F486557

General Info

Members Datasets Scaffolds Average Seq Length
950 607 725 256

Family's Representative Sequence

Representative Sequence 3300032005|Ga0307411_10214309|Ga0307411_102143092
Length 298
Sequence MIIVILFEHVPPRNIPLGLPLTSRRNVLGSGGNRPDQVTENNMEMLNPHCGIDRDGRGVVRLSICNAGSLNILSSAVTDGVREGFEKLASDKTIRAVILAGQSEKSMIGGADIKEMAKLDQKSAEAFITRLRDLCEAVRRFPAPVIARLPGWCLGGGLEVAAACDFRIAAHDAKFGMPEVRVGIPSVIHAALLPRLIGWGRARWLVMTAENIDAPTAHTWGLVDVVAEEGGLDAAVEHTVKALLECGPEALRAQKALMRQWEELPLTESVNLSIEVFGKSFLTGEPQRLMQGFLERKK

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
5 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
6 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
7 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
8 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
9 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
10 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
11 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
12 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
13 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
14 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
15 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
16 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
17 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
18 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
19 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
20 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
21 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
22 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
23 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
24 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
25 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
26 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
27 2643221621 Achromobacter sp. Root83 Isolate Unclassified
28 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
29 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
30 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
31 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
32 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
33 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
34 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
35 2791355199
36 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
37 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
38 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
39 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
40 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
41 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
42 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
43 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
44 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
45 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
46 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
47 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
48 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
49 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
50 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
51 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
52 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
53 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
54 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
55 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
56 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
57 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
58 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
59 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
60 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
61 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
62 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
63 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
64 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
65 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
66 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
67 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
68 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
69 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
70 2855730933 Achromobacter sp. HZ28 Isolate Nodule
71 2855767633 Achromobacter sp. HZ34 Isolate Nodule
72 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
73 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
74 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
75 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
76 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
77 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
78 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
79 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
80 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
81 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
82 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
83 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
84 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
85 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
86 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
87 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
88 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
89 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
90 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
91 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
92 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
93 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
94 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
95 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
96 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
97 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
98 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
99 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
100 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
101 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
102 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
103 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
104 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
105 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
106 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
107 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
108 2904699407
109 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
110 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
111 2906610324
112 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
113 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
114 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
115 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
116 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
117 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
118 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
119 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
120 2922368715
121 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
122 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
123 2922425934
124 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
125 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
126 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
127 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
128 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
129 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
130 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
131 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
132 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
133 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
134 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
135 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
136 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
137 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
138 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
139 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
140 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
141 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
142 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
143 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
144 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
145 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
146 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
147 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
148 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
149 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
150 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
151 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
152 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
153 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
154 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
155 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
156 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
157 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
158 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
159 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
160 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
161 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
162 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
163 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
164 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
165 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
166 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
167 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
168 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
169 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
170 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
171 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
172 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
173 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
174 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
175 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
176 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
177 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
178 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
179 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
180 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
181 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
182 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
183 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
184 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
185 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
186 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
187 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
188 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
189 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
190 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
191 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
192 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
193 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
194 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
195 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
196 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
197 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
198 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
199 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
200 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
201 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
202 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
203 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
204 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
205 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
206 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
207 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
208 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
209 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
210 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
211 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
212 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
213 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
214 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
215 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
216 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
217 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
218 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
219 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
220 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
221 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
222 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
223 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
224 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
225 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
226 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
227 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
228 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
229 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
230 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
231 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
232 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
233 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
234 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
235 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
236 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
237 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
238 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
239 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
240 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
241 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
242 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
243 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
244 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
245 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
246 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
247 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
248 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
249 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
250 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
251 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
252 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
253 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
254 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
255 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
256 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
257 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
258 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
259 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
260 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
261 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
262 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
263 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
264 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
265 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
266 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
267 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
268 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
269 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
270 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
271 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
272 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
273 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
274 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
275 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
276 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
277 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
278 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
279 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
280 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
281 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
282 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
283 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
284 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
285 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
286 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
287 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
288 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
289 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
290 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
291 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
292 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
293 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
294 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
295 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
296 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
297 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
298 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
299 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
302 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
303 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
304 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
305 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
306 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
309 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
313 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
314 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
315 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
316 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
317 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
318 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
319 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
320 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
321 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
322 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
323 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
324 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
325 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
326 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
327 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
328 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
329 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
330 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
331 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
332 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
333 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
334 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
335 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
336 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
337 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
338 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
339 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
340 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
341 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
342 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
343 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
344 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
345 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
346 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
347 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
348 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
349 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
350 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
351 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
352 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
353 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
354 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
355 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
356 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
357 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
358 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
359 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
360 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
361 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
362 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
363 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
364 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
365 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
366 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
367 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
368 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
369 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
370 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
371 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
372 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
373 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
374 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
375 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
376 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
377 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
378 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
379 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
380 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
381 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
382 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
383 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
384 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
385 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
386 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
387 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
388 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
389 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
390 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
391 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
392 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
393 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
394 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
395 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
396 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
397 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
398 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
399 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
400 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
401 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
402 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
403 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
404 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
405 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
406 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
407 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
408 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
409 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
410 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
411 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
412 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
413 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
414 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
415 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
416 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
417 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
418 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
419 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
420 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
421 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
422 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
423 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
424 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
425 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
426 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
427 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
428 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
429 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
430 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
431 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
432 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
433 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
434 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
435 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
436 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
437 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
438 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
439 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
440 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
441 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
442 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
443 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
444 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
445 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
446 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
447 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
448 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
449 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
450 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
451 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
452 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
453 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
454 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
455 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
456 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
457 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
458 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
459 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
460 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
461 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
462 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
463 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
464 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
465 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
466 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
467 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
468 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
469 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
470 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
471 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
472 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
473 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
474 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
475 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
476 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
477 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
478 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
479 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
480 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
481 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
482 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
483 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
484 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
485 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
486 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
487 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
488 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
489 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
490 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
491 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
492 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
493 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
494 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
495 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
496 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
497 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
498 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
499 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
500 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
501 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
502 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
503 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
504 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
505 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
506 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
507 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
508 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
509 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
510 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
511 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
512 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
513 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
514 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
515 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
516 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
517 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
518 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
519 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
520 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
521 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
522 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
523 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
524 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
525 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
526 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
527 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
528 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
529 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
530 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
531 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
532 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
533 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
534 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
535 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
536 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
537 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
538 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
539 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
540 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
541 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
542 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
543 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
544 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
545 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
546 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
547 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
548 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
549 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
550 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
551 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
552 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
553 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
554 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
555 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
556 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
557 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
558 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
559 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
560 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
561 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
562 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
563 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
564 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
565 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
566 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
567 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
568 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
569 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
570 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
571 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
572 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
573 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
574 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
575 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
576 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
577 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
578 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
579 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
580 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
581 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
582 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
583 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
584 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
585 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
586 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
587 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
588 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
589 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
590 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
591 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
592 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
593 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
594 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
595 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
596 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
597 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
598 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
599 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
600 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
601 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
602 8055225921 Achromobacter panacis KCTC 42751 Isolate Rhizosphere
603 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
604 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
605 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
606 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
607 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 76.72
Metatranscriptomes 0
Isolates 23.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.21
Nodule 17.79
Rhizoplane 5.37
Rhizosphere 50.32
Stem 0
Stem Tuber 0
Unclassified 12.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10000771 3300003187 Bacteria 25948
2 JGI25406J46586_10010965 3300003203 Bacteria 3989
3 JGI25153J46596_10001356 3300003215 Bacteria 14648
4 JGI25153J46596_10003157 3300003215 Bacteria 9295
5 JGI25153J46596_10006306 3300003215 Bacteria 6038
6 JGI25160J50197_1001301 3300003354 Bacteria 12602
7 JGI25160J50197_1018309 3300003354 Bacteria 2188
8 JGI25404J52841_10007507 3300003659 Bacteria 2307
9 JGI25404J52841_10026821 3300003659 Bacteria 1239
10 Ga0055531_10001373 3300003794 Bacteria 18075
11 Ga0055543_1005177 3300004625 Bacteria 3379
12 Ga0065165_1000231 3300005262 Bacteria 97237
13 Ga0065165_1001615 3300005262 Bacteria 22970
14 Ga0065165_1012190 3300005262 Bacteria 3519
15 Ga0065165_1030497 3300005262 Bacteria 1714
16 Ga0070683_100073945 3300005329 Bacteria 3182
17 Ga0070683_100129317 3300005329 Bacteria 2389
18 Ga0070690_100268989 3300005330 Bacteria 1212
19 Ga0068868_100006460 3300005338 Bacteria 8297
20 Ga0070660_100078143 3300005339 Bacteria 2594
21 Ga0070669_100082491 3300005353 Bacteria 2397
22 Ga0070675_100121948 3300005354 Bacteria 2215
23 Ga0070671_100207479 3300005355 Bacteria 1662
24 Ga0070671_100326443 3300005355 Bacteria 1308
25 Ga0070671_100435493 3300005355 Bacteria 1124
26 Ga0070674_100042283 3300005356 Bacteria 3094
27 Ga0070674_100068497 3300005356 Bacteria 2500
28 Ga0070673_100470675 3300005364 Bacteria 1133
29 Ga0070659_100033068 3300005366 Bacteria 4015
30 Ga0070659_100135974 3300005366 Bacteria 1999
31 Ga0070659_100259853 3300005366 Bacteria 1441
32 Ga0070667_100207919 3300005367 Bacteria 1739
33 Ga0070667_100418830 3300005367 Bacteria 1221
34 Ga0070709_10000351 3300005434 Bacteria 28490
35 Ga0070709_10059167 3300005434 Bacteria 2432
36 Ga0070709_10097368 3300005434 Bacteria 1953
37 Ga0070709_10181078 3300005434 Bacteria 1480
38 Ga0070709_10281330 3300005434 Bacteria 1209
39 Ga0070714_100028697 3300005435 Bacteria 4620
40 Ga0070714_100060765 3300005435 Bacteria 3244
41 Ga0070714_100114084 3300005435 Bacteria 2397
42 Ga0070714_100191918 3300005435 Bacteria 1864
43 Ga0070714_100419947 3300005435 Bacteria 1267
44 Ga0070713_100010740 3300005436 Bacteria 6632
45 Ga0070713_100045355 3300005436 Bacteria 3602
46 Ga0070713_100134091 3300005436 Bacteria 2187
47 Ga0070713_100169677 3300005436 Bacteria 1954
48 Ga0070710_10000790 3300005437 Bacteria 15175
49 Ga0070710_10006588 3300005437 Bacteria 5584
50 Ga0070710_10021776 3300005437 Bacteria 3346
51 Ga0070710_10023705 3300005437 Bacteria 3229
52 Ga0070711_100003109 3300005439 Bacteria 9606
53 Ga0070711_100005522 3300005439 Bacteria 7570
54 Ga0070663_100030695 3300005455 Bacteria 3686
55 Ga0070663_100060153 3300005455 Bacteria 2731
56 Ga0070663_100118917 3300005455 Bacteria 1994
57 Ga0070663_100141497 3300005455 Bacteria 1837
58 Ga0070678_100158271 3300005456 Bacteria 1832
59 Ga0070678_100347736 3300005456 Bacteria 1274
60 Ga0070706_100556312 3300005467 Bacteria 1067
61 Ga0070679_100055233 3300005530 Bacteria 3955
62 Ga0070679_100166882 3300005530 Bacteria 2175
63 Ga0070679_100186312 3300005530 Bacteria 2046
64 Ga0070684_100023204 3300005535 Bacteria 5185
65 Ga0070684_100645903 3300005535 Bacteria 985
66 Ga0068853_100474643 3300005539 Bacteria 1179
67 Ga0068853_100560449 3300005539 Bacteria 1083
68 Ga0070672_100397050 3300005543 Bacteria 1181
69 Ga0070665_100025947 3300005548 Bacteria 5901
70 Ga0070665_100036979 3300005548 Bacteria 4910
71 Ga0070665_100060854 3300005548 Bacteria 3785
72 Ga0070665_100151628 3300005548 Bacteria 2321
73 Ga0070665_100200021 3300005548 Bacteria 1999
74 Ga0070665_100203493 3300005548 Bacteria 1980
75 Ga0070665_100208313 3300005548 Bacteria 1956
76 Ga0070665_100871143 3300005548 Bacteria 913
77 Ga0068855_100102451 3300005563 Bacteria 3295
78 Ga0068855_100315982 3300005563 Bacteria 1727
79 Ga0068857_100083327 3300005577 Bacteria 2856
80 Ga0068854_100012639 3300005578 Bacteria 5533
81 Ga0068854_100280741 3300005578 Bacteria 1341
82 Ga0068854_100321672 3300005578 Bacteria 1257
83 Ga0068856_100000020 3300005614 Bacteria 146775
84 Ga0068856_100004981 3300005614 Bacteria 13148
85 Ga0068856_100592409 3300005614 Bacteria 1130
86 Ga0070702_100082602 3300005615 Bacteria 1928
87 Ga0068852_100025025 3300005616 Bacteria 4832
88 Ga0068866_10055899 3300005718 Bacteria 2029
89 Ga0068861_100037780 3300005719 Bacteria 3590
90 Ga0068861_100059734 3300005719 Bacteria 2920
91 Ga0068851_10192907 3300005834 Bacteria 1133
92 Ga0068858_100177740 3300005842 Bacteria 2009
93 Ga0068860_100181433 3300005843 Bacteria 2034
94 Ga0068860_100701869 3300005843 Bacteria 1021
95 Ga0068862_100053644 3300005844 Bacteria 3451
96 Ga0068862_100092250 3300005844 Bacteria 2640
97 Ga0068862_100185838 3300005844 Bacteria 1867
98 Ga0081455_10002087 3300005937 Bacteria 23835
99 Ga0081455_10178435 3300005937 Bacteria 1611
100 Ga0081540_1000544 3300005983 Bacteria 36521
101 Ga0081540_1002537 3300005983 Bacteria 14812
102 Ga0081540_1007763 3300005983 Bacteria 7594
103 Ga0081540_1014601 3300005983 Bacteria 5021
104 Ga0081540_1018042 3300005983 Bacteria 4344
105 Ga0081540_1019612 3300005983 Bacteria 4101
106 Ga0081540_1052409 3300005983 Bacteria 2009
107 Ga0081540_1080110 3300005983 Bacteria 1474
108 Ga0081539_10001065 3300005985 Bacteria 50187
109 Ga0081539_10025008 3300005985 Bacteria 3858
110 Ga0070717_10033314 3300006028 Bacteria 4156
111 Ga0070717_10035208 3300006028 Bacteria 4051
112 Ga0070717_10196040 3300006028 Bacteria 1767
113 Ga0075365_10015033 3300006038 Bacteria 4671
114 Ga0075365_10016997 3300006038 Bacteria 4442
115 Ga0075365_10027865 3300006038 Bacteria 3598
116 Ga0075365_10080641 3300006038 Bacteria 2203
117 Ga0075365_10081177 3300006038 Bacteria 2197
118 Ga0075368_10005507 3300006042 Bacteria 4359
119 Ga0075368_10012445 3300006042 Bacteria 3110
120 Ga0075368_10069060 3300006042 Bacteria 1425
121 Ga0075363_100003747 3300006048 Bacteria 6543
122 Ga0075363_100042738 3300006048 Bacteria 2395
123 Ga0075363_100094667 3300006048 Bacteria 1647
124 Ga0075364_10021240 3300006051 Bacteria 4090
125 Ga0070715_10047457 3300006163 Bacteria 1830
126 Ga0070716_100001893 3300006173 Bacteria 9489
127 Ga0070716_100002939 3300006173 Bacteria 7944
128 Ga0070716_100032549 3300006173 Bacteria 2845
129 Ga0070712_100014227 3300006175 Bacteria 5106
130 Ga0070712_100034601 3300006175 Bacteria 3425
131 Ga0070712_100055261 3300006175 Bacteria 2780
132 Ga0070712_100131428 3300006175 Bacteria 1898
133 Ga0070712_100207338 3300006175 Bacteria 1544
134 Ga0075362_10010396 3300006177 Bacteria 3632
135 Ga0075367_10029633 3300006178 Bacteria 3132
136 Ga0075367_10088416 3300006178 Bacteria 1883
137 Ga0075367_10139696 3300006178 Bacteria 1500
138 Ga0075367_10286152 3300006178 Bacteria 1037
139 Ga0075369_10024341 3300006186 Bacteria 2508
140 Ga0075369_10063006 3300006186 Bacteria 1621
141 Ga0075366_10235662 3300006195 Bacteria 1115
142 Ga0097621_100044709 3300006237 Bacteria 3574
143 Ga0075370_10041783 3300006353 Bacteria 2589
144 Ga0075370_10050053 3300006353 Bacteria 2369
145 Ga0075370_10086243 3300006353 Bacteria 1808
146 Ga0075428_100020304 3300006844 Bacteria 7357
147 Ga0075428_100393436 3300006844 Bacteria 1485
148 Ga0075434_100113707 3300006871 Bacteria 2719
149 Ga0099825_1027806 3300006941 Bacteria 2834
150 Ga0099824_1013697 3300006942 Bacteria 8328
151 Ga0075435_100061221 3300007076 Bacteria 3053
152 Ga0099795_10155305 3300007788 Bacteria 940
153 Ga0105240_10016003 3300009093 Bacteria 10167
154 Ga0105240_10594063 3300009093 Bacteria 1220
155 Ga0105240_10954614 3300009093 Bacteria 919
156 Ga0105245_10388955 3300009098 Bacteria 1391
157 Ga0114129_10202039 3300009147 Bacteria 2691
158 Ga0105241_10078470 3300009174 Bacteria 2580
159 Ga0105241_10213832 3300009174 Bacteria 1617
160 Ga0105242_10487436 3300009176 Bacteria 1170
161 Ga0105242_10869106 3300009176 Bacteria 899
162 Ga0105248_10116638 3300009177 Bacteria 3011
163 Ga0105248_10548232 3300009177 Bacteria 1304
164 Ga0105237_10008180 3300009545 Bacteria 11362
165 Ga0105237_10044534 3300009545 Bacteria 4469
166 Ga0105237_10108781 3300009545 Bacteria 2763
167 Ga0105238_10086581 3300009551 Bacteria 3120
168 Ga0105238_10379099 3300009551 Bacteria 1406
169 Ga0105239_10063987 3300010375 Bacteria 4038
170 Ga0105239_10114262 3300010375 Bacteria 2995
171 Ga0105239_10121462 3300010375 Bacteria 2901
172 Ga0105239_10600764 3300010375 Bacteria 1255
173 Ga0105239_10746272 3300010375 Bacteria 1120
174 Ga0105246_10551445 3300011119 Bacteria 988
175 Ga0157371_10299676 3300013102 Bacteria 1164
176 Ga0157370_10175441 3300013104 Bacteria 1992
177 Ga0157369_10017045 3300013105 Bacteria 8162
178 Ga0157369_10100743 3300013105 Bacteria 3079
179 Ga0157378_10005570 3300013297 Bacteria 11023
180 Ga0157378_10208892 3300013297 Bacteria 1850
181 Ga0163162_10036732 3300013306 Bacteria 4885
182 Ga0157372_10167784 3300013307 Bacteria 2539
183 Ga0157375_10512727 3300013308 Bacteria 1363
184 Ga0163163_10020685 3300014325 Bacteria 6202
185 Ga0157380_10162545 3300014326 Bacteria 1942
186 Ga0182008_10125385 3300014497 Bacteria 1278
187 Ga0157379_10312350 3300014968 Bacteria 1434
188 Ga0157376_10032597 3300014969 Bacteria 4185
189 Ga0214544_1000002 3300021320 Bacteria 753857
190 Ga0214542_1000001 3300021321 Bacteria 1018696
191 Ga0214545_1000001 3300021324 Bacteria 1092817
192 Ga0214543_1000001 3300021327 Bacteria 776921
193 Ga0213872_10138378 3300021361 Bacteria 1070
194 Ga0213874_10024195 3300021377 Bacteria 1701
195 Ga0213871_10003516 3300021441 Bacteria 3031
196 Ga0209677_100483 3300025253 Bacteria 22633
197 Ga0209677_104067 3300025253 Bacteria 4396
198 Ga0209148_1005631 3300025254 Bacteria 2840
199 Ga0209233_1001668 3300025261 Bacteria 8646
200 Ga0209233_1006103 3300025261 Bacteria 3920
201 Ga0209233_1008167 3300025261 Bacteria 3259
202 Ga0209455_1001684 3300025272 Bacteria 9471
203 Ga0209025_1000018 3300025294 Bacteria 686898
204 Ga0209564_1021385 3300025295 Bacteria 2329
205 Ga0209564_1040789 3300025295 Bacteria 1255
206 Ga0209758_1000140 3300025297 Bacteria 174267
207 Ga0209758_1000321 3300025297 Bacteria 92591
208 Ga0209758_1001331 3300025297 Bacteria 29931
209 Ga0209758_1003646 3300025297 Bacteria 13738
210 Ga0209758_1006172 3300025297 Bacteria 8773
211 Ga0209758_1007980 3300025297 Bacteria 7009
212 Ga0209758_1012881 3300025297 Bacteria 4627
213 Ga0209758_1016109 3300025297 Bacteria 3816
214 Ga0209758_1037807 3300025297 Bacteria 1860
215 Ga0209758_1050985 3300025297 Bacteria 1445
216 Ga0209256_1004950 3300025299 Bacteria 7983
217 Ga0207426_1000278 3300025302 Bacteria 105775
218 Ga0207426_1000434 3300025302 Bacteria 68127
219 Ga0207426_1007488 3300025302 Bacteria 4565
220 Ga0207426_1023439 3300025302 Bacteria 2106
221 Ga0209257_1000522 3300025304 Bacteria 66723
222 Ga0209257_1013223 3300025304 Bacteria 3703
223 Ga0207697_10047475 3300025315 Bacteria 1770
224 Ga0207692_10005939 3300025898 Bacteria 4927
225 Ga0207692_10015770 3300025898 Bacteria 3332
226 Ga0207692_10030387 3300025898 Bacteria 2576
227 Ga0207642_10078545 3300025899 Bacteria 1595
228 Ga0207680_10033125 3300025903 Bacteria 2944
229 Ga0207647_10010455 3300025904 Bacteria 6556
230 Ga0207699_10000274 3300025906 Bacteria 28351
231 Ga0207699_10010208 3300025906 Bacteria 4703
232 Ga0207699_10061107 3300025906 Bacteria 2266
233 Ga0207699_10182488 3300025906 Bacteria 1412
234 Ga0207643_10212224 3300025908 Bacteria 1182
235 Ga0207705_10225416 3300025909 Bacteria 1424
236 Ga0207707_10180129 3300025912 Bacteria 1845
237 Ga0207707_10196337 3300025912 Bacteria 1760
238 Ga0207695_10000008 3300025913 Bacteria 1058268
239 Ga0207671_10005303 3300025914 Bacteria 11944
240 Ga0207671_10035244 3300025914 Bacteria 3715
241 Ga0207671_10153871 3300025914 Bacteria 1778
242 Ga0207671_10419527 3300025914 Bacteria 1065
243 Ga0207693_10008368 3300025915 Bacteria 8464
244 Ga0207693_10023655 3300025915 Bacteria 4875
245 Ga0207693_10070166 3300025915 Bacteria 2742
246 Ga0207663_10000084 3300025916 Bacteria 44454
247 Ga0207663_10007427 3300025916 Bacteria 5682
248 Ga0207663_10030428 3300025916 Bacteria 3185
249 Ga0207660_10037461 3300025917 Bacteria 3379
250 Ga0207657_10412032 3300025919 Bacteria 1062
251 Ga0207649_10113680 3300025920 Bacteria 1813
252 Ga0207652_10066947 3300025921 Bacteria 3114
253 Ga0207681_10068461 3300025923 Bacteria 2466
254 Ga0207694_10070674 3300025924 Bacteria 2727
255 Ga0207659_10208204 3300025926 Bacteria 1566
256 Ga0207687_10341400 3300025927 Bacteria 1218
257 Ga0207700_10073423 3300025928 Bacteria 2641
258 Ga0207700_10086545 3300025928 Bacteria 2463
259 Ga0207700_10134927 3300025928 Bacteria 2020
260 Ga0207700_10143541 3300025928 Bacteria 1965
261 Ga0207700_10445875 3300025928 Bacteria 1140
262 Ga0207664_10002496 3300025929 Bacteria 12180
263 Ga0207664_10085336 3300025929 Bacteria 2576
264 Ga0207664_10102554 3300025929 Bacteria 2366
265 Ga0207664_10486355 3300025929 Bacteria 1104
266 Ga0207644_10189752 3300025931 Bacteria 1615
267 Ga0207644_10193326 3300025931 Bacteria 1601
268 Ga0207644_10395333 3300025931 Bacteria 1129
269 Ga0207644_10451598 3300025931 Bacteria 1056
270 Ga0207690_10179677 3300025932 Bacteria 1592
271 Ga0207706_10050730 3300025933 Bacteria 3666
272 Ga0207706_10070340 3300025933 Bacteria 3078
273 Ga0207686_10203494 3300025934 Bacteria 1419
274 Ga0207669_10174680 3300025937 Bacteria 1533
275 Ga0207665_10002807 3300025939 Bacteria 11674
276 Ga0207665_10032925 3300025939 Bacteria 3433
277 Ga0207665_10206823 3300025939 Bacteria 1432
278 Ga0207665_10261301 3300025939 Bacteria 1283
279 Ga0207665_10306626 3300025939 Bacteria 1188
280 Ga0207691_10076528 3300025940 Bacteria 3015
281 Ga0207711_10090544 3300025941 Bacteria 2689
282 Ga0207711_10532513 3300025941 Bacteria 1096
283 Ga0207661_10008546 3300025944 Bacteria 7318
284 Ga0207661_10114804 3300025944 Bacteria 2284
285 Ga0207679_10138591 3300025945 Bacteria 1963
286 Ga0207667_10785701 3300025949 Bacteria 950
287 Ga0207651_10041786 3300025960 Bacteria 3046
288 Ga0207651_10245886 3300025960 Bacteria 1461
289 Ga0207712_10172803 3300025961 Bacteria 1691
290 Ga0207668_10040632 3300025972 Bacteria 3139
291 Ga0207668_10074342 3300025972 Bacteria 2439
292 Ga0207640_10004002 3300025981 Bacteria 7962
293 Ga0207658_10209925 3300025986 Bacteria 1631
294 Ga0207677_10046223 3300026023 Bacteria 2913
295 Ga0207639_10492668 3300026041 Bacteria 1118
296 Ga0207678_10006143 3300026067 Bacteria 10683
297 Ga0207678_10016812 3300026067 Bacteria 6425
298 Ga0207678_10093268 3300026067 Bacteria 2573
299 Ga0207678_10123907 3300026067 Bacteria 2206
300 Ga0207678_10189170 3300026067 Bacteria 1759
301 Ga0207678_10345845 3300026067 Bacteria 1282
302 Ga0207678_10456843 3300026067 Bacteria 1111
303 Ga0207708_10019823 3300026075 Bacteria 5071
304 Ga0207708_10121088 3300026075 Bacteria 2039
305 Ga0207708_10138261 3300026075 Bacteria 1909
306 Ga0207702_10000748 3300026078 Bacteria 34672
307 Ga0207702_10091695 3300026078 Bacteria 2661
308 Ga0207702_10143059 3300026078 Bacteria 2167
309 Ga0207702_10497402 3300026078 Bacteria 1188
310 Ga0207641_10137968 3300026088 Bacteria 2197
311 Ga0207641_10355050 3300026088 Bacteria 1398
312 Ga0207675_100046463 3300026118 Bacteria 4056
313 Ga0207683_10029535 3300026121 Bacteria 4747
314 Ga0207683_10349609 3300026121 Bacteria 1357
315 Ga0207698_10051841 3300026142 Bacteria 3139
316 Ga0207698_10060464 3300026142 Bacteria 2947
317 Ga0207698_10428359 3300026142 Bacteria 1271
318 Ga0209389_1000040 3300027296 Bacteria 124256
319 Ga0209389_1000123 3300027296 Bacteria 70041
320 Ga0209589_1000036 3300027357 Bacteria 131278
321 Ga0209489_100006 3300027361 Bacteria 475698
322 Ga0209489_111146 3300027361 Bacteria 9434
323 Ga0209700_100005 3300027363 Bacteria 573969
324 Ga0209813_10039185 3300027866 Bacteria 1435
325 Ga0207428_10383415 3300027907 Bacteria 1031
326 Ga0268266_10002598 3300028379 Bacteria 19129
327 Ga0268266_10027621 3300028379 Bacteria 4824
328 Ga0268266_10152487 3300028379 Bacteria 2084
329 Ga0268266_10229557 3300028379 Bacteria 1709
330 Ga0268266_10300258 3300028379 Bacteria 1498
331 Ga0268266_10307747 3300028379 Bacteria 1480
332 Ga0268266_10463615 3300028379 Bacteria 1206
333 Ga0268266_10774991 3300028379 Bacteria 926
334 Ga0268265_10062055 3300028380 Bacteria 2870
335 Ga0268265_10225589 3300028380 Bacteria 1643
336 Ga0268265_10620121 3300028380 Bacteria 1036
337 Ga0268264_10071176 3300028381 Bacteria 2946
338 Ga0268264_10452889 3300028381 Bacteria 1244
339 Ga0265337_1030922 3300028556 Bacteria 1591
340 Ga0265319_1001625 3300028563 Bacteria 13112
341 Ga0265334_10011646 3300028573 Bacteria 3698
342 Ga0265323_10000194 3300028653 Bacteria 36720
343 Ga0265336_10000244 3300028666 Bacteria 38493
344 Ga0307517_10000249 3300028786 Bacteria 91911
345 Ga0307515_10075370 3300028794 Bacteria 4495
346 Ga0265338_10000665 3300028800 Bacteria 59449
347 Ga0265324_10013895 3300029957 Bacteria 2989
348 Ga0265330_10007755 3300031235 Bacteria 5211
349 Ga0265330_10077068 3300031235 Bacteria 1439
350 Ga0265325_10028947 3300031241 Bacteria 2981
351 Ga0265340_10013213 3300031247 Bacteria 4345
352 Ga0265339_10149755 3300031249 Bacteria 1181
353 Ga0265316_10133331 3300031344 Bacteria 1870
354 Ga0307513_10064593 3300031456 Bacteria 3856
355 Ga0265313_10077547 3300031595 Bacteria 1517
356 Ga0265314_10006694 3300031711 Bacteria 10125
357 Ga0265342_10074982 3300031712 Bacteria 1964
358 Ga0307516_10066838 3300031730 Bacteria 3466
359 Ga0307516_10252820 3300031730 Bacteria 1456
360 Ga0307413_10546295 3300031824 Bacteria 939
361 Ga0307406_10190542 3300031901 Bacteria 1501
362 Ga0307409_100505020 3300031995 Bacteria 1178
363 Ga0307414_10268514 3300032004 Bacteria 1427
364 Ga0307411_10214309 3300032005 Bacteria 1489
365 Ga0307510_10003728 3300033180 Bacteria 17805
366 Ga0307510_10229219 3300033180 Bacteria 1361
367 Ga0315911_1000006 3300033442 Bacteria 414563
368 Ga0373959_0043778 3300034820 Bacteria 948
369 Ga0373928_0022976 3300035084 Bacteria 1326
370 Ga0373934_0017731 3300035086 Bacteria 2720
371 Ga0373944_0096679 3300035089 Bacteria 993
372 Ga0373923_0007119 3300035111 Bacteria 3916
373 Ga0373936_0072373 3300035113 Bacteria 1423
374 Ga0373953_0000370 3300035117 Bacteria 12142
375 Ga0373953_0085020 3300035117 Bacteria 1319
376 Ga0373954_0000900 3300035118 Bacteria 11573
377 Ga0373956_0001015 3300035119 Bacteria 11589
378 Ga0373943_0039037 3300035170 Bacteria 2285
379 Ga0373955_0000271 3300035172 Bacteria 21553
380 Ga0373955_0022527 3300035172 Bacteria 3196
381 Ga0373955_0065761 3300035172 Bacteria 2014
382 Ga0373931_0001699 3300035691 Bacteria 9542
383 Ga0373935_0192187 3300035692 Bacteria 1407
384 Ga0373927_0006090 3300035695 Bacteria 8260
385 Ga0373927_0056397 3300035695 Bacteria 2540
386 Ga0373927_0194411 3300035695 Bacteria 1331
387 Ga0373933_0002469 3300035724 Bacteria 10403
388 Ga0373947_0081262 3300035725 Bacteria 2006
389 Ga0373937_0027502 3300036401 Bacteria 5143
390 Ga0373937_0078045 3300036401 Bacteria 3060
391 Ga0373925_0044168 3300037068 Bacteria 3309
392 Ga0373925_0243554 3300037068 Bacteria 1441
393 Ga0395899_0129770 3300037312 Bacteria 1800
394 Ga0395900_0007773 3300037418 Bacteria 11059
395 Ga0395900_0435461 3300037418 Bacteria 1270
396 Ga0395898_0018745 3300037466 Bacteria 7052
397 Ga0395898_0068852 3300037466 Bacteria 3425
398 Ga0395905_0030242 3300037471 Bacteria 5105
399 Ga0395905_0127471 3300037471 Bacteria 2393
400 Ga0395905_0198186 3300037471 Bacteria 1883
401 Ga0436364_0042848 3300037853 Bacteria 4706
402 Ga0436364_0901257 3300037853 Bacteria 1598
403 Ga0436365_0907811 3300039437 Bacteria 1142
404 Ga0436365_1082335 3300039437 Bacteria 1433
405 Ga0436365_1668816 3300039437 Bacteria 1738
406 Ga0436360_0888541 3300039438 Bacteria 6397
407 Ga0436361_0873079 3300039447 Bacteria 3237
408 Ga0436361_1057161 3300039447 Bacteria 1694
409 Ga0436363_1613029 3300039450 Bacteria 5674
410 Ga0451807_0494685 3300041486 Bacteria 1645
411 Ga0451855_1184848 3300041511 Bacteria 858
412 Ga0439455_0046295 3300042012 Bacteria 1127
413 Ga0439459_0012683 3300042438 Bacteria 1505
414 Ga0466969_0027564 3300044656 Bacteria 2909
415 Ga0466969_0042371 3300044656 Bacteria 2273
416 Ga0466972_0000160 3300044658 Bacteria 54154
417 Ga0466972_0006766 3300044658 Bacteria 5754
418 Ga0453683_0097213 3300044673 Bacteria 1848
419 Ga0466965_0024363 3300044683 Bacteria 2927
420 Ga0466966_0001852 3300044684 Bacteria 13714
421 Ga0466966_0162157 3300044684 Bacteria 1361
422 Ga0466961_0002102 3300044693 Bacteria 12393
423 Ga0466971_0193891 3300044719 Bacteria 958
424 Ga0466968_0014536 3300044735 Bacteria 3111
425 Ga0466970_0138645 3300044765 Bacteria 1339
426 Ga0466960_0005483 3300044901 Bacteria 5030
427 Ga0466960_0040682 3300044901 Bacteria 2199
428 Ga0466959_0001487 3300045049 Bacteria 14377
429 Ga0466959_0141407 3300045049 Bacteria 1700
430 Ga0466959_0178953 3300045049 Bacteria 1484
431 Ga0466958_0109103 3300045836 Bacteria 1727
432 Ga0466967_0031696 3300045976 Bacteria 4454
433 Ga0466967_0148652 3300045976 Bacteria 2187
434 Ga0466967_0374035 3300045976 Bacteria 1382
435 Ga0466967_1062510 3300045976 Bacteria 806
436 Ga0495603_0012659 3300046455 Bacteria 5102
437 Ga0495603_0017993 3300046455 Bacteria 4276
438 Ga0495603_0036946 3300046455 Bacteria 2931
439 Ga0495603_0047425 3300046455 Bacteria 2558
440 Ga0495603_0113339 3300046455 Bacteria 1581
441 Ga0495629_0007149 3300046459 Bacteria 8224
442 Ga0495638_0098461 3300046460 Bacteria 1752
443 Ga0495641_0031962 3300046461 Bacteria 2510
444 Ga0495651_0018066 3300046462 Bacteria 5459
445 Ga0495651_0076075 3300046462 Bacteria 2543
446 Ga0495651_0092723 3300046462 Bacteria 2262
447 Ga0495651_0233734 3300046462 Bacteria 1264
448 Ga0495651_0317328 3300046462 Bacteria 1040
449 Ga0495653_0052078 3300046463 Bacteria 3139
450 Ga0495650_0010928 3300046471 Bacteria 5023
451 Ga0495582_0148657 3300046473 Bacteria 1330
452 Ga0495605_0063307 3300046474 Bacteria 1765
453 Ga0495639_0021278 3300046475 Bacteria 2838
454 Ga0495639_0023073 3300046475 Bacteria 2733
455 Ga0495662_0121429 3300046476 Bacteria 1283
456 Ga0495664_0058033 3300046477 Bacteria 2302
457 Ga0495664_0121029 3300046477 Bacteria 1583
458 Ga0495664_0134109 3300046477 Bacteria 1500
459 Ga0495584_0068792 3300046491 Bacteria 1779
460 Ga0495585_0027274 3300046492 Bacteria 3259
461 Ga0495594_0037759 3300046499 Bacteria 2636
462 Ga0495594_0055424 3300046499 Bacteria 2186
463 Ga0495583_0067541 3300046506 Bacteria 1579
464 Ga0495606_0016917 3300046507 Bacteria 5536
465 Ga0495608_0082775 3300046511 Bacteria 2084
466 Ga0495608_0147796 3300046511 Bacteria 1498
467 Ga0495608_0149512 3300046511 Bacteria 1489
468 Ga0495616_0075041 3300046513 Bacteria 1628
469 Ga0495618_0033328 3300046514 Bacteria 3229
470 Ga0495620_0103082 3300046515 Bacteria 1136
471 Ga0495628_0048889 3300046516 Bacteria 3350
472 Ga0495628_0109630 3300046516 Bacteria 2124
473 Ga0495628_0339394 3300046516 Bacteria 1106
474 Ga0495643_0021848 3300046522 Bacteria 3662
475 Ga0495652_0027032 3300046529 Bacteria 5060
476 Ga0495640_0045531 3300046533 Bacteria 3044
477 Ga0495640_0119038 3300046533 Bacteria 1718
478 Ga0495640_0266793 3300046533 Bacteria 1068
479 Ga0495587_0001231 3300046536 Bacteria 16965
480 Ga0495587_0018937 3300046536 Bacteria 4266
481 Ga0495609_0020238 3300046538 Bacteria 3075
482 Ga0495609_0121263 3300046538 Bacteria 1124
483 Ga0495645_0004742 3300046543 Bacteria 9292
484 Ga0495645_0255925 3300046543 Bacteria 1161
485 Ga0495622_0080786 3300046557 Bacteria 1496
486 Ga0495667_0024251 3300046559 Bacteria 4085
487 Ga0495667_0035177 3300046559 Bacteria 3348
488 Ga0495656_0008574 3300046615 Bacteria 3653
489 Ga0495656_0188916 3300046615 Bacteria 1016
490 Ga0495656_0194068 3300046615 Bacteria 1004
491 Ga0495668_0020807 3300046616 Bacteria 3768
492 Ga0495668_0046110 3300046616 Bacteria 2422
493 Ga0495634_0027297 3300046642 Bacteria 3973
494 Ga0495611_0129235 3300046648 Bacteria 1179
495 Ga0495625_0056679 3300046660 Bacteria 2788
496 Ga0495625_0133265 3300046660 Bacteria 1682
497 Ga0495625_0271875 3300046660 Bacteria 1093
498 Ga0495625_0290659 3300046660 Bacteria 1049
499 Ga0495635_0013502 3300046663 Bacteria 5715
500 Ga0495659_0071812 3300046664 Bacteria 1298
501 Ga0495659_0099621 3300046664 Bacteria 1124
502 Ga0495661_0132880 3300046665 Bacteria 1362
503 Ga0495588_0020300 3300046674 Bacteria 3263
504 Ga0495588_0266010 3300046674 Bacteria 903
505 Ga0495657_0003048 3300046675 Bacteria 13866
506 Ga0495657_0022491 3300046675 Bacteria 4515
507 Ga0495657_0027210 3300046675 Bacteria 4038
508 Ga0495657_0131361 3300046675 Bacteria 1568
509 Ga0495599_0012174 3300046678 Bacteria 5297
510 Ga0495623_0010720 3300046679 Bacteria 5936
511 Ga0495646_0122816 3300046680 Bacteria 1468
512 Ga0495647_0010644 3300046681 Bacteria 3135
513 Ga0495658_0083701 3300046683 Bacteria 1877
514 Ga0495669_0021361 3300046684 Bacteria 2808
515 Ga0495669_0098415 3300046684 Bacteria 1357
516 Ga0495613_0029694 3300046689 Bacteria 4064
517 Ga0495613_0305038 3300046689 Bacteria 1101
518 Ga0495624_0106680 3300046690 Bacteria 1723
519 Ga0495624_0152891 3300046690 Bacteria 1411
520 Ga0495624_0299992 3300046690 Bacteria 969
521 Ga0495624_0314970 3300046690 Bacteria 943
522 Ga0495670_0130922 3300046691 Bacteria 1307
523 Ga0495600_0009290 3300046809 Bacteria 6069
524 Ga0495600_0055481 3300046809 Bacteria 2587
525 Ga0495600_0155673 3300046809 Bacteria 1478
526 Ga0495581_0127221 3300047315 Bacteria 1484
527 Ga0495581_0175523 3300047315 Bacteria 1253
528 Ga0495581_0239057 3300047315 Bacteria 1062
529 Ga0495581_0325939 3300047315 Bacteria 897
530 Ga0495604_0004143 3300047317 Bacteria 11513
531 Ga0495604_0024939 3300047317 Bacteria 4768
532 Ga0495604_0043000 3300047317 Bacteria 3538
533 Ga0495636_0120296 3300047318 Bacteria 1161
534 Ga0495674_0021971 3300047319 Bacteria 5890
535 Ga0495674_0057891 3300047319 Bacteria 3390
536 Ga0495672_0012877 3300047320 Bacteria 5802
537 Ga0495672_0030772 3300047320 Bacteria 3359
538 Ga0495676_0060616 3300047321 Bacteria 2964
539 Ga0495680_0002256 3300047322 Bacteria 19869
540 Ga0495680_0017868 3300047322 Bacteria 6036
541 Ga0495680_0204221 3300047322 Bacteria 1416
542 Ga0495687_013063 3300047443 Bacteria 4351
543 Ga0495675_0025039 3300047444 Bacteria 3805
544 Ga0495675_0044584 3300047444 Bacteria 2825
545 Ga0495677_0015810 3300047445 Bacteria 2740
546 Ga0495673_0107710 3300047469 Bacteria 1118
547 Ga0495684_0009505 3300047471 Bacteria 7502
548 Ga0495684_0049434 3300047471 Bacteria 3213
549 Ga0495684_0243879 3300047471 Bacteria 1309
550 Ga0495593_0048051 3300047673 Bacteria 2268
551 Ga0495602_0031896 3300048088 Bacteria 4972
552 Ga0495602_0188536 3300048088 Bacteria 1583
553 Ga0496100_0029235 3300048903 Bacteria 3407
554 Ga0496100_0338701 3300048903 Bacteria 1134
555 Ga0496101_0004401 3300048904 Bacteria 8854
556 Ga0496101_0033676 3300048904 Bacteria 3615
557 Ga0496101_0297703 3300048904 Bacteria 1263
558 Ga0496102_0062019 3300048905 Bacteria 3423
559 Ga0496102_0089687 3300048905 Bacteria 2844
560 Ga0496102_0133305 3300048905 Bacteria 2327
561 Ga0496102_0299376 3300048905 Bacteria 1516
562 Ga0496103_0034728 3300048906 Bacteria 3085
563 Ga0496103_0036941 3300048906 Bacteria 2992
564 Ga0496103_0280444 3300048906 Bacteria 1072
565 Ga0496104_0009984 3300048907 Bacteria 8477
566 Ga0496104_0506525 3300048907 Bacteria 1118
567 Ga0496105_0316590 3300048908 Bacteria 1251
568 Ga0496106_0007812 3300048909 Bacteria 7913
569 Ga0496106_0011928 3300048909 Bacteria 6417
570 Ga0496107_0007527 3300048910 Bacteria 7514
571 Ga0496107_0080548 3300048910 Bacteria 2374
572 Ga0496107_0085467 3300048910 Bacteria 2302
573 Ga0496108_0343029 3300048911 Bacteria 1303
574 Ga0496109_0401259 3300048912 Bacteria 1295
575 Ga0496109_0406335 3300048912 Bacteria 1286
576 Ga0496109_0410105 3300048912 Bacteria 1280
577 Ga0496109_0517685 3300048912 Bacteria 1126
578 Ga0496109_0681525 3300048912 Bacteria 965
579 Ga0496110_0036901 3300048913 Bacteria 4246
580 Ga0496110_0215759 3300048913 Bacteria 1745
581 Ga0496110_0376839 3300048913 Bacteria 1293
582 Ga0496110_0541674 3300048913 Bacteria 1058
583 Ga0496111_0021489 3300048914 Bacteria 4508
584 Ga0496111_0055700 3300048914 Bacteria 2860
585 Ga0496111_0200666 3300048914 Bacteria 1483
586 Ga0496112_0000004 3300048915 Bacteria 553294
587 Ga0496112_0013523 3300048915 Bacteria 7539
588 Ga0496112_0024619 3300048915 Bacteria 5768
589 Ga0496112_0347293 3300048915 Bacteria 1426
590 Ga0496113_0304497 3300048916 Bacteria 1276
591 Ga0496113_0363930 3300048916 Bacteria 1160
592 Ga0496114_0035406 3300048917 Bacteria 4122
593 Ga0496114_0061257 3300048917 Bacteria 3147
594 Ga0496114_0113306 3300048917 Bacteria 2325
595 Ga0496114_0120338 3300048917 Bacteria 2257
596 Ga0496114_0666713 3300048917 Bacteria 914
597 Ga0496115_0002608 3300048918 Bacteria 12941
598 Ga0496115_0039675 3300048918 Bacteria 3741
599 Ga0496115_0074334 3300048918 Bacteria 2759
600 Ga0496115_0160075 3300048918 Bacteria 1860
601 Ga0496115_0178656 3300048918 Bacteria 1755
602 Ga0496116_0026275 3300048919 Bacteria 4262
603 Ga0496117_0052595 3300048920 Bacteria 2868
604 Ga0496117_0108130 3300048920 Bacteria 1740
605 Ga0496117_0156145 3300048920 Bacteria 1343
606 Ga0496118_0013128 3300048921 Bacteria 7865
607 Ga0496118_0026494 3300048921 Bacteria 4936
608 Ga0496118_0051192 3300048921 Bacteria 3161
609 Ga0496118_0054716 3300048921 Bacteria 3020
610 Ga0496119_0011739 3300048922 Bacteria 7206
611 Ga0496119_0070726 3300048922 Bacteria 2045
612 Ga0496119_0173169 3300048922 Bacteria 1138
613 Ga0496119_0174488 3300048922 Bacteria 1132
614 Ga0496121_0000458 3300048924 Bacteria 80207
615 Ga0496121_0002768 3300048924 Bacteria 26008
616 Ga0496121_0013901 3300048924 Bacteria 8605
617 Ga0496121_0021415 3300048924 Bacteria 6331
618 Ga0496121_0033694 3300048924 Bacteria 4629
619 Ga0496121_0080309 3300048924 Bacteria 2586
620 Ga0496121_0134036 3300048924 Bacteria 1848
621 Ga0496122_0027043 3300048925 Bacteria 4920
622 Ga0496122_0119786 3300048925 Bacteria 1701
623 Ga0496123_0010439 3300048926 Bacteria 8208
624 Ga0496124_0031915 3300048927 Bacteria 4658
625 Ga0496124_0253444 3300048927 Bacteria 1300
626 Ga0496125_0002258 3300048928 Bacteria 25570
627 Ga0496125_0070716 3300048928 Bacteria 2730
628 Ga0496125_0108087 3300048928 Bacteria 2024
629 Ga0496126_0010740 3300048929 Bacteria 9562
630 Ga0496126_0021457 3300048929 Bacteria 6306
631 Ga0496126_0036391 3300048929 Bacteria 4603
632 Ga0496126_0068282 3300048929 Bacteria 3174
633 Ga0496126_0071842 3300048929 Bacteria 3079
634 Ga0496126_0107962 3300048929 Bacteria 2427
635 Ga0496126_0114780 3300048929 Bacteria 2343
636 Ga0496126_0218460 3300048929 Bacteria 1602
637 Ga0496126_0354169 3300048929 Bacteria 1200
638 Ga0496126_0426407 3300048929 Bacteria 1071
639 Ga0495682_0101098 3300049460 Bacteria 1034
640 Ga0495682_0110560 3300049460 Bacteria 985
641 Ga0501036_0244136 3300049572 Bacteria 1506
642 Ga0501047_0356052 3300049581 Bacteria 1300
643 Ga0501069_0236557 3300049585 Bacteria 1064
644 nmdc:mga03683_5086_c1 3300050489 Bacteria 4414
645 nmdc:mga03n38_41670_c1 3300050490 Bacteria 2003
646 nmdc:mga03n38_48697_c1 3300050490 Bacteria 1881
647 nmdc:mga00v17_77626_c1 3300050491 Bacteria 2068
648 nmdc:mga0yw44_102069_c1 3300050492 Bacteria 1828
649 nmdc:mga0yw44_194563_c1 3300050492 Bacteria 1338
650 nmdc:mga0yw44_21547_c1 3300050492 Bacteria 3597
651 nmdc:mga0yw44_86663_c1 3300050492 Bacteria 1973
652 nmdc:mga0k408_215347_c1 3300050493 Bacteria 1147
653 nmdc:mga0k408_31972_c1 3300050493 Bacteria 3007
654 nmdc:mga06z11_1189_c1 3300050494 Bacteria 9578
655 nmdc:mga06z11_119062_c1 3300050494 Bacteria 1471
656 nmdc:mga06z11_203008_c1 3300050494 Bacteria 1152
657 nmdc:mga06z11_22297_c1 3300050494 Bacteria 2956
658 nmdc:mga04h51_52287_c1 3300050495 Bacteria 1375
659 nmdc:mga04h51_96242_c1 3300050495 Bacteria 1073
660 nmdc:mga07m45_41293_c1 3300050496 Bacteria 2583
661 nmdc:mga07m45_49982_c1 3300050496 Bacteria 2355
662 nmdc:mga05p37_302933_c1 3300050507 Bacteria 1898
663 nmdc:mga06r32_561520_c1 3300050510 Bacteria 1114
664 nmdc:mga0n895_113919_c1 3300050512 Bacteria 2722
665 nmdc:mga0rr50_65295_c1 3300050513 Bacteria 2756
666 nmdc:mga08x19_81102_c1 3300050514 Bacteria 2130
667 nmdc:mga0sz30_150449_c1 3300050516 Bacteria 1030
668 nmdc:mga0sz30_5200_c1 3300050516 Bacteria 4763
669 nmdc:mga0sz30_69284_c1 3300050516 Bacteria 1517
670 nmdc:mga0sz30_8049_c1 3300050516 Bacteria 3971
671 Ga0495601_0009741 3300053077 Bacteria 5682
672 Ga0495595_0042824 3300053084 Bacteria 2075
673 Ga0495619_0001765 3300053085 Bacteria 14387
674 Ga0495619_0005620 3300053085 Bacteria 7956
675 Ga0500578_0066616 3300053086 Bacteria 2296
676 Ga0500578_0140988 3300053086 Bacteria 1507
677 Ga0500643_000035 3300053087 Bacteria 184794
678 Ga0500583_0144102 3300053092 Bacteria 1184
679 Ga0500651_0008223 3300053093 Bacteria 6125
680 Ga0500651_0035620 3300053093 Bacteria 3136
681 Ga0500566_0000995 3300053094 Bacteria 16308
682 Ga0500566_0036349 3300053094 Bacteria 2858
683 Ga0500641_0009486 3300053096 Bacteria 3502
684 Ga0500554_020508 3300053102 Bacteria 1818
685 Ga0500555_002156 3300053103 Bacteria 5765
686 Ga0500556_0003621 3300053104 Bacteria 4497
687 Ga0500557_000004 3300053105 Bacteria 202318
688 Ga0500562_015689 3300053108 Bacteria 1944
689 Ga0500562_062370 3300053108 Bacteria 1002
690 Ga0500569_001889 3300053109 Bacteria 4041
691 Ga0500572_006675 3300053111 Bacteria 2649
692 Ga0500595_006151 3300053119 Bacteria 5137
693 Ga0500595_008294 3300053119 Bacteria 4250
694 Ga0500595_016372 3300053119 Bacteria 2762
695 Ga0500595_033412 3300053119 Bacteria 1707
696 Ga0500597_136812 3300053120 Bacteria 1057
697 Ga0500608_158108 3300053122 Bacteria 985
698 Ga0500642_0000124 3300053130 Bacteria 35205
699 Ga0500642_0074298 3300053130 Bacteria 1551
700 Ga0500652_039046 3300053131 Bacteria 1902
701 Ga0500658_0045287 3300053134 Bacteria 1778
702 Ga0500559_0001481 3300053136 Bacteria 13253
703 Ga0500564_192471 3300053138 Bacteria 843
704 Ga0500568_0018807 3300053139 Bacteria 3013
705 Ga0500568_0068786 3300053139 Bacteria 1359
706 Ga0500603_001693 3300053150 Bacteria 4973
707 Ga0500603_011120 3300053150 Bacteria 2041
708 Ga0500604_0122798 3300053151 Bacteria 869
709 Ga0500620_002492 3300053155 Bacteria 3725
710 Ga0500622_0088644 3300053156 Bacteria 1538
711 Ga0500624_015529 3300053157 Bacteria 1166
712 Ga0500627_0012584 3300053158 Bacteria 3177
713 Ga0500633_0100433 3300053160 Bacteria 1065
714 Ga0500638_144188 3300053162 Bacteria 1066
715 Ga0500636_0001590 3300053177 Bacteria 12361
716 Ga0500636_0041180 3300053177 Bacteria 2732
717 Ga0500637_0000377 3300053178 Bacteria 16875
718 Ga0500637_0000979 3300053178 Bacteria 11648
719 Ga0500625_002428 3300053729 Bacteria 6985
720 Ga0500645_007384 3300053730 Bacteria 3836
721 Ga0500609_006065 3300053731 Bacteria 1647
722 Ga0500601_000602 3300053737 Bacteria 5122
723 Ga0501084_0602073 3300054114 Bacteria 929
724 Ga0500661_000291 3300055283 Bacteria 9158
725 Ga0500661_003528 3300055283 Bacteria 2935

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005983 Ga0081540_1080110 Ga0081540_10801102 238
2 3300003203 JGI25406J46586_10010965 JGI25406J46586_100109652 239
3 3300003659 JGI25404J52841_10007507 JGI25404J52841_100075072 239
4 3300005937 Ga0081455_10178435 Ga0081455_101784352 239
5 3300005983 Ga0081540_1002537 Ga0081540_100253714 239
6 3300005983 Ga0081540_1007763 Ga0081540_10077636 239
7 3300005985 Ga0081539_10001065 Ga0081539_1000106518 239
8 3300037853 Ga0436364_0901257 Ga0436364_0901257_529_1293 239
9 3300046455 Ga0495603_0017993 Ga0495603_0017993_621_1385 239
10 3300047315 Ga0495581_0239057 Ga0495581_0239057_271_1041 239
11 3300048913 Ga0496110_0541674 Ga0496110_0541674_319_1038 239
12 3300048912 Ga0496109_0681525 Ga0496109_0681525_12_734 240
13 3300028379 Ga0268266_10463615 Ga0268266_104636151 241
14 3300047320 Ga0495672_0030772 Ga0495672_0030772_2382_3152 241
15 3300048924 Ga0496121_0000458 Ga0496121_0000458_50451_51221 241
16 3300053102 Ga0500554_020508 Ga0500554_020508_392_1162 241
17 3300053150 Ga0500603_001693 Ga0500603_001693_2723_3493 241
18 3300053178 Ga0500637_0000979 Ga0500637_0000979_1823_2593 241
19 3300046660 Ga0495625_0271875 Ga0495625_0271875_245_1015 242
20 3300053731 Ga0500609_006065 Ga0500609_006065_598_1326 242
21 iso_pu_bacteria 2922368715 2922374697 243
22 3300005548 Ga0070665_100151628 Ga0070665_1001516282 244
23 3300037471 Ga0395905_0198186 Ga0395905_0198186_508_1278 244
24 3300048924 Ga0496121_0013901 Ga0496121_0013901_1369_2139 246
25 3300053108 Ga0500562_015689 Ga0500562_015689_1187_1930 247
26 3300006028 Ga0070717_10196040 Ga0070717_101960402 249
27 3300046616 Ga0495668_0046110 Ga0495668_0046110_1161_1931 250
28 iso_pu_bacteria 2879083081 2879089496 250
29 3300053119 Ga0500595_016372 Ga0500595_016372_1740_2510 251
30 iso_pu_bacteria 2507262055 2507508332 252
31 iso_pu_bacteria 2508501009 2508542407 252
32 iso_pu_bacteria 2508501042 2508691842 252
33 iso_pu_bacteria 2508501128 2509150457 252
34 iso_pu_bacteria 2511231028 2511397623 252
35 iso_pu_bacteria 2513237092 2513629140 252
36 iso_pu_bacteria 2513237094 2513640643 252
37 iso_pu_bacteria 2513237095 2513645576 252
38 iso_pu_bacteria 2513237096 2513657884 252
39 iso_pu_bacteria 2513237098 2513674429 252
40 iso_pu_bacteria 2513237101 2513692840 252
41 iso_pu_bacteria 2513237102 2513701578 252
42 iso_pu_bacteria 2513237137 2513855583 252
43 iso_pu_bacteria 2513237139 2513873011 252
44 iso_pu_bacteria 2513237141 2513890221 252
45 iso_pu_bacteria 2513237145 2513920023 252
46 iso_pu_bacteria 2513237161 2514015695 252
47 iso_pu_bacteria 2515154112 2515627165 252
48 iso_pu_bacteria 2517093001 2517102798 252
49 iso_pu_bacteria 2517572143 2517892128 252
50 iso_pu_bacteria 2524023205 2524437596 252
51 iso_pu_bacteria 2524023210 2524465765 252
52 iso_pu_bacteria 2524023228 2524534224 252
53 iso_pu_bacteria 2617270735 2617347128 252
54 iso_pu_bacteria 2617270741 2617375504 252
55 iso_pu_bacteria 2667528175 2671120617 252
56 iso_pu_bacteria 2721755755 2723844795 252
57 iso_pu_bacteria 2728368998 2728753514 252
58 iso_pu_bacteria 2744054633 2745079530 252
59 iso_pu_bacteria 2791355196 2793062726 252
60 iso_pu_bacteria 2791355197 2793068789 252
61 iso_pu_bacteria 2791355199 2793082426 252
62 iso_pu_bacteria 2802429603 2805915089 252
63 iso_pu_bacteria 2816332527 2818238622 252
64 iso_pu_bacteria 2824600985 2824604137 252
65 iso_pu_bacteria 2824609381 2824610406 252
66 iso_pu_bacteria 2824617872 2824617980 252
67 iso_pu_bacteria 2824626560 2824626648 252
68 iso_pu_bacteria 2824635225 2824642954 252
69 iso_pu_bacteria 2824644064 2824647932 252
70 iso_pu_bacteria 2824653114 2824659399 252
71 iso_pu_bacteria 2824661429 2824668852 252
72 iso_pu_bacteria 2824679649 2824682619 252
73 iso_pu_bacteria 2824687955 2824688919 252
74 iso_pu_bacteria 2824696289 2824702655 252
75 iso_pu_bacteria 2824704595 2824712542 252
76 iso_pu_bacteria 2824714736 2824720869 252
77 iso_pu_bacteria 2824723954 2824731096 252
78 iso_pu_bacteria 2824732956 2824733330 252
79 iso_pu_bacteria 2824746037 2824746543 252
80 iso_pu_bacteria 2824753945 2824754222 252
81 iso_pu_bacteria 2824763712 2824768959 252
82 iso_pu_bacteria 2824773399 2824775388 252
83 iso_pu_bacteria 2838122688 2838123487 252
84 iso_pu_bacteria 2841941048 2841947740 252
85 iso_pu_bacteria 2841949485 2841949589 252
86 iso_pu_bacteria 2841957949 2841964170 252
87 iso_pu_bacteria 2841966195 2841971906 252
88 iso_pu_bacteria 2841974524 2841974751 252
89 iso_pu_bacteria 2841983080 2841983689 252
90 iso_pu_bacteria 2842038055 2842040055 252
91 iso_pu_bacteria 2842045827 2842047000 252
92 iso_pu_bacteria 2844315083 2844319303 252
93 iso_pu_bacteria 2847930680 2847936468 252
94 iso_pu_bacteria 2847939898 2847946813 252
95 iso_pu_bacteria 2849076700 2849079074 252
96 iso_pu_bacteria 2857509624 2857516677 252
97 iso_pu_bacteria 2874590934 2874598301 252
98 iso_pu_bacteria 2874604998 2874605486 252
99 iso_pu_bacteria 2874612657 2874619497 252
100 iso_pu_bacteria 2874620515 2874627552 252
101 iso_pu_bacteria 2874628541 2874632126 252
102 iso_pu_bacteria 2874645413 2874652643 252
103 iso_pu_bacteria 2876761206 2876764788 252
104 iso_pu_bacteria 2876771140 2876778221 252
105 iso_pu_bacteria 2876818435 2876825910 252
106 iso_pu_bacteria 2879074833 2879082015 252
107 iso_pu_bacteria 2879099564 2879104858 252
108 iso_pu_bacteria 2879110137 2879115803 252
109 iso_pu_bacteria 2879127579 2879135137 252
110 iso_pu_bacteria 2879142872 2879149822 252
111 iso_pu_bacteria 2881364244 2881368596 252
112 iso_pu_bacteria 2881665667 2881672642 252
113 iso_pu_bacteria 2885366525 2885369146 252
114 iso_pu_bacteria 2885374607 2885381683 252
115 iso_pu_bacteria 2885383462 2885390542 252
116 iso_pu_bacteria 2885409591 2885417217 252
117 iso_pu_bacteria 2888378607 2888384345 252
118 iso_pu_bacteria 2888388044 2888393566 252
119 iso_pu_bacteria 2888419890 2888424781 252
120 iso_pu_bacteria 2889033259 2889039501 252
121 iso_pu_bacteria 2893066018 2893068585 252
122 iso_pu_bacteria 2903727486 2903731143 252
123 iso_pu_bacteria 2903748898 2903753370 252
124 iso_pu_bacteria 2903768456 2903774444 252
125 iso_pu_bacteria 2904666416 2904673128 252
126 iso_pu_bacteria 2904690495 2904694792 252
127 iso_pu_bacteria 2904699407 2904702266 252
128 iso_pu_bacteria 2904711408 2904714945 252
129 iso_pu_bacteria 2906602504 2906607348 252
130 iso_pu_bacteria 2906610324 2906617254 252
131 iso_pu_bacteria 2906626472 2906633586 252
132 iso_pu_bacteria 2906635258 2906643353 252
133 iso_pu_bacteria 2906643746 2906650822 252
134 iso_pu_bacteria 2906660503 2906662517 252
135 iso_pu_bacteria 2908739725 2908742408 252
136 iso_pu_bacteria 2908756301 2908761205 252
137 iso_pu_bacteria 2908775508 2908780432 252
138 iso_pu_bacteria 2922386360 2922391236 252
139 iso_pu_bacteria 2922393267 2922400542 252
140 iso_pu_bacteria 2922425934 2922430573 252
141 iso_pu_bacteria 2929615660 2929621784 252
142 iso_pu_bacteria 2929624759 2929629909 252
143 iso_pu_bacteria 2932784394 2932788638 252
144 iso_pu_bacteria 2932794094 2932798104 252
145 iso_pu_bacteria 2932801729 2932807040 252
146 iso_pu_bacteria 2932809354 2932817221 252
147 iso_pu_bacteria 2932818245 2932825171 252
148 iso_pu_bacteria 2932828146 2932830286 252
149 iso_pu_bacteria 2933577622 2933583940 252
150 iso_pu_bacteria 2935608549 2935609178 252
151 iso_pu_bacteria 2935616580 2935622487 252
152 iso_pu_bacteria 2935630451 2935631265 252
153 iso_pu_bacteria 2935638405 2935642093 252
154 iso_pu_bacteria 2935648319 2935651019 252
155 iso_pu_bacteria 2935656913 2935659200 252
156 iso_pu_bacteria 2935665750 2935672523 252
157 iso_pu_bacteria 2935675223 2935676012 252
158 iso_pu_bacteria 2935684952 2935686004 252
159 iso_pu_bacteria 2935694250 2935697752 252
160 iso_pu_bacteria 2935703347 2935705844 252
161 iso_pu_bacteria 2935713505 2935714556 252
162 iso_pu_bacteria 2935722832 2935725175 252
163 iso_pu_bacteria 2935732158 2935732465 252
164 iso_pu_bacteria 2935741537 2935741844 252
165 iso_pu_bacteria 2935750917 2935751969 252
166 iso_pu_bacteria 2935760218 2935765226 252
167 iso_pu_bacteria 2935777560 2935778756 252
168 iso_pu_bacteria 2935801545 2935802841 252
169 iso_pu_bacteria 2935810662 2935813327 252
170 iso_pu_bacteria 2935819856 2935822338 252
171 iso_pu_bacteria 2935827899 2935830260 252
172 iso_pu_bacteria 2935837841 2935838157 252
173 iso_pu_bacteria 2935847175 2935847920 252
174 iso_pu_bacteria 2935855204 2935860736 252
175 iso_pu_bacteria 2935864058 2935872291 252
176 iso_pu_bacteria 2935873716 2935878654 252
177 iso_pu_bacteria 2935883170 2935886833 252
178 iso_pu_bacteria 2935908558 2935908861 252
179 iso_pu_bacteria 2935916978 2935919580 252
180 iso_pu_bacteria 2935926038 2935926565 252
181 iso_pu_bacteria 2935934488 2935935015 252
182 iso_pu_bacteria 2935942939 2935943465 252
183 iso_pu_bacteria 2935951376 2935951903 252
184 iso_pu_bacteria 2935959822 2935960662 252
185 iso_pu_bacteria 2935967501 2935968028 252
186 iso_pu_bacteria 2935975950 2935978659 252
187 iso_pu_bacteria 2935984226 2935987474 252
188 iso_pu_bacteria 2935992306 2935996309 252
189 iso_pu_bacteria 2936002035 2936003592 252
190 iso_pu_bacteria 2936011229 2936013615 252
191 iso_pu_bacteria 2936019824 2936022258 252
192 iso_pu_bacteria 2936028420 2936030704 252
193 iso_pu_bacteria 2936037263 2936042276 252
194 iso_pu_bacteria 2936046547 2936048517 252
195 iso_pu_bacteria 2936055302 2936058731 252
196 iso_pu_bacteria 2940556831 2940557228 252
197 iso_pu_bacteria 2941507105 2941510006 252
198 iso_pu_bacteria 2941515067 2941518907 252
199 iso_pu_bacteria 2941523033 2941525405 252
200 iso_pu_bacteria 2941538514 2941539176 252
201 iso_pu_bacteria 3005474847 3005480484 252
202 iso_pu_bacteria 3005483717 3005484571 252
203 iso_pu_bacteria 3005506211 3005510568 252
204 iso_pu_bacteria 3005587118 3005587786 252
205 iso_pu_bacteria 3005710791 3005715151 252
206 iso_pu_bacteria 3005718088 3005722547 252
207 iso_pu_bacteria 8006933436 8006940309 252
208 iso_pu_bacteria 8006964411 8006967047 252
209 iso_pu_bacteria 8006973647 8006980087 252
210 iso_pu_bacteria 8006984368 8006988001 252
211 iso_pu_bacteria 8016511872 8016522021 252
212 iso_pu_bacteria 8016583857 8016593138 252
213 iso_pu_bacteria 8016603502 8016610257 252
214 iso_pu_bacteria 8016630954 8016640057 252
215 iso_pu_bacteria 8017057580 8017063647 252
216 iso_pu_bacteria 8019538911 8019545114 252
217 iso_pu_bacteria 8019555841 8019556278 252
218 iso_pu_bacteria 8019565922 8019569035 252
219 iso_pu_bacteria 8019619141 8019628461 252
220 iso_pu_bacteria 8019629233 8019634179 252
221 iso_pu_bacteria 8019638758 8019645554 252
222 iso_pu_bacteria 8019648815 8019658797 252
223 iso_pu_bacteria 8019659431 8019662054 252
224 iso_pu_bacteria 8019668869 8019671578 252
225 iso_pu_bacteria 8019687851 8019690329 252
226 iso_pu_bacteria 8055742211 8055746050 252
227 iso_pu_bacteria 8056681323 8056687353 252
228 iso_pu_bacteria 8056689827 8056694188 252
229 iso_pu_bacteria 8056967851 8056968278 252
230 iso_pu_bacteria 2513237104 2513718495 253
231 iso_pu_bacteria 2876808645 2876814351 253
232 3300006175 Ga0070712_100034601 Ga0070712_1000346013 254
233 3300006942 Ga0099824_1013697 Ga0099824_10136974 254
234 3300025915 Ga0207693_10023655 Ga0207693_100236553 254
235 3300027296 Ga0209389_1000040 Ga0209389_100004098 254
236 3300027296 Ga0209389_1000123 Ga0209389_100012317 254
237 3300027357 Ga0209589_1000036 Ga0209589_100003617 254
238 3300027361 Ga0209489_100006 Ga0209489_100006345 254
239 3300027361 Ga0209489_111146 Ga0209489_1111462 254
240 3300035111 Ga0373923_0007119 Ga0373923_0007119_2193_2957 254
241 3300035117 Ga0373953_0085020 Ga0373953_0085020_111_875 254
242 3300035118 Ga0373954_0000900 Ga0373954_0000900_8656_9420 254
243 3300035692 Ga0373935_0192187 Ga0373935_0192187_378_1142 254
244 3300039447 Ga0436361_0873079 Ga0436361_0873079_1642_2406 254
245 3300046462 Ga0495651_0233734 Ga0495651_0233734_60_824 254
246 3300046511 Ga0495608_0147796 Ga0495608_0147796_367_1131 254
247 3300046536 Ga0495587_0018937 Ga0495587_0018937_3289_4053 254
248 3300046559 Ga0495667_0024251 Ga0495667_0024251_570_1334 254
249 3300047471 Ga0495684_0243879 Ga0495684_0243879_445_1209 254
250 3300048912 Ga0496109_0410105 Ga0496109_0410105_408_1172 254
251 3300048922 Ga0496119_0173169 Ga0496119_0173169_174_938 254
252 3300048929 Ga0496126_0107962 Ga0496126_0107962_1418_2182 254
253 3300053103 Ga0500555_002156 Ga0500555_002156_2953_3717 254
254 3300053134 Ga0500658_0045287 Ga0500658_0045287_792_1556 254
255 3300053139 Ga0500568_0018807 Ga0500568_0018807_201_965 254
256 3300053158 Ga0500627_0012584 Ga0500627_0012584_1615_2379 254
257 iso_pu_bacteria 8055225921 8055226775 254
258 3300025931 Ga0207644_10395333 Ga0207644_103953331 255
259 3300034820 Ga0373959_0043778 Ga0373959_0043778_82_849 255
260 3300035695 Ga0373927_0056397 Ga0373927_0056397_285_1052 255
261 3300044673 Ga0453683_0097213 Ga0453683_0097213_295_1077 255
262 3300003215 JGI25153J46596_10001356 JGI25153J46596_100013564 256
263 3300003215 JGI25153J46596_10006306 JGI25153J46596_100063064 256
264 3300003354 JGI25160J50197_1001301 JGI25160J50197_10013018 256
265 3300003354 JGI25160J50197_1018309 JGI25160J50197_10183092 256
266 3300003659 JGI25404J52841_10026821 JGI25404J52841_100268212 256
267 3300003794 Ga0055531_10001373 Ga0055531_1000137315 256
268 3300004625 Ga0055543_1005177 Ga0055543_10051772 256
269 3300005262 Ga0065165_1000231 Ga0065165_100023133 256
270 3300005262 Ga0065165_1001615 Ga0065165_100161515 256
271 3300005262 Ga0065165_1012190 Ga0065165_10121901 256
272 3300005262 Ga0065165_1030497 Ga0065165_10304972 256
273 3300005329 Ga0070683_100073945 Ga0070683_1000739453 256
274 3300005329 Ga0070683_100129317 Ga0070683_1001293172 256
275 3300005330 Ga0070690_100268989 Ga0070690_1002689892 256
276 3300005338 Ga0068868_100006460 Ga0068868_1000064608 256
277 3300005339 Ga0070660_100078143 Ga0070660_1000781432 256
278 3300005353 Ga0070669_100082491 Ga0070669_1000824912 256
279 3300005354 Ga0070675_100121948 Ga0070675_1001219483 256
280 3300005355 Ga0070671_100207479 Ga0070671_1002074792 256
281 3300005355 Ga0070671_100326443 Ga0070671_1003264431 256
282 3300005355 Ga0070671_100435493 Ga0070671_1004354932 256
283 3300005356 Ga0070674_100042283 Ga0070674_1000422833 256
284 3300005356 Ga0070674_100068497 Ga0070674_1000684972 256
285 3300005364 Ga0070673_100470675 Ga0070673_1004706752 256
286 3300005366 Ga0070659_100033068 Ga0070659_1000330683 256
287 3300005366 Ga0070659_100135974 Ga0070659_1001359742 256
288 3300005366 Ga0070659_100259853 Ga0070659_1002598531 256
289 3300005367 Ga0070667_100207919 Ga0070667_1002079193 256
290 3300005367 Ga0070667_100418830 Ga0070667_1004188301 256
291 3300005434 Ga0070709_10000351 Ga0070709_1000035116 256
292 3300005434 Ga0070709_10059167 Ga0070709_100591672 256
293 3300005434 Ga0070709_10097368 Ga0070709_100973681 256
294 3300005434 Ga0070709_10181078 Ga0070709_101810781 256
295 3300005434 Ga0070709_10281330 Ga0070709_102813301 256
296 3300005435 Ga0070714_100028697 Ga0070714_1000286974 256
297 3300005435 Ga0070714_100060765 Ga0070714_1000607652 256
298 3300005435 Ga0070714_100114084 Ga0070714_1001140842 256
299 3300005435 Ga0070714_100191918 Ga0070714_1001919182 256
300 3300005435 Ga0070714_100419947 Ga0070714_1004199471 256
301 3300005436 Ga0070713_100010740 Ga0070713_1000107403 256
302 3300005436 Ga0070713_100045355 Ga0070713_1000453552 256
303 3300005436 Ga0070713_100134091 Ga0070713_1001340913 256
304 3300005436 Ga0070713_100169677 Ga0070713_1001696771 256
305 3300005437 Ga0070710_10000790 Ga0070710_1000079010 256
306 3300005437 Ga0070710_10006588 Ga0070710_100065882 256
307 3300005437 Ga0070710_10021776 Ga0070710_100217762 256
308 3300005437 Ga0070710_10023705 Ga0070710_100237054 256
309 3300005439 Ga0070711_100003109 Ga0070711_1000031097 256
310 3300005439 Ga0070711_100005522 Ga0070711_1000055224 256
311 3300005455 Ga0070663_100030695 Ga0070663_1000306954 256
312 3300005455 Ga0070663_100060153 Ga0070663_1000601532 256
313 3300005455 Ga0070663_100118917 Ga0070663_1001189172 256
314 3300005455 Ga0070663_100141497 Ga0070663_1001414971 256
315 3300005456 Ga0070678_100158271 Ga0070678_1001582712 256
316 3300005456 Ga0070678_100347736 Ga0070678_1003477361 256
317 3300005467 Ga0070706_100556312 Ga0070706_1005563121 256
318 3300005530 Ga0070679_100055233 Ga0070679_1000552331 256
319 3300005530 Ga0070679_100166882 Ga0070679_1001668823 256
320 3300005530 Ga0070679_100186312 Ga0070679_1001863121 256
321 3300005535 Ga0070684_100023204 Ga0070684_1000232044 256
322 3300005535 Ga0070684_100645903 Ga0070684_1006459031 256
323 3300005539 Ga0068853_100474643 Ga0068853_1004746431 256
324 3300005539 Ga0068853_100560449 Ga0068853_1005604491 256
325 3300005543 Ga0070672_100397050 Ga0070672_1003970502 256
326 3300005548 Ga0070665_100025947 Ga0070665_1000259475 256
327 3300005548 Ga0070665_100036979 Ga0070665_1000369792 256
328 3300005548 Ga0070665_100060854 Ga0070665_1000608542 256
329 3300005548 Ga0070665_100200021 Ga0070665_1002000213 256
330 3300005548 Ga0070665_100203493 Ga0070665_1002034932 256
331 3300005548 Ga0070665_100208313 Ga0070665_1002083132 256
332 3300005548 Ga0070665_100871143 Ga0070665_1008711431 256
333 3300005563 Ga0068855_100102451 Ga0068855_1001024512 256
334 3300005563 Ga0068855_100315982 Ga0068855_1003159822 256
335 3300005577 Ga0068857_100083327 Ga0068857_1000833273 256
336 3300005578 Ga0068854_100012639 Ga0068854_1000126392 256
337 3300005578 Ga0068854_100280741 Ga0068854_1002807412 256
338 3300005578 Ga0068854_100321672 Ga0068854_1003216721 256
339 3300005614 Ga0068856_100000020 Ga0068856_10000002055 256
340 3300005614 Ga0068856_100004981 Ga0068856_1000049813 256
341 3300005614 Ga0068856_100592409 Ga0068856_1005924091 256
342 3300005615 Ga0070702_100082602 Ga0070702_1000826022 256
343 3300005616 Ga0068852_100025025 Ga0068852_1000250255 256
344 3300005718 Ga0068866_10055899 Ga0068866_100558992 256
345 3300005719 Ga0068861_100037780 Ga0068861_1000377802 256
346 3300005719 Ga0068861_100059734 Ga0068861_1000597342 256
347 3300005834 Ga0068851_10192907 Ga0068851_101929071 256
348 3300005842 Ga0068858_100177740 Ga0068858_1001777402 256
349 3300005843 Ga0068860_100181433 Ga0068860_1001814332 256
350 3300005843 Ga0068860_100701869 Ga0068860_1007018691 256
351 3300005844 Ga0068862_100053644 Ga0068862_1000536442 256
352 3300005844 Ga0068862_100092250 Ga0068862_1000922501 256
353 3300005844 Ga0068862_100185838 Ga0068862_1001858382 256
354 3300005937 Ga0081455_10002087 Ga0081455_100020872 256
355 3300005983 Ga0081540_1000544 Ga0081540_100054429 256
356 3300005983 Ga0081540_1014601 Ga0081540_10146015 256
357 3300005983 Ga0081540_1018042 Ga0081540_10180426 256
358 3300005983 Ga0081540_1019612 Ga0081540_10196122 256
359 3300005983 Ga0081540_1052409 Ga0081540_10524092 256
360 3300005985 Ga0081539_10025008 Ga0081539_100250081 256
361 3300006028 Ga0070717_10033314 Ga0070717_100333143 256
362 3300006028 Ga0070717_10035208 Ga0070717_100352083 256
363 3300006038 Ga0075365_10015033 Ga0075365_100150333 256
364 3300006038 Ga0075365_10016997 Ga0075365_100169972 256
365 3300006038 Ga0075365_10027865 Ga0075365_100278653 256
366 3300006038 Ga0075365_10080641 Ga0075365_100806413 256
367 3300006038 Ga0075365_10081177 Ga0075365_100811772 256
368 3300006042 Ga0075368_10005507 Ga0075368_100055071 256
369 3300006042 Ga0075368_10012445 Ga0075368_100124452 256
370 3300006042 Ga0075368_10069060 Ga0075368_100690601 256
371 3300006048 Ga0075363_100003747 Ga0075363_1000037472 256
372 3300006048 Ga0075363_100042738 Ga0075363_1000427381 256
373 3300006048 Ga0075363_100094667 Ga0075363_1000946671 256
374 3300006163 Ga0070715_10047457 Ga0070715_100474572 256
375 3300006173 Ga0070716_100001893 Ga0070716_1000018934 256
376 3300006173 Ga0070716_100002939 Ga0070716_1000029398 256
377 3300006173 Ga0070716_100032549 Ga0070716_1000325492 256
378 3300006175 Ga0070712_100014227 Ga0070712_1000142271 256
379 3300006175 Ga0070712_100055261 Ga0070712_1000552613 256
380 3300006175 Ga0070712_100131428 Ga0070712_1001314281 256
381 3300006175 Ga0070712_100207338 Ga0070712_1002073382 256
382 3300006177 Ga0075362_10010396 Ga0075362_100103962 256
383 3300006178 Ga0075367_10029633 Ga0075367_100296334 256
384 3300006178 Ga0075367_10088416 Ga0075367_100884162 256
385 3300006178 Ga0075367_10139696 Ga0075367_101396961 256
386 3300006178 Ga0075367_10286152 Ga0075367_102861522 256
387 3300006186 Ga0075369_10024341 Ga0075369_100243412 256
388 3300006186 Ga0075369_10063006 Ga0075369_100630062 256
389 3300006195 Ga0075366_10235662 Ga0075366_102356621 256
390 3300006237 Ga0097621_100044709 Ga0097621_1000447094 256
391 3300006353 Ga0075370_10041783 Ga0075370_100417832 256
392 3300006353 Ga0075370_10050053 Ga0075370_100500532 256
393 3300006353 Ga0075370_10086243 Ga0075370_100862431 256
394 3300006844 Ga0075428_100020304 Ga0075428_1000203045 256
395 3300006844 Ga0075428_100393436 Ga0075428_1003934362 256
396 3300006871 Ga0075434_100113707 Ga0075434_1001137072 256
397 3300006941 Ga0099825_1027806 Ga0099825_10278061 256
398 3300007076 Ga0075435_100061221 Ga0075435_1000612212 256
399 3300007788 Ga0099795_10155305 Ga0099795_101553051 256
400 3300009093 Ga0105240_10016003 Ga0105240_100160034 256
401 3300009093 Ga0105240_10594063 Ga0105240_105940631 256
402 3300009093 Ga0105240_10954614 Ga0105240_109546141 256
403 3300009098 Ga0105245_10388955 Ga0105245_103889552 256
404 3300009147 Ga0114129_10202039 Ga0114129_102020393 256
405 3300009174 Ga0105241_10078470 Ga0105241_100784703 256
406 3300009174 Ga0105241_10213832 Ga0105241_102138321 256
407 3300009176 Ga0105242_10487436 Ga0105242_104874362 256
408 3300009176 Ga0105242_10869106 Ga0105242_108691061 256
409 3300009177 Ga0105248_10116638 Ga0105248_101166383 256
410 3300009177 Ga0105248_10548232 Ga0105248_105482321 256
411 3300009545 Ga0105237_10008180 Ga0105237_100081804 256
412 3300009545 Ga0105237_10044534 Ga0105237_100445345 256
413 3300009545 Ga0105237_10108781 Ga0105237_101087812 256
414 3300009551 Ga0105238_10086581 Ga0105238_100865813 256
415 3300009551 Ga0105238_10379099 Ga0105238_103790991 256
416 3300010375 Ga0105239_10063987 Ga0105239_100639872 256
417 3300010375 Ga0105239_10114262 Ga0105239_101142622 256
418 3300010375 Ga0105239_10121462 Ga0105239_101214623 256
419 3300010375 Ga0105239_10746272 Ga0105239_107462721 256
420 3300011119 Ga0105246_10551445 Ga0105246_105514451 256
421 3300013102 Ga0157371_10299676 Ga0157371_102996762 256
422 3300013104 Ga0157370_10175441 Ga0157370_101754412 256
423 3300013105 Ga0157369_10017045 Ga0157369_100170456 256
424 3300013105 Ga0157369_10100743 Ga0157369_101007433 256
425 3300013297 Ga0157378_10208892 Ga0157378_102088922 256
426 3300013306 Ga0163162_10036732 Ga0163162_100367324 256
427 3300013307 Ga0157372_10167784 Ga0157372_101677842 256
428 3300013308 Ga0157375_10512727 Ga0157375_105127272 256
429 3300014325 Ga0163163_10020685 Ga0163163_100206856 256
430 3300014326 Ga0157380_10162545 Ga0157380_101625453 256
431 3300014497 Ga0182008_10125385 Ga0182008_101253851 256
432 3300014968 Ga0157379_10312350 Ga0157379_103123501 256
433 3300014969 Ga0157376_10032597 Ga0157376_100325974 256
434 3300021320 Ga0214544_1000002 Ga0214544_1000002188 256
435 3300021321 Ga0214542_1000001 Ga0214542_1000001538 256
436 3300021324 Ga0214545_1000001 Ga0214545_1000001604 256
437 3300021327 Ga0214543_1000001 Ga0214543_1000001592 256
438 3300021361 Ga0213872_10138378 Ga0213872_101383781 256
439 3300021441 Ga0213871_10003516 Ga0213871_100035161 256
440 3300025253 Ga0209677_100483 Ga0209677_1004835 256
441 3300025253 Ga0209677_104067 Ga0209677_1040672 256
442 3300025254 Ga0209148_1005631 Ga0209148_10056312 256
443 3300025261 Ga0209233_1001668 Ga0209233_10016687 256
444 3300025261 Ga0209233_1006103 Ga0209233_10061033 256
445 3300025261 Ga0209233_1008167 Ga0209233_10081672 256
446 3300025272 Ga0209455_1001684 Ga0209455_10016848 256
447 3300025295 Ga0209564_1021385 Ga0209564_10213851 256
448 3300025295 Ga0209564_1040789 Ga0209564_10407891 256
449 3300025297 Ga0209758_1000140 Ga0209758_100014036 256
450 3300025297 Ga0209758_1000321 Ga0209758_100032187 256
451 3300025297 Ga0209758_1001331 Ga0209758_10013315 256
452 3300025297 Ga0209758_1003646 Ga0209758_10036466 256
453 3300025297 Ga0209758_1006172 Ga0209758_10061728 256
454 3300025297 Ga0209758_1007980 Ga0209758_10079807 256
455 3300025297 Ga0209758_1012881 Ga0209758_10128812 256
456 3300025297 Ga0209758_1016109 Ga0209758_10161093 256
457 3300025297 Ga0209758_1037807 Ga0209758_10378073 256
458 3300025297 Ga0209758_1050985 Ga0209758_10509852 256
459 3300025299 Ga0209256_1004950 Ga0209256_10049505 256
460 3300025302 Ga0207426_1000278 Ga0207426_100027889 256
461 3300025302 Ga0207426_1000434 Ga0207426_100043418 256
462 3300025302 Ga0207426_1007488 Ga0207426_10074883 256
463 3300025302 Ga0207426_1023439 Ga0207426_10234392 256
464 3300025304 Ga0209257_1000522 Ga0209257_100052215 256
465 3300025304 Ga0209257_1013223 Ga0209257_10132232 256
466 3300025315 Ga0207697_10047475 Ga0207697_100474753 256
467 3300025898 Ga0207692_10005939 Ga0207692_100059394 256
468 3300025898 Ga0207692_10015770 Ga0207692_100157703 256
469 3300025898 Ga0207692_10030387 Ga0207692_100303872 256
470 3300025899 Ga0207642_10078545 Ga0207642_100785452 256
471 3300025903 Ga0207680_10033125 Ga0207680_100331254 256
472 3300025904 Ga0207647_10010455 Ga0207647_100104553 256
473 3300025906 Ga0207699_10000274 Ga0207699_1000027411 256
474 3300025906 Ga0207699_10010208 Ga0207699_100102083 256
475 3300025906 Ga0207699_10061107 Ga0207699_100611073 256
476 3300025906 Ga0207699_10182488 Ga0207699_101824882 256
477 3300025908 Ga0207643_10212224 Ga0207643_102122241 256
478 3300025909 Ga0207705_10225416 Ga0207705_102254161 256
479 3300025912 Ga0207707_10180129 Ga0207707_101801292 256
480 3300025912 Ga0207707_10196337 Ga0207707_101963372 256
481 3300025913 Ga0207695_10000008 Ga0207695_1000000831 256
482 3300025914 Ga0207671_10005303 Ga0207671_100053039 256
483 3300025914 Ga0207671_10035244 Ga0207671_100352442 256
484 3300025914 Ga0207671_10153871 Ga0207671_101538712 256
485 3300025914 Ga0207671_10419527 Ga0207671_104195271 256
486 3300025915 Ga0207693_10008368 Ga0207693_100083686 256
487 3300025915 Ga0207693_10070166 Ga0207693_100701661 256
488 3300025916 Ga0207663_10000084 Ga0207663_1000008440 256
489 3300025916 Ga0207663_10007427 Ga0207663_100074274 256
490 3300025916 Ga0207663_10030428 Ga0207663_100304282 256
491 3300025917 Ga0207660_10037461 Ga0207660_100374612 256
492 3300025919 Ga0207657_10412032 Ga0207657_104120322 256
493 3300025920 Ga0207649_10113680 Ga0207649_101136802 256
494 3300025921 Ga0207652_10066947 Ga0207652_100669472 256
495 3300025923 Ga0207681_10068461 Ga0207681_100684612 256
496 3300025924 Ga0207694_10070674 Ga0207694_100706741 256
497 3300025926 Ga0207659_10208204 Ga0207659_102082042 256
498 3300025927 Ga0207687_10341400 Ga0207687_103414001 256
499 3300025928 Ga0207700_10073423 Ga0207700_100734232 256
500 3300025928 Ga0207700_10086545 Ga0207700_100865453 256
501 3300025928 Ga0207700_10134927 Ga0207700_101349272 256
502 3300025928 Ga0207700_10143541 Ga0207700_101435412 256
503 3300025928 Ga0207700_10445875 Ga0207700_104458751 256
504 3300025929 Ga0207664_10002496 Ga0207664_1000249610 256
505 3300025929 Ga0207664_10085336 Ga0207664_100853362 256
506 3300025929 Ga0207664_10102554 Ga0207664_101025542 256
507 3300025929 Ga0207664_10486355 Ga0207664_104863551 256
508 3300025931 Ga0207644_10189752 Ga0207644_101897522 256
509 3300025931 Ga0207644_10193326 Ga0207644_101933262 256
510 3300025931 Ga0207644_10451598 Ga0207644_104515982 256
511 3300025932 Ga0207690_10179677 Ga0207690_101796772 256
512 3300025933 Ga0207706_10050730 Ga0207706_100507305 256
513 3300025933 Ga0207706_10070340 Ga0207706_100703403 256
514 3300025934 Ga0207686_10203494 Ga0207686_102034942 256
515 3300025937 Ga0207669_10174680 Ga0207669_101746803 256
516 3300025939 Ga0207665_10002807 Ga0207665_100028076 256
517 3300025939 Ga0207665_10032925 Ga0207665_100329254 256
518 3300025939 Ga0207665_10206823 Ga0207665_102068231 256
519 3300025939 Ga0207665_10261301 Ga0207665_102613012 256
520 3300025939 Ga0207665_10306626 Ga0207665_103066262 256
521 3300025940 Ga0207691_10076528 Ga0207691_100765282 256
522 3300025941 Ga0207711_10090544 Ga0207711_100905442 256
523 3300025941 Ga0207711_10532513 Ga0207711_105325131 256
524 3300025944 Ga0207661_10008546 Ga0207661_100085465 256
525 3300025944 Ga0207661_10114804 Ga0207661_101148042 256
526 3300025945 Ga0207679_10138591 Ga0207679_101385912 256
527 3300025949 Ga0207667_10785701 Ga0207667_107857011 256
528 3300025960 Ga0207651_10041786 Ga0207651_100417863 256
529 3300025960 Ga0207651_10245886 Ga0207651_102458862 256
530 3300025961 Ga0207712_10172803 Ga0207712_101728032 256
531 3300025972 Ga0207668_10040632 Ga0207668_100406322 256
532 3300025981 Ga0207640_10004002 Ga0207640_100040025 256
533 3300025986 Ga0207658_10209925 Ga0207658_102099252 256
534 3300026023 Ga0207677_10046223 Ga0207677_100462232 256
535 3300026041 Ga0207639_10492668 Ga0207639_104926681 256
536 3300026067 Ga0207678_10006143 Ga0207678_100061434 256
537 3300026067 Ga0207678_10016812 Ga0207678_100168127 256
538 3300026067 Ga0207678_10093268 Ga0207678_100932682 256
539 3300026067 Ga0207678_10123907 Ga0207678_101239072 256
540 3300026067 Ga0207678_10189170 Ga0207678_101891701 256
541 3300026067 Ga0207678_10345845 Ga0207678_103458451 256
542 3300026067 Ga0207678_10456843 Ga0207678_104568431 256
543 3300026075 Ga0207708_10019823 Ga0207708_100198234 256
544 3300026075 Ga0207708_10121088 Ga0207708_101210882 256
545 3300026075 Ga0207708_10138261 Ga0207708_101382613 256
546 3300026078 Ga0207702_10000748 Ga0207702_100007484 256
547 3300026078 Ga0207702_10091695 Ga0207702_100916952 256
548 3300026078 Ga0207702_10143059 Ga0207702_101430592 256
549 3300026078 Ga0207702_10497402 Ga0207702_104974021 256
550 3300026088 Ga0207641_10137968 Ga0207641_101379681 256
551 3300026088 Ga0207641_10355050 Ga0207641_103550502 256
552 3300026118 Ga0207675_100046463 Ga0207675_1000464632 256
553 3300026121 Ga0207683_10029535 Ga0207683_100295354 256
554 3300026121 Ga0207683_10349609 Ga0207683_103496092 256
555 3300026142 Ga0207698_10051841 Ga0207698_100518414 256
556 3300026142 Ga0207698_10060464 Ga0207698_100604643 256
557 3300026142 Ga0207698_10428359 Ga0207698_104283591 256
558 3300027363 Ga0209700_100005 Ga0209700_100005202 256
559 3300027866 Ga0209813_10039185 Ga0209813_100391851 256
560 3300027907 Ga0207428_10383415 Ga0207428_103834151 256
561 3300028379 Ga0268266_10002598 Ga0268266_1000259813 256
562 3300028379 Ga0268266_10027621 Ga0268266_100276214 256
563 3300028379 Ga0268266_10152487 Ga0268266_101524871 256
564 3300028379 Ga0268266_10229557 Ga0268266_102295571 256
565 3300028379 Ga0268266_10300258 Ga0268266_103002582 256
566 3300028379 Ga0268266_10307747 Ga0268266_103077472 256
567 3300028379 Ga0268266_10774991 Ga0268266_107749911 256
568 3300028380 Ga0268265_10062055 Ga0268265_100620552 256
569 3300028380 Ga0268265_10225589 Ga0268265_102255892 256
570 3300028380 Ga0268265_10620121 Ga0268265_106201211 256
571 3300028381 Ga0268264_10071176 Ga0268264_100711762 256
572 3300028381 Ga0268264_10452889 Ga0268264_104528892 256
573 3300028556 Ga0265337_1030922 Ga0265337_10309221 256
574 3300028563 Ga0265319_1001625 Ga0265319_100162511 256
575 3300028573 Ga0265334_10011646 Ga0265334_100116464 256
576 3300028653 Ga0265323_10000194 Ga0265323_1000019422 256
577 3300028666 Ga0265336_10000244 Ga0265336_1000024421 256
578 3300028786 Ga0307517_10000249 Ga0307517_100002498 256
579 3300028794 Ga0307515_10075370 Ga0307515_100753704 256
580 3300028800 Ga0265338_10000665 Ga0265338_1000066512 256
581 3300029957 Ga0265324_10013895 Ga0265324_100138952 256
582 3300031235 Ga0265330_10007755 Ga0265330_100077554 256
583 3300031235 Ga0265330_10077068 Ga0265330_100770682 256
584 3300031241 Ga0265325_10028947 Ga0265325_100289472 256
585 3300031247 Ga0265340_10013213 Ga0265340_100132134 256
586 3300031249 Ga0265339_10149755 Ga0265339_101497551 256
587 3300031344 Ga0265316_10133331 Ga0265316_101333313 256
588 3300031456 Ga0307513_10064593 Ga0307513_100645934 256
589 3300031595 Ga0265313_10077547 Ga0265313_100775472 256
590 3300031711 Ga0265314_10006694 Ga0265314_100066947 256
591 3300031712 Ga0265342_10074982 Ga0265342_100749822 256
592 3300031730 Ga0307516_10066838 Ga0307516_100668383 256
593 3300031824 Ga0307413_10546295 Ga0307413_105462952 256
594 3300031901 Ga0307406_10190542 Ga0307406_101905422 256
595 3300031995 Ga0307409_100505020 Ga0307409_1005050201 256
596 3300033180 Ga0307510_10003728 Ga0307510_100037286 256
597 3300033180 Ga0307510_10229219 Ga0307510_102292192 256
598 3300033442 Ga0315911_1000006 Ga0315911_1000006289 256
599 3300035084 Ga0373928_0022976 Ga0373928_0022976_398_1168 256
600 3300035086 Ga0373934_0017731 Ga0373934_0017731_974_1744 256
601 3300035089 Ga0373944_0096679 Ga0373944_0096679_203_973 256
602 3300035113 Ga0373936_0072373 Ga0373936_0072373_600_1370 256
603 3300035117 Ga0373953_0000370 Ga0373953_0000370_2569_3339 256
604 3300035119 Ga0373956_0001015 Ga0373956_0001015_25_795 256
605 3300035170 Ga0373943_0039037 Ga0373943_0039037_1029_1799 256
606 3300035172 Ga0373955_0000271 Ga0373955_0000271_3845_4615 256
607 3300035172 Ga0373955_0022527 Ga0373955_0022527_2325_3095 256
608 3300035172 Ga0373955_0065761 Ga0373955_0065761_958_1728 256
609 3300035691 Ga0373931_0001699 Ga0373931_0001699_3294_4064 256
610 3300035695 Ga0373927_0006090 Ga0373927_0006090_6501_7271 256
611 3300035695 Ga0373927_0194411 Ga0373927_0194411_144_914 256
612 3300035724 Ga0373933_0002469 Ga0373933_0002469_8088_8858 256
613 3300035725 Ga0373947_0081262 Ga0373947_0081262_689_1459 256
614 3300036401 Ga0373937_0027502 Ga0373937_0027502_815_1585 256
615 3300036401 Ga0373937_0078045 Ga0373937_0078045_1674_2444 256
616 3300037068 Ga0373925_0044168 Ga0373925_0044168_1575_2345 256
617 3300037068 Ga0373925_0243554 Ga0373925_0243554_415_1185 256
618 3300037312 Ga0395899_0129770 Ga0395899_0129770_997_1767 256
619 3300037418 Ga0395900_0007773 Ga0395900_0007773_5448_6218 256
620 3300037418 Ga0395900_0435461 Ga0395900_0435461_335_1105 256
621 3300037466 Ga0395898_0018745 Ga0395898_0018745_4762_5532 256
622 3300037466 Ga0395898_0068852 Ga0395898_0068852_1021_1791 256
623 3300037471 Ga0395905_0030242 Ga0395905_0030242_713_1483 256
624 3300037471 Ga0395905_0127471 Ga0395905_0127471_1436_2206 256
625 3300037853 Ga0436364_0042848 Ga0436364_0042848_3678_4448 256
626 3300039437 Ga0436365_0907811 Ga0436365_0907811_186_956 256
627 3300039437 Ga0436365_1082335 Ga0436365_1082335_30_800 256
628 3300039437 Ga0436365_1668816 Ga0436365_1668816_52_822 256
629 3300039438 Ga0436360_0888541 Ga0436360_0888541_2592_3362 256
630 3300039447 Ga0436361_1057161 Ga0436361_1057161_762_1532 256
631 3300041486 Ga0451807_0494685 Ga0451807_0494685_374_1144 256
632 3300041511 Ga0451855_1184848 Ga0451855_1184848_22_792 256
633 3300042012 Ga0439455_0046295 Ga0439455_0046295_335_1105 256
634 3300042438 Ga0439459_0012683 Ga0439459_0012683_504_1274 256
635 3300044656 Ga0466969_0027564 Ga0466969_0027564_1895_2665 256
636 3300044656 Ga0466969_0042371 Ga0466969_0042371_724_1494 256
637 3300044658 Ga0466972_0000160 Ga0466972_0000160_21358_22128 256
638 3300044658 Ga0466972_0006766 Ga0466972_0006766_4355_5125 256
639 3300044683 Ga0466965_0024363 Ga0466965_0024363_446_1216 256
640 3300044684 Ga0466966_0001852 Ga0466966_0001852_11873_12643 256
641 3300044684 Ga0466966_0162157 Ga0466966_0162157_134_904 256
642 3300044693 Ga0466961_0002102 Ga0466961_0002102_3984_4754 256
643 3300044719 Ga0466971_0193891 Ga0466971_0193891_42_812 256
644 3300044735 Ga0466968_0014536 Ga0466968_0014536_1887_2657 256
645 3300044765 Ga0466970_0138645 Ga0466970_0138645_422_1192 256
646 3300044901 Ga0466960_0005483 Ga0466960_0005483_2334_3104 256
647 3300044901 Ga0466960_0040682 Ga0466960_0040682_497_1267 256
648 3300045049 Ga0466959_0001487 Ga0466959_0001487_12285_13055 256
649 3300045049 Ga0466959_0141407 Ga0466959_0141407_284_1054 256
650 3300045049 Ga0466959_0178953 Ga0466959_0178953_47_817 256
651 3300045836 Ga0466958_0109103 Ga0466958_0109103_654_1424 256
652 3300045976 Ga0466967_0031696 Ga0466967_0031696_240_1010 256
653 3300045976 Ga0466967_0148652 Ga0466967_0148652_211_981 256
654 3300045976 Ga0466967_0374035 Ga0466967_0374035_104_874 256
655 3300045976 Ga0466967_1062510 Ga0466967_1062510_20_790 256
656 3300046455 Ga0495603_0012659 Ga0495603_0012659_3668_4438 256
657 3300046455 Ga0495603_0036946 Ga0495603_0036946_2036_2806 256
658 3300046455 Ga0495603_0047425 Ga0495603_0047425_291_1061 256
659 3300046455 Ga0495603_0113339 Ga0495603_0113339_536_1306 256
660 3300046459 Ga0495629_0007149 Ga0495629_0007149_1980_2750 256
661 3300046460 Ga0495638_0098461 Ga0495638_0098461_215_985 256
662 3300046461 Ga0495641_0031962 Ga0495641_0031962_407_1177 256
663 3300046462 Ga0495651_0018066 Ga0495651_0018066_849_1619 256
664 3300046462 Ga0495651_0076075 Ga0495651_0076075_949_1719 256
665 3300046462 Ga0495651_0092723 Ga0495651_0092723_1045_1815 256
666 3300046462 Ga0495651_0317328 Ga0495651_0317328_102_872 256
667 3300046463 Ga0495653_0052078 Ga0495653_0052078_2237_3007 256
668 3300046471 Ga0495650_0010928 Ga0495650_0010928_789_1559 256
669 3300046473 Ga0495582_0148657 Ga0495582_0148657_469_1239 256
670 3300046474 Ga0495605_0063307 Ga0495605_0063307_440_1210 256
671 3300046475 Ga0495639_0021278 Ga0495639_0021278_2021_2791 256
672 3300046475 Ga0495639_0023073 Ga0495639_0023073_191_961 256
673 3300046476 Ga0495662_0121429 Ga0495662_0121429_290_1060 256
674 3300046477 Ga0495664_0058033 Ga0495664_0058033_416_1186 256
675 3300046477 Ga0495664_0121029 Ga0495664_0121029_345_1115 256
676 3300046477 Ga0495664_0134109 Ga0495664_0134109_89_859 256
677 3300046491 Ga0495584_0068792 Ga0495584_0068792_667_1437 256
678 3300046492 Ga0495585_0027274 Ga0495585_0027274_76_846 256
679 3300046499 Ga0495594_0037759 Ga0495594_0037759_480_1250 256
680 3300046499 Ga0495594_0055424 Ga0495594_0055424_338_1108 256
681 3300046506 Ga0495583_0067541 Ga0495583_0067541_101_871 256
682 3300046507 Ga0495606_0016917 Ga0495606_0016917_4336_5106 256
683 3300046511 Ga0495608_0082775 Ga0495608_0082775_995_1765 256
684 3300046511 Ga0495608_0149512 Ga0495608_0149512_592_1362 256
685 3300046513 Ga0495616_0075041 Ga0495616_0075041_153_923 256
686 3300046514 Ga0495618_0033328 Ga0495618_0033328_18_788 256
687 3300046515 Ga0495620_0103082 Ga0495620_0103082_94_864 256
688 3300046516 Ga0495628_0048889 Ga0495628_0048889_168_938 256
689 3300046516 Ga0495628_0109630 Ga0495628_0109630_1099_1869 256
690 3300046516 Ga0495628_0339394 Ga0495628_0339394_157_927 256
691 3300046522 Ga0495643_0021848 Ga0495643_0021848_1830_2600 256
692 3300046529 Ga0495652_0027032 Ga0495652_0027032_701_1471 256
693 3300046533 Ga0495640_0045531 Ga0495640_0045531_2131_2901 256
694 3300046533 Ga0495640_0119038 Ga0495640_0119038_874_1644 256
695 3300046533 Ga0495640_0266793 Ga0495640_0266793_18_788 256
696 3300046536 Ga0495587_0001231 Ga0495587_0001231_15335_16105 256
697 3300046538 Ga0495609_0020238 Ga0495609_0020238_135_905 256
698 3300046538 Ga0495609_0121263 Ga0495609_0121263_140_910 256
699 3300046543 Ga0495645_0004742 Ga0495645_0004742_8099_8869 256
700 3300046543 Ga0495645_0255925 Ga0495645_0255925_35_805 256
701 3300046557 Ga0495622_0080786 Ga0495622_0080786_102_872 256
702 3300046559 Ga0495667_0035177 Ga0495667_0035177_1677_2447 256
703 3300046615 Ga0495656_0188916 Ga0495656_0188916_223_993 256
704 3300046615 Ga0495656_0194068 Ga0495656_0194068_145_915 256
705 3300046642 Ga0495634_0027297 Ga0495634_0027297_2232_3002 256
706 3300046648 Ga0495611_0129235 Ga0495611_0129235_386_1156 256
707 3300046660 Ga0495625_0056679 Ga0495625_0056679_1602_2372 256
708 3300046660 Ga0495625_0133265 Ga0495625_0133265_267_1037 256
709 3300046660 Ga0495625_0290659 Ga0495625_0290659_140_910 256
710 3300046663 Ga0495635_0013502 Ga0495635_0013502_1546_2316 256
711 3300046664 Ga0495659_0071812 Ga0495659_0071812_285_1055 256
712 3300046664 Ga0495659_0099621 Ga0495659_0099621_247_1017 256
713 3300046665 Ga0495661_0132880 Ga0495661_0132880_490_1260 256
714 3300046674 Ga0495588_0020300 Ga0495588_0020300_320_1090 256
715 3300046674 Ga0495588_0266010 Ga0495588_0266010_104_874 256
716 3300046675 Ga0495657_0003048 Ga0495657_0003048_11725_12495 256
717 3300046675 Ga0495657_0022491 Ga0495657_0022491_2566_3336 256
718 3300046675 Ga0495657_0027210 Ga0495657_0027210_1120_1890 256
719 3300046675 Ga0495657_0131361 Ga0495657_0131361_379_1149 256
720 3300046678 Ga0495599_0012174 Ga0495599_0012174_492_1262 256
721 3300046679 Ga0495623_0010720 Ga0495623_0010720_1955_2725 256
722 3300046680 Ga0495646_0122816 Ga0495646_0122816_380_1150 256
723 3300046681 Ga0495647_0010644 Ga0495647_0010644_2001_2771 256
724 3300046683 Ga0495658_0083701 Ga0495658_0083701_284_1054 256
725 3300046684 Ga0495669_0021361 Ga0495669_0021361_1278_2048 256
726 3300046684 Ga0495669_0098415 Ga0495669_0098415_58_828 256
727 3300046689 Ga0495613_0029694 Ga0495613_0029694_901_1671 256
728 3300046689 Ga0495613_0305038 Ga0495613_0305038_47_817 256
729 3300046690 Ga0495624_0106680 Ga0495624_0106680_914_1684 256
730 3300046690 Ga0495624_0152891 Ga0495624_0152891_163_933 256
731 3300046690 Ga0495624_0299992 Ga0495624_0299992_125_895 256
732 3300046690 Ga0495624_0314970 Ga0495624_0314970_115_918 256
733 3300046691 Ga0495670_0130922 Ga0495670_0130922_156_926 256
734 3300046809 Ga0495600_0009290 Ga0495600_0009290_1226_1996 256
735 3300046809 Ga0495600_0055481 Ga0495600_0055481_72_842 256
736 3300046809 Ga0495600_0155673 Ga0495600_0155673_216_986 256
737 3300047315 Ga0495581_0127221 Ga0495581_0127221_325_1095 256
738 3300047315 Ga0495581_0175523 Ga0495581_0175523_364_1134 256
739 3300047315 Ga0495581_0325939 Ga0495581_0325939_40_810 256
740 3300047317 Ga0495604_0004143 Ga0495604_0004143_8360_9130 256
741 3300047317 Ga0495604_0024939 Ga0495604_0024939_2027_2797 256
742 3300047317 Ga0495604_0043000 Ga0495604_0043000_18_788 256
743 3300047318 Ga0495636_0120296 Ga0495636_0120296_370_1140 256
744 3300047319 Ga0495674_0021971 Ga0495674_0021971_809_1579 256
745 3300047319 Ga0495674_0057891 Ga0495674_0057891_1799_2569 256
746 3300047320 Ga0495672_0012877 Ga0495672_0012877_488_1258 256
747 3300047321 Ga0495676_0060616 Ga0495676_0060616_121_891 256
748 3300047322 Ga0495680_0002256 Ga0495680_0002256_11708_12478 256
749 3300047322 Ga0495680_0017868 Ga0495680_0017868_1065_1835 256
750 3300047322 Ga0495680_0204221 Ga0495680_0204221_95_865 256
751 3300047443 Ga0495687_013063 Ga0495687_013063_2641_3411 256
752 3300047444 Ga0495675_0025039 Ga0495675_0025039_2083_2853 256
753 3300047444 Ga0495675_0044584 Ga0495675_0044584_1905_2675 256
754 3300047445 Ga0495677_0015810 Ga0495677_0015810_1510_2280 256
755 3300047469 Ga0495673_0107710 Ga0495673_0107710_50_820 256
756 3300047471 Ga0495684_0009505 Ga0495684_0009505_4002_4772 256
757 3300047471 Ga0495684_0049434 Ga0495684_0049434_1393_2163 256
758 3300047673 Ga0495593_0048051 Ga0495593_0048051_823_1593 256
759 3300048088 Ga0495602_0031896 Ga0495602_0031896_2368_3138 256
760 3300048088 Ga0495602_0188536 Ga0495602_0188536_561_1331 256
761 3300048903 Ga0496100_0029235 Ga0496100_0029235_925_1695 256
762 3300048903 Ga0496100_0338701 Ga0496100_0338701_78_848 256
763 3300048904 Ga0496101_0004401 Ga0496101_0004401_6424_7194 256
764 3300048904 Ga0496101_0033676 Ga0496101_0033676_237_1007 256
765 3300048904 Ga0496101_0297703 Ga0496101_0297703_220_990 256
766 3300048905 Ga0496102_0062019 Ga0496102_0062019_515_1285 256
767 3300048905 Ga0496102_0089687 Ga0496102_0089687_36_806 256
768 3300048905 Ga0496102_0133305 Ga0496102_0133305_1268_2038 256
769 3300048905 Ga0496102_0299376 Ga0496102_0299376_346_1116 256
770 3300048906 Ga0496103_0034728 Ga0496103_0034728_58_828 256
771 3300048906 Ga0496103_0036941 Ga0496103_0036941_2111_2881 256
772 3300048906 Ga0496103_0280444 Ga0496103_0280444_272_1042 256
773 3300048907 Ga0496104_0009984 Ga0496104_0009984_7631_8401 256
774 3300048907 Ga0496104_0506525 Ga0496104_0506525_88_858 256
775 3300048908 Ga0496105_0316590 Ga0496105_0316590_78_848 256
776 3300048909 Ga0496106_0007812 Ga0496106_0007812_2324_3094 256
777 3300048909 Ga0496106_0011928 Ga0496106_0011928_3271_4041 256
778 3300048910 Ga0496107_0007527 Ga0496107_0007527_3972_4742 256
779 3300048910 Ga0496107_0080548 Ga0496107_0080548_509_1279 256
780 3300048910 Ga0496107_0085467 Ga0496107_0085467_52_822 256
781 3300048911 Ga0496108_0343029 Ga0496108_0343029_157_927 256
782 3300048912 Ga0496109_0401259 Ga0496109_0401259_455_1225 256
783 3300048912 Ga0496109_0406335 Ga0496109_0406335_186_956 256
784 3300048912 Ga0496109_0517685 Ga0496109_0517685_253_1023 256
785 3300048913 Ga0496110_0036901 Ga0496110_0036901_3232_4002 256
786 3300048913 Ga0496110_0215759 Ga0496110_0215759_642_1412 256
787 3300048913 Ga0496110_0376839 Ga0496110_0376839_460_1230 256
788 3300048914 Ga0496111_0021489 Ga0496111_0021489_993_1763 256
789 3300048914 Ga0496111_0055700 Ga0496111_0055700_576_1346 256
790 3300048914 Ga0496111_0200666 Ga0496111_0200666_699_1469 256
791 3300048915 Ga0496112_0000004 Ga0496112_0000004_287985_288755 256
792 3300048915 Ga0496112_0013523 Ga0496112_0013523_3105_3875 256
793 3300048915 Ga0496112_0024619 Ga0496112_0024619_417_1187 256
794 3300048915 Ga0496112_0347293 Ga0496112_0347293_361_1131 256
795 3300048916 Ga0496113_0304497 Ga0496113_0304497_405_1175 256
796 3300048916 Ga0496113_0363930 Ga0496113_0363930_138_908 256
797 3300048917 Ga0496114_0035406 Ga0496114_0035406_325_1095 256
798 3300048917 Ga0496114_0061257 Ga0496114_0061257_605_1375 256
799 3300048917 Ga0496114_0113306 Ga0496114_0113306_1217_1987 256
800 3300048917 Ga0496114_0120338 Ga0496114_0120338_1308_2078 256
801 3300048917 Ga0496114_0666713 Ga0496114_0666713_101_871 256
802 3300048918 Ga0496115_0002608 Ga0496115_0002608_11667_12437 256
803 3300048918 Ga0496115_0039675 Ga0496115_0039675_2169_2939 256
804 3300048918 Ga0496115_0074334 Ga0496115_0074334_1607_2377 256
805 3300048918 Ga0496115_0160075 Ga0496115_0160075_109_879 256
806 3300048918 Ga0496115_0178656 Ga0496115_0178656_228_998 256
807 3300048919 Ga0496116_0026275 Ga0496116_0026275_2568_3338 256
808 3300048920 Ga0496117_0108130 Ga0496117_0108130_864_1634 256
809 3300048920 Ga0496117_0156145 Ga0496117_0156145_262_1032 256
810 3300048921 Ga0496118_0013128 Ga0496118_0013128_6987_7757 256
811 3300048921 Ga0496118_0051192 Ga0496118_0051192_1123_1893 256
812 3300048921 Ga0496118_0054716 Ga0496118_0054716_1422_2192 256
813 3300048922 Ga0496119_0011739 Ga0496119_0011739_252_1022 256
814 3300048922 Ga0496119_0174488 Ga0496119_0174488_41_811 256
815 3300048924 Ga0496121_0002768 Ga0496121_0002768_12647_13417 256
816 3300048924 Ga0496121_0021415 Ga0496121_0021415_945_1715 256
817 3300048924 Ga0496121_0080309 Ga0496121_0080309_1799_2569 256
818 3300048924 Ga0496121_0134036 Ga0496121_0134036_996_1766 256
819 3300048925 Ga0496122_0119786 Ga0496122_0119786_501_1271 256
820 3300048927 Ga0496124_0253444 Ga0496124_0253444_469_1239 256
821 3300048928 Ga0496125_0070716 Ga0496125_0070716_218_988 256
822 3300048928 Ga0496125_0108087 Ga0496125_0108087_625_1395 256
823 3300048929 Ga0496126_0021457 Ga0496126_0021457_1470_2240 256
824 3300048929 Ga0496126_0036391 Ga0496126_0036391_2276_3046 256
825 3300048929 Ga0496126_0068282 Ga0496126_0068282_1311_2081 256
826 3300048929 Ga0496126_0071842 Ga0496126_0071842_280_1050 256
827 3300048929 Ga0496126_0114780 Ga0496126_0114780_1436_2206 256
828 3300048929 Ga0496126_0218460 Ga0496126_0218460_15_785 256
829 3300048929 Ga0496126_0354169 Ga0496126_0354169_16_786 256
830 3300048929 Ga0496126_0426407 Ga0496126_0426407_228_998 256
831 3300049460 Ga0495682_0101098 Ga0495682_0101098_127_897 256
832 3300049460 Ga0495682_0110560 Ga0495682_0110560_156_926 256
833 3300049572 Ga0501036_0244136 Ga0501036_0244136_462_1232 256
834 3300049581 Ga0501047_0356052 Ga0501047_0356052_180_950 256
835 3300049585 Ga0501069_0236557 Ga0501069_0236557_167_937 256
836 3300050489 nmdc:mga03683_5086_c1 nmdc:mga03683_5086_c1_3155_3925 256
837 3300050490 nmdc:mga03n38_41670_c1 nmdc:mga03n38_41670_c1_695_1465 256
838 3300050490 nmdc:mga03n38_48697_c1 nmdc:mga03n38_48697_c1_257_1027 256
839 3300050492 nmdc:mga0yw44_102069_c1 nmdc:mga0yw44_102069_c1_795_1565 256
840 3300050492 nmdc:mga0yw44_194563_c1 nmdc:mga0yw44_194563_c1_53_823 256
841 3300050492 nmdc:mga0yw44_21547_c1 nmdc:mga0yw44_21547_c1_1541_2311 256
842 3300050492 nmdc:mga0yw44_86663_c1 nmdc:mga0yw44_86663_c1_502_1272 256
843 3300050493 nmdc:mga0k408_215347_c1 nmdc:mga0k408_215347_c1_144_914 256
844 3300050493 nmdc:mga0k408_31972_c1 nmdc:mga0k408_31972_c1_276_1046 256
845 3300050494 nmdc:mga06z11_1189_c1 nmdc:mga06z11_1189_c1_3953_4723 256
846 3300050494 nmdc:mga06z11_119062_c1 nmdc:mga06z11_119062_c1_627_1397 256
847 3300050494 nmdc:mga06z11_203008_c1 nmdc:mga06z11_203008_c1_48_818 256
848 3300050494 nmdc:mga06z11_22297_c1 nmdc:mga06z11_22297_c1_46_816 256
849 3300050495 nmdc:mga04h51_52287_c1 nmdc:mga04h51_52287_c1_158_928 256
850 3300050495 nmdc:mga04h51_96242_c1 nmdc:mga04h51_96242_c1_133_903 256
851 3300050496 nmdc:mga07m45_41293_c1 nmdc:mga07m45_41293_c1_647_1417 256
852 3300050496 nmdc:mga07m45_49982_c1 nmdc:mga07m45_49982_c1_718_1488 256
853 3300050507 nmdc:mga05p37_302933_c1 nmdc:mga05p37_302933_c1_85_855 256
854 3300050512 nmdc:mga0n895_113919_c1 nmdc:mga0n895_113919_c1_778_1548 256
855 3300050513 nmdc:mga0rr50_65295_c1 nmdc:mga0rr50_65295_c1_1468_2238 256
856 3300050514 nmdc:mga08x19_81102_c1 nmdc:mga08x19_81102_c1_524_1294 256
857 3300050516 nmdc:mga0sz30_150449_c1 nmdc:mga0sz30_150449_c1_192_962 256
858 3300050516 nmdc:mga0sz30_5200_c1 nmdc:mga0sz30_5200_c1_3018_3788 256
859 3300050516 nmdc:mga0sz30_69284_c1 nmdc:mga0sz30_69284_c1_381_1151 256
860 3300050516 nmdc:mga0sz30_8049_c1 nmdc:mga0sz30_8049_c1_2220_2990 256
861 3300053077 Ga0495601_0009741 Ga0495601_0009741_4318_5088 256
862 3300053084 Ga0495595_0042824 Ga0495595_0042824_421_1191 256
863 3300053085 Ga0495619_0001765 Ga0495619_0001765_3030_3800 256
864 3300053086 Ga0500578_0066616 Ga0500578_0066616_553_1323 256
865 3300053086 Ga0500578_0140988 Ga0500578_0140988_198_968 256
866 3300053087 Ga0500643_000035 Ga0500643_000035_32256_33026 256
867 3300053093 Ga0500651_0008223 Ga0500651_0008223_2370_3140 256
868 3300053093 Ga0500651_0035620 Ga0500651_0035620_1184_1954 256
869 3300053094 Ga0500566_0000995 Ga0500566_0000995_2930_3700 256
870 3300053094 Ga0500566_0036349 Ga0500566_0036349_1469_2239 256
871 3300053096 Ga0500641_0009486 Ga0500641_0009486_67_837 256
872 3300053104 Ga0500556_0003621 Ga0500556_0003621_226_1023 256
873 3300053105 Ga0500557_000004 Ga0500557_000004_104912_105682 256
874 3300053108 Ga0500562_062370 Ga0500562_062370_59_829 256
875 3300053109 Ga0500569_001889 Ga0500569_001889_1192_1962 256
876 3300053111 Ga0500572_006675 Ga0500572_006675_579_1349 256
877 3300053119 Ga0500595_006151 Ga0500595_006151_3626_4396 256
878 3300053119 Ga0500595_033412 Ga0500595_033412_471_1241 256
879 3300053120 Ga0500597_136812 Ga0500597_136812_18_788 256
880 3300053130 Ga0500642_0074298 Ga0500642_0074298_391_1164 256
881 3300053131 Ga0500652_039046 Ga0500652_039046_752_1522 256
882 3300053136 Ga0500559_0001481 Ga0500559_0001481_7101_7871 256
883 3300053138 Ga0500564_192471 Ga0500564_192471_27_797 256
884 3300053139 Ga0500568_0068786 Ga0500568_0068786_331_1101 256
885 3300053150 Ga0500603_011120 Ga0500603_011120_172_942 256
886 3300053151 Ga0500604_0122798 Ga0500604_0122798_17_787 256
887 3300053155 Ga0500620_002492 Ga0500620_002492_1471_2241 256
888 3300053156 Ga0500622_0088644 Ga0500622_0088644_366_1163 256
889 3300053157 Ga0500624_015529 Ga0500624_015529_306_1076 256
890 3300053162 Ga0500638_144188 Ga0500638_144188_162_932 256
891 3300053177 Ga0500636_0001590 Ga0500636_0001590_1590_2360 256
892 3300053177 Ga0500636_0041180 Ga0500636_0041180_1666_2436 256
893 3300053730 Ga0500645_007384 Ga0500645_007384_824_1594 256
894 3300053737 Ga0500601_000602 Ga0500601_000602_1414_2184 256
895 3300054114 Ga0501084_0602073 Ga0501084_0602073_25_795 256
896 3300055283 Ga0500661_003528 Ga0500661_003528_1388_2158 256
897 iso_pu_bacteria 2935785616 2935788855 256
898 iso_pu_bacteria 2935793552 2935795345 256
899 iso_pu_bacteria 8006926726 8006931990 256
900 iso_pu_bacteria 8016522445 8016529367 256
901 iso_pu_bacteria 8016530956 8016534578 256
902 iso_pu_bacteria 8016539877 8016547798 256
903 iso_pu_bacteria 8016548790 8016554338 256
904 iso_pu_bacteria 8016566248 8016572922 256
905 iso_pu_bacteria 8016575299 8016577078 256
906 iso_pu_bacteria 8016595262 8016600490 256
907 iso_pu_bacteria 8019530166 8019534343 256
908 iso_pu_bacteria 8056673599 8056677637 256
909 3300003215 JGI25153J46596_10003157 JGI25153J46596_100031576 257
910 3300021377 Ga0213874_10024195 Ga0213874_100241952 257
911 3300031730 Ga0307516_10252820 Ga0307516_102528202 257
912 3300039450 Ga0436363_1613029 Ga0436363_1613029_3736_4509 257
913 3300050510 nmdc:mga06r32_561520_c1 nmdc:mga06r32_561520_c1_311_1084 257
914 3300053119 Ga0500595_008294 Ga0500595_008294_343_1116 257
915 3300053122 Ga0500608_158108 Ga0500608_158108_119_961 257
916 3300053130 Ga0500642_0000124 Ga0500642_0000124_6457_7299 257
917 3300053178 Ga0500637_0000377 Ga0500637_0000377_4359_5132 257
918 3300053729 Ga0500625_002428 Ga0500625_002428_3153_3995 257
919 3300055283 Ga0500661_000291 Ga0500661_000291_1634_2407 257
920 iso_pu_bacteria 2887375801 2887380650 257
921 iso_pu_bacteria 2922361189 2922365620 257
922 3300010375 Ga0105239_10600764 Ga0105239_106007641 259
923 3300013297 Ga0157378_10005570 Ga0157378_100055704 259
924 3300025972 Ga0207668_10074342 Ga0207668_100743423 259
925 3300032005 Ga0307411_10214309 Ga0307411_102143092 259
926 3300046615 Ga0495656_0008574 Ga0495656_0008574_2507_3403 259
927 3300046616 Ga0495668_0020807 Ga0495668_0020807_2779_3675 259
928 3300053085 Ga0495619_0005620 Ga0495619_0005620_2842_3684 259
929 3300053092 Ga0500583_0144102 Ga0500583_0144102_150_1022 259
930 3300053160 Ga0500633_0100433 Ga0500633_0100433_92_964 259
931 iso_pu_bacteria 2643221621 2644124193 259
932 iso_pu_bacteria 2739367655 2739613562 259
933 iso_pu_bacteria 2857537821 2857540331 259
934 iso_pu_bacteria 2855730933 2855731634 260
935 iso_pu_bacteria 2855767633 2855768340 260
936 iso_pu_bacteria 2881412998 2881413482 260
937 3300032004 Ga0307414_10268514 Ga0307414_102685142 261
938 3300006051 Ga0075364_10021240 Ga0075364_100212405 263
939 3300048920 Ga0496117_0052595 Ga0496117_0052595_1426_2217 263
940 3300048921 Ga0496118_0026494 Ga0496118_0026494_1577_2368 263
941 3300048922 Ga0496119_0070726 Ga0496119_0070726_10_801 263
942 3300048924 Ga0496121_0033694 Ga0496121_0033694_2770_3561 263
943 3300048925 Ga0496122_0027043 Ga0496122_0027043_1880_2671 263
944 3300048926 Ga0496123_0010439 Ga0496123_0010439_1259_2050 263
945 3300048927 Ga0496124_0031915 Ga0496124_0031915_2989_3780 263
946 3300048928 Ga0496125_0002258 Ga0496125_0002258_18291_19082 263
947 3300048929 Ga0496126_0010740 Ga0496126_0010740_822_1613 263
948 3300050491 nmdc:mga00v17_77626_c1 nmdc:mga00v17_77626_c1_219_1013 263
949 3300003187 JGI25151J46595_10000771 JGI25151J46595_1000077122 264
950 3300025294 Ga0209025_1000018 Ga0209025_1000018315 264

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00378

ECH_1

Enoyl-CoA hydratase/isomerase

54

298

0.93

PF16113

ECH_2

Enoyl-CoA hydratase/isomerase

59

281

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
3kqf-assembly1.cif.gz_B 1.8 angstrom resolution crystal structure of enoyl-coa hydratase from bacillus anthracis. 0.9364 10 257
7eum-assembly1.cif.gz_C crystal structure of apo nmar_1308 protein at cryogenic temperature 0.9352 10 243
7eum-assembly1.cif.gz_D crystal structure of apo nmar_1308 protein at cryogenic temperature 0.9309 10 243
7eum-assembly1.cif.gz_A crystal structure of apo nmar_1308 protein at cryogenic temperature 0.9302 10 243
7eum-assembly1.cif.gz_E crystal structure of apo nmar_1308 protein at cryogenic temperature 0.9281 10 243
ID Description Score Start End Superfamily
af_Q54HG7_37_243_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9325 10 204 3.90.226.10
af_Q4DIE0_13_217_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9281 6 205 3.90.226.10
af_Q9JLZ3_43_254_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.927 10 201 3.90.226.10
af_B7F9R1_37_234_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9235 15 205 3.90.226.10
2a7kB01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9185 11 206 3.90.226.10
ID Description Score Start End GO Terms
AF-A0A2N4UE97-F1-model_v4 Enoyl-CoA hydratase (EC 4.2.1.17) 0.9618 5 260 GO:0004300
GO:0006635
AF-A0A363REB8-F1-model_v4 Enoyl-CoA hydratase (EC 4.2.1.17) 0.9616 3 254 GO:0004300
GO:0006635
AF-A0A261U359-F1-model_v4 Enoyl-CoA hydratase 0.9607 7 260
AF-A0A261SIX8-F1-model_v4 Enoyl-CoA hydratase 0.9602 6 258 GO:0006635
AF-A0A356HTY6-F1-model_v4 deleted 0.9576 49 255

Feature Viewer

pLDDT pTM Quality
89.77 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map