
1476 Ga0495623_0015656
1477 Ga0495623_0192632
1478 Ga0495646_0021082
1479 Ga0495647_0043311
1480 Ga0495669_0103906
1481 Ga0495669_0138903
1482 Ga0495669_0140560
1483 Ga0495613_0054694
1484 Ga0495624_0012055
1485 Ga0495624_0063031
1486 Ga0495670_0023060
1487 Ga0495671_0061439
1488 Ga0495671_0062954
1489 Ga0495649_0034861
1490 Ga0495649_0069672
1491 Ga0495649_0117562
1492 Ga0495600_0058204
1493 Ga0495600_0279878
1494 Ga0495660_0076316
1495 Ga0495581_0014380
1496 Ga0495581_0056366
1497 Ga0495604_0050014
1498 Ga0495636_0100476
1499 Ga0495674_0017339
1500 Ga0495672_0003454
1501 Ga0495676_0016597
1502 Ga0495676_0055212
1503 Ga0495676_0180870
1504 Ga0495680_0003339
1505 Ga0495683_0119387
1506 Ga0495687_006133
1507 Ga0495675_0017126
1508 Ga0495679_047950
1509 Ga0495684_0119901
1510 Ga0495686_0037857
1511 Ga0495686_0077377
1512 Ga0495686_0118778
1513 Ga0495686_0124975
1514 Ga0495686_0157222
1515 Ga0496100_0020485
1516 Ga0496101_0018497
1517 Ga0496101_0380445
1518 Ga0496101_0470243
1519 Ga0496102_0003779
1520 Ga0496103_0030234
1521 Ga0496103_0109504
1522 Ga0496103_0135346
1523 Ga0496104_0034559
1524 Ga0496104_0099320
1525 Ga0496104_0120835
1526 Ga0496105_0017158
1527 Ga0496105_0043112
1528 Ga0496105_0129115
1529 Ga0496106_0005145
1530 Ga0496106_0036989
1531 Ga0496106_0283254
1532 Ga0496107_0001223
1533 Ga0496107_0069849
1534 Ga0496108_0001270
1535 Ga0496108_0100461
1536 Ga0496109_0001572
1537 Ga0496109_0010849
1538 Ga0496109_0014731
1539 Ga0496109_0082659
1540 Ga0496110_0073037
1541 Ga0496110_0111561
1542 Ga0496110_0121571
1543 Ga0496110_0204914
1544 Ga0496111_0021439
1545 Ga0496111_0041783
1546 Ga0496111_0058870
1547 Ga0496112_0000351
1548 Ga0496112_0001047
1549 Ga0496112_0005591
1550 Ga0496112_0068342
1551 Ga0496112_0287464
1552 Ga0496112_0366997
1553 Ga0496112_0510280
1554 Ga0496113_0008705
1555 Ga0496113_0142212
1556 Ga0496114_0010530
1557 Ga0496114_0013061
1558 Ga0496114_0051247
1559 Ga0496114_0073406
1560 Ga0496115_0018670
1561 Ga0496115_0049125
1562 Ga0496115_0049495
1563 Ga0496116_0040605
1564 Ga0496116_0134511
1565 Ga0496117_0096190
1566 Ga0496118_0021638
1567 Ga0496118_0022292
1568 Ga0496119_0013227
1569 Ga0496119_0049478
1570 Ga0496119_0093352
1571 Ga0496120_0056955
1572 Ga0496121_0002920
1573 Ga0496121_0030134
1574 Ga0496121_0057739
1575 Ga0496121_0078600
1576 Ga0496121_0079206
1577 Ga0496121_0092061
1578 Ga0496121_0094653
1579 Ga0496121_0131897
1580 Ga0496121_0196379
1581 Ga0496121_0240582
1582 Ga0496122_0028429
1583 Ga0496122_0190670
1584 Ga0496124_0053471
1585 Ga0496124_0068821
1586 Ga0496124_0077220
1587 Ga0496125_0166530
1588 Ga0496126_0014679
1589 Ga0496126_0033603
1590 Ga0496126_0033972
1591 Ga0496126_0067686
1592 Ga0496126_0092160
1593 Ga0496126_0126667
1594 Ga0496126_0138784
1595 Ga0495678_035968
1596 Ga0495682_0049670
1597 Ga0501033_0022528
1598 Ga0501034_0457617
1599 Ga0501036_0070003
1600 Ga0501037_0043926
1601 Ga0501038_0027436
1602 Ga0501038_0310104
1603 Ga0501039_0208650
1604 Ga0501043_0017220
1605 Ga0501047_0081861
1606 Ga0501047_0253299
1607 Ga0501047_0496174
1608 Ga0501048_0054419
1609 Ga0501069_0018082
1610 Ga0501070_0099078
1611 Ga0501070_0375816
1612 Ga0501071_0223108
1613 Ga0501076_0148567
1614 Ga0501079_0363272
1615 Ga0501035_0058887
1616 Ga0501035_0120149
1617 Ga0501044_0098540
1618 Ga0501044_0138682
1619 nmdc:mga03683_55793_c1
1620 nmdc:mga00v17_101167_c1
1621 nmdc:mga00v17_158319_c1
1622 nmdc:mga00v17_31877_c1
1623 nmdc:mga00v17_63048_c1
1624 nmdc:mga0yw44_14925_c2
1625 nmdc:mga0yw44_166848_c1
1626 nmdc:mga0yw44_207572_c1
1627 nmdc:mga0yw44_221865_c1
1628 nmdc:mga0yw44_2357_c1
1629 nmdc:mga0yw44_292328_c1
1630 nmdc:mga0yw44_30412_c1
1631 nmdc:mga0yw44_47858_c1
1632 nmdc:mga0k408_3134_c1
1633 nmdc:mga0k408_59371_c1
1634 nmdc:mga06z11_18233_c1
1635 nmdc:mga06z11_29051_c1
1636 nmdc:mga06z11_86320_c1
1637 nmdc:mga04h51_3032_c1
1638 nmdc:mga07m45_133124_c1
1639 nmdc:mga07m45_31998_c1
1640 nmdc:mga07m45_53306_c1
1641 nmdc:mga05p37_117263_c1
1642 nmdc:mga0n895_229083_c1
1643 nmdc:mga0sz30_13284_c1
1644 nmdc:mga0sz30_21814_c1
1645 nmdc:mga0sz30_5711_c1
1646 Ga0495601_0145822
1647 Ga0500635_0016984
1648 Ga0495619_0011385
1649 Ga0495619_0224582
1650 Ga0500578_0095536
1651 Ga0500643_000160
1652 Ga0500643_017325
1653 Ga0500644_0004497
1654 Ga0500647_0028580
1655 Ga0500583_0011441
1656 Ga0500651_0120370
1657 Ga0500651_0120487
1658 Ga0500566_0000022
1659 Ga0500566_0001625
1660 Ga0500641_0048955
1661 Ga0500554_009786
1662 Ga0500555_020861
1663 Ga0500557_000026
1664 Ga0500562_005063
1665 Ga0500562_029451
1666 Ga0500572_000057
1667 Ga0500572_005930
1668 Ga0500591_023855
1669 Ga0500592_008258
1670 Ga0500595_000095
1671 Ga0500595_002800
1672 Ga0500595_010862
1673 Ga0500608_104750
1674 Ga0500614_005827
1675 Ga0500614_012364
1676 Ga0500642_0000914
1677 Ga0500642_0077870
1678 Ga0500642_0162251
1679 Ga0500652_036285
1680 Ga0500655_009321
1681 Ga0500559_0000529
1682 Ga0500559_0039886
1683 Ga0500564_092607
1684 Ga0500568_0042372
1685 Ga0500568_0056453
1686 Ga0500589_031529
1687 Ga0500589_072401
1688 Ga0500590_047136
1689 Ga0500603_008784
1690 Ga0500604_0020714
1691 Ga0500616_0074405
1692 Ga0500619_050593
1693 Ga0500622_0045742
1694 Ga0500627_0031949
1695 Ga0500627_0081453
1696 Ga0500634_0051219
1697 Ga0500638_003349
1698 Ga0500638_013255
1699 Ga0500639_017618
1700 Ga0500639_036859
1701 Ga0500636_0001690
1702 Ga0500637_0000168
1703 Ga0500637_0075693
1704 Ga0500576_098930
1705 Ga0500611_007972
1706 Ga0500625_001446
1707 Ga0500609_018516
1708 Ga0500596_000300
1709 Ga0500599_005197
1710 Ga0500601_000043
1711 Ga0500661_000448
1712 Ga0466962_0024843
1713 Ga0466962_0096975
1714 2507505522
1715 2508539406
1716 2508695737
1717 2511397397
1718 2513624825
1719 2513642371
1720 2513652599
1721 2513695036
1722 2513704691
1723 2513721896
1724 2513879279
1725 2514016890
1726 2515630182
1727 2517107605
1728 2524441961
1729 2524468110
1730 2528851886
1731 2617353700
1732 2617377394
1733 2723841898
1734 2745082760
1735 2793065703
1736 2793079167
1737 2805921573
1738 2818239040
1739 2824608372
1740 2824616733
1741 2824624874
1742 2824633781
1743 2824640922
1744 2824651548
1745 2824660405
1746 2824668122
1747 2824678494
1748 2824686830
1749 2824695328
1750 2824703246
1751 2824709787
1752 2824721614
1753 2824731402
1754 2824738426
1755 2824751613
1756 2824761384
1757 2824768543
1758 2824780411
1759 2838130172
1760 2841947849
1761 2841956975
1762 2841965024
1763 2841972674
1764 2841977407
1765 2841990694
1766 2842041254
1767 2842049296
1768 2844315734
1769 2847931324
1770 2847942417
1771 2849083285
1772 2857516446
1773 2874592597
1774 2874610502
1775 2874619229
1776 2874623001
1777 2874636874
1778 2874647421
1779 2876763758
1780 2876772721
1781 2876820054
1782 2879076559
1783 2879087635
1784 2879103324
1785 2879106823
1786 2879115144
1787 2879129192
1788 2879144831
1789 2881365418
1790 2881666467
1791 2885368567
1792 2885410256
1793 2888379314
1794 2888390426
1795 2888420004
1796 2889035183
1797 2903730966
1798 2904668937
1799 2904714044
1800 2906608446
1801 2906631612
1802 2906652086
1803 2908775922
1804 2922363289
1805 2922369218
1806 2922388786
1807 2922398060
1808 2929630959
1809 2932788914
1810 2932800032
1811 2932809042
1812 2932817929
1813 2932820560
1814 2932834607
1815 2933580408
1816 2935614577
1817 2935624381
1818 2935645979
1819 2935654740
1820 2935663620
1821 2935674522
1822 2935682714
1823 2935686672
1824 2935701650
1825 2935712835
1826 2935716360
1827 2935723515
1828 2935735071
1829 2935744138
1830 2935752638
1831 2935764932
1832 2935774215
1833 2935782321
1834 2935789069
1835 2935796819
1836 2935806020
1837 2935816836
1838 2935826391
1839 2935835120
1840 2935841491
1841 2935853878
1842 2935863100
1843 2935873037
1844 2935880192
1845 2935888248
1846 2935915420
1847 2935925104
1848 2935933315
1849 2935941407
1850 2935949534
1851 2935958291
1852 2935966542
1853 2935974879
1854 2935983141
1855 2935985231
1856 2936000807
1857 2936010397
1858 2936017776
1859 2936026279
1860 2936035026
1861 2936043827
1862 2936053217
1863 2936057007
1864 2940558551
1865 2941537959
1866 2941543717
1867 3005489296
1868 3005511470
1869 3005592324
1870 3005595318
1871 3005711273
1872 3005718560
1873 8006930273
1874 8006969403
1875 8006988451
1876 8007000698
1877 8016525934
1878 8016539535
1879 8016543828
1880 8016549471
1881 8016557894
1882 8016581864
1883 8016586068
1884 8016595911
1885 8016618681
1886 8016622841
1887 8016635349
1888 8017058742
1889 8019540764
1890 8019549844
1891 8019576912
1892 8019594974
1893 8019606766
1894 8019611741
1895 8019623245
1896 8019629851
1897 8019652119
1898 8019666689
1899 8019676451
1900 8019679542
1901 8019695971
1902 8055742731
1903 8056678585
1904 8056687328
1905 8056691893
1906 8056975775

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00656

Peptidase_C14

Caspase domain

88

307

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ak0-assembly1.cif.gz_A human malt1(329-729) in complex with a chromane urea containing inhibitor 0.8942 57 278
7ak1-assembly1.cif.gz_A human malt1(329-729) in complex with a chromane urea containing inhibitor 0.8929 57 278
4i1r-assembly1.cif.gz_A-2 human malt1 (caspase-ig3) in complex with thioridazine 0.8747 57 278
7a41-assembly1.cif.gz_A malt1 in complex with a nvs-malt1 chemical probe 0.8669 57 278
7paw-assembly1.cif.gz_A malt1 in complex with compound 1 0.8642 57 278
ID Description Score Start End Superfamily
3v55A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8332 58 278 3.40.50.1460
af_G5EG87_241_482_3.40.50.1460 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8284 57 280 3.40.50.1460
3v6mA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8069 59 279 3.40.50.1460
af_G5ECW5_43_138_3.30.70.1470 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Caspase-like 0.8003 203 283 3.30.70.1470
4hq0A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.7931 59 279 3.40.50.1460
ID Description Score Start End GO Terms
AF-A0A815XD94-F1-model_v4 Caspase family p20 domain-containing protein 0.9511 59 183 GO:0004197
GO:0006508
AF-A0A822C9K7-F1-model_v4 Caspase family p20 domain-containing protein 0.9462 58 174 GO:0004197
GO:0006508
AF-A0A816ATE8-F1-model_v4 Caspase family p20 domain-containing protein 0.9445 58 183 GO:0004197
GO:0006508
AF-A0A525JQP6-F1-model_v4 Tetratricopeptide repeat protein 0.935 58 286 GO:0004197
GO:0006508
AF-A0A7V7KBN6-F1-model_v4 Caspase family p20 domain-containing protein 0.9309 57 279 GO:0004197
GO:0006508

Map