F486662

General Info

Members Datasets Scaffolds Average Seq Length
953 486 836 185

Family's Representative Sequence

Representative Sequence 3300031995|Ga0307409_100224041|Ga0307409_1002240412
Length 209
Sequence MKAAKASTLPQASGPAAAPPSGVRMSKSTVLTLVGSLRTESTNQKLAEAIQLNAPEQVDVVIHESLGNIPFYNEDIDVEGQVPAAAAALRAAANEADTLLLVTPEHNGTVPASLKNAIDWLSRPFGAGALAGKPTAVVGTAFGQFGGVWAQDEARKAVGIAGAHVLEDVKLAVPGSMVRFAEVHPKDDAEVVEQIKGVFDALTTAQPVA

Samples

Sample ID Description Type Environment
1 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
2 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
3 2554235227 Arthrobacter sp. PAO19 Isolate Rhizosphere
4 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
5 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
6 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
7 2643221548 Streptomyces sp. Root55 Isolate Unclassified
8 2643221647 Streptomyces sp. Root369 Isolate Unclassified
9 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
10 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
11 2643221714 Streptomyces sp. Root264 Isolate Unclassified
12 2654587600 Glutamicibacter halophytocola KLBMP5180 Isolate Unclassified
13 2690315906 Arthrobacter sp. OY3WO11 Isolate Unclassified
14 2728369276 Kineococcus rhizosphaerae DSM 19711 Isolate Rhizosphere
15 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
16 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
17 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
18 2751185788 Curtobacterium pusillum AA3 Isolate Unclassified
19 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
20 2775506735 Arthrobacter sp. S95 1704 Isolate Unclassified
21 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
22 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
23 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
24 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
25 2808606357 Arthrobacter sp. SLBN-122 Isolate Unclassified
26 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
27 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
28 2808606366 Arthrobacter sp. SLBN-83 Isolate Unclassified
29 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
30 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
31 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
32 2808606448 Streptomyces sp. 193411 Isolate Unclassified
33 2808606700 Arthrobacter agilis UMCV2 Isolate Rhizosphere
34 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
35 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
36 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
37 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
38 2844849076 Arthrobacter cupressi DSM 24664 Isolate Rhizosphere
39 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
40 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
41 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
42 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
43 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
44 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
45 2862574272 Streptomyces sp. AcE210 Isolate Nodule
46 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
47 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
48 2867428634 Streptomyces sp. RP5T Isolate Unclassified
49 2904430863 Curtobacterium oceanosedimentum 1519 Isolate Rhizosphere
50 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
51 2904501621 Curtobacterium sp. 1909 Isolate Unclassified
52 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
53 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
54 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
55 2905926851 Arthrobacter sedimenti MIC A30 Isolate Rhizosphere
56 2908674828 Curtobacterium sp. 1517 Isolate Rhizosphere
57 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
58 2909074476 Curtobacterium sp. 1310 Isolate Rhizosphere
59 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
60 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
61 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
62 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
63 2919039151 Curtobacterium sp. 260 Isolate Rhizosphere
64 2919042368 Curtobacterium sp. 320 Isolate Rhizosphere
65 2919059106 Arthrobacter sp. 1088 Isolate Rhizosphere
66 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
67 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
68 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
69 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
70 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
71 2928104781 Curtobacterium sp. 1544 Isolate Rhizosphere
72 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
73 2928500415 Curtobacterium oceanosedimentum 1257 Isolate Rhizosphere
74 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
75 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
76 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
77 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere
78 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
79 2945916053 Arthrobacter ulcerisalmonis W1I2 Isolate Rhizosphere
80 2945920336 Pseudarthrobacter siccitolerans W1I3 Isolate Rhizosphere
81 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
82 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
83 2946003308 Arthrobacter agilis W3I6 Isolate Rhizosphere
84 2946037020 Arthrobacter sp. W4I7 Isolate Rhizosphere
85 2946059875 Arthrobacter sp. SLBN-112 Isolate Rhizosphere
86 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
87 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
88 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
89 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
90 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
91 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
92 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
93 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
94 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
95 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
96 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
97 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
98 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
99 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
100 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
101 2974302888 Pseudarthrobacter sp. SORGH_AS 212 Isolate Unclassified
102 2974315732 Rhodococcus sp. SORGH_AS 301 Isolate Unclassified
103 2984523437 Rhodococcus sp. SORGH_AS303 Isolate Aerial Root
104 2984551494 Curtobacterium sp. SORGH_AS776 Isolate Aerial Root
105 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
106 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
107 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
108 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
109 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
110 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
111 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
112 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
113 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
114 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
115 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
116 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
117 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
118 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
119 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
120 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
121 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
122 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
123 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
124 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
125 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
126 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
127 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
128 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
129 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
130 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
131 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
132 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
133 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
134 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
135 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
136 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
137 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
138 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
139 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
140 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
141 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
142 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
143 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
144 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
145 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
146 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
147 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
148 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
149 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
150 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
151 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
152 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
153 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
154 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
155 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
156 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
157 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
158 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
159 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
160 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
161 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
162 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
163 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
164 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
165 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
166 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
167 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
168 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
169 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
170 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
171 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
172 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
173 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
174 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
175 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
176 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
177 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
178 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
179 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
180 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
181 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
182 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
183 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
184 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
185 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
186 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
187 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
188 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
189 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
190 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
191 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
192 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
193 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
194 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
224 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
225 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
226 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
228 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
229 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
230 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
231 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
232 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
233 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
234 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
235 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
236 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
237 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
238 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
239 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
240 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
241 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
242 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
243 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
244 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
245 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
246 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
247 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
248 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
249 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
250 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
251 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
252 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
253 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
254 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
255 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
256 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
257 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
258 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
259 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
260 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
261 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
262 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
263 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
264 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
265 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
266 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
267 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
268 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
269 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
270 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
271 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
272 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
273 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
274 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
275 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
276 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
277 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
278 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
279 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
280 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
281 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
282 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
283 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
284 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
285 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
286 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
287 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
288 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
289 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
290 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
291 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
292 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
293 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
294 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
295 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
296 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
297 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
298 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
299 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
300 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
301 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
302 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
303 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
304 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
305 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
306 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
307 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
308 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
309 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
310 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
311 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
312 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
313 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
314 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
315 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
316 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
317 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
318 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
319 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
320 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
321 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
322 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
323 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
324 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
325 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
326 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
327 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
328 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
329 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
330 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
331 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
332 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
333 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
334 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
335 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
336 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
337 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
338 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
339 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
340 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
341 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
342 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
343 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
344 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
345 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
346 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
347 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
348 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
349 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
350 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
351 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
352 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
353 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
354 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
355 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
356 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
357 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
358 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
359 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
360 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
361 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
362 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
363 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
364 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
365 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
366 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
367 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
368 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
369 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
370 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
371 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
372 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
373 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
374 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
375 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
376 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
377 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
378 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
379 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
380 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
381 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
382 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
383 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
384 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
385 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
386 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
387 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
388 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
389 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
390 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
391 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
392 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
393 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
394 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
395 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
396 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
397 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
398 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
399 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
400 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
401 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
402 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
403 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
404 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
405 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
406 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
407 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
408 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
409 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
410 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
411 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
412 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
413 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
414 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
415 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
416 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
417 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
418 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
419 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
420 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
421 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
422 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
423 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
424 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
425 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
426 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
427 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
428 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
429 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
430 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
431 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
432 3300049542 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
433 3300049547 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
434 3300049548 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
435 3300049554 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
436 3300049556 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
437 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
438 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
439 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
440 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
441 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
442 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
443 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
444 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
445 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
446 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
447 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
448 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
449 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
450 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
451 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
452 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
453 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
454 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
455 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
456 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
457 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
458 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
459 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
460 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
461 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
462 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
463 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
464 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
465 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
466 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
467 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
468 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
469 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
470 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
471 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
472 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
473 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
474 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
475 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
476 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
477 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
478 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
479 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
480 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
481 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
482 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
483 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
484 8054107350 Arthrobacter rhizosphaerae CCNWLXL 1-35 Isolate Rhizosphere
485 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified
486 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 78.59
Metatranscriptomes 9.13
Isolates 12.28

Biome Distribution

Category Percentage (%)
Aerial Root 0.21
Bulb 0
Endosphere 3.57
Nodule 0.42
Rhizoplane 3.67
Rhizosphere 81.85
Stem 0
Stem Tuber 0
Unclassified 10.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10066862 3300001979 Bacteria 974
2 JGI24033J26618_1024995 3300002155 Bacteria 782
3 JGI25152J39213_1001239 3300002773 Bacteria 11661
4 Ga0006759J45824_1049098 3300003163 Bacteria 593
5 JGI25153J46596_10071137 3300003215 Bacteria 900
6 Ga0006777J48905_1041791 3300003308 Bacteria 589
7 rootH1_10008542 3300003316 Bacteria 1734
8 rootH1_10008952 3300003316 Bacteria 37325
9 rootH2_10052948 3300003320 Bacteria 3620
10 rootL2_10017544 3300003322 Bacteria 1787
11 rootH1_10048105 3300003323 Bacteria 1524
12 rootH1_10117255 3300003323 Bacteria 4523
13 Ga0007416J51690_1135091 3300003577 Bacteria 641
14 Ga0006562J51391_1112167 3300003578 Bacteria 650
15 Ga0032354_1012055 3300003693 Bacteria 605
16 Ga0055542_1006500 3300003762 Bacteria 2491
17 Ga0058859_11451262 3300004798 Bacteria 652
18 Ga0065714_10012667 3300005288 Bacteria 2591
19 Ga0065714_10130094 3300005288 Bacteria 1247
20 Ga0065714_10336468 3300005288 Bacteria 651
21 Ga0065712_10040502 3300005290 Bacteria 1074
22 Ga0070658_10862152 3300005327 Bacteria 787
23 Ga0070676_10005407 3300005328 Bacteria 6805
24 Ga0070670_100071851 3300005331 Bacteria 2971
25 Ga0070670_100777299 3300005331 Bacteria 864
26 Ga0070677_10002207 3300005333 Bacteria 6220
27 Ga0070677_10125759 3300005333 Bacteria 1164
28 Ga0070666_10022628 3300005335 Bacteria 4083
29 Ga0070680_100157237 3300005336 Bacteria 1910
30 Ga0070668_100007104 3300005347 Bacteria 8296
31 Ga0070669_100011371 3300005353 Bacteria 6319
32 Ga0070675_100078923 3300005354 Bacteria 2742
33 Ga0070671_100024103 3300005355 Bacteria 4980
34 Ga0070674_100041219 3300005356 Bacteria 3127
35 Ga0070674_100408538 3300005356 Bacteria 1111
36 Ga0070673_100005463 3300005364 Bacteria 8139
37 Ga0070667_100039528 3300005367 Bacteria 3954
38 Ga0070667_100629319 3300005367 Bacteria 990
39 Ga0070678_100130874 3300005456 Bacteria 1993
40 Ga0070662_100203477 3300005457 Bacteria 1572
41 Ga0070679_100002368 3300005530 Bacteria 17089
42 Ga0070684_100263252 3300005535 Bacteria 1577
43 Ga0070672_100246862 3300005543 Bacteria 1503
44 Ga0070665_100043306 3300005548 Bacteria 4524
45 Ga0070665_100068963 3300005548 Bacteria 3544
46 Ga0068855_100165013 3300005563 Bacteria 2511
47 Ga0068855_100344247 3300005563 Bacteria 1643
48 Ga0070664_100620473 3300005564 Bacteria 1004
49 Ga0068857_100674183 3300005577 Bacteria 981
50 Ga0068870_10030971 3300005840 Bacteria 2708
51 Ga0081455_10000520 3300005937 Bacteria 49994
52 Ga0075365_10625466 3300006038 Bacteria 761
53 Ga0075363_100018677 3300006048 Bacteria 3458
54 Ga0075363_100123854 3300006048 Bacteria 1446
55 Ga0075432_10012515 3300006058 Bacteria 2882
56 Ga0075432_10129229 3300006058 Bacteria 955
57 Ga0075367_10004683 3300006178 Bacteria 6715
58 Ga0097621_101565439 3300006237 Bacteria 626
59 Ga0099826_10209855 3300006948 Bacteria 1058
60 Ga0105251_10005515 3300009011 Bacteria 8238
61 Ga0105244_10011815 3300009036 Bacteria 5206
62 Ga0105244_10018414 3300009036 Bacteria 3918
63 Ga0105244_10132336 3300009036 Bacteria 1203
64 Ga0105250_10048688 3300009092 Bacteria 1700
65 Ga0105245_10029557 3300009098 Bacteria 4843
66 Ga0105243_10071423 3300009148 Bacteria 2806
67 Ga0105243_10260001 3300009148 Bacteria 1554
68 Ga0105243_10450202 3300009148 Bacteria 1208
69 Ga0105241_10722927 3300009174 Bacteria 911
70 Ga0105242_10125999 3300009176 Bacteria 2204
71 Ga0105248_10025296 3300009177 Bacteria 6600
72 Ga0105238_10072052 3300009551 Bacteria 3452
73 Ga0105246_10009375 3300011119 Bacteria 6031
74 Ga0105246_10016192 3300011119 Bacteria 4718
75 Ga0105246_10068289 3300011119 Bacteria 2493
76 Ga0105246_10074554 3300011119 Bacteria 2399
77 Ga0157373_10003130 3300013100 Bacteria 12498
78 Ga0157371_10160862 3300013102 Bacteria 1604
79 Ga0157370_10155288 3300013104 Bacteria 2129
80 Ga0157369_10150165 3300013105 Bacteria 2462
81 Ga0163162_10980880 3300013306 Bacteria 955
82 Ga0157375_11357843 3300013308 Bacteria 836
83 Ga0163163_10107058 3300014325 Bacteria 2822
84 Ga0157380_10126760 3300014326 Bacteria 2171
85 Ga0182008_10001811 3300014497 Bacteria 13951
86 Ga0157377_10806342 3300014745 Bacteria 693
87 Ga0157377_11043526 3300014745 Bacteria 622
88 Ga0182006_1053811 3300015261 Bacteria 1541
89 Ga0182007_10004511 3300015262 Bacteria 6294
90 Ga0183367_1016 3300015688 Bacteria 290198
91 Ga0197907_10856159 3300020069 Bacteria 695
92 Ga0206349_1229207 3300020075 Bacteria 745
93 Ga0206355_1325693 3300020076 Bacteria 1041
94 Ga0206350_10339140 3300020080 Bacteria 1057
95 Ga0206350_11395529 3300020080 Bacteria 1107
96 Ga0206354_10122585 3300020081 Bacteria 645
97 Ga0206354_10852819 3300020081 Bacteria 1370
98 Ga0206354_10978295 3300020081 Bacteria 624
99 Ga0206354_11573772 3300020081 Bacteria 643
100 Ga0206353_11108962 3300020082 Bacteria 1362
101 Ga0206353_11379541 3300020082 Bacteria 831
102 Ga0224712_10108449 3300022467 Bacteria 1188
103 Ga0224712_10219254 3300022467 Bacteria 870
104 Ga0209148_1002503 3300025254 Bacteria 6203
105 Ga0209759_1012462 3300025256 Bacteria 2354
106 Ga0209129_1000518 3300025258 Bacteria 27541
107 Ga0207673_1002199 3300025290 Bacteria 2201
108 Ga0209025_1000369 3300025294 Bacteria 94915
109 Ga0209758_1005228 3300025297 Bacteria 10172
110 Ga0207426_1012570 3300025302 Bacteria 3173
111 Ga0209051_1001812 3300025303 Bacteria 16941
112 Ga0209051_1104842 3300025303 Bacteria 751
113 Ga0207697_10001581 3300025315 Bacteria 12314
114 Ga0207697_10007084 3300025315 Bacteria 5020
115 Ga0207697_10038004 3300025315 Bacteria 1974
116 Ga0207655_1008458 3300025728 Bacteria 6524
117 Ga0207655_1036400 3300025728 Bacteria 2183
118 Ga0207655_1064398 3300025728 Bacteria 1398
119 Ga0207713_1016069 3300025735 Bacteria 3813
120 Ga0207682_10004228 3300025893 Bacteria 6064
121 Ga0207682_10022099 3300025893 Bacteria 2505
122 Ga0207688_10110983 3300025901 Bacteria 1592
123 Ga0207680_10110597 3300025903 Bacteria 1781
124 Ga0207647_10029660 3300025904 Bacteria 3536
125 Ga0207645_10000166 3300025907 Bacteria 52485
126 Ga0207643_10024739 3300025908 Bacteria 3314
127 Ga0207705_10068050 3300025909 Bacteria 2578
128 Ga0207660_10238965 3300025917 Bacteria 1430
129 Ga0207652_10177426 3300025921 Bacteria 1913
130 Ga0207681_10008824 3300025923 Bacteria 6159
131 Ga0207650_10015389 3300025925 Bacteria 5326
132 Ga0207659_10009658 3300025926 Bacteria 6036
133 Ga0207687_10047005 3300025927 Bacteria 2990
134 Ga0207664_10686774 3300025929 Bacteria 920
135 Ga0207644_10028772 3300025931 Bacteria 3850
136 Ga0207706_10214318 3300025933 Bacteria 1687
137 Ga0207686_10107692 3300025934 Bacteria 1873
138 Ga0207709_10129241 3300025935 Bacteria 1719
139 Ga0207669_10004805 3300025937 Bacteria 5995
140 Ga0207691_10000225 3300025940 Bacteria 55028
141 Ga0207691_10493475 3300025940 Bacteria 1040
142 Ga0207711_10038604 3300025941 Bacteria 4061
143 Ga0207651_10028821 3300025960 Bacteria 3508
144 Ga0207658_10160614 3300025986 Bacteria 1841
145 Ga0207678_10010712 3300026067 Bacteria 8054
146 Ga0207674_11030161 3300026116 Bacteria 792
147 Ga0207674_11035498 3300026116 Bacteria 790
148 Ga0207683_10010420 3300026121 Bacteria 7930
149 Ga0207683_10384880 3300026121 Bacteria 1290
150 Ga0209371_1065377 3300027312 Bacteria 657
151 Ga0209813_10077013 3300027866 Bacteria 1095
152 Ga0207428_10001247 3300027907 Bacteria 27274
153 Ga0268266_10119276 3300028379 Bacteria 2346
154 Ga0268266_10529495 3300028379 Bacteria 1127
155 Ga0307517_10059790 3300028786 Bacteria 3642
156 Ga0307515_10000325 3300028794 Bacteria 118141
157 Ga0307515_10212706 3300028794 Bacteria 1773
158 Ga0307515_10497160 3300028794 Bacteria 830
159 Ga0268256_1072889 3300030500 Bacteria 657
160 Ga0307511_10025842 3300030521 Bacteria 5399
161 Ga0307511_10029108 3300030521 Bacteria 4997
162 Ga0307512_10015746 3300030522 Bacteria 6997
163 Ga0316177_1115214 3300030731 Bacteria 3075
164 Ga0314311_1009278 3300030733 Bacteria 3738
165 Ga0307513_10001575 3300031456 Bacteria 32715
166 Ga0307513_10085089 3300031456 Bacteria 3246
167 Ga0307513_10126009 3300031456 Bacteria 2516
168 Ga0307509_10036506 3300031507 Bacteria 5379
169 Ga0307408_100006509 3300031548 Bacteria 7743
170 Ga0307408_100009119 3300031548 Bacteria 6545
171 Ga0307408_100016181 3300031548 Bacteria 4973
172 Ga0307408_100018446 3300031548 Bacteria 4684
173 Ga0307408_100018624 3300031548 Bacteria 4664
174 Ga0307408_100020750 3300031548 Bacteria 4438
175 Ga0307408_100025109 3300031548 Bacteria 4077
176 Ga0307408_100031323 3300031548 Bacteria 3703
177 Ga0307408_100097382 3300031548 Bacteria 2234
178 Ga0307408_100204862 3300031548 Bacteria 1599
179 Ga0307408_100539619 3300031548 Bacteria 1027
180 Ga0307408_100757379 3300031548 Bacteria 878
181 Ga0307508_10002767 3300031616 Bacteria 18278
182 Ga0307508_10062830 3300031616 Bacteria 3277
183 Ga0307508_10253887 3300031616 Bacteria 1354
184 Ga0307514_10024827 3300031649 Bacteria 4847
185 Ga0307514_10041820 3300031649 Bacteria 3606
186 Ga0307514_10241303 3300031649 Bacteria 1082
187 Ga0307514_10247403 3300031649 Bacteria 1060
188 Ga0307516_10008539 3300031730 Bacteria 11568
189 Ga0307516_10017287 3300031730 Bacteria 7525
190 Ga0307516_10524642 3300031730 Bacteria 838
191 Ga0307405_10006869 3300031731 Bacteria 5642
192 Ga0307405_10026001 3300031731 Bacteria 3369
193 Ga0307405_10043930 3300031731 Bacteria 2730
194 Ga0307405_10067163 3300031731 Bacteria 2289
195 Ga0307405_10231960 3300031731 Bacteria 1361
196 Ga0307405_10439994 3300031731 Bacteria 1031
197 Ga0307405_10483159 3300031731 Bacteria 989
198 Ga0307405_10582795 3300031731 Bacteria 910
199 Ga0307413_10005160 3300031824 Bacteria 5788
200 Ga0307413_10008405 3300031824 Bacteria 4872
201 Ga0307413_10047535 3300031824 Bacteria 2559
202 Ga0307413_10087653 3300031824 Bacteria 2017
203 Ga0307413_10153191 3300031824 Bacteria 1609
204 Ga0307413_10163499 3300031824 Bacteria 1566
205 Ga0307413_10169331 3300031824 Bacteria 1544
206 Ga0307413_10278081 3300031824 Bacteria 1257
207 Ga0307413_10285340 3300031824 Bacteria 1244
208 Ga0307413_11120967 3300031824 Bacteria 680
209 Ga0307518_10302848 3300031838 Bacteria 970
210 Ga0307410_10004832 3300031852 Bacteria 7039
211 Ga0307410_10008385 3300031852 Bacteria 5727
212 Ga0307410_10025846 3300031852 Bacteria 3689
213 Ga0307410_10041948 3300031852 Bacteria 3020
214 Ga0307410_10056138 3300031852 Bacteria 2676
215 Ga0307410_10057403 3300031852 Bacteria 2650
216 Ga0307410_10076239 3300031852 Bacteria 2340
217 Ga0307410_10080121 3300031852 Bacteria 2290
218 Ga0307410_10163283 3300031852 Bacteria 1671
219 Ga0307410_10376961 3300031852 Bacteria 1140
220 Ga0307406_10030947 3300031901 Bacteria 3255
221 Ga0307406_10129920 3300031901 Bacteria 1767
222 Ga0307406_10148831 3300031901 Bacteria 1667
223 Ga0307406_10153298 3300031901 Bacteria 1647
224 Ga0307406_10278353 3300031901 Bacteria 1275
225 Ga0307406_10389793 3300031901 Bacteria 1101
226 Ga0307406_10492935 3300031901 Bacteria 992
227 Ga0307406_10805784 3300031901 Bacteria 793
228 Ga0307407_10001258 3300031903 Bacteria 9021
229 Ga0307407_10005209 3300031903 Bacteria 5611
230 Ga0307407_10011336 3300031903 Bacteria 4240
231 Ga0307407_10025134 3300031903 Bacteria 3135
232 Ga0307407_10037637 3300031903 Bacteria 2675
233 Ga0307407_10040828 3300031903 Bacteria 2590
234 Ga0307407_10120167 3300031903 Bacteria 1664
235 Ga0307407_10130729 3300031903 Bacteria 1606
236 Ga0307407_10173552 3300031903 Bacteria 1422
237 Ga0307407_10232803 3300031903 Bacteria 1252
238 Ga0307407_10412709 3300031903 Bacteria 971
239 Ga0307407_10643672 3300031903 Bacteria 793
240 Ga0307412_10000863 3300031911 Bacteria 17426
241 Ga0307412_10003766 3300031911 Bacteria 8429
242 Ga0307412_10023040 3300031911 Bacteria 3827
243 Ga0307412_10038657 3300031911 Bacteria 3074
244 Ga0307412_10044812 3300031911 Bacteria 2887
245 Ga0307412_10061231 3300031911 Bacteria 2529
246 Ga0307412_10088769 3300031911 Bacteria 2157
247 Ga0307412_10151190 3300031911 Bacteria 1713
248 Ga0307412_10458013 3300031911 Bacteria 1052
249 Ga0307412_10682740 3300031911 Bacteria 879
250 Ga0307412_11081247 3300031911 Bacteria 713
251 Ga0307412_11421814 3300031911 Bacteria 628
252 Ga0307409_100002496 3300031995 Bacteria 9637
253 Ga0307409_100016671 3300031995 Bacteria 4870
254 Ga0307409_100017717 3300031995 Bacteria 4759
255 Ga0307409_100047265 3300031995 Bacteria 3265
256 Ga0307409_100062767 3300031995 Bacteria 2910
257 Ga0307409_100065864 3300031995 Bacteria 2853
258 Ga0307409_100088972 3300031995 Bacteria 2522
259 Ga0307409_100198373 3300031995 Bacteria 1793
260 Ga0307409_100216643 3300031995 Bacteria 1725
261 Ga0307409_100224041 3300031995 Bacteria 1700
262 Ga0307409_100232701 3300031995 Bacteria 1671
263 Ga0307409_100499180 3300031995 Bacteria 1184
264 Ga0307409_100798484 3300031995 Bacteria 951
265 Ga0307416_100003113 3300032002 Bacteria 9712
266 Ga0307416_100010844 3300032002 Bacteria 6042
267 Ga0307416_100023028 3300032002 Bacteria 4510
268 Ga0307416_100043224 3300032002 Bacteria 3526
269 Ga0307416_100051515 3300032002 Bacteria 3289
270 Ga0307416_100071512 3300032002 Bacteria 2882
271 Ga0307416_100114240 3300032002 Bacteria 2388
272 Ga0307416_100130560 3300032002 Bacteria 2260
273 Ga0307416_100440721 3300032002 Bacteria 1352
274 Ga0307416_100475444 3300032002 Bacteria 1308
275 Ga0307416_100543209 3300032002 Bacteria 1234
276 Ga0307416_101127892 3300032002 Bacteria 889
277 Ga0307416_101312449 3300032002 Bacteria 829
278 Ga0307416_101430445 3300032002 Bacteria 797
279 Ga0307416_102324236 3300032002 Bacteria 636
280 Ga0307414_10003244 3300032004 Bacteria 8662
281 Ga0307414_10042118 3300032004 Bacteria 3100
282 Ga0307414_10102167 3300032004 Bacteria 2160
283 Ga0307411_10020563 3300032005 Bacteria 3842
284 Ga0307411_10067521 3300032005 Bacteria 2407
285 Ga0307411_10119694 3300032005 Bacteria 1902
286 Ga0307411_10282351 3300032005 Bacteria 1322
287 Ga0307415_100004754 3300032126 Bacteria 7107
288 Ga0307415_100025445 3300032126 Bacteria 3714
289 Ga0307415_100060913 3300032126 Bacteria 2610
290 Ga0307415_100270669 3300032126 Bacteria 1391
291 Ga0307415_100652795 3300032126 Bacteria 943
292 Ga0307415_100791877 3300032126 Bacteria 864
293 Ga0307510_10004225 3300033180 Bacteria 16876
294 Ga0307510_10005756 3300033180 Bacteria 14772
295 Ga0307510_10081748 3300033180 Bacteria 3129
296 Ga0307510_10265809 3300033180 Bacteria 1194
297 Ga0307510_10498500 3300033180 Bacteria 660
298 Ga0395899_0009945 3300037312 Bacteria 7296
299 Ga0395899_0075177 3300037312 Bacteria 2467
300 Ga0395899_0086062 3300037312 Bacteria 2283
301 Ga0395900_0032236 3300037418 Bacteria 5387
302 Ga0395900_0271509 3300037418 Bacteria 1690
303 Ga0395900_0790691 3300037418 Bacteria 877
304 Ga0395898_0005522 3300037466 Bacteria 13647
305 Ga0395898_0014337 3300037466 Bacteria 8146
306 Ga0395898_0052440 3300037466 Bacteria 3985
307 Ga0395898_0284145 3300037466 Bacteria 1578
308 Ga0395898_0412553 3300037466 Bacteria 1287
309 Ga0395905_0406421 3300037471 Bacteria 1257
310 Ga0395905_0909208 3300037471 Bacteria 783
311 Ga0395901_0010715 3300038443 Bacteria 9294
312 Ga0395901_0035434 3300038443 Bacteria 5155
313 Ga0395901_0078966 3300038443 Bacteria 3436
314 Ga0395901_0117672 3300038443 Bacteria 2792
315 Ga0395901_0183706 3300038443 Bacteria 2193
316 Ga0439436_0002002 3300041404 Bacteria 6054
317 Ga0439436_0016382 3300041404 Bacteria 2223
318 Ga0439436_0111257 3300041404 Bacteria 764
319 Ga0439438_023390 3300041405 Bacteria 1703
320 Ga0439438_050433 3300041405 Bacteria 1060
321 Ga0439439_0000854 3300041406 Bacteria 5594
322 Ga0439439_0003145 3300041406 Bacteria 3608
323 Ga0439461_0000787 3300041410 Bacteria 4657
324 Ga0439466_0005784 3300041411 Bacteria 4716
325 Ga0439466_0025012 3300041411 Bacteria 2088
326 Ga0439466_0027983 3300041411 Bacteria 1948
327 Ga0439465_0009939 3300041413 Bacteria 2996
328 Ga0439465_0101644 3300041413 Bacteria 993
329 Ga0451789_0785007 3300041443 Bacteria 868
330 Ga0451791_0410500 3300041451 Bacteria 810
331 Ga0451795_1599879 3300041456 Bacteria 754
332 Ga0451853_1466771 3300041512 Bacteria 1765
333 Ga0451853_3338504 3300041512 Bacteria 3105
334 Ga0439433_0000321 3300041999 Bacteria 8396
335 Ga0439433_0004043 3300041999 Bacteria 3152
336 Ga0439433_0017349 3300041999 Bacteria 1598
337 Ga0439433_0056625 3300041999 Bacteria 930
338 Ga0439442_000028 3300042002 Bacteria 33584
339 Ga0439442_000202 3300042002 Bacteria 14923
340 Ga0439442_000208 3300042002 Bacteria 14596
341 Ga0439442_001492 3300042002 Bacteria 4614
342 Ga0439442_016138 3300042002 Bacteria 1539
343 Ga0439442_020966 3300042002 Bacteria 1355
344 Ga0439448_0000449 3300042005 Bacteria 9477
345 Ga0439448_0034318 3300042005 Bacteria 1621
346 Ga0439432_002607 3300042006 Bacteria 6779
347 Ga0439449_0000141 3300042007 Bacteria 24575
348 Ga0439449_0002023 3300042007 Bacteria 7981
349 Ga0439449_0023063 3300042007 Bacteria 2329
350 Ga0439449_0029958 3300042007 Bacteria 2027
351 Ga0439449_0031305 3300042007 Bacteria 1983
352 Ga0439449_0034059 3300042007 Bacteria 1896
353 Ga0439449_0106362 3300042007 Bacteria 1038
354 Ga0439452_001011 3300042010 Bacteria 12449
355 Ga0439452_072319 3300042010 Bacteria 758
356 Ga0439455_0013444 3300042012 Bacteria 1853
357 Ga0439457_000171 3300042014 Bacteria 16750
358 Ga0439457_000632 3300042014 Bacteria 10382
359 Ga0439457_003861 3300042014 Bacteria 4015
360 Ga0439457_013047 3300042014 Bacteria 1868
361 Ga0439457_042141 3300042014 Bacteria 1018
362 Ga0439462_0017932 3300042015 Bacteria 1836
363 Ga0439462_0025794 3300042015 Bacteria 1548
364 Ga0450919_000743 3300042121 Bacteria 4134
365 Ga0450920_000031 3300042122 Bacteria 16770
366 Ga0450920_001863 3300042122 Bacteria 3541
367 Ga0450920_008754 3300042122 Bacteria 1855
368 Ga0450923_070218 3300042125 Bacteria 776
369 Ga0450890_009239 3300042127 Bacteria 1261
370 Ga0450903_000033 3300042138 Bacteria 27469
371 Ga0450903_026673 3300042138 Bacteria 880
372 Ga0450906_074435 3300042145 Bacteria 610
373 Ga0450907_000343 3300042146 Bacteria 14667
374 Ga0450907_015550 3300042146 Bacteria 1270
375 Ga0450907_056821 3300042146 Bacteria 674
376 Ga0439446_0037802 3300042156 Bacteria 1414
377 Ga0439458_0004773 3300042157 Bacteria 3081
378 Ga0450908_027681 3300042184 Bacteria 988
379 Ga0450909_000577 3300042185 Bacteria 4829
380 Ga0439434_0000181 3300042435 Bacteria 17155
381 Ga0439434_0025680 3300042435 Bacteria 1778
382 Ga0439464_0041304 3300042439 Bacteria 1315
383 Ga0450918_000319 3300042531 Bacteria 10842
384 Ga0450918_016648 3300042531 Bacteria 1278
385 Ga0466969_0001593 3300044656 Bacteria 12143
386 Ga0466969_0026528 3300044656 Bacteria 2971
387 Ga0466969_0045709 3300044656 Bacteria 2173
388 Ga0466972_0000712 3300044658 Bacteria 15908
389 Ga0466972_0008510 3300044658 Bacteria 5148
390 Ga0466972_0009370 3300044658 Bacteria 4922
391 Ga0466972_0187125 3300044658 Bacteria 970
392 Ga0466965_0000469 3300044683 Bacteria 14281
393 Ga0466965_0011579 3300044683 Bacteria 4135
394 Ga0466965_0031182 3300044683 Bacteria 2599
395 Ga0466966_0001612 3300044684 Bacteria 14529
396 Ga0466966_0008860 3300044684 Bacteria 6664
397 Ga0466966_0051060 3300044684 Bacteria 2629
398 Ga0466961_0000237 3300044693 Bacteria 37109
399 Ga0466961_0260106 3300044693 Bacteria 1064
400 Ga0466961_0428399 3300044693 Bacteria 801
401 Ga0466963_0000782 3300044694 Bacteria 15791
402 Ga0466963_0005423 3300044694 Bacteria 7468
403 Ga0466963_0039529 3300044694 Bacteria 3089
404 Ga0466964_0001427 3300044706 Bacteria 8158
405 Ga0466964_0028683 3300044706 Bacteria 2194
406 Ga0466971_0017171 3300044719 Bacteria 3199
407 Ga0466971_0369673 3300044719 Bacteria 696
408 Ga0466968_0109181 3300044735 Bacteria 1243
409 Ga0466968_0116231 3300044735 Bacteria 1207
410 Ga0466970_0000192 3300044765 Bacteria 29653
411 Ga0466970_0003115 3300044765 Bacteria 8056
412 Ga0466970_0005445 3300044765 Bacteria 6316
413 Ga0466970_0091283 3300044765 Bacteria 1653
414 Ga0466970_0145692 3300044765 Bacteria 1306
415 Ga0466970_0226680 3300044765 Bacteria 1044
416 Ga0466970_0591602 3300044765 Bacteria 643
417 Ga0466957_0000488 3300044842 Bacteria 19749
418 Ga0466957_0365381 3300044842 Bacteria 981
419 Ga0466960_0008310 3300044901 Bacteria 4247
420 Ga0466960_0013360 3300044901 Bacteria 3486
421 Ga0466960_0079331 3300044901 Bacteria 1651
422 Ga0466960_0429991 3300044901 Bacteria 764
423 Ga0466959_0005532 3300045049 Bacteria 8668
424 Ga0466959_0285533 3300045049 Bacteria 1132
425 Ga0466959_0405575 3300045049 Bacteria 926
426 Ga0466959_0460686 3300045049 Bacteria 861
427 Ga0466958_0001773 3300045836 Bacteria 10456
428 Ga0466958_0190585 3300045836 Bacteria 1303
429 Ga0466967_0000611 3300045976 Bacteria 17839
430 Ga0466967_0034224 3300045976 Bacteria 4310
431 Ga0466967_0068834 3300045976 Bacteria 3162
432 Ga0466967_1650586 3300045976 Bacteria 638
433 Ga0495617_107545 3300046452 Bacteria 903
434 Ga0495603_0000301 3300046455 Bacteria 26310
435 Ga0495603_0035831 3300046455 Bacteria 2979
436 Ga0495629_0003310 3300046459 Bacteria 12173
437 Ga0495629_0020402 3300046459 Bacteria 4732
438 Ga0495629_0281936 3300046459 Bacteria 1140
439 Ga0495638_0288008 3300046460 Bacteria 890
440 Ga0495638_0342901 3300046460 Bacteria 791
441 Ga0495651_0000915 3300046462 Bacteria 22900
442 Ga0495651_0038768 3300046462 Bacteria 3710
443 Ga0495653_0006950 3300046463 Bacteria 9291
444 Ga0495653_0082052 3300046463 Bacteria 2381
445 Ga0495580_0003163 3300046472 Bacteria 14113
446 Ga0495580_0026321 3300046472 Bacteria 4242
447 Ga0495582_0132197 3300046473 Bacteria 1410
448 Ga0495605_0009377 3300046474 Bacteria 5500
449 Ga0495605_0082197 3300046474 Bacteria 1505
450 Ga0495639_0009726 3300046475 Bacteria 4127
451 Ga0495662_0002502 3300046476 Bacteria 9272
452 Ga0495662_0004930 3300046476 Bacteria 6680
453 Ga0495662_0031019 3300046476 Bacteria 2581
454 Ga0495662_0421762 3300046476 Bacteria 655
455 Ga0495664_0001219 3300046477 Bacteria 13454
456 Ga0495664_0061630 3300046477 Bacteria 2233
457 Ga0495664_0092488 3300046477 Bacteria 1819
458 Ga0495585_0026362 3300046492 Bacteria 3319
459 Ga0495585_0031788 3300046492 Bacteria 2995
460 Ga0495594_0033945 3300046499 Bacteria 2775
461 Ga0495594_0047990 3300046499 Bacteria 2345
462 Ga0495594_0066872 3300046499 Bacteria 1994
463 Ga0495594_0109223 3300046499 Bacteria 1559
464 Ga0495594_0285469 3300046499 Bacteria 940
465 Ga0495594_0360675 3300046499 Bacteria 827
466 Ga0495596_0038542 3300046500 Bacteria 1889
467 Ga0495607_0026962 3300046501 Bacteria 3559
468 Ga0495583_0104341 3300046506 Bacteria 1207
469 Ga0495606_0001671 3300046507 Bacteria 28733
470 Ga0495606_0161614 3300046507 Bacteria 1306
471 Ga0495610_0057465 3300046512 Bacteria 1865
472 Ga0495610_0140939 3300046512 Bacteria 1038
473 Ga0495616_0305192 3300046513 Bacteria 671
474 Ga0495618_0012800 3300046514 Bacteria 5098
475 Ga0495618_0029449 3300046514 Bacteria 3427
476 Ga0495618_0060819 3300046514 Bacteria 2395
477 Ga0495620_0002213 3300046515 Bacteria 11288
478 Ga0495628_0389062 3300046516 Bacteria 1020
479 Ga0495630_0045217 3300046517 Bacteria 3290
480 Ga0495631_0001344 3300046518 Bacteria 15027
481 Ga0495631_0190383 3300046518 Bacteria 878
482 Ga0495637_0044630 3300046520 Bacteria 1886
483 Ga0495643_0004460 3300046522 Bacteria 9777
484 Ga0495643_0014350 3300046522 Bacteria 4714
485 Ga0495643_0243270 3300046522 Bacteria 843
486 Ga0495648_0030131 3300046524 Bacteria 3593
487 Ga0495663_0219785 3300046525 Bacteria 668
488 Ga0495666_0027417 3300046526 Bacteria 2803
489 Ga0495666_0036253 3300046526 Bacteria 2402
490 Ga0495666_0162713 3300046526 Bacteria 1034
491 Ga0495642_0004717 3300046528 Bacteria 5280
492 Ga0495642_0163598 3300046528 Bacteria 965
493 Ga0495652_0163505 3300046529 Bacteria 1725
494 Ga0495654_0170738 3300046530 Bacteria 948
495 Ga0495665_0002369 3300046531 Bacteria 10170
496 Ga0495665_0088919 3300046531 Bacteria 1623
497 Ga0495640_0137129 3300046533 Bacteria 1579
498 Ga0495586_0002268 3300046535 Bacteria 10463
499 Ga0495586_0004109 3300046535 Bacteria 7799
500 Ga0495586_0011519 3300046535 Bacteria 4704
501 Ga0495586_0017747 3300046535 Bacteria 3786
502 Ga0495586_0060079 3300046535 Bacteria 2066
503 Ga0495587_0004295 3300046536 Bacteria 9413
504 Ga0495587_0022266 3300046536 Bacteria 3902
505 Ga0495587_0052191 3300046536 Bacteria 2413
506 Ga0495609_0038255 3300046538 Bacteria 2163
507 Ga0495609_0113921 3300046538 Bacteria 1166
508 Ga0495597_0021872 3300046542 Bacteria 2971
509 Ga0495597_0025086 3300046542 Bacteria 2746
510 Ga0495645_0042521 3300046543 Bacteria 3313
511 Ga0495645_0077133 3300046543 Bacteria 2396
512 Ga0495622_0013070 3300046557 Bacteria 3852
513 Ga0495622_0014928 3300046557 Bacteria 3610
514 Ga0495633_0141967 3300046558 Bacteria 1110
515 Ga0495633_0262571 3300046558 Bacteria 787
516 Ga0495667_0005051 3300046559 Bacteria 8922
517 Ga0495667_0014027 3300046559 Bacteria 5410
518 Ga0495667_0179308 3300046559 Bacteria 1360
519 Ga0495667_0307310 3300046559 Bacteria 1004
520 Ga0495667_0438930 3300046559 Bacteria 821
521 Ga0495656_0001419 3300046615 Bacteria 7836
522 Ga0495656_0016996 3300046615 Bacteria 2770
523 Ga0495668_0010285 3300046616 Bacteria 5674
524 Ga0495668_0047613 3300046616 Bacteria 2380
525 Ga0495634_0002621 3300046642 Bacteria 14805
526 Ga0495634_0026488 3300046642 Bacteria 4045
527 Ga0495611_0043464 3300046648 Bacteria 2009
528 Ga0495611_0047879 3300046648 Bacteria 1919
529 Ga0495611_0077578 3300046648 Bacteria 1524
530 Ga0495611_0132490 3300046648 Bacteria 1163
531 Ga0495625_0003384 3300046660 Bacteria 15983
532 Ga0495625_0110954 3300046660 Bacteria 1874
533 Ga0495625_0672977 3300046660 Bacteria 614
534 Ga0495635_0159600 3300046663 Bacteria 1534
535 Ga0495635_0304871 3300046663 Bacteria 1067
536 Ga0495635_0488000 3300046663 Bacteria 812
537 Ga0495659_0316909 3300046664 Bacteria 661
538 Ga0495661_0046233 3300046665 Bacteria 2659
539 Ga0495661_0106965 3300046665 Bacteria 1565
540 Ga0495661_0309020 3300046665 Bacteria 789
541 Ga0495588_0006323 3300046674 Bacteria 5332
542 Ga0495588_0006960 3300046674 Bacteria 5127
543 Ga0495588_0012490 3300046674 Bacteria 4016
544 Ga0495657_0001642 3300046675 Bacteria 19219
545 Ga0495657_0028869 3300046675 Bacteria 3895
546 Ga0495657_0032971 3300046675 Bacteria 3610
547 Ga0495657_0037835 3300046675 Bacteria 3323
548 Ga0495657_0125658 3300046675 Bacteria 1611
549 Ga0495599_0398187 3300046678 Bacteria 820
550 Ga0495623_0064930 3300046679 Bacteria 2283
551 Ga0495646_0009636 3300046680 Bacteria 6132
552 Ga0495658_0098812 3300046683 Bacteria 1739
553 Ga0495613_0000345 3300046689 Bacteria 41165
554 Ga0495613_0015885 3300046689 Bacteria 5605
555 Ga0495613_0021709 3300046689 Bacteria 4783
556 Ga0495613_0033208 3300046689 Bacteria 3834
557 Ga0495613_0050889 3300046689 Bacteria 3054
558 Ga0495613_0052728 3300046689 Bacteria 2994
559 Ga0495613_0107375 3300046689 Bacteria 2013
560 Ga0495613_0117762 3300046689 Bacteria 1910
561 Ga0495624_0035807 3300046690 Bacteria 3203
562 Ga0495624_0147310 3300046690 Bacteria 1440
563 Ga0495670_0006381 3300046691 Bacteria 5794
564 Ga0495670_0014913 3300046691 Bacteria 3826
565 Ga0495670_0083583 3300046691 Bacteria 1628
566 Ga0495671_0037267 3300046692 Bacteria 2460
567 Ga0495671_0055977 3300046692 Bacteria 1953
568 Ga0495671_0093192 3300046692 Bacteria 1474
569 Ga0495649_0021626 3300046694 Bacteria 3603
570 Ga0495649_0024820 3300046694 Bacteria 3342
571 Ga0495649_0184351 3300046694 Bacteria 1088
572 Ga0495589_0014011 3300046794 Bacteria 4134
573 Ga0495589_0016264 3300046794 Bacteria 3823
574 Ga0495589_0018530 3300046794 Bacteria 3568
575 Ga0495589_0072194 3300046794 Bacteria 1686
576 Ga0495589_0125385 3300046794 Bacteria 1235
577 Ga0495600_0015559 3300046809 Bacteria 4812
578 Ga0495600_0019304 3300046809 Bacteria 4352
579 Ga0495600_0384971 3300046809 Bacteria 874
580 Ga0495581_0003778 3300047315 Bacteria 8710
581 Ga0495581_0021308 3300047315 Bacteria 3758
582 Ga0495581_0059108 3300047315 Bacteria 2215
583 Ga0495581_0082981 3300047315 Bacteria 1856
584 Ga0495581_0277158 3300047315 Bacteria 980
585 Ga0495581_0310486 3300047315 Bacteria 922
586 Ga0495604_0000331 3300047317 Bacteria 42336
587 Ga0495604_0177051 3300047317 Bacteria 1494
588 Ga0495636_0001675 3300047318 Bacteria 8447
589 Ga0495636_0003069 3300047318 Bacteria 6479
590 Ga0495636_0007105 3300047318 Bacteria 4407
591 Ga0495636_0080747 3300047318 Bacteria 1400
592 Ga0495636_0448448 3300047318 Bacteria 619
593 Ga0495636_0451231 3300047318 Bacteria 617
594 Ga0495674_0313715 3300047319 Bacteria 1279
595 Ga0495672_0136140 3300047320 Bacteria 1288
596 Ga0495672_0343443 3300047320 Bacteria 695
597 Ga0495676_0001973 3300047321 Bacteria 18026
598 Ga0495676_0002533 3300047321 Bacteria 16252
599 Ga0495676_0062777 3300047321 Bacteria 2898
600 Ga0495676_0327733 3300047321 Bacteria 1027
601 Ga0495680_0025831 3300047322 Bacteria 4855
602 Ga0495680_0027575 3300047322 Bacteria 4664
603 Ga0495683_0173213 3300047323 Bacteria 990
604 Ga0495687_001006 3300047443 Bacteria 28126
605 Ga0495687_002032 3300047443 Bacteria 17108
606 Ga0495687_013692 3300047443 Bacteria 4215
607 Ga0495687_022647 3300047443 Bacteria 3012
608 Ga0495687_079775 3300047443 Bacteria 1286
609 Ga0495687_116544 3300047443 Bacteria 971
610 Ga0495687_175287 3300047443 Bacteria 705
611 Ga0495675_0012981 3300047444 Bacteria 5253
612 Ga0495675_0030907 3300047444 Bacteria 3417
613 Ga0495675_0033602 3300047444 Bacteria 3273
614 Ga0495675_0248217 3300047444 Bacteria 1070
615 Ga0495675_0428769 3300047444 Bacteria 767
616 Ga0495677_0045801 3300047445 Bacteria 1605
617 Ga0495677_0155132 3300047445 Bacteria 882
618 Ga0495677_0168718 3300047445 Bacteria 846
619 Ga0495685_005882 3300047447 Bacteria 4007
620 Ga0495685_035911 3300047447 Bacteria 1702
621 Ga0495685_076525 3300047447 Bacteria 1117
622 Ga0495685_184466 3300047447 Bacteria 671
623 Ga0495681_0003485 3300047470 Bacteria 10949
624 Ga0495681_0058787 3300047470 Bacteria 1780
625 Ga0495684_0028383 3300047471 Bacteria 4297
626 Ga0495686_0108718 3300047472 Bacteria 1665
627 Ga0495593_0007738 3300047673 Bacteria 6266
628 Ga0495593_0026017 3300047673 Bacteria 3235
629 Ga0495593_0056456 3300047673 Bacteria 2064
630 Ga0495593_0257592 3300047673 Bacteria 873
631 Ga0495614_0004986 3300048089 Bacteria 5992
632 Ga0495614_0024939 3300048089 Bacteria 2580
633 Ga0495614_0293369 3300048089 Bacteria 750
634 Ga0495615_0007187 3300048090 Bacteria 2102
635 Ga0495626_0012086 3300048091 Bacteria 4542
636 Ga0496100_0028311 3300048903 Bacteria 3455
637 Ga0496100_0595422 3300048903 Bacteria 858
638 Ga0496101_0048253 3300048904 Bacteria 3059
639 Ga0496101_0591425 3300048904 Bacteria 877
640 Ga0496101_1144348 3300048904 Bacteria 610
641 Ga0496102_0024784 3300048905 Bacteria 5336
642 Ga0496102_0100582 3300048905 Bacteria 2685
643 Ga0496102_0117987 3300048905 Bacteria 2477
644 Ga0496102_0443505 3300048905 Bacteria 1218
645 Ga0496103_0024600 3300048906 Bacteria 3635
646 Ga0496103_0024753 3300048906 Bacteria 3622
647 Ga0496103_0089235 3300048906 Bacteria 1944
648 Ga0496103_0107625 3300048906 Bacteria 1769
649 Ga0496103_0279122 3300048906 Bacteria 1074
650 Ga0496105_0009128 3300048908 Bacteria 7737
651 Ga0496106_0020555 3300048909 Bacteria 4901
652 Ga0496106_0094082 3300048909 Bacteria 2316
653 Ga0496108_0331606 3300048911 Bacteria 1327
654 Ga0496109_0067134 3300048912 Bacteria 3285
655 Ga0496109_0072886 3300048912 Bacteria 3155
656 Ga0496109_0104947 3300048912 Bacteria 2624
657 Ga0496110_0053627 3300048913 Bacteria 3545
658 Ga0496110_0669166 3300048913 Bacteria 938
659 Ga0496111_0014722 3300048914 Bacteria 5350
660 Ga0496111_0021670 3300048914 Bacteria 4490
661 Ga0496111_0129657 3300048914 Bacteria 1865
662 Ga0496112_0008887 3300048915 Bacteria 9015
663 Ga0496112_0879100 3300048915 Bacteria 819
664 Ga0496113_0113201 3300048916 Bacteria 2114
665 Ga0496113_0247518 3300048916 Bacteria 1423
666 Ga0496114_0085377 3300048917 Bacteria 2673
667 Ga0496115_0018479 3300048918 Bacteria 5353
668 Ga0496117_0027498 3300048920 Bacteria 4431
669 Ga0496118_0001425 3300048921 Bacteria 36014
670 Ga0496119_0145607 3300048922 Bacteria 1275
671 Ga0496119_0408845 3300048922 Bacteria 646
672 Ga0496119_0418399 3300048922 Bacteria 636
673 Ga0496122_0218999 3300048925 Bacteria 1094
674 Ga0496123_0024875 3300048926 Bacteria 4533
675 Ga0496124_0000075 3300048927 Bacteria 218086
676 Ga0496124_0024701 3300048927 Bacteria 5458
677 Ga0496124_0040301 3300048927 Bacteria 4042
678 Ga0496124_0426746 3300048927 Bacteria 911
679 Ga0496125_0020894 3300048928 Bacteria 6127
680 Ga0496126_0590806 3300048929 Bacteria 876
681 Ga0501306_007587 3300049127 Bacteria 1302
682 Ga0501306_029110 3300049127 Bacteria 812
683 Ga0501306_030279 3300049127 Bacteria 801
684 Ga0501306_041660 3300049127 Bacteria 714
685 Ga0501306_046647 3300049127 Bacteria 685
686 Ga0501308_011777 3300049128 Bacteria 991
687 Ga0501308_023905 3300049128 Bacteria 783
688 Ga0501308_042955 3300049128 Bacteria 642
689 Ga0501308_054596 3300049128 Bacteria 592
690 Ga0501309_022869 3300049129 Bacteria 886
691 Ga0501310_013552 3300049130 Bacteria 947
692 Ga0501310_034265 3300049130 Bacteria 685
693 Ga0501304_014724 3300049160 Bacteria 727
694 Ga0501304_020821 3300049160 Bacteria 649
695 Ga0501304_023373 3300049160 Bacteria 625
696 Ga0501305_027632 3300049161 Bacteria 870
697 Ga0501305_064184 3300049161 Bacteria 637
698 Ga0501307_024303 3300049162 Bacteria 807
699 Ga0501307_052763 3300049162 Bacteria 615
700 Ga0501307_057037 3300049162 Bacteria 599
701 Ga0501311_026481 3300049527 Bacteria 817
702 Ga0501311_056111 3300049527 Bacteria 627
703 Ga0501312_039896 3300049528 Bacteria 764
704 Ga0501312_053518 3300049528 Bacteria 685
705 Ga0501312_061123 3300049528 Bacteria 653
706 Ga0501312_080677 3300049528 Bacteria 588
707 Ga0501313_024058 3300049529 Bacteria 765
708 Ga0501313_038719 3300049529 Bacteria 636
709 Ga0501313_045354 3300049529 Bacteria 599
710 Ga0501314_017571 3300049530 Bacteria 721
711 Ga0501315_015556 3300049531 Bacteria 976
712 Ga0501315_024854 3300049531 Bacteria 831
713 Ga0501315_038871 3300049531 Bacteria 713
714 Ga0501315_048721 3300049531 Bacteria 660
715 Ga0501315_049269 3300049531 Bacteria 658
716 Ga0501315_063259 3300049531 Bacteria 602
717 Ga0501316_019387 3300049532 Bacteria 847
718 Ga0501316_023273 3300049532 Bacteria 794
719 Ga0501317_028356 3300049533 Bacteria 800
720 Ga0501317_052812 3300049533 Bacteria 650
721 Ga0501318_029548 3300049534 Bacteria 739
722 Ga0501318_033816 3300049534 Bacteria 706
723 Ga0501319_005497 3300049535 Bacteria 911
724 Ga0501319_012920 3300049535 Bacteria 688
725 Ga0501319_020396 3300049535 Bacteria 591
726 Ga0501320_009108 3300049536 Bacteria 989
727 Ga0501320_026878 3300049536 Bacteria 697
728 Ga0501320_042814 3300049536 Bacteria 598
729 Ga0501321_011784 3300049537 Bacteria 980
730 Ga0501321_024814 3300049537 Bacteria 769
731 Ga0501321_027620 3300049537 Bacteria 742
732 Ga0501322_005976 3300049538 Bacteria 856
733 Ga0501322_006812 3300049538 Bacteria 819
734 Ga0501322_018994 3300049538 Bacteria 592
735 Ga0501323_010324 3300049539 Bacteria 1112
736 Ga0501323_029308 3300049539 Bacteria 766
737 Ga0501323_030112 3300049539 Bacteria 758
738 Ga0501323_047502 3300049539 Bacteria 644
739 Ga0501325_008801 3300049541 Bacteria 884
740 Ga0501326_06983 3300049542 Bacteria 638
741 Ga0501331_04537 3300049547 Bacteria 777
742 Ga0501332_09604 3300049548 Bacteria 639
743 Ga0501338_09938 3300049554 Bacteria 638
744 Ga0501340_013022 3300049556 Bacteria 636
745 Ga0501032_0001066 3300049569 Bacteria 21921
746 Ga0501032_0016945 3300049569 Bacteria 5121
747 Ga0501032_0040105 3300049569 Bacteria 3183
748 Ga0501033_0057503 3300049570 Bacteria 2874
749 Ga0501033_0186510 3300049570 Bacteria 1486
750 Ga0501033_0493561 3300049570 Bacteria 847
751 Ga0501033_0815326 3300049570 Bacteria 630
752 Ga0501034_0000038 3300049571 Bacteria 237795
753 Ga0501034_0006957 3300049571 Bacteria 12088
754 Ga0501034_0078180 3300049571 Bacteria 3313
755 Ga0501034_0164540 3300049571 Bacteria 2187
756 Ga0501034_0284387 3300049571 Bacteria 1593
757 Ga0501036_0001650 3300049572 Bacteria 17283
758 Ga0501036_0020328 3300049572 Bacteria 5576
759 Ga0501036_0097413 3300049572 Bacteria 2486
760 Ga0501036_0244453 3300049572 Bacteria 1505
761 Ga0501037_0004406 3300049573 Bacteria 10227
762 Ga0501037_0009946 3300049573 Bacteria 6975
763 Ga0501037_0028683 3300049573 Bacteria 4111
764 Ga0501038_0000842 3300049574 Bacteria 27261
765 Ga0501038_0020152 3300049574 Bacteria 6001
766 Ga0501038_0024313 3300049574 Bacteria 5406
767 Ga0501038_0045736 3300049574 Bacteria 3798
768 Ga0501038_0057100 3300049574 Bacteria 3352
769 Ga0501038_0088375 3300049574 Bacteria 2601
770 Ga0501038_0214341 3300049574 Bacteria 1539
771 Ga0501039_0008147 3300049575 Bacteria 7985
772 Ga0501039_0057277 3300049575 Bacteria 3018
773 Ga0501039_0182627 3300049575 Bacteria 1649
774 Ga0501039_0326023 3300049575 Bacteria 1207
775 Ga0501039_0469318 3300049575 Bacteria 988
776 Ga0501042_0029977 3300049578 Bacteria 3840
777 Ga0501043_0010239 3300049579 Bacteria 7349
778 Ga0501043_0028273 3300049579 Bacteria 4401
779 Ga0501043_0028524 3300049579 Bacteria 4382
780 Ga0501043_0106380 3300049579 Bacteria 2203
781 Ga0501043_0191280 3300049579 Bacteria 1591
782 Ga0501043_0377046 3300049579 Bacteria 1074
783 Ga0501043_0552149 3300049579 Bacteria 855
784 Ga0501046_0745209 3300049580 Bacteria 688
785 Ga0501047_0088361 3300049581 Bacteria 2976
786 Ga0501047_0214624 3300049581 Bacteria 1781
787 Ga0501047_0730753 3300049581 Bacteria 807
788 Ga0501047_0916527 3300049581 Bacteria 690
789 Ga0501048_0013427 3300049582 Bacteria 6078
790 Ga0501067_0293773 3300049583 Bacteria 905
791 Ga0501070_0000699 3300049586 Bacteria 30827
792 Ga0501070_0106955 3300049586 Bacteria 2312
793 Ga0501073_0750132 3300049589 Bacteria 673
794 Ga0501074_0002089 3300049590 Bacteria 13798
795 Ga0501080_0092226 3300049742 Bacteria 2813
796 Ga0501083_0391421 3300049744 Bacteria 904
797 Ga0501279_038272 3300049775 Bacteria 729
798 Ga0501035_0011628 3300049822 Bacteria 8159
799 Ga0501035_0017014 3300049822 Bacteria 6701
800 Ga0501035_0033495 3300049822 Bacteria 4672
801 Ga0501035_0077672 3300049822 Bacteria 2934
802 Ga0501035_0213002 3300049822 Bacteria 1652
803 Ga0501044_0001666 3300049823 Bacteria 26069
804 Ga0501044_0003537 3300049823 Bacteria 17592
805 Ga0501044_0020765 3300049823 Bacteria 7009
806 Ga0501044_0066567 3300049823 Bacteria 3672
807 Ga0501044_0158658 3300049823 Bacteria 2240
808 Ga0501044_0166487 3300049823 Bacteria 2178
809 Ga0501044_0246843 3300049823 Bacteria 1728
810 nmdc:mga03n38_27714_c1 3300050490 Bacteria 2353
811 nmdc:mga00v17_166774_c1 3300050491 Bacteria 1419
812 nmdc:mga06z11_3998_c1 3300050494 Bacteria 5756
813 nmdc:mga04h51_6421_c1 3300050495 Bacteria 3049
814 Ga0495655_0029982 3300053083 Bacteria 1312
815 Ga0500644_0019646 3300053088 Bacteria 1998
816 Ga0500640_123794 3300053095 Bacteria 1031
817 Ga0500650_0082608 3300053098 Bacteria 1503
818 Ga0500553_040173 3300053101 Bacteria 2298
819 Ga0500560_001299 3300053107 Bacteria 4239
820 Ga0500655_051009 3300053133 Bacteria 825
821 Ga0500573_0004435 3300053140 Bacteria 7399
822 Ga0500573_0007965 3300053140 Bacteria 5816
823 Ga0500573_0132382 3300053140 Bacteria 1380
824 Ga0500577_0079825 3300053142 Bacteria 1302
825 Ga0500600_0170175 3300053149 Bacteria 1060
826 Ga0500600_0258692 3300053149 Bacteria 774
827 Ga0500624_001893 3300053157 Bacteria 3020
828 Ga0500634_0226384 3300053161 Bacteria 798
829 Ga0500636_0108504 3300053177 Bacteria 1571
830 Ga0587085_087139 3300059506 Bacteria 639
831 Ga0587088_050404 3300059508 Bacteria 814
832 Ga0587090_012051 3300059510 Bacteria 1227
833 Ga0587072_097673 3300059643 Bacteria 655
834 Ga0466962_0001240 3300061719 Bacteria 11757
835 Ga0466962_0006899 3300061719 Bacteria 5444
836 Ga0466962_0099110 3300061719 Bacteria 1399

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031548 Ga0307408_100204862 Ga0307408_1002048621 160
2 3300031852 Ga0307410_10076239 Ga0307410_100762392 160
3 3300031903 Ga0307407_10037637 Ga0307407_100376374 160
4 3300031995 Ga0307409_100062767 Ga0307409_1000627673 160
5 3300032002 Ga0307416_100003113 Ga0307416_1000031133 160
6 3300020081 Ga0206354_10122585 Ga0206354_101225851 161
7 3300020081 Ga0206354_11573772 Ga0206354_115737721 161
8 3300022467 Ga0224712_10219254 Ga0224712_102192541 161
9 3300031901 Ga0307406_10492935 Ga0307406_104929352 161
10 3300031903 Ga0307407_10130729 Ga0307407_101307291 161
11 3300031911 Ga0307412_11421814 Ga0307412_114218141 161
12 3300031995 Ga0307409_100798484 Ga0307409_1007984842 161
13 3300037312 Ga0395899_0009945 Ga0395899_0009945_45_602 161
14 3300037418 Ga0395900_0790691 Ga0395900_0790691_163_720 161
15 3300037466 Ga0395898_0052440 Ga0395898_0052440_3189_3746 161
16 3300038443 Ga0395901_0183706 Ga0395901_0183706_1200_1757 161
17 3300044901 Ga0466960_0079331 Ga0466960_0079331_904_1464 161
18 3300049529 Ga0501313_038719 Ga0501313_038719_25_582 161
19 3300059506 Ga0587085_087139 Ga0587085_087139_52_609 161
20 3300041404 Ga0439436_0111257 Ga0439436_0111257_91_645 163
21 3300041406 Ga0439439_0003145 Ga0439439_0003145_2957_3511 163
22 3300041410 Ga0439461_0000787 Ga0439461_0000787_3220_3774 163
23 3300041411 Ga0439466_0005784 Ga0439466_0005784_4074_4628 163
24 3300041413 Ga0439465_0101644 Ga0439465_0101644_119_673 163
25 3300042002 Ga0439442_001492 Ga0439442_001492_537_1091 163
26 3300042006 Ga0439432_002607 Ga0439432_002607_5682_6236 163
27 3300042007 Ga0439449_0034059 Ga0439449_0034059_633_1187 163
28 3300042010 Ga0439452_001011 Ga0439452_001011_4105_4659 163
29 3300042014 Ga0439457_000632 Ga0439457_000632_2773_3327 163
30 3300042121 Ga0450919_000743 Ga0450919_000743_2052_2606 163
31 3300042125 Ga0450923_070218 Ga0450923_070218_139_693 163
32 3300042146 Ga0450907_015550 Ga0450907_015550_394_948 163
33 3300042156 Ga0439446_0037802 Ga0439446_0037802_91_645 163
34 3300042185 Ga0450909_000577 Ga0450909_000577_31_585 163
35 3300042531 Ga0450918_016648 Ga0450918_016648_462_1016 163
36 iso_pu_bacteria 2844849076 2844850657 163
37 3300002773 JGI25152J39213_1001239 JGI25152J39213_10012394 164
38 3300025258 Ga0209129_1000518 Ga0209129_100051815 164
39 3300025294 Ga0209025_1000369 Ga0209025_100036951 164
40 3300025934 Ga0207686_10107692 Ga0207686_101076922 164
41 3300005457 Ga0070662_100203477 Ga0070662_1002034771 165
42 3300026067 Ga0207678_10010712 Ga0207678_100107126 165
43 3300026116 Ga0207674_11030161 Ga0207674_110301611 165
44 3300031548 Ga0307408_100757379 Ga0307408_1007573792 165
45 3300031903 Ga0307407_10412709 Ga0307407_104127092 165
46 3300031995 Ga0307409_100047265 Ga0307409_1000472652 165
47 3300032002 Ga0307416_100051515 Ga0307416_1000515153 165
48 3300042145 Ga0450906_074435 Ga0450906_074435_38_592 165
49 3300042435 Ga0439434_0025680 Ga0439434_0025680_93_647 165
50 3300042439 Ga0439464_0041304 Ga0439464_0041304_539_1087 165
51 3300005564 Ga0070664_100620473 Ga0070664_1006204732 166
52 3300020069 Ga0197907_10856159 Ga0197907_108561591 166
53 3300020076 Ga0206355_1325693 Ga0206355_13256932 166
54 3300020080 Ga0206350_10339140 Ga0206350_103391401 166
55 3300020081 Ga0206354_10852819 Ga0206354_108528191 166
56 3300020082 Ga0206353_11108962 Ga0206353_111089622 166
57 3300025933 Ga0207706_10214318 Ga0207706_102143182 166
58 3300042002 Ga0439442_000208 Ga0439442_000208_3356_3913 166
59 3300046472 Ga0495580_0026321 Ga0495580_0026321_3116_3682 167
60 3300005327 Ga0070658_10862152 Ga0070658_108621521 168
61 3300013104 Ga0157370_10155288 Ga0157370_101552882 168
62 3300013105 Ga0157369_10150165 Ga0157369_101501653 168
63 3300020075 Ga0206349_1229207 Ga0206349_12292071 168
64 3300020080 Ga0206350_11395529 Ga0206350_113955292 168
65 3300020081 Ga0206354_10978295 Ga0206354_109782951 168
66 3300022467 Ga0224712_10108449 Ga0224712_101084492 168
67 3300044765 Ga0466970_0005445 Ga0466970_0005445_824_1381 168
68 3300044765 Ga0466970_0145692 Ga0466970_0145692_695_1252 168
69 3300048915 Ga0496112_0879100 Ga0496112_0879100_159_716 168
70 3300013100 Ga0157373_10003130 Ga0157373_100031303 170
71 3300046476 Ga0495662_0421762 Ga0495662_0421762_96_629 170
72 3300005937 Ga0081455_10000520 Ga0081455_1000052025 172
73 iso_pu_bacteria 2728369276 2729905353 172
74 iso_pu_bacteria 2866552031 2866553980 172
75 iso_pu_bacteria 2995463766 2995470323 172
76 3300046648 Ga0495611_0077578 Ga0495611_0077578_879_1442 173
77 iso_pu_bacteria 2554235227 2555230720 173
78 iso_pu_bacteria 2654587600 2655031904 173
79 iso_pu_bacteria 2974315732 2974317134 173
80 iso_pu_bacteria 2984523437 2984525340 173
81 iso_pu_bacteria 2616644814 2616695766 174
82 iso_pu_bacteria 2616644941 2616904748 174
83 iso_pu_bacteria 2643221548 2643763398 174
84 iso_pu_bacteria 2643221682 2644463732 174
85 iso_pu_bacteria 2690315906 2691511867 174
86 iso_pu_bacteria 2751185788 2753300510 174
87 iso_pu_bacteria 2775506735 2775657207 174
88 iso_pu_bacteria 2808606357 2808829049 174
89 iso_pu_bacteria 2808606360 2808850273 174
90 iso_pu_bacteria 2808606366 2808877177 174
91 iso_pu_bacteria 2808606370 2808893293 174
92 iso_pu_bacteria 2808606370 2808894998 174
93 iso_pu_bacteria 2808606371 2808898637 174
94 iso_pu_bacteria 2811994871 2812319214 174
95 iso_pu_bacteria 2862382967 2862383025 174
96 iso_pu_bacteria 2904430863 2904433935 174
97 iso_pu_bacteria 2904501621 2904502395 174
98 iso_pu_bacteria 2908674828 2908677406 174
99 iso_pu_bacteria 2909074476 2909076037 174
100 iso_pu_bacteria 2919039151 2919042179 174
101 iso_pu_bacteria 2919042368 2919045219 174
102 iso_pu_bacteria 2928104781 2928106953 174
103 iso_pu_bacteria 2928500415 2928503577 174
104 iso_pu_bacteria 2945916053 2945916968 174
105 iso_pu_bacteria 2945920336 2945922784 174
106 iso_pu_bacteria 2945941187 2945945428 174
107 iso_pu_bacteria 2946037020 2946041527 174
108 iso_pu_bacteria 2946059875 2946060799 174
109 iso_pu_bacteria 2953998280 2954002731 174
110 iso_pu_bacteria 2966598605 2966602382 174
111 iso_pu_bacteria 2974302888 2974304957 174
112 iso_pu_bacteria 2984551494 2984552625 174
113 iso_pu_bacteria 8008558824 8008561030 174
114 3300046690 Ga0495624_0147310 Ga0495624_0147310_244_816 175
115 3300047444 Ga0495675_0030907 Ga0495675_0030907_1893_2456 175
116 3300053107 Ga0500560_001299 Ga0500560_001299_3001_3573 175
117 3300053140 Ga0500573_0004435 Ga0500573_0004435_5363_5935 175
118 iso_pu_bacteria 2738543005 2739203157 175
119 iso_pu_bacteria 2784746763 2785345947 175
120 iso_pu_bacteria 2808606700 2810365583 175
121 iso_pu_bacteria 2818991463 2819698149 175
122 iso_pu_bacteria 2862290372 2862293660 175
123 iso_pu_bacteria 2862574272 2862580353 175
124 iso_pu_bacteria 2863404153 2863407214 175
125 iso_pu_bacteria 2905926851 2905929804 175
126 iso_pu_bacteria 2912715099 2912715707 175
127 iso_pu_bacteria 2928142448 2928142618 175
128 iso_pu_bacteria 2946003308 2946006271 175
129 iso_pu_bacteria 2954002825 2954009389 175
130 iso_pu_bacteria 2990059506 2990063631 175
131 iso_pu_bacteria 8008574985 8008575668 175
132 iso_pu_bacteria 8048406513 8048409865 175
133 3300044656 Ga0466969_0001593 Ga0466969_0001593_2297_2848 176
134 3300044656 Ga0466969_0045709 Ga0466969_0045709_1371_1922 176
135 3300044684 Ga0466966_0008860 Ga0466966_0008860_1891_2442 176
136 3300044684 Ga0466966_0051060 Ga0466966_0051060_566_1117 176
137 3300044719 Ga0466971_0017171 Ga0466971_0017171_316_867 176
138 3300044765 Ga0466970_0226680 Ga0466970_0226680_313_864 176
139 3300045049 Ga0466959_0005532 Ga0466959_0005532_3844_4395 176
140 3300061719 Ga0466962_0001240 Ga0466962_0001240_805_1356 176
141 iso_pu_bacteria 2547132111 2547409245 176
142 iso_pu_bacteria 2554235005 2554260700 176
143 iso_pu_bacteria 2582581314 2585315027 176
144 iso_pu_bacteria 2616644814 2616693792 176
145 iso_pu_bacteria 2643221647 2644270673 176
146 iso_pu_bacteria 2643221678 2644440720 176
147 iso_pu_bacteria 2643221714 2644630216 176
148 iso_pu_bacteria 2784132148 2784592142 176
149 iso_pu_bacteria 2784746768 2785374396 176
150 iso_pu_bacteria 2786546132 2786674497 176
151 iso_pu_bacteria 2808606359 2808845597 176
152 iso_pu_bacteria 2808606375 2808915388 176
153 iso_pu_bacteria 2808606448 2809235830 176
154 iso_pu_bacteria 2811994879 2812354098 176
155 iso_pu_bacteria 2811994917 2812483005 176
156 iso_pu_bacteria 2852635781 2852635790 176
157 iso_pu_bacteria 2857740372 2857743979 176
158 iso_pu_bacteria 2862281513 2862282829 176
159 iso_pu_bacteria 2862507626 2862513452 176
160 iso_pu_bacteria 2867428634 2867429491 176
161 iso_pu_bacteria 2904497146 2904499028 176
162 iso_pu_bacteria 2904765812 2904765817 176
163 iso_pu_bacteria 2904770941 2904773688 176
164 iso_pu_bacteria 2904776348 2904779849 176
165 iso_pu_bacteria 2908811453 2908814980 176
166 iso_pu_bacteria 2910809715 2910814444 176
167 iso_pu_bacteria 2912723979 2912728645 176
168 iso_pu_bacteria 2919034639 2919036650 176
169 iso_pu_bacteria 2919059106 2919061014 176
170 iso_pu_bacteria 2919391150 2919392749 176
171 iso_pu_bacteria 2919420072 2919424288 176
172 iso_pu_bacteria 2919432681 2919437128 176
173 iso_pu_bacteria 2919468124 2919472907 176
174 iso_pu_bacteria 2919538618 2919541411 176
175 iso_pu_bacteria 2932426870 2932430074 176
176 iso_pu_bacteria 2933418574 2933422278 176
177 iso_pu_bacteria 2939598168 2939601852 176
178 iso_pu_bacteria 2939647034 2939649399 176
179 iso_pu_bacteria 2939674588 2939678594 176
180 iso_pu_bacteria 2945956166 2945956259 176
181 iso_pu_bacteria 2946064051 2946071602 176
182 iso_pu_bacteria 2946072368 2946079393 176
183 iso_pu_bacteria 2947224130 2947225111 176
184 iso_pu_bacteria 2954380949 2954382147 176
185 iso_pu_bacteria 2954673503 2954680906 176
186 iso_pu_bacteria 2954682443 2954683251 176
187 iso_pu_bacteria 2954711539 2954712569 176
188 iso_pu_bacteria 2954721474 2954722524 176
189 iso_pu_bacteria 2954731030 2954739334 176
190 iso_pu_bacteria 2954740390 2954741403 176
191 iso_pu_bacteria 2954749733 2954758162 176
192 iso_pu_bacteria 2954759201 2954760419 176
193 iso_pu_bacteria 3006393351 3006399930 176
194 iso_pu_bacteria 3006493962 3006501372 176
195 iso_pu_bacteria 8023623736 8023625841 176
196 iso_pu_bacteria 8054107350 8054109774 176
197 iso_pu_bacteria 8055172936 8055181558 176
198 iso_pu_bacteria 8056829672 8056836379 176
199 3300003316 rootH1_10008952 rootH1_1000895243 177
200 3300003320 rootH2_10052948 rootH2_100529481 177
201 3300041451 Ga0451791_0410500 Ga0451791_0410500_21_575 177
202 3300049531 Ga0501315_024854 Ga0501315_024854_173_727 177
203 iso_pu_bacteria 2744054611 2744958028 177
204 3300003163 Ga0006759J45824_1049098 Ga0006759J45824_10490981 178
205 3300003215 JGI25153J46596_10071137 JGI25153J46596_100711371 178
206 3300003308 Ga0006777J48905_1041791 Ga0006777J48905_10417911 178
207 3300003323 rootH1_10048105 rootH1_100481052 178
208 3300003693 Ga0032354_1012055 Ga0032354_10120551 178
209 3300005288 Ga0065714_10130094 Ga0065714_101300942 178
210 3300011119 Ga0105246_10016192 Ga0105246_100161923 178
211 3300025297 Ga0209758_1005228 Ga0209758_100522813 178
212 3300025302 Ga0207426_1012570 Ga0207426_10125702 178
213 3300025303 Ga0209051_1104842 Ga0209051_11048421 178
214 3300028786 Ga0307517_10059790 Ga0307517_100597903 178
215 3300030521 Ga0307511_10025842 Ga0307511_100258426 178
216 3300030731 Ga0316177_1115214 Ga0316177_11152144 178
217 3300030733 Ga0314311_1009278 Ga0314311_10092783 178
218 3300031548 Ga0307408_100016181 Ga0307408_1000161815 178
219 3300031548 Ga0307408_100018624 Ga0307408_1000186241 178
220 3300031548 Ga0307408_100020750 Ga0307408_1000207503 178
221 3300031548 Ga0307408_100025109 Ga0307408_1000251092 178
222 3300031548 Ga0307408_100031323 Ga0307408_1000313234 178
223 3300031548 Ga0307408_100539619 Ga0307408_1005396191 178
224 3300031616 Ga0307508_10002767 Ga0307508_1000276711 178
225 3300031731 Ga0307405_10006869 Ga0307405_100068693 178
226 3300031731 Ga0307405_10026001 Ga0307405_100260014 178
227 3300031731 Ga0307405_10043930 Ga0307405_100439301 178
228 3300031731 Ga0307405_10483159 Ga0307405_104831592 178
229 3300031824 Ga0307413_10005160 Ga0307413_100051603 178
230 3300031824 Ga0307413_10008405 Ga0307413_100084053 178
231 3300031824 Ga0307413_10163499 Ga0307413_101634991 178
232 3300031824 Ga0307413_10169331 Ga0307413_101693311 178
233 3300031824 Ga0307413_10278081 Ga0307413_102780812 178
234 3300031824 Ga0307413_10285340 Ga0307413_102853402 178
235 3300031852 Ga0307410_10004832 Ga0307410_100048323 178
236 3300031852 Ga0307410_10056138 Ga0307410_100561382 178
237 3300031852 Ga0307410_10057403 Ga0307410_100574032 178
238 3300031901 Ga0307406_10030947 Ga0307406_100309474 178
239 3300031901 Ga0307406_10129920 Ga0307406_101299202 178
240 3300031901 Ga0307406_10148831 Ga0307406_101488312 178
241 3300031901 Ga0307406_10153298 Ga0307406_101532981 178
242 3300031901 Ga0307406_10278353 Ga0307406_102783532 178
243 3300031903 Ga0307407_10001258 Ga0307407_100012588 178
244 3300031903 Ga0307407_10005209 Ga0307407_100052095 178
245 3300031903 Ga0307407_10120167 Ga0307407_101201672 178
246 3300031903 Ga0307407_10232803 Ga0307407_102328032 178
247 3300031903 Ga0307407_10643672 Ga0307407_106436721 178
248 3300031911 Ga0307412_10000863 Ga0307412_1000086316 178
249 3300031911 Ga0307412_10038657 Ga0307412_100386572 178
250 3300031911 Ga0307412_10044812 Ga0307412_100448122 178
251 3300031911 Ga0307412_10088769 Ga0307412_100887691 178
252 3300031911 Ga0307412_10458013 Ga0307412_104580132 178
253 3300031995 Ga0307409_100017717 Ga0307409_1000177172 178
254 3300031995 Ga0307409_100088972 Ga0307409_1000889722 178
255 3300031995 Ga0307409_100198373 Ga0307409_1001983732 178
256 3300031995 Ga0307409_100224041 Ga0307409_1002240412 178
257 3300031995 Ga0307409_100499180 Ga0307409_1004991802 178
258 3300032002 Ga0307416_100023028 Ga0307416_1000230283 178
259 3300032002 Ga0307416_100043224 Ga0307416_1000432243 178
260 3300032002 Ga0307416_100114240 Ga0307416_1001142403 178
261 3300032002 Ga0307416_100440721 Ga0307416_1004407212 178
262 3300032002 Ga0307416_100475444 Ga0307416_1004754442 178
263 3300032002 Ga0307416_100543209 Ga0307416_1005432091 178
264 3300032002 Ga0307416_101127892 Ga0307416_1011278922 178
265 3300032002 Ga0307416_101312449 Ga0307416_1013124491 178
266 3300032002 Ga0307416_101430445 Ga0307416_1014304451 178
267 3300032004 Ga0307414_10003244 Ga0307414_100032446 178
268 3300032004 Ga0307414_10042118 Ga0307414_100421183 178
269 3300032005 Ga0307411_10020563 Ga0307411_100205634 178
270 3300032005 Ga0307411_10067521 Ga0307411_100675211 178
271 3300032005 Ga0307411_10119694 Ga0307411_101196942 178
272 3300032126 Ga0307415_100025445 Ga0307415_1000254453 178
273 3300032126 Ga0307415_100652795 Ga0307415_1006527951 178
274 3300033180 Ga0307510_10265809 Ga0307510_102658092 178
275 3300037312 Ga0395899_0075177 Ga0395899_0075177_665_1222 178
276 3300037471 Ga0395905_0406421 Ga0395905_0406421_140_697 178
277 3300038443 Ga0395901_0010715 Ga0395901_0010715_1810_2367 178
278 3300041405 Ga0439438_050433 Ga0439438_050433_229_786 178
279 3300041443 Ga0451789_0785007 Ga0451789_0785007_70_627 178
280 3300041456 Ga0451795_1599879 Ga0451795_1599879_71_628 178
281 3300041512 Ga0451853_3338504 Ga0451853_3338504_1938_2495 178
282 3300041999 Ga0439433_0004043 Ga0439433_0004043_2327_2884 178
283 3300042002 Ga0439442_000028 Ga0439442_000028_21290_21847 178
284 3300042002 Ga0439442_000202 Ga0439442_000202_11536_12093 178
285 3300042002 Ga0439442_020966 Ga0439442_020966_109_666 178
286 3300042007 Ga0439449_0029958 Ga0439449_0029958_361_918 178
287 3300042007 Ga0439449_0031305 Ga0439449_0031305_166_723 178
288 3300042010 Ga0439452_072319 Ga0439452_072319_111_668 178
289 3300042014 Ga0439457_042141 Ga0439457_042141_312_869 178
290 3300042015 Ga0439462_0017932 Ga0439462_0017932_567_1124 178
291 3300042122 Ga0450920_000031 Ga0450920_000031_10432_10989 178
292 3300042122 Ga0450920_008754 Ga0450920_008754_791_1348 178
293 3300042146 Ga0450907_000343 Ga0450907_000343_8394_8951 178
294 3300042146 Ga0450907_056821 Ga0450907_056821_90_647 178
295 3300042435 Ga0439434_0000181 Ga0439434_0000181_11049_11606 178
296 3300042531 Ga0450918_000319 Ga0450918_000319_5518_6075 178
297 3300044656 Ga0466969_0026528 Ga0466969_0026528_768_1325 178
298 3300044658 Ga0466972_0187125 Ga0466972_0187125_340_897 178
299 3300044683 Ga0466965_0011579 Ga0466965_0011579_403_960 178
300 3300044683 Ga0466965_0031182 Ga0466965_0031182_2004_2561 178
301 3300044735 Ga0466968_0116231 Ga0466968_0116231_576_1133 178
302 3300045049 Ga0466959_0405575 Ga0466959_0405575_307_864 178
303 3300046530 Ga0495654_0170738 Ga0495654_0170738_135_692 178
304 3300046538 Ga0495609_0113921 Ga0495609_0113921_565_1125 178
305 3300046689 Ga0495613_0015885 Ga0495613_0015885_2246_2803 178
306 3300048091 Ga0495626_0012086 Ga0495626_0012086_146_703 178
307 3300048903 Ga0496100_0595422 Ga0496100_0595422_226_783 178
308 3300048904 Ga0496101_0591425 Ga0496101_0591425_248_805 178
309 3300048920 Ga0496117_0027498 Ga0496117_0027498_3837_4394 178
310 3300048921 Ga0496118_0001425 Ga0496118_0001425_35406_35963 178
311 3300048922 Ga0496119_0145607 Ga0496119_0145607_59_616 178
312 3300048922 Ga0496119_0418399 Ga0496119_0418399_67_624 178
313 3300048925 Ga0496122_0218999 Ga0496122_0218999_34_591 178
314 3300048926 Ga0496123_0024875 Ga0496123_0024875_3840_4397 178
315 3300048927 Ga0496124_0000075 Ga0496124_0000075_180569_181126 178
316 3300048927 Ga0496124_0024701 Ga0496124_0024701_1032_1589 178
317 3300048927 Ga0496124_0426746 Ga0496124_0426746_57_614 178
318 3300049127 Ga0501306_007587 Ga0501306_007587_723_1283 178
319 3300049128 Ga0501308_054596 Ga0501308_054596_18_578 178
320 3300049130 Ga0501310_034265 Ga0501310_034265_56_613 178
321 3300049162 Ga0501307_057037 Ga0501307_057037_22_582 178
322 3300049527 Ga0501311_056111 Ga0501311_056111_25_585 178
323 3300049528 Ga0501312_053518 Ga0501312_053518_63_620 178
324 3300049528 Ga0501312_080677 Ga0501312_080677_18_578 178
325 3300049529 Ga0501313_045354 Ga0501313_045354_22_582 178
326 3300049531 Ga0501315_015556 Ga0501315_015556_18_578 178
327 3300049531 Ga0501315_049269 Ga0501315_049269_38_595 178
328 3300049532 Ga0501316_019387 Ga0501316_019387_65_622 178
329 3300049534 Ga0501318_029548 Ga0501318_029548_65_622 178
330 3300049534 Ga0501318_033816 Ga0501318_033816_125_685 178
331 3300049535 Ga0501319_012920 Ga0501319_012920_68_625 178
332 3300049535 Ga0501319_020396 Ga0501319_020396_18_578 178
333 3300049536 Ga0501320_042814 Ga0501320_042814_25_585 178
334 3300049537 Ga0501321_011784 Ga0501321_011784_65_622 178
335 3300049538 Ga0501322_018994 Ga0501322_018994_18_578 178
336 3300049539 Ga0501323_030112 Ga0501323_030112_60_617 178
337 3300049569 Ga0501032_0040105 Ga0501032_0040105_279_836 178
338 3300049573 Ga0501037_0004406 Ga0501037_0004406_9558_10115 178
339 3300049574 Ga0501038_0020152 Ga0501038_0020152_3424_3981 178
340 3300049574 Ga0501038_0045736 Ga0501038_0045736_1782_2339 178
341 3300049575 Ga0501039_0182627 Ga0501039_0182627_244_801 178
342 3300049575 Ga0501039_0326023 Ga0501039_0326023_579_1136 178
343 3300049579 Ga0501043_0028524 Ga0501043_0028524_3104_3661 178
344 3300049579 Ga0501043_0552149 Ga0501043_0552149_241_798 178
345 3300049586 Ga0501070_0106955 Ga0501070_0106955_1225_1782 178
346 3300049775 Ga0501279_038272 Ga0501279_038272_35_592 178
347 3300053140 Ga0500573_0132382 Ga0500573_0132382_666_1223 178
348 3300053142 Ga0500577_0079825 Ga0500577_0079825_573_1130 178
349 3300061719 Ga0466962_0099110 Ga0466962_0099110_48_605 178
350 3300005548 Ga0070665_100043306 Ga0070665_1000433064 179
351 3300006038 Ga0075365_10625466 Ga0075365_106254661 179
352 3300025256 Ga0209759_1012462 Ga0209759_10124623 179
353 3300025315 Ga0207697_10038004 Ga0207697_100380042 179
354 3300028379 Ga0268266_10119276 Ga0268266_101192763 179
355 3300028794 Ga0307515_10497160 Ga0307515_104971601 179
356 3300031456 Ga0307513_10001575 Ga0307513_1000157523 179
357 3300031616 Ga0307508_10253887 Ga0307508_102538871 179
358 3300031649 Ga0307514_10247403 Ga0307514_102474031 179
359 3300031824 Ga0307413_11120967 Ga0307413_111209671 179
360 3300031852 Ga0307410_10163283 Ga0307410_101632831 179
361 3300033180 Ga0307510_10004225 Ga0307510_100042253 179
362 3300041404 Ga0439436_0002002 Ga0439436_0002002_3606_4166 179
363 3300042014 Ga0439457_000171 Ga0439457_000171_6022_6582 179
364 3300042122 Ga0450920_001863 Ga0450920_001863_2021_2581 179
365 3300042127 Ga0450890_009239 Ga0450890_009239_156_716 179
366 3300042184 Ga0450908_027681 Ga0450908_027681_69_629 179
367 3300044694 Ga0466963_0005423 Ga0466963_0005423_6815_7375 179
368 3300045976 Ga0466967_1650586 Ga0466967_1650586_45_605 179
369 3300046460 Ga0495638_0342901 Ga0495638_0342901_181_741 179
370 3300046492 Ga0495585_0026362 Ga0495585_0026362_391_951 179
371 3300046499 Ga0495594_0360675 Ga0495594_0360675_169_729 179
372 3300046648 Ga0495611_0043464 Ga0495611_0043464_384_944 179
373 3300046665 Ga0495661_0309020 Ga0495661_0309020_192_752 179
374 3300046674 Ga0495588_0012490 Ga0495588_0012490_393_953 179
375 3300046794 Ga0495589_0014011 Ga0495589_0014011_2063_2623 179
376 3300046794 Ga0495589_0016264 Ga0495589_0016264_1610_2170 179
377 3300046794 Ga0495589_0125385 Ga0495589_0125385_61_621 179
378 3300047315 Ga0495581_0059108 Ga0495581_0059108_1623_2183 179
379 3300047318 Ga0495636_0001675 Ga0495636_0001675_6187_6747 179
380 3300047318 Ga0495636_0448448 Ga0495636_0448448_39_599 179
381 3300047444 Ga0495675_0428769 Ga0495675_0428769_65_625 179
382 3300047447 Ga0495685_184466 Ga0495685_184466_56_616 179
383 3300048905 Ga0496102_0100582 Ga0496102_0100582_1510_2073 179
384 3300048906 Ga0496103_0107625 Ga0496103_0107625_745_1308 179
385 3300048916 Ga0496113_0247518 Ga0496113_0247518_323_886 179
386 3300049127 Ga0501306_029110 Ga0501306_029110_53_613 179
387 3300049128 Ga0501308_042955 Ga0501308_042955_13_573 179
388 3300049129 Ga0501309_022869 Ga0501309_022869_249_809 179
389 3300049160 Ga0501304_023373 Ga0501304_023373_16_576 179
390 3300049161 Ga0501305_064184 Ga0501305_064184_20_580 179
391 3300049162 Ga0501307_024303 Ga0501307_024303_53_613 179
392 3300049538 Ga0501322_006812 Ga0501322_006812_203_763 179
393 3300049539 Ga0501323_047502 Ga0501323_047502_22_585 179
394 3300049569 Ga0501032_0016945 Ga0501032_0016945_4499_5059 179
395 3300049570 Ga0501033_0057503 Ga0501033_0057503_85_645 179
396 3300049570 Ga0501033_0186510 Ga0501033_0186510_858_1418 179
397 3300049571 Ga0501034_0164540 Ga0501034_0164540_583_1143 179
398 3300049572 Ga0501036_0097413 Ga0501036_0097413_696_1256 179
399 3300049573 Ga0501037_0009946 Ga0501037_0009946_6325_6885 179
400 3300049573 Ga0501037_0028683 Ga0501037_0028683_94_654 179
401 3300049574 Ga0501038_0024313 Ga0501038_0024313_4731_5291 179
402 3300049575 Ga0501039_0057277 Ga0501039_0057277_2366_2926 179
403 3300049578 Ga0501042_0029977 Ga0501042_0029977_3192_3752 179
404 3300049579 Ga0501043_0106380 Ga0501043_0106380_93_653 179
405 3300049581 Ga0501047_0730753 Ga0501047_0730753_202_762 179
406 3300049582 Ga0501048_0013427 Ga0501048_0013427_583_1143 179
407 3300049589 Ga0501073_0750132 Ga0501073_0750132_96_656 179
408 3300049822 Ga0501035_0033495 Ga0501035_0033495_3196_3756 179
409 3300049823 Ga0501044_0003537 Ga0501044_0003537_9483_10043 179
410 3300049823 Ga0501044_0020765 Ga0501044_0020765_6358_6918 179
411 3300049823 Ga0501044_0066567 Ga0501044_0066567_360_920 179
412 3300002155 JGI24033J26618_1024995 JGI24033J26618_10249952 180
413 3300003316 rootH1_10008542 rootH1_100085421 180
414 3300003322 rootL2_10017544 rootL2_100175442 180
415 3300003323 rootH1_10117255 rootH1_101172555 180
416 3300003577 Ga0007416J51690_1135091 Ga0007416J51690_11350911 180
417 3300003578 Ga0006562J51391_1112167 Ga0006562J51391_11121671 180
418 3300003762 Ga0055542_1006500 Ga0055542_10065001 180
419 3300004798 Ga0058859_11451262 Ga0058859_114512621 180
420 3300005288 Ga0065714_10012667 Ga0065714_100126672 180
421 3300005288 Ga0065714_10336468 Ga0065714_103364681 180
422 3300005290 Ga0065712_10040502 Ga0065712_100405022 180
423 3300005328 Ga0070676_10005407 Ga0070676_100054073 180
424 3300005331 Ga0070670_100071851 Ga0070670_1000718513 180
425 3300005331 Ga0070670_100777299 Ga0070670_1007772991 180
426 3300005333 Ga0070677_10002207 Ga0070677_100022072 180
427 3300005333 Ga0070677_10125759 Ga0070677_101257591 180
428 3300005335 Ga0070666_10022628 Ga0070666_100226284 180
429 3300005347 Ga0070668_100007104 Ga0070668_1000071043 180
430 3300005353 Ga0070669_100011371 Ga0070669_1000113714 180
431 3300005354 Ga0070675_100078923 Ga0070675_1000789232 180
432 3300005355 Ga0070671_100024103 Ga0070671_1000241032 180
433 3300005356 Ga0070674_100041219 Ga0070674_1000412192 180
434 3300005356 Ga0070674_100408538 Ga0070674_1004085382 180
435 3300005364 Ga0070673_100005463 Ga0070673_1000054636 180
436 3300005367 Ga0070667_100039528 Ga0070667_1000395284 180
437 3300005456 Ga0070678_100130874 Ga0070678_1001308742 180
438 3300005543 Ga0070672_100246862 Ga0070672_1002468621 180
439 3300005548 Ga0070665_100068963 Ga0070665_1000689633 180
440 3300005563 Ga0068855_100165013 Ga0068855_1001650133 180
441 3300005840 Ga0068870_10030971 Ga0068870_100309713 180
442 3300006048 Ga0075363_100018677 Ga0075363_1000186775 180
443 3300006048 Ga0075363_100123854 Ga0075363_1001238541 180
444 3300006058 Ga0075432_10012515 Ga0075432_100125154 180
445 3300006058 Ga0075432_10129229 Ga0075432_101292291 180
446 3300006178 Ga0075367_10004683 Ga0075367_100046838 180
447 3300006237 Ga0097621_101565439 Ga0097621_1015654391 180
448 3300006948 Ga0099826_10209855 Ga0099826_102098552 180
449 3300009011 Ga0105251_10005515 Ga0105251_100055152 180
450 3300009036 Ga0105244_10011815 Ga0105244_100118155 180
451 3300009036 Ga0105244_10018414 Ga0105244_100184144 180
452 3300009036 Ga0105244_10132336 Ga0105244_101323362 180
453 3300009092 Ga0105250_10048688 Ga0105250_100486882 180
454 3300009098 Ga0105245_10029557 Ga0105245_100295575 180
455 3300009148 Ga0105243_10071423 Ga0105243_100714232 180
456 3300009148 Ga0105243_10260001 Ga0105243_102600012 180
457 3300009148 Ga0105243_10450202 Ga0105243_104502022 180
458 3300009174 Ga0105241_10722927 Ga0105241_107229271 180
459 3300009176 Ga0105242_10125999 Ga0105242_101259992 180
460 3300009177 Ga0105248_10025296 Ga0105248_100252962 180
461 3300009551 Ga0105238_10072052 Ga0105238_100720524 180
462 3300011119 Ga0105246_10009375 Ga0105246_100093754 180
463 3300011119 Ga0105246_10068289 Ga0105246_100682892 180
464 3300011119 Ga0105246_10074554 Ga0105246_100745543 180
465 3300013102 Ga0157371_10160862 Ga0157371_101608621 180
466 3300013306 Ga0163162_10980880 Ga0163162_109808801 180
467 3300013308 Ga0157375_11357843 Ga0157375_113578432 180
468 3300014325 Ga0163163_10107058 Ga0163163_101070582 180
469 3300014326 Ga0157380_10126760 Ga0157380_101267603 180
470 3300014497 Ga0182008_10001811 Ga0182008_1000181112 180
471 3300014745 Ga0157377_10806342 Ga0157377_108063421 180
472 3300014745 Ga0157377_11043526 Ga0157377_110435261 180
473 3300015261 Ga0182006_1053811 Ga0182006_10538112 180
474 3300015262 Ga0182007_10004511 Ga0182007_100045116 180
475 3300015688 Ga0183367_1016 Ga0183367_1016169 180
476 3300020082 Ga0206353_11379541 Ga0206353_113795412 180
477 3300025254 Ga0209148_1002503 Ga0209148_10025032 180
478 3300025290 Ga0207673_1002199 Ga0207673_10021992 180
479 3300025303 Ga0209051_1001812 Ga0209051_10018123 180
480 3300025315 Ga0207697_10001581 Ga0207697_1000158111 180
481 3300025315 Ga0207697_10007084 Ga0207697_100070845 180
482 3300025728 Ga0207655_1008458 Ga0207655_10084584 180
483 3300025728 Ga0207655_1036400 Ga0207655_10364001 180
484 3300025728 Ga0207655_1064398 Ga0207655_10643982 180
485 3300025735 Ga0207713_1016069 Ga0207713_10160694 180
486 3300025893 Ga0207682_10004228 Ga0207682_100042285 180
487 3300025893 Ga0207682_10022099 Ga0207682_100220993 180
488 3300025901 Ga0207688_10110983 Ga0207688_101109832 180
489 3300025903 Ga0207680_10110597 Ga0207680_101105971 180
490 3300025904 Ga0207647_10029660 Ga0207647_100296603 180
491 3300025907 Ga0207645_10000166 Ga0207645_100001666 180
492 3300025908 Ga0207643_10024739 Ga0207643_100247393 180
493 3300025923 Ga0207681_10008824 Ga0207681_100088243 180
494 3300025925 Ga0207650_10015389 Ga0207650_100153893 180
495 3300025926 Ga0207659_10009658 Ga0207659_100096584 180
496 3300025927 Ga0207687_10047005 Ga0207687_100470052 180
497 3300025929 Ga0207664_10686774 Ga0207664_106867741 180
498 3300025931 Ga0207644_10028772 Ga0207644_100287724 180
499 3300025935 Ga0207709_10129241 Ga0207709_101292412 180
500 3300025937 Ga0207669_10004805 Ga0207669_100048054 180
501 3300025940 Ga0207691_10000225 Ga0207691_1000022525 180
502 3300025940 Ga0207691_10493475 Ga0207691_104934751 180
503 3300025941 Ga0207711_10038604 Ga0207711_100386044 180
504 3300025960 Ga0207651_10028821 Ga0207651_100288212 180
505 3300025986 Ga0207658_10160614 Ga0207658_101606142 180
506 3300026121 Ga0207683_10010420 Ga0207683_100104206 180
507 3300027312 Ga0209371_1065377 Ga0209371_10653771 180
508 3300027866 Ga0209813_10077013 Ga0209813_100770132 180
509 3300027907 Ga0207428_10001247 Ga0207428_100012476 180
510 3300028379 Ga0268266_10529495 Ga0268266_105294952 180
511 3300028794 Ga0307515_10000325 Ga0307515_1000032539 180
512 3300028794 Ga0307515_10212706 Ga0307515_102127062 180
513 3300030500 Ga0268256_1072889 Ga0268256_10728891 180
514 3300030521 Ga0307511_10029108 Ga0307511_100291084 180
515 3300030522 Ga0307512_10015746 Ga0307512_100157467 180
516 3300031456 Ga0307513_10085089 Ga0307513_100850895 180
517 3300031456 Ga0307513_10126009 Ga0307513_101260093 180
518 3300031507 Ga0307509_10036506 Ga0307509_100365061 180
519 3300031548 Ga0307408_100006509 Ga0307408_1000065092 180
520 3300031548 Ga0307408_100009119 Ga0307408_1000091197 180
521 3300031548 Ga0307408_100018446 Ga0307408_1000184465 180
522 3300031548 Ga0307408_100097382 Ga0307408_1000973823 180
523 3300031616 Ga0307508_10062830 Ga0307508_100628303 180
524 3300031649 Ga0307514_10024827 Ga0307514_100248274 180
525 3300031649 Ga0307514_10041820 Ga0307514_100418202 180
526 3300031649 Ga0307514_10241303 Ga0307514_102413031 180
527 3300031730 Ga0307516_10008539 Ga0307516_100085392 180
528 3300031730 Ga0307516_10017287 Ga0307516_100172873 180
529 3300031730 Ga0307516_10524642 Ga0307516_105246422 180
530 3300031731 Ga0307405_10067163 Ga0307405_100671633 180
531 3300031731 Ga0307405_10231960 Ga0307405_102319602 180
532 3300031731 Ga0307405_10439994 Ga0307405_104399941 180
533 3300031731 Ga0307405_10582795 Ga0307405_105827951 180
534 3300031824 Ga0307413_10047535 Ga0307413_100475352 180
535 3300031824 Ga0307413_10087653 Ga0307413_100876533 180
536 3300031824 Ga0307413_10153191 Ga0307413_101531912 180
537 3300031838 Ga0307518_10302848 Ga0307518_103028482 180
538 3300031852 Ga0307410_10008385 Ga0307410_100083852 180
539 3300031852 Ga0307410_10025846 Ga0307410_100258463 180
540 3300031852 Ga0307410_10041948 Ga0307410_100419483 180
541 3300031852 Ga0307410_10080121 Ga0307410_100801212 180
542 3300031852 Ga0307410_10376961 Ga0307410_103769611 180
543 3300031901 Ga0307406_10389793 Ga0307406_103897932 180
544 3300031901 Ga0307406_10805784 Ga0307406_108057841 180
545 3300031903 Ga0307407_10011336 Ga0307407_100113362 180
546 3300031903 Ga0307407_10025134 Ga0307407_100251343 180
547 3300031903 Ga0307407_10040828 Ga0307407_100408281 180
548 3300031903 Ga0307407_10173552 Ga0307407_101735521 180
549 3300031911 Ga0307412_10003766 Ga0307412_100037663 180
550 3300031911 Ga0307412_10023040 Ga0307412_100230406 180
551 3300031911 Ga0307412_10061231 Ga0307412_100612313 180
552 3300031911 Ga0307412_10151190 Ga0307412_101511903 180
553 3300031911 Ga0307412_10682740 Ga0307412_106827402 180
554 3300031911 Ga0307412_11081247 Ga0307412_110812471 180
555 3300031995 Ga0307409_100002496 Ga0307409_1000024966 180
556 3300031995 Ga0307409_100016671 Ga0307409_1000166714 180
557 3300031995 Ga0307409_100065864 Ga0307409_1000658643 180
558 3300031995 Ga0307409_100216643 Ga0307409_1002166431 180
559 3300031995 Ga0307409_100232701 Ga0307409_1002327011 180
560 3300032002 Ga0307416_100010844 Ga0307416_1000108443 180
561 3300032002 Ga0307416_100071512 Ga0307416_1000715123 180
562 3300032002 Ga0307416_100130560 Ga0307416_1001305603 180
563 3300032002 Ga0307416_102324236 Ga0307416_1023242361 180
564 3300032004 Ga0307414_10102167 Ga0307414_101021673 180
565 3300032005 Ga0307411_10282351 Ga0307411_102823511 180
566 3300032126 Ga0307415_100004754 Ga0307415_1000047547 180
567 3300032126 Ga0307415_100060913 Ga0307415_1000609132 180
568 3300032126 Ga0307415_100270669 Ga0307415_1002706691 180
569 3300032126 Ga0307415_100791877 Ga0307415_1007918771 180
570 3300033180 Ga0307510_10005756 Ga0307510_100057565 180
571 3300033180 Ga0307510_10081748 Ga0307510_100817481 180
572 3300033180 Ga0307510_10498500 Ga0307510_104985001 180
573 3300037312 Ga0395899_0086062 Ga0395899_0086062_264_830 180
574 3300037418 Ga0395900_0032236 Ga0395900_0032236_1471_2037 180
575 3300037418 Ga0395900_0271509 Ga0395900_0271509_840_1406 180
576 3300037466 Ga0395898_0005522 Ga0395898_0005522_9035_9598 180
577 3300037466 Ga0395898_0014337 Ga0395898_0014337_7151_7714 180
578 3300037466 Ga0395898_0284145 Ga0395898_0284145_881_1447 180
579 3300037466 Ga0395898_0412553 Ga0395898_0412553_469_1038 180
580 3300037471 Ga0395905_0909208 Ga0395905_0909208_24_587 180
581 3300038443 Ga0395901_0035434 Ga0395901_0035434_3452_4021 180
582 3300038443 Ga0395901_0078966 Ga0395901_0078966_2497_3060 180
583 3300038443 Ga0395901_0117672 Ga0395901_0117672_470_1036 180
584 3300041404 Ga0439436_0016382 Ga0439436_0016382_48_614 180
585 3300041405 Ga0439438_023390 Ga0439438_023390_336_902 180
586 3300041411 Ga0439466_0025012 Ga0439466_0025012_1430_1996 180
587 3300041411 Ga0439466_0027983 Ga0439466_0027983_301_867 180
588 3300041413 Ga0439465_0009939 Ga0439465_0009939_1545_2111 180
589 3300041999 Ga0439433_0000321 Ga0439433_0000321_1430_1996 180
590 3300041999 Ga0439433_0017349 Ga0439433_0017349_1008_1571 180
591 3300041999 Ga0439433_0056625 Ga0439433_0056625_178_744 180
592 3300042002 Ga0439442_016138 Ga0439442_016138_891_1457 180
593 3300042005 Ga0439448_0000449 Ga0439448_0000449_3427_3990 180
594 3300042005 Ga0439448_0034318 Ga0439448_0034318_836_1399 180
595 3300042007 Ga0439449_0000141 Ga0439449_0000141_14498_15061 180
596 3300042007 Ga0439449_0002023 Ga0439449_0002023_5908_6474 180
597 3300042007 Ga0439449_0023063 Ga0439449_0023063_1668_2234 180
598 3300042007 Ga0439449_0106362 Ga0439449_0106362_405_968 180
599 3300042012 Ga0439455_0013444 Ga0439455_0013444_942_1505 180
600 3300042014 Ga0439457_013047 Ga0439457_013047_825_1391 180
601 3300042015 Ga0439462_0025794 Ga0439462_0025794_419_985 180
602 3300042138 Ga0450903_000033 Ga0450903_000033_3521_4084 180
603 3300042138 Ga0450903_026673 Ga0450903_026673_224_787 180
604 3300042157 Ga0439458_0004773 Ga0439458_0004773_1989_2552 180
605 3300044658 Ga0466972_0000712 Ga0466972_0000712_2066_2629 180
606 3300044658 Ga0466972_0009370 Ga0466972_0009370_1728_2291 180
607 3300044683 Ga0466965_0000469 Ga0466965_0000469_161_724 180
608 3300044684 Ga0466966_0001612 Ga0466966_0001612_8753_9316 180
609 3300044693 Ga0466961_0000237 Ga0466961_0000237_18850_19413 180
610 3300044693 Ga0466961_0260106 Ga0466961_0260106_478_1041 180
611 3300044694 Ga0466963_0000782 Ga0466963_0000782_15103_15666 180
612 3300044706 Ga0466964_0001427 Ga0466964_0001427_241_804 180
613 3300044706 Ga0466964_0028683 Ga0466964_0028683_198_761 180
614 3300044765 Ga0466970_0000192 Ga0466970_0000192_17825_18388 180
615 3300044765 Ga0466970_0003115 Ga0466970_0003115_3685_4248 180
616 3300044842 Ga0466957_0000488 Ga0466957_0000488_17134_17697 180
617 3300044901 Ga0466960_0013360 Ga0466960_0013360_47_610 180
618 3300045836 Ga0466958_0001773 Ga0466958_0001773_9188_9751 180
619 3300045976 Ga0466967_0000611 Ga0466967_0000611_12140_12703 180
620 3300045976 Ga0466967_0034224 Ga0466967_0034224_1566_2129 180
621 3300045976 Ga0466967_0068834 Ga0466967_0068834_1388_1951 180
622 3300046452 Ga0495617_107545 Ga0495617_107545_193_756 180
623 3300046455 Ga0495603_0000301 Ga0495603_0000301_14342_14905 180
624 3300046455 Ga0495603_0035831 Ga0495603_0035831_715_1278 180
625 3300046459 Ga0495629_0003310 Ga0495629_0003310_7368_7931 180
626 3300046459 Ga0495629_0020402 Ga0495629_0020402_2723_3286 180
627 3300046459 Ga0495629_0281936 Ga0495629_0281936_85_648 180
628 3300046460 Ga0495638_0288008 Ga0495638_0288008_53_616 180
629 3300046462 Ga0495651_0000915 Ga0495651_0000915_12051_12614 180
630 3300046462 Ga0495651_0038768 Ga0495651_0038768_1248_1811 180
631 3300046463 Ga0495653_0006950 Ga0495653_0006950_897_1460 180
632 3300046463 Ga0495653_0082052 Ga0495653_0082052_1752_2321 180
633 3300046472 Ga0495580_0003163 Ga0495580_0003163_8135_8698 180
634 3300046473 Ga0495582_0132197 Ga0495582_0132197_589_1152 180
635 3300046474 Ga0495605_0009377 Ga0495605_0009377_2246_2809 180
636 3300046475 Ga0495639_0009726 Ga0495639_0009726_1507_2076 180
637 3300046476 Ga0495662_0002502 Ga0495662_0002502_41_604 180
638 3300046476 Ga0495662_0004930 Ga0495662_0004930_3580_4143 180
639 3300046476 Ga0495662_0031019 Ga0495662_0031019_1182_1745 180
640 3300046477 Ga0495664_0001219 Ga0495664_0001219_5511_6074 180
641 3300046477 Ga0495664_0061630 Ga0495664_0061630_1088_1651 180
642 3300046477 Ga0495664_0092488 Ga0495664_0092488_36_599 180
643 3300046499 Ga0495594_0033945 Ga0495594_0033945_862_1425 180
644 3300046499 Ga0495594_0066872 Ga0495594_0066872_1336_1899 180
645 3300046499 Ga0495594_0109223 Ga0495594_0109223_13_576 180
646 3300046499 Ga0495594_0285469 Ga0495594_0285469_339_902 180
647 3300046501 Ga0495607_0026962 Ga0495607_0026962_384_947 180
648 3300046506 Ga0495583_0104341 Ga0495583_0104341_632_1195 180
649 3300046507 Ga0495606_0001671 Ga0495606_0001671_26224_26787 180
650 3300046512 Ga0495610_0057465 Ga0495610_0057465_1101_1664 180
651 3300046512 Ga0495610_0140939 Ga0495610_0140939_59_622 180
652 3300046514 Ga0495618_0012800 Ga0495618_0012800_1079_1642 180
653 3300046514 Ga0495618_0060819 Ga0495618_0060819_547_1110 180
654 3300046517 Ga0495630_0045217 Ga0495630_0045217_148_711 180
655 3300046518 Ga0495631_0190383 Ga0495631_0190383_265_828 180
656 3300046520 Ga0495637_0044630 Ga0495637_0044630_581_1144 180
657 3300046522 Ga0495643_0004460 Ga0495643_0004460_6768_7331 180
658 3300046522 Ga0495643_0243270 Ga0495643_0243270_109_672 180
659 3300046525 Ga0495663_0219785 Ga0495663_0219785_13_576 180
660 3300046526 Ga0495666_0027417 Ga0495666_0027417_1482_2045 180
661 3300046526 Ga0495666_0162713 Ga0495666_0162713_28_591 180
662 3300046528 Ga0495642_0004717 Ga0495642_0004717_3601_4164 180
663 3300046529 Ga0495652_0163505 Ga0495652_0163505_660_1223 180
664 3300046531 Ga0495665_0002369 Ga0495665_0002369_9152_9715 180
665 3300046531 Ga0495665_0088919 Ga0495665_0088919_839_1402 180
666 3300046533 Ga0495640_0137129 Ga0495640_0137129_34_597 180
667 3300046535 Ga0495586_0002268 Ga0495586_0002268_1838_2401 180
668 3300046535 Ga0495586_0004109 Ga0495586_0004109_85_648 180
669 3300046535 Ga0495586_0011519 Ga0495586_0011519_910_1473 180
670 3300046535 Ga0495586_0017747 Ga0495586_0017747_720_1289 180
671 3300046535 Ga0495586_0060079 Ga0495586_0060079_1465_2028 180
672 3300046536 Ga0495587_0004295 Ga0495587_0004295_1849_2412 180
673 3300046536 Ga0495587_0022266 Ga0495587_0022266_2854_3417 180
674 3300046536 Ga0495587_0052191 Ga0495587_0052191_1622_2191 180
675 3300046538 Ga0495609_0038255 Ga0495609_0038255_1330_1893 180
676 3300046542 Ga0495597_0025086 Ga0495597_0025086_376_939 180
677 3300046543 Ga0495645_0042521 Ga0495645_0042521_720_1289 180
678 3300046543 Ga0495645_0077133 Ga0495645_0077133_947_1510 180
679 3300046557 Ga0495622_0014928 Ga0495622_0014928_1504_2067 180
680 3300046558 Ga0495633_0141967 Ga0495633_0141967_473_1036 180
681 3300046559 Ga0495667_0005051 Ga0495667_0005051_7557_8126 180
682 3300046559 Ga0495667_0014027 Ga0495667_0014027_1520_2083 180
683 3300046559 Ga0495667_0179308 Ga0495667_0179308_438_1001 180
684 3300046559 Ga0495667_0307310 Ga0495667_0307310_21_584 180
685 3300046559 Ga0495667_0438930 Ga0495667_0438930_167_730 180
686 3300046615 Ga0495656_0001419 Ga0495656_0001419_1444_2007 180
687 3300046615 Ga0495656_0016996 Ga0495656_0016996_274_837 180
688 3300046616 Ga0495668_0010285 Ga0495668_0010285_2698_3261 180
689 3300046642 Ga0495634_0002621 Ga0495634_0002621_3305_3868 180
690 3300046648 Ga0495611_0047879 Ga0495611_0047879_886_1449 180
691 3300046660 Ga0495625_0003384 Ga0495625_0003384_2357_2920 180
692 3300046660 Ga0495625_0110954 Ga0495625_0110954_715_1278 180
693 3300046660 Ga0495625_0672977 Ga0495625_0672977_19_582 180
694 3300046663 Ga0495635_0159600 Ga0495635_0159600_418_981 180
695 3300046663 Ga0495635_0304871 Ga0495635_0304871_302_865 180
696 3300046663 Ga0495635_0488000 Ga0495635_0488000_90_653 180
697 3300046664 Ga0495659_0316909 Ga0495659_0316909_76_639 180
698 3300046665 Ga0495661_0046233 Ga0495661_0046233_193_756 180
699 3300046665 Ga0495661_0106965 Ga0495661_0106965_719_1282 180
700 3300046674 Ga0495588_0006323 Ga0495588_0006323_3720_4283 180
701 3300046674 Ga0495588_0006960 Ga0495588_0006960_4499_5062 180
702 3300046675 Ga0495657_0001642 Ga0495657_0001642_14596_15159 180
703 3300046675 Ga0495657_0028869 Ga0495657_0028869_967_1530 180
704 3300046675 Ga0495657_0032971 Ga0495657_0032971_237_800 180
705 3300046675 Ga0495657_0037835 Ga0495657_0037835_2673_3236 180
706 3300046675 Ga0495657_0125658 Ga0495657_0125658_59_622 180
707 3300046678 Ga0495599_0398187 Ga0495599_0398187_135_698 180
708 3300046679 Ga0495623_0064930 Ga0495623_0064930_303_866 180
709 3300046680 Ga0495646_0009636 Ga0495646_0009636_5272_5835 180
710 3300046683 Ga0495658_0098812 Ga0495658_0098812_655_1218 180
711 3300046689 Ga0495613_0000345 Ga0495613_0000345_3872_4435 180
712 3300046689 Ga0495613_0021709 Ga0495613_0021709_4150_4713 180
713 3300046689 Ga0495613_0033208 Ga0495613_0033208_194_757 180
714 3300046689 Ga0495613_0050889 Ga0495613_0050889_2086_2649 180
715 3300046689 Ga0495613_0052728 Ga0495613_0052728_839_1402 180
716 3300046689 Ga0495613_0107375 Ga0495613_0107375_1149_1712 180
717 3300046689 Ga0495613_0117762 Ga0495613_0117762_433_996 180
718 3300046691 Ga0495670_0006381 Ga0495670_0006381_2747_3310 180
719 3300046691 Ga0495670_0014913 Ga0495670_0014913_1890_2453 180
720 3300046691 Ga0495670_0083583 Ga0495670_0083583_977_1540 180
721 3300046692 Ga0495671_0037267 Ga0495671_0037267_1155_1718 180
722 3300046692 Ga0495671_0055977 Ga0495671_0055977_858_1421 180
723 3300046692 Ga0495671_0093192 Ga0495671_0093192_458_1021 180
724 3300046694 Ga0495649_0024820 Ga0495649_0024820_1421_1984 180
725 3300046694 Ga0495649_0184351 Ga0495649_0184351_178_741 180
726 3300046809 Ga0495600_0015559 Ga0495600_0015559_1119_1682 180
727 3300046809 Ga0495600_0019304 Ga0495600_0019304_2973_3542 180
728 3300046809 Ga0495600_0384971 Ga0495600_0384971_30_593 180
729 3300047315 Ga0495581_0003778 Ga0495581_0003778_6428_6991 180
730 3300047315 Ga0495581_0021308 Ga0495581_0021308_3110_3673 180
731 3300047315 Ga0495581_0082981 Ga0495581_0082981_935_1498 180
732 3300047315 Ga0495581_0277158 Ga0495581_0277158_235_798 180
733 3300047315 Ga0495581_0310486 Ga0495581_0310486_63_626 180
734 3300047317 Ga0495604_0000331 Ga0495604_0000331_31550_32113 180
735 3300047317 Ga0495604_0177051 Ga0495604_0177051_128_691 180
736 3300047318 Ga0495636_0003069 Ga0495636_0003069_3628_4191 180
737 3300047318 Ga0495636_0007105 Ga0495636_0007105_3799_4362 180
738 3300047318 Ga0495636_0451231 Ga0495636_0451231_43_606 180
739 3300047319 Ga0495674_0313715 Ga0495674_0313715_548_1111 180
740 3300047320 Ga0495672_0343443 Ga0495672_0343443_30_593 180
741 3300047321 Ga0495676_0001973 Ga0495676_0001973_11408_11971 180
742 3300047321 Ga0495676_0002533 Ga0495676_0002533_11327_11890 180
743 3300047321 Ga0495676_0062777 Ga0495676_0062777_1996_2559 180
744 3300047321 Ga0495676_0327733 Ga0495676_0327733_292_855 180
745 3300047322 Ga0495680_0025831 Ga0495680_0025831_2507_3070 180
746 3300047322 Ga0495680_0027575 Ga0495680_0027575_1063_1626 180
747 3300047323 Ga0495683_0173213 Ga0495683_0173213_17_580 180
748 3300047443 Ga0495687_001006 Ga0495687_001006_4624_5187 180
749 3300047443 Ga0495687_002032 Ga0495687_002032_6920_7483 180
750 3300047443 Ga0495687_175287 Ga0495687_175287_68_631 180
751 3300047444 Ga0495675_0012981 Ga0495675_0012981_1536_2099 180
752 3300047444 Ga0495675_0033602 Ga0495675_0033602_2581_3144 180
753 3300047444 Ga0495675_0248217 Ga0495675_0248217_52_615 180
754 3300047445 Ga0495677_0045801 Ga0495677_0045801_119_682 180
755 3300047445 Ga0495677_0155132 Ga0495677_0155132_240_803 180
756 3300047447 Ga0495685_035911 Ga0495685_035911_1013_1576 180
757 3300047447 Ga0495685_076525 Ga0495685_076525_504_1067 180
758 3300047470 Ga0495681_0003485 Ga0495681_0003485_7073_7636 180
759 3300047471 Ga0495684_0028383 Ga0495684_0028383_1023_1586 180
760 3300047472 Ga0495686_0108718 Ga0495686_0108718_1070_1633 180
761 3300047673 Ga0495593_0007738 Ga0495593_0007738_3295_3858 180
762 3300047673 Ga0495593_0026017 Ga0495593_0026017_1081_1644 180
763 3300047673 Ga0495593_0056456 Ga0495593_0056456_302_865 180
764 3300047673 Ga0495593_0257592 Ga0495593_0257592_177_740 180
765 3300048089 Ga0495614_0004986 Ga0495614_0004986_4244_4807 180
766 3300048089 Ga0495614_0024939 Ga0495614_0024939_990_1553 180
767 3300048089 Ga0495614_0293369 Ga0495614_0293369_89_652 180
768 3300048090 Ga0495615_0007187 Ga0495615_0007187_969_1532 180
769 3300048903 Ga0496100_0028311 Ga0496100_0028311_1812_2375 180
770 3300048904 Ga0496101_0048253 Ga0496101_0048253_961_1524 180
771 3300048904 Ga0496101_1144348 Ga0496101_1144348_27_590 180
772 3300048905 Ga0496102_0024784 Ga0496102_0024784_1629_2192 180
773 3300048905 Ga0496102_0117987 Ga0496102_0117987_1448_2014 180
774 3300048905 Ga0496102_0443505 Ga0496102_0443505_48_617 180
775 3300048906 Ga0496103_0024600 Ga0496103_0024600_1401_1967 180
776 3300048906 Ga0496103_0024753 Ga0496103_0024753_680_1243 180
777 3300048906 Ga0496103_0089235 Ga0496103_0089235_404_967 180
778 3300048906 Ga0496103_0279122 Ga0496103_0279122_359_922 180
779 3300048908 Ga0496105_0009128 Ga0496105_0009128_6495_7058 180
780 3300048909 Ga0496106_0020555 Ga0496106_0020555_83_646 180
781 3300048909 Ga0496106_0094082 Ga0496106_0094082_88_651 180
782 3300048911 Ga0496108_0331606 Ga0496108_0331606_122_688 180
783 3300048912 Ga0496109_0072886 Ga0496109_0072886_301_864 180
784 3300048912 Ga0496109_0104947 Ga0496109_0104947_259_822 180
785 3300048913 Ga0496110_0053627 Ga0496110_0053627_1467_2030 180
786 3300048913 Ga0496110_0669166 Ga0496110_0669166_75_638 180
787 3300048914 Ga0496111_0014722 Ga0496111_0014722_3700_4263 180
788 3300048914 Ga0496111_0021670 Ga0496111_0021670_3870_4433 180
789 3300048914 Ga0496111_0129657 Ga0496111_0129657_1230_1793 180
790 3300048915 Ga0496112_0008887 Ga0496112_0008887_1760_2323 180
791 3300048916 Ga0496113_0113201 Ga0496113_0113201_75_638 180
792 3300048917 Ga0496114_0085377 Ga0496114_0085377_1413_1976 180
793 3300048918 Ga0496115_0018479 Ga0496115_0018479_3011_3574 180
794 3300048922 Ga0496119_0408845 Ga0496119_0408845_10_573 180
795 3300048927 Ga0496124_0040301 Ga0496124_0040301_2383_2946 180
796 3300048928 Ga0496125_0020894 Ga0496125_0020894_5421_5984 180
797 3300049127 Ga0501306_030279 Ga0501306_030279_76_642 180
798 3300049127 Ga0501306_041660 Ga0501306_041660_63_629 180
799 3300049127 Ga0501306_046647 Ga0501306_046647_14_580 180
800 3300049128 Ga0501308_011777 Ga0501308_011777_298_864 180
801 3300049128 Ga0501308_023905 Ga0501308_023905_140_706 180
802 3300049130 Ga0501310_013552 Ga0501310_013552_282_848 180
803 3300049160 Ga0501304_014724 Ga0501304_014724_10_576 180
804 3300049160 Ga0501304_020821 Ga0501304_020821_60_626 180
805 3300049161 Ga0501305_027632 Ga0501305_027632_60_626 180
806 3300049162 Ga0501307_052763 Ga0501307_052763_29_595 180
807 3300049527 Ga0501311_026481 Ga0501311_026481_156_722 180
808 3300049528 Ga0501312_039896 Ga0501312_039896_156_719 180
809 3300049528 Ga0501312_061123 Ga0501312_061123_62_628 180
810 3300049529 Ga0501313_024058 Ga0501313_024058_29_595 180
811 3300049530 Ga0501314_017571 Ga0501314_017571_142_708 180
812 3300049531 Ga0501315_038871 Ga0501315_038871_129_695 180
813 3300049531 Ga0501315_048721 Ga0501315_048721_56_622 180
814 3300049531 Ga0501315_063259 Ga0501315_063259_12_578 180
815 3300049532 Ga0501316_023273 Ga0501316_023273_171_737 180
816 3300049533 Ga0501317_028356 Ga0501317_028356_29_595 180
817 3300049533 Ga0501317_052812 Ga0501317_052812_55_621 180
818 3300049535 Ga0501319_005497 Ga0501319_005497_62_628 180
819 3300049536 Ga0501320_009108 Ga0501320_009108_366_932 180
820 3300049536 Ga0501320_026878 Ga0501320_026878_90_656 180
821 3300049537 Ga0501321_024814 Ga0501321_024814_35_601 180
822 3300049537 Ga0501321_027620 Ga0501321_027620_35_601 180
823 3300049538 Ga0501322_005976 Ga0501322_005976_60_626 180
824 3300049539 Ga0501323_010324 Ga0501323_010324_17_583 180
825 3300049539 Ga0501323_029308 Ga0501323_029308_184_750 180
826 3300049541 Ga0501325_008801 Ga0501325_008801_169_735 180
827 3300049542 Ga0501326_06983 Ga0501326_06983_17_583 180
828 3300049547 Ga0501331_04537 Ga0501331_04537_19_585 180
829 3300049548 Ga0501332_09604 Ga0501332_09604_56_622 180
830 3300049554 Ga0501338_09938 Ga0501338_09938_55_621 180
831 3300049556 Ga0501340_013022 Ga0501340_013022_16_582 180
832 3300049569 Ga0501032_0001066 Ga0501032_0001066_12033_12602 180
833 3300049570 Ga0501033_0493561 Ga0501033_0493561_220_783 180
834 3300049570 Ga0501033_0815326 Ga0501033_0815326_13_576 180
835 3300049571 Ga0501034_0000038 Ga0501034_0000038_150520_151089 180
836 3300049571 Ga0501034_0006957 Ga0501034_0006957_3668_4231 180
837 3300049571 Ga0501034_0078180 Ga0501034_0078180_1940_2503 180
838 3300049571 Ga0501034_0284387 Ga0501034_0284387_240_803 180
839 3300049572 Ga0501036_0001650 Ga0501036_0001650_9529_10092 180
840 3300049572 Ga0501036_0020328 Ga0501036_0020328_3851_4414 180
841 3300049572 Ga0501036_0244453 Ga0501036_0244453_443_1006 180
842 3300049574 Ga0501038_0000842 Ga0501038_0000842_11046_11609 180
843 3300049574 Ga0501038_0057100 Ga0501038_0057100_1567_2136 180
844 3300049574 Ga0501038_0088375 Ga0501038_0088375_1907_2473 180
845 3300049574 Ga0501038_0214341 Ga0501038_0214341_963_1526 180
846 3300049575 Ga0501039_0008147 Ga0501039_0008147_4645_5208 180
847 3300049575 Ga0501039_0469318 Ga0501039_0469318_155_718 180
848 3300049579 Ga0501043_0010239 Ga0501043_0010239_2081_2644 180
849 3300049579 Ga0501043_0028273 Ga0501043_0028273_2700_3269 180
850 3300049579 Ga0501043_0191280 Ga0501043_0191280_979_1545 180
851 3300049579 Ga0501043_0377046 Ga0501043_0377046_193_756 180
852 3300049580 Ga0501046_0745209 Ga0501046_0745209_34_597 180
853 3300049581 Ga0501047_0088361 Ga0501047_0088361_1106_1669 180
854 3300049581 Ga0501047_0214624 Ga0501047_0214624_734_1297 180
855 3300049581 Ga0501047_0916527 Ga0501047_0916527_20_583 180
856 3300049583 Ga0501067_0293773 Ga0501067_0293773_218_781 180
857 3300049586 Ga0501070_0000699 Ga0501070_0000699_14758_15321 180
858 3300049590 Ga0501074_0002089 Ga0501074_0002089_10998_11561 180
859 3300049742 Ga0501080_0092226 Ga0501080_0092226_1153_1716 180
860 3300049744 Ga0501083_0391421 Ga0501083_0391421_329_892 180
861 3300049822 Ga0501035_0011628 Ga0501035_0011628_993_1556 180
862 3300049822 Ga0501035_0017014 Ga0501035_0017014_489_1052 180
863 3300049822 Ga0501035_0077672 Ga0501035_0077672_293_859 180
864 3300049822 Ga0501035_0213002 Ga0501035_0213002_435_998 180
865 3300049823 Ga0501044_0001666 Ga0501044_0001666_16162_16725 180
866 3300049823 Ga0501044_0158658 Ga0501044_0158658_319_882 180
867 3300049823 Ga0501044_0166487 Ga0501044_0166487_1202_1765 180
868 3300049823 Ga0501044_0246843 Ga0501044_0246843_623_1186 180
869 3300050490 nmdc:mga03n38_27714_c1 nmdc:mga03n38_27714_c1_287_850 180
870 3300050491 nmdc:mga00v17_166774_c1 nmdc:mga00v17_166774_c1_244_810 180
871 3300050494 nmdc:mga06z11_3998_c1 nmdc:mga06z11_3998_c1_4301_4864 180
872 3300050495 nmdc:mga04h51_6421_c1 nmdc:mga04h51_6421_c1_1996_2559 180
873 3300053083 Ga0495655_0029982 Ga0495655_0029982_110_673 180
874 3300053095 Ga0500640_123794 Ga0500640_123794_176_739 180
875 3300053098 Ga0500650_0082608 Ga0500650_0082608_166_729 180
876 3300053101 Ga0500553_040173 Ga0500553_040173_502_1065 180
877 3300053133 Ga0500655_051009 Ga0500655_051009_235_798 180
878 3300053149 Ga0500600_0170175 Ga0500600_0170175_242_805 180
879 3300053149 Ga0500600_0258692 Ga0500600_0258692_52_618 180
880 3300053157 Ga0500624_001893 Ga0500624_001893_2272_2835 180
881 3300053161 Ga0500634_0226384 Ga0500634_0226384_18_581 180
882 3300053177 Ga0500636_0108504 Ga0500636_0108504_556_1119 180
883 3300059508 Ga0587088_050404 Ga0587088_050404_20_586 180
884 3300059510 Ga0587090_012051 Ga0587090_012051_334_900 180
885 3300059643 Ga0587072_097673 Ga0587072_097673_78_644 180
886 3300061719 Ga0466962_0006899 Ga0466962_0006899_3045_3608 180
887 3300026121 Ga0207683_10384880 Ga0207683_103848802 181
888 3300041512 Ga0451853_1466771 Ga0451853_1466771_887_1459 181
889 3300044658 Ga0466972_0008510 Ga0466972_0008510_1474_2058 181
890 3300044693 Ga0466961_0428399 Ga0466961_0428399_163_708 181
891 3300044719 Ga0466971_0369673 Ga0466971_0369673_33_578 181
892 3300044765 Ga0466970_0091283 Ga0466970_0091283_231_776 181
893 3300044765 Ga0466970_0591602 Ga0466970_0591602_47_592 181
894 3300044901 Ga0466960_0008310 Ga0466960_0008310_371_955 181
895 3300044901 Ga0466960_0429991 Ga0466960_0429991_85_630 181
896 3300045049 Ga0466959_0285533 Ga0466959_0285533_116_661 181
897 3300046474 Ga0495605_0082197 Ga0495605_0082197_166_732 181
898 3300046499 Ga0495594_0047990 Ga0495594_0047990_1061_1627 181
899 3300046500 Ga0495596_0038542 Ga0495596_0038542_776_1342 181
900 3300046507 Ga0495606_0161614 Ga0495606_0161614_681_1247 181
901 3300046513 Ga0495616_0305192 Ga0495616_0305192_29_595 181
902 3300046514 Ga0495618_0029449 Ga0495618_0029449_1060_1626 181
903 3300046515 Ga0495620_0002213 Ga0495620_0002213_9281_9847 181
904 3300046516 Ga0495628_0389062 Ga0495628_0389062_435_1001 181
905 3300046522 Ga0495643_0014350 Ga0495643_0014350_1747_2313 181
906 3300046524 Ga0495648_0030131 Ga0495648_0030131_2746_3312 181
907 3300046526 Ga0495666_0036253 Ga0495666_0036253_1369_1935 181
908 3300046528 Ga0495642_0163598 Ga0495642_0163598_147_713 181
909 3300046542 Ga0495597_0021872 Ga0495597_0021872_104_670 181
910 3300046557 Ga0495622_0013070 Ga0495622_0013070_1509_2075 181
911 3300046558 Ga0495633_0262571 Ga0495633_0262571_56_622 181
912 3300046616 Ga0495668_0047613 Ga0495668_0047613_1721_2287 181
913 3300046642 Ga0495634_0026488 Ga0495634_0026488_833_1399 181
914 3300046648 Ga0495611_0132490 Ga0495611_0132490_53_619 181
915 3300046690 Ga0495624_0035807 Ga0495624_0035807_1916_2482 181
916 3300046694 Ga0495649_0021626 Ga0495649_0021626_2278_2844 181
917 3300046794 Ga0495589_0018530 Ga0495589_0018530_55_621 181
918 3300047318 Ga0495636_0080747 Ga0495636_0080747_673_1239 181
919 3300047320 Ga0495672_0136140 Ga0495672_0136140_705_1271 181
920 3300047443 Ga0495687_013692 Ga0495687_013692_2967_3533 181
921 3300047443 Ga0495687_022647 Ga0495687_022647_683_1249 181
922 3300047445 Ga0495677_0168718 Ga0495677_0168718_158_724 181
923 3300048929 Ga0496126_0590806 Ga0496126_0590806_61_627 181
924 3300053088 Ga0500644_0019646 Ga0500644_0019646_1365_1943 181
925 3300005367 Ga0070667_100629319 Ga0070667_1006293191 182
926 3300041406 Ga0439439_0000854 Ga0439439_0000854_1691_2269 182
927 3300042014 Ga0439457_003861 Ga0439457_003861_177_755 182
928 3300046492 Ga0495585_0031788 Ga0495585_0031788_1483_2070 182
929 3300046518 Ga0495631_0001344 Ga0495631_0001344_10945_11532 182
930 3300046794 Ga0495589_0072194 Ga0495589_0072194_342_929 182
931 3300047443 Ga0495687_079775 Ga0495687_079775_374_961 182
932 3300047443 Ga0495687_116544 Ga0495687_116544_179_766 182
933 3300047447 Ga0495685_005882 Ga0495685_005882_1131_1718 182
934 3300047470 Ga0495681_0058787 Ga0495681_0058787_378_965 182
935 3300048912 Ga0496109_0067134 Ga0496109_0067134_2651_3259 182
936 3300053140 Ga0500573_0007965 Ga0500573_0007965_4468_5019 182
937 iso_pu_bacteria 2751185725 2753035386 184
938 iso_pu_bacteria 2751185792 2753326588 184
939 3300044694 Ga0466963_0039529 Ga0466963_0039529_1991_2551 186
940 3300044735 Ga0466968_0109181 Ga0466968_0109181_59_619 186
941 3300044842 Ga0466957_0365381 Ga0466957_0365381_162_722 186
942 3300045049 Ga0466959_0460686 Ga0466959_0460686_179_739 186
943 3300045836 Ga0466958_0190585 Ga0466958_0190585_194_754 186
944 3300001979 JGI24740J21852_10066862 JGI24740J21852_100668622 190
945 3300005336 Ga0070680_100157237 Ga0070680_1001572372 190
946 3300005530 Ga0070679_100002368 Ga0070679_1000023688 190
947 3300005535 Ga0070684_100263252 Ga0070684_1002632522 190
948 3300005563 Ga0068855_100344247 Ga0068855_1003442472 190
949 3300005577 Ga0068857_100674183 Ga0068857_1006741832 190
950 3300025909 Ga0207705_10068050 Ga0207705_100680503 190
951 3300025917 Ga0207660_10238965 Ga0207660_102389652 190
952 3300025921 Ga0207652_10177426 Ga0207652_101774262 190
953 3300026116 Ga0207674_11035498 Ga0207674_110354981 190

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03358

FMN_red

NADPH-dependent FMN reductase

28

177

0.95

PF02525

Flavodoxin_2

Flavodoxin-like fold

28

162

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
1x77-assembly1.cif.gz_B crystal structure of a nad(p)h-dependent fmn reductase complexed with fmn 0.8723 11 180
4hs4-assembly1.cif.gz_G-1 crystal structure of a putative chromate reductase from gluconacetobacter hansenii, gh-chrr, containing a y129n substitution. 0.8654 9 180
3s2y-assembly1.cif.gz_A crystal structure of a chromate/uranium reductase from gluconacetobacter hansenii 0.8641 9 180
3svl-assembly1.cif.gz_B structural basis of the improvement of chrr - a multi-purpose enzyme 0.8612 9 180
4h6p-assembly1.cif.gz_A crystal structure of a putative chromate reductase from gluconacetobacter hansenii, gh-chrr, containing a r101a substitution. 0.86 9 180
ID Description Score Start End Superfamily
af_P95105_3_183_3.40.50.360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.929 3 179 3.40.50.360
af_P95105_3_183_3.40.50.360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8994 3 179 3.40.50.360
3svlA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8784 9 180 3.40.50.360
1x77B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8723 11 180 3.40.50.360
1x77B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8491 11 180 3.40.50.360
ID Description Score Start End GO Terms
AF-A0A7K2MG86-F1-model_v4 FMN reductase 0.9681 9 87 GO:0005829
GO:0010181
GO:0016491
AF-A0A4Q4CW87-F1-model_v4 NAD(P)H-dependent oxidoreductase 0.9621 10 148 GO:0005829
GO:0010181
GO:0016491
AF-N1USY7-F1-model_v4 Reductase 0.956 9 89 GO:0005829
GO:0010181
GO:0016491
AF-A0A1A3H9G9-F1-model_v4 FMN reductase 0.9517 10 133 GO:0005829
GO:0010181
GO:0016491
AF-D6ZFM8-F1-model_v4 NADPH-dependent FMN reductase 0.9479 10 180 GO:0005829
GO:0010181
GO:0016491

Feature Viewer

pLDDT pTM Quality
88.57 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map