F486456

General Info

Members Datasets Scaffolds Average Seq Length
946 450 1892 132

Family's Representative Sequence

Representative Sequence 3300025272|Ga0209455_1003000|Ga0209455_10030007
Length 153
Sequence MMSVHAHITASAGRIQSHGGSLRFAPDARYRQAMTSDLLFVYGTLMRGFDHPMARLLAANADFISEASCRGRLYLVKHYPGLVLFRLREVDAMLREFDMYEACGEGFPEPTEYVRRQLAVTLADGSMRDAWTYLYNWSVDDLPRIASGRFLEH

Samples

Sample ID Description Type Environment
1 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
6 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
7 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
10 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
63 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
64 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
67 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
68 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
69 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
70 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
71 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
72 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
73 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
74 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
82 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
83 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
84 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
85 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
86 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
87 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
90 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
93 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
96 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
101 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
102 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
103 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
104 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
105 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
106 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
107 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
108 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
109 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
110 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
111 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
112 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
115 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
116 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
117 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
118 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
120 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
121 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
182 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
183 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
184 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
187 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
191 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
192 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
193 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
194 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
195 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
196 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
197 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
198 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
199 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
200 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
201 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
202 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
203 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
204 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
205 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
206 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
207 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
208 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
209 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
210 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
211 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
212 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
213 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
214 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
215 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
216 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
217 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
218 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
219 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
220 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
221 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
222 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
223 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
224 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
225 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
226 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
227 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
228 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
229 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
230 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
231 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
232 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
233 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
234 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
235 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
236 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
237 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
238 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
239 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
240 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
241 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
242 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
243 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
244 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
245 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
246 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
247 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
248 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
249 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
250 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
251 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
252 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
253 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
254 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
255 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
256 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
257 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
258 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
259 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
260 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
261 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
262 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
263 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
264 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
265 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
266 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
267 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
268 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
269 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
270 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
271 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
272 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
273 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
274 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
275 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
276 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
277 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
278 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
279 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
280 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
281 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
282 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
283 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
284 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
285 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
286 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
287 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
288 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
289 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
290 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
291 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
292 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
293 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
294 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
295 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
296 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
297 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
298 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
299 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
300 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
301 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
302 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
303 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
304 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
305 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
306 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
307 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
308 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
309 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
310 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
311 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
312 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
313 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
314 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
315 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
316 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
317 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
318 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
319 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
320 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
321 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
322 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
323 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
324 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
325 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
326 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
327 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
328 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
329 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
330 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
331 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
332 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
333 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
334 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
335 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
336 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
337 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
338 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
339 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
340 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
341 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
342 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
343 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
344 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
345 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
346 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
347 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
348 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
349 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
350 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
351 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
352 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
353 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
354 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
355 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
356 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
357 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
358 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
359 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
360 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
361 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
362 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
363 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
364 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
365 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
366 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
367 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
368 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
369 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
370 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
371 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
372 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
373 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
374 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
375 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
376 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
377 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
378 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
379 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
380 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
381 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
382 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
383 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
384 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
385 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
386 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
387 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
388 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
389 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
390 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
391 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
392 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
393 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
394 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
395 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
396 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
397 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
398 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
399 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
400 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
401 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
402 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
403 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
404 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
405 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
406 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
407 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
408 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
409 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
410 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
411 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
412 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
413 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
414 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
415 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
416 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
417 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
418 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
419 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
420 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
421 3300053112 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 endosphere Metagenome Endosphere
422 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
423 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
424 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
425 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
426 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
427 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
428 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
429 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
430 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
431 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
432 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
433 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
434 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
435 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
436 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
437 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
438 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
439 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
440 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
441 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
442 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
443 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
444 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
445 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
446 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
447 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
448 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
449 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
450 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.26
Metatranscriptomes 0.11
Isolates 0.63

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.31
Nodule 0.95
Rhizoplane 6.03
Rhizosphere 74
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0209455_1003000 3300025272 Bacteria 6199
2 JGI24740J21852_10007504 3300001979 Bacteria 4425
3 JGI24737J22298_10006778 3300001990 Bacteria 3891
4 JGI24738J21930_10016886 3300002075 Bacteria 1538
5 JGI24744J21845_10034538 3300002077 Bacteria 959
6 JGI24742J22300_10016342 3300002244 Bacteria 1252
7 JGI25406J46586_10000956 3300003203 Bacteria 13581
8 rootH1_10038988 3300003323 Bacteria 1920
9 JGI25404J52841_10003671 3300003659 Bacteria 3050
10 JGI25404J52841_10070669 3300003659 Bacteria 729
11 JGI25404J52841_10081077 3300003659 Bacteria 678
12 JGI25404J52841_10085617 3300003659 Bacteria 659
13 Ga0055539_1004922 3300003752 Bacteria 1758
14 Ga0070676_10114424 3300005328 Bacteria 1684
15 Ga0070676_10207713 3300005328 Bacteria 1287
16 Ga0070683_101213114 3300005329 Bacteria 725
17 Ga0070683_101842261 3300005329 Bacteria 581
18 Ga0070677_10586106 3300005333 Bacteria 616
19 Ga0068869_100018657 3300005334 Bacteria 4726
20 Ga0070680_100194286 3300005336 Bacteria 1710
21 Ga0070680_100875655 3300005336 Bacteria 774
22 Ga0070680_100941606 3300005336 Bacteria 745
23 Ga0068868_100450302 3300005338 Bacteria 1120
24 Ga0068868_100752924 3300005338 Bacteria 875
25 Ga0068868_100894101 3300005338 Bacteria 807
26 Ga0070660_100165206 3300005339 Bacteria 1785
27 Ga0070689_100141126 3300005340 Bacteria 1938
28 Ga0070689_100381639 3300005340 Bacteria 1188
29 Ga0070691_10493469 3300005341 Bacteria 707
30 Ga0070668_100107147 3300005347 Bacteria 2221
31 Ga0070668_100134320 3300005347 Bacteria 1988
32 Ga0070668_100136644 3300005347 Bacteria 1972
33 Ga0070668_100327291 3300005347 Bacteria 1291
34 Ga0070668_100370565 3300005347 Bacteria 1216
35 Ga0070668_100376387 3300005347 Bacteria 1207
36 Ga0070668_100447015 3300005347 Bacteria 1110
37 Ga0070669_100259747 3300005353 Bacteria 1386
38 Ga0070675_100171599 3300005354 Bacteria 1870
39 Ga0070674_100028523 3300005356 Bacteria 3667
40 Ga0070688_100079079 3300005365 Bacteria 2123
41 Ga0070688_100756760 3300005365 Bacteria 757
42 Ga0070659_100675857 3300005366 Bacteria 892
43 Ga0070667_100704448 3300005367 Bacteria 934
44 Ga0070667_100772038 3300005367 Bacteria 891
45 Ga0070667_102015315 3300005367 Bacteria 544
46 Ga0070714_100264434 3300005435 Bacteria 1594
47 Ga0070701_10069769 3300005438 Bacteria 1876
48 Ga0070711_100023363 3300005439 Bacteria 4019
49 Ga0070711_100471322 3300005439 Bacteria 1031
50 Ga0070694_100691614 3300005444 Bacteria 829
51 Ga0070663_100012138 3300005455 Bacteria 5437
52 Ga0070663_100035437 3300005455 Bacteria 3463
53 Ga0070663_100307132 3300005455 Bacteria 1271
54 Ga0070663_100310803 3300005455 Bacteria 1264
55 Ga0070678_100526600 3300005456 Bacteria 1046
56 Ga0070678_100672389 3300005456 Bacteria 930
57 Ga0070662_100014560 3300005457 Bacteria 5258
58 Ga0070662_100443906 3300005457 Bacteria 1076
59 Ga0070662_100559903 3300005457 Bacteria 959
60 Ga0070681_10117173 3300005458 Bacteria 2600
61 Ga0070681_10357152 3300005458 Bacteria 1371
62 Ga0070681_10385368 3300005458 Bacteria 1312
63 Ga0070681_10470440 3300005458 Bacteria 1169
64 Ga0070681_10917034 3300005458 Bacteria 795
65 Ga0070681_11330267 3300005458 Bacteria 641
66 Ga0070681_11397638 3300005458 Bacteria 623
67 Ga0068867_100509516 3300005459 Bacteria 1036
68 Ga0068867_100825937 3300005459 Bacteria 828
69 Ga0070685_10037284 3300005466 Bacteria 2753
70 Ga0070685_10712761 3300005466 Bacteria 733
71 Ga0070706_100127509 3300005467 Bacteria 2373
72 Ga0070698_100787651 3300005471 Bacteria 894
73 Ga0070699_101290466 3300005518 Bacteria 670
74 Ga0070679_100033018 3300005530 Bacteria 5122
75 Ga0070679_100090031 3300005530 Bacteria 3056
76 Ga0070679_100168109 3300005530 Bacteria 2166
77 Ga0070679_101058975 3300005530 Bacteria 755
78 Ga0070684_100002732 3300005535 Bacteria 13046
79 Ga0070684_100327575 3300005535 Bacteria 1407
80 Ga0070684_101536260 3300005535 Bacteria 628
81 Ga0070697_100584576 3300005536 Bacteria 981
82 Ga0068853_100020846 3300005539 Bacteria 5453
83 Ga0068853_100069457 3300005539 Bacteria 3064
84 Ga0068853_100082526 3300005539 Bacteria 2815
85 Ga0070696_101321432 3300005546 Bacteria 613
86 Ga0070665_100002394 3300005548 Bacteria 20689
87 Ga0070665_100005213 3300005548 Bacteria 13447
88 Ga0070665_100269421 3300005548 Bacteria 1704
89 Ga0070665_100721984 3300005548 Bacteria 1009
90 Ga0070665_101613230 3300005548 Bacteria 656
91 Ga0070665_101630821 3300005548 Bacteria 653
92 Ga0070665_101775003 3300005548 Bacteria 624
93 Ga0068855_100029025 3300005563 Bacteria 6616
94 Ga0068855_100054469 3300005563 Bacteria 4701
95 Ga0068855_100174563 3300005563 Bacteria 2432
96 Ga0068855_100254556 3300005563 Bacteria 1958
97 Ga0070664_100675305 3300005564 Bacteria 961
98 Ga0070664_100804598 3300005564 Bacteria 879
99 Ga0070664_100906766 3300005564 Bacteria 826
100 Ga0070664_101229753 3300005564 Bacteria 707
101 Ga0068857_100026813 3300005577 Bacteria 5080
102 Ga0068857_100063005 3300005577 Bacteria 3296
103 Ga0068854_100017345 3300005578 Bacteria 4817
104 Ga0068854_100033447 3300005578 Bacteria 3585
105 Ga0068854_101124485 3300005578 Bacteria 701
106 Ga0068856_100010975 3300005614 Bacteria 8795
107 Ga0068856_100031583 3300005614 Bacteria 5182
108 Ga0068856_100196810 3300005614 Bacteria 2029
109 Ga0070702_100266176 3300005615 Bacteria 1170
110 Ga0068852_100011898 3300005616 Bacteria 6581
111 Ga0068852_100119073 3300005616 Bacteria 2414
112 Ga0068852_100369521 3300005616 Bacteria 1405
113 Ga0068852_100395770 3300005616 Bacteria 1358
114 Ga0068852_101009414 3300005616 Bacteria 851
115 Ga0068859_100017410 3300005617 Bacteria 7221
116 Ga0068859_100560682 3300005617 Bacteria 1236
117 Ga0068864_100019927 3300005618 Bacteria 5607
118 Ga0068864_100706888 3300005618 Bacteria 985
119 Ga0068861_101227502 3300005719 Bacteria 726
120 Ga0068851_10000403 3300005834 Bacteria 19540
121 Ga0068851_10025246 3300005834 Bacteria 2914
122 Ga0068870_11006227 3300005840 Bacteria 595
123 Ga0068863_100764433 3300005841 Bacteria 963
124 Ga0068863_101420972 3300005841 Bacteria 702
125 Ga0068858_100007998 3300005842 Bacteria 10189
126 Ga0068858_100107479 3300005842 Bacteria 2604
127 Ga0068858_100155901 3300005842 Bacteria 2148
128 Ga0068858_100176894 3300005842 Bacteria 2014
129 Ga0068858_100614207 3300005842 Bacteria 1055
130 Ga0068858_101048155 3300005842 Bacteria 800
131 Ga0068858_101449369 3300005842 Bacteria 677
132 Ga0068860_100152128 3300005843 Bacteria 2228
133 Ga0068860_100219622 3300005843 Bacteria 1845
134 Ga0068860_100522922 3300005843 Bacteria 1186
135 Ga0068862_100228704 3300005844 Bacteria 1686
136 Ga0068862_101270213 3300005844 Bacteria 737
137 Ga0068862_102739439 3300005844 Bacteria 504
138 Ga0068862_102739440 3300005844 Bacteria 504
139 Ga0081455_10026317 3300005937 Bacteria 5354
140 Ga0081455_10035588 3300005937 Bacteria 4447
141 Ga0081455_10071617 3300005937 Bacteria 2873
142 Ga0081538_10038623 3300005981 Bacteria 3076
143 Ga0081540_1004293 3300005983 Bacteria 10919
144 Ga0081540_1005288 3300005983 Bacteria 9660
145 Ga0081540_1009614 3300005983 Bacteria 6650
146 Ga0081540_1018656 3300005983 Bacteria 4247
147 Ga0081540_1025191 3300005983 Bacteria 3431
148 Ga0081540_1082684 3300005983 Bacteria 1440
149 Ga0081540_1122422 3300005983 Bacteria 1077
150 Ga0081539_10001182 3300005985 Bacteria 47183
151 Ga0075365_10070950 3300006038 Bacteria 2344
152 Ga0075365_10427914 3300006038 Bacteria 935
153 Ga0075365_11122621 3300006038 Bacteria 553
154 Ga0075368_10018320 3300006042 Bacteria 2631
155 Ga0075368_10075241 3300006042 Bacteria 1369
156 Ga0075368_10103152 3300006042 Bacteria 1173
157 Ga0075368_10241313 3300006042 Bacteria 771
158 Ga0075363_100003500 3300006048 Bacteria 6686
159 Ga0075363_100571594 3300006048 Bacteria 676
160 Ga0075364_10092780 3300006051 Bacteria 2004
161 Ga0070712_100099670 3300006175 Bacteria 2145
162 Ga0070712_100495166 3300006175 Bacteria 1024
163 Ga0075362_10149549 3300006177 Bacteria 1120
164 Ga0075362_10368851 3300006177 Bacteria 721
165 Ga0075362_10462183 3300006177 Bacteria 646
166 Ga0075367_10008328 3300006178 Bacteria 5370
167 Ga0075367_10017360 3300006178 Bacteria 3949
168 Ga0075367_10077209 3300006178 Bacteria 2011
169 Ga0075367_10105429 3300006178 Bacteria 1726
170 Ga0075369_10123558 3300006186 Bacteria 1173
171 Ga0075366_10071521 3300006195 Bacteria 2066
172 Ga0075366_10206316 3300006195 Bacteria 1196
173 Ga0075366_10298482 3300006195 Bacteria 985
174 Ga0075366_10882939 3300006195 Bacteria 557
175 Ga0097621_100157741 3300006237 Bacteria 1949
176 Ga0097621_101063016 3300006237 Bacteria 759
177 Ga0075370_10017740 3300006353 Bacteria 3849
178 Ga0075370_10120759 3300006353 Bacteria 1525
179 Ga0075370_10196466 3300006353 Bacteria 1189
180 Ga0075428_100244669 3300006844 Bacteria 1935
181 Ga0075434_100086670 3300006871 Bacteria 3132
182 Ga0075434_101140749 3300006871 Bacteria 792
183 Ga0075434_102423048 3300006871 Bacteria 527
184 Ga0075436_100112638 3300006914 Bacteria 1900
185 Ga0075436_101209240 3300006914 Bacteria 570
186 Ga0097620_100017410 3300006931 Bacteria 7221
187 Ga0097620_100560685 3300006931 Bacteria 1236
188 Ga0099824_1021760 3300006942 Bacteria 4391
189 Ga0099822_1005624 3300006943 Bacteria 16355
190 Ga0075435_101482933 3300007076 Bacteria 595
191 Ga0099794_10017013 3300007265 Bacteria 3234
192 Ga0099794_10061337 3300007265 Bacteria 1827
193 Ga0099794_10166842 3300007265 Bacteria 1121
194 Ga0099794_10295284 3300007265 Bacteria 839
195 Ga0099795_10087520 3300007788 Bacteria 1202
196 Ga0099795_10090695 3300007788 Bacteria 1184
197 Ga0099795_10143857 3300007788 Bacteria 972
198 Ga0099795_10240080 3300007788 Bacteria 778
199 Ga0099795_10346109 3300007788 Bacteria 664
200 Ga0105240_10004842 3300009093 Bacteria 20284
201 Ga0105240_10068783 3300009093 Bacteria 4385
202 Ga0105240_10161440 3300009093 Bacteria 2661
203 Ga0111539_10964432 3300009094 Bacteria 991
204 Ga0111539_11526398 3300009094 Bacteria 775
205 Ga0105245_10029960 3300009098 Bacteria 4812
206 Ga0105245_11052101 3300009098 Bacteria 859
207 Ga0105245_11505708 3300009098 Bacteria 724
208 Ga0105247_10029834 3300009101 Bacteria 3306
209 Ga0105247_10163403 3300009101 Bacteria 1476
210 Ga0105247_10392042 3300009101 Bacteria 987
211 Ga0105247_11134489 3300009101 Bacteria 619
212 Ga0114129_10693999 3300009147 Bacteria 1309
213 Ga0114129_11586707 3300009147 Bacteria 802
214 Ga0114129_13369805 3300009147 Bacteria 515
215 Ga0105243_10056145 3300009148 Bacteria 3130
216 Ga0105243_10229673 3300009148 Bacteria 1645
217 Ga0105241_10001414 3300009174 Bacteria 18391
218 Ga0105241_10005266 3300009174 Bacteria 9554
219 Ga0105241_10686572 3300009174 Bacteria 933
220 Ga0105242_10366713 3300009176 Bacteria 1335
221 Ga0105242_10499240 3300009176 Bacteria 1157
222 Ga0105242_11894830 3300009176 Bacteria 636
223 Ga0105248_10039015 3300009177 Bacteria 5317
224 Ga0105248_10134904 3300009177 Bacteria 2785
225 Ga0105248_11648953 3300009177 Bacteria 727
226 Ga0105248_11784142 3300009177 Bacteria 698
227 Ga0105237_10039842 3300009545 Bacteria 4740
228 Ga0105237_10167517 3300009545 Bacteria 2196
229 Ga0105237_10177618 3300009545 Bacteria 2129
230 Ga0105237_10249867 3300009545 Bacteria 1775
231 Ga0105237_11468351 3300009545 Bacteria 688
232 Ga0105237_11737551 3300009545 Bacteria 631
233 Ga0105238_10003351 3300009551 Bacteria 15986
234 Ga0105238_10040294 3300009551 Bacteria 4734
235 Ga0105238_10045520 3300009551 Bacteria 4432
236 Ga0105238_10054116 3300009551 Bacteria 4032
237 Ga0105238_10876428 3300009551 Bacteria 915
238 Ga0105238_12323608 3300009551 Bacteria 571
239 Ga0105249_10191179 3300009553 Bacteria 1998
240 Ga0099796_10144493 3300010159 Bacteria 932
241 Ga0105239_10025763 3300010375 Bacteria 6477
242 Ga0105239_10025860 3300010375 Bacteria 6465
243 Ga0105239_10044086 3300010375 Bacteria 4889
244 Ga0105239_10189157 3300010375 Bacteria 2304
245 Ga0105239_10745550 3300010375 Bacteria 1121
246 Ga0105239_10793620 3300010375 Bacteria 1085
247 Ga0105239_11922797 3300010375 Bacteria 686
248 Ga0105246_10007720 3300011119 Bacteria 6600
249 Ga0157316_1019030 3300012510 Bacteria 732
250 Ga0157371_10213067 3300013102 Bacteria 1386
251 Ga0157370_10055928 3300013104 Bacteria 3756
252 Ga0157370_10950941 3300013104 Bacteria 779
253 Ga0157369_10076057 3300013105 Bacteria 3599
254 Ga0157369_10085372 3300013105 Bacteria 3373
255 Ga0157369_11111955 3300013105 Bacteria 808
256 Ga0157369_11878731 3300013105 Bacteria 608
257 Ga0157374_11734617 3300013296 Bacteria 649
258 Ga0157378_10002606 3300013297 Bacteria 16048
259 Ga0157378_11050013 3300013297 Bacteria 850
260 Ga0157378_11753442 3300013297 Bacteria 668
261 Ga0157378_12006647 3300013297 Bacteria 628
262 Ga0163162_10244401 3300013306 Bacteria 1926
263 Ga0163162_10807910 3300013306 Bacteria 1055
264 Ga0163162_10881717 3300013306 Bacteria 1009
265 Ga0163162_11879372 3300013306 Bacteria 685
266 Ga0157372_10154049 3300013307 Bacteria 2654
267 Ga0157372_10957403 3300013307 Bacteria 992
268 Ga0157372_12016687 3300013307 Bacteria 663
269 Ga0157375_10393063 3300013308 Bacteria 1553
270 Ga0157375_10620944 3300013308 Bacteria 1239
271 Ga0157375_10909717 3300013308 Bacteria 1023
272 Ga0163163_10007726 3300014325 Bacteria 9499
273 Ga0163163_10310213 3300014325 Bacteria 1630
274 Ga0163163_10329233 3300014325 Bacteria 1582
275 Ga0163163_11048232 3300014325 Bacteria 879
276 Ga0157380_11157059 3300014326 Bacteria 815
277 Ga0157380_11971940 3300014326 Bacteria 645
278 Ga0157377_10213064 3300014745 Bacteria 1233
279 Ga0157379_10149247 3300014968 Bacteria 2109
280 Ga0157379_10176913 3300014968 Bacteria 1927
281 Ga0157376_10122270 3300014969 Bacteria 2309
282 Ga0157376_10197254 3300014969 Bacteria 1850
283 Ga0157376_10668822 3300014969 Bacteria 1041
284 Ga0163161_10182604 3300017792 Bacteria 1609
285 Ga0163161_10367312 3300017792 Bacteria 1147
286 Ga0213872_10154075 3300021361 Bacteria 1003
287 Ga0213876_10018004 3300021384 Bacteria 3727
288 Ga0209677_100740 3300025253 Bacteria 16584
289 Ga0209233_1001693 3300025261 Bacteria 8557
290 Ga0209233_1007637 3300025261 Bacteria 3408
291 Ga0209758_1086475 3300025297 Bacteria 931
292 Ga0207656_10001759 3300025321 Bacteria 7211
293 Ga0207653_10310484 3300025885 Bacteria 612
294 Ga0207682_10079391 3300025893 Bacteria 1403
295 Ga0207682_10237661 3300025893 Bacteria 846
296 Ga0207642_10107535 3300025899 Bacteria 1413
297 Ga0207642_10290539 3300025899 Bacteria 944
298 Ga0207710_10071082 3300025900 Bacteria 1596
299 Ga0207710_10375419 3300025900 Bacteria 727
300 Ga0207688_10005613 3300025901 Bacteria 6820
301 Ga0207680_10052456 3300025903 Bacteria 2444
302 Ga0207647_10001152 3300025904 Bacteria 20358
303 Ga0207647_10342165 3300025904 Bacteria 848
304 Ga0207685_10208187 3300025905 Bacteria 923
305 Ga0207699_10045165 3300025906 Bacteria 2570
306 Ga0207699_10487033 3300025906 Bacteria 889
307 Ga0207699_10601896 3300025906 Bacteria 800
308 Ga0207645_10042112 3300025907 Bacteria 2922
309 Ga0207645_10134674 3300025907 Bacteria 1609
310 Ga0207645_10558878 3300025907 Bacteria 776
311 Ga0207643_10737152 3300025908 Bacteria 638
312 Ga0207643_10823352 3300025908 Bacteria 602
313 Ga0207643_10896376 3300025908 Bacteria 575
314 Ga0207705_10098865 3300025909 Bacteria 2144
315 Ga0207705_10653700 3300025909 Bacteria 817
316 Ga0207684_10240599 3300025910 Bacteria 1561
317 Ga0207684_10938785 3300025910 Bacteria 726
318 Ga0207654_10000303 3300025911 Bacteria 30000
319 Ga0207654_10016251 3300025911 Bacteria 3872
320 Ga0207654_10651408 3300025911 Bacteria 754
321 Ga0207707_10020923 3300025912 Bacteria 5715
322 Ga0207707_10106738 3300025912 Bacteria 2448
323 Ga0207695_10000430 3300025913 Bacteria 92372
324 Ga0207695_10122330 3300025913 Bacteria 2569
325 Ga0207695_10273769 3300025913 Bacteria 1583
326 Ga0207695_11282202 3300025913 Bacteria 613
327 Ga0207671_10016753 3300025914 Bacteria 5684
328 Ga0207671_10058733 3300025914 Bacteria 2852
329 Ga0207671_10147864 3300025914 Bacteria 1814
330 Ga0207671_10742771 3300025914 Bacteria 780
331 Ga0207693_10097036 3300025915 Bacteria 2311
332 Ga0207693_10302534 3300025915 Bacteria 1253
333 Ga0207663_10030206 3300025916 Bacteria 3193
334 Ga0207660_10066037 3300025917 Bacteria 2616
335 Ga0207660_10118700 3300025917 Bacteria 2001
336 Ga0207657_10021413 3300025919 Bacteria 6084
337 Ga0207657_11056205 3300025919 Bacteria 622
338 Ga0207652_10070496 3300025921 Bacteria 3036
339 Ga0207652_10116582 3300025921 Bacteria 2373
340 Ga0207652_11404054 3300025921 Bacteria 602
341 Ga0207681_11294850 3300025923 Bacteria 612
342 Ga0207694_10000183 3300025924 Bacteria 64696
343 Ga0207694_10050840 3300025924 Bacteria 3212
344 Ga0207694_11321190 3300025924 Bacteria 610
345 Ga0207650_10050504 3300025925 Bacteria 3076
346 Ga0207650_11172316 3300025925 Bacteria 654
347 Ga0207659_10180253 3300025926 Bacteria 1673
348 Ga0207687_10032471 3300025927 Bacteria 3536
349 Ga0207687_10142616 3300025927 Bacteria 1819
350 Ga0207664_10109944 3300025929 Bacteria 2291
351 Ga0207664_11415038 3300025929 Bacteria 616
352 Ga0207644_10281859 3300025931 Bacteria 1334
353 Ga0207644_10341843 3300025931 Bacteria 1214
354 Ga0207644_10486226 3300025931 Bacteria 1017
355 Ga0207644_11401294 3300025931 Bacteria 587
356 Ga0207690_10085694 3300025932 Bacteria 2212
357 Ga0207690_10201128 3300025932 Bacteria 1513
358 Ga0207690_10652469 3300025932 Bacteria 862
359 Ga0207706_10014567 3300025933 Bacteria 7124
360 Ga0207706_10108760 3300025933 Bacteria 2439
361 Ga0207706_10444488 3300025933 Bacteria 1122
362 Ga0207686_10268276 3300025934 Bacteria 1254
363 Ga0207709_10091077 3300025935 Bacteria 1993
364 Ga0207670_10417332 3300025936 Bacteria 1076
365 Ga0207669_10003952 3300025937 Bacteria 6468
366 Ga0207669_10732098 3300025937 Bacteria 815
367 Ga0207704_10044473 3300025938 Bacteria 2631
368 Ga0207704_10741386 3300025938 Bacteria 816
369 Ga0207691_10327491 3300025940 Bacteria 1313
370 Ga0207711_10287083 3300025941 Bacteria 1516
371 Ga0207711_11525873 3300025941 Bacteria 611
372 Ga0207689_10007618 3300025942 Bacteria 9483
373 Ga0207689_10029218 3300025942 Bacteria 4606
374 Ga0207689_10081909 3300025942 Bacteria 2653
375 Ga0207661_10088320 3300025944 Bacteria 2576
376 Ga0207661_10976717 3300025944 Bacteria 780
377 Ga0207679_10420298 3300025945 Bacteria 1180
378 Ga0207679_10434834 3300025945 Bacteria 1161
379 Ga0207679_10713968 3300025945 Bacteria 910
380 Ga0207667_10008851 3300025949 Bacteria 11914
381 Ga0207667_10048202 3300025949 Bacteria 4505
382 Ga0207667_10049954 3300025949 Bacteria 4414
383 Ga0207667_10932561 3300025949 Bacteria 859
384 Ga0207667_11316288 3300025949 Bacteria 698
385 Ga0207667_11682603 3300025949 Bacteria 601
386 Ga0207712_10079020 3300025961 Bacteria 2389
387 Ga0207712_10118653 3300025961 Bacteria 1998
388 Ga0207668_10195524 3300025972 Bacteria 1606
389 Ga0207668_10337287 3300025972 Bacteria 1256
390 Ga0207668_11157712 3300025972 Bacteria 694
391 Ga0207640_10363396 3300025981 Bacteria 1167
392 Ga0207640_10409714 3300025981 Bacteria 1106
393 Ga0207640_10996268 3300025981 Bacteria 737
394 Ga0207658_10111105 3300025986 Bacteria 2167
395 Ga0207658_10839033 3300025986 Bacteria 835
396 Ga0207658_12055542 3300025986 Bacteria 519
397 Ga0207677_10808170 3300026023 Bacteria 840
398 Ga0207677_10848736 3300026023 Bacteria 820
399 Ga0207677_11086719 3300026023 Bacteria 729
400 Ga0207703_10006563 3300026035 Bacteria 9281
401 Ga0207703_10201715 3300026035 Bacteria 1768
402 Ga0207703_10235392 3300026035 Bacteria 1644
403 Ga0207703_11249855 3300026035 Bacteria 714
404 Ga0207639_10007256 3300026041 Bacteria 7553
405 Ga0207639_10370320 3300026041 Bacteria 1284
406 Ga0207639_10500110 3300026041 Bacteria 1110
407 Ga0207639_10862032 3300026041 Bacteria 846
408 Ga0207678_10091211 3300026067 Bacteria 2604
409 Ga0207678_10105055 3300026067 Bacteria 2410
410 Ga0207678_10170006 3300026067 Bacteria 1861
411 Ga0207678_10345188 3300026067 Bacteria 1283
412 Ga0207678_10393092 3300026067 Bacteria 1200
413 Ga0207678_10670843 3300026067 Bacteria 911
414 Ga0207678_10829086 3300026067 Bacteria 817
415 Ga0207678_11282962 3300026067 Bacteria 648
416 Ga0207678_11283048 3300026067 Bacteria 648
417 Ga0207678_11541164 3300026067 Bacteria 586
418 Ga0207708_10117108 3300026075 Bacteria 2073
419 Ga0207702_10000006 3300026078 Bacteria 346370
420 Ga0207702_10008332 3300026078 Bacteria 8751
421 Ga0207702_10222400 3300026078 Bacteria 1759
422 Ga0207702_10415875 3300026078 Bacteria 1299
423 Ga0207702_10714012 3300026078 Bacteria 988
424 Ga0207641_10144496 3300026088 Bacteria 2150
425 Ga0207648_10029907 3300026089 Bacteria 4830
426 Ga0207648_10080640 3300026089 Bacteria 2839
427 Ga0207648_11338143 3300026089 Bacteria 673
428 Ga0207648_11341738 3300026089 Bacteria 672
429 Ga0207676_11090952 3300026095 Bacteria 789
430 Ga0207674_10014170 3300026116 Bacteria 8812
431 Ga0207674_10023755 3300026116 Bacteria 6561
432 Ga0207674_10059205 3300026116 Bacteria 3877
433 Ga0207674_10095997 3300026116 Bacteria 2950
434 Ga0207674_10109680 3300026116 Bacteria 2736
435 Ga0207675_100042611 3300026118 Bacteria 4238
436 Ga0207675_100257993 3300026118 Bacteria 1689
437 Ga0207675_100315279 3300026118 Bacteria 1526
438 Ga0207675_100455007 3300026118 Bacteria 1269
439 Ga0207683_10154618 3300026121 Bacteria 2071
440 Ga0207683_10385726 3300026121 Bacteria 1288
441 Ga0207683_10408003 3300026121 Bacteria 1250
442 Ga0207683_10685161 3300026121 Bacteria 950
443 Ga0207683_11306820 3300026121 Bacteria 671
444 Ga0207698_10074157 3300026142 Bacteria 2713
445 Ga0207698_10092547 3300026142 Bacteria 2479
446 Ga0207698_10362167 3300026142 Bacteria 1374
447 Ga0209589_1000007 3300027357 Bacteria 425699
448 Ga0209489_100008 3300027361 Bacteria 425699
449 Ga0209700_100009 3300027363 Bacteria 425699
450 Ga0209179_1025881 3300027512 Bacteria 1173
451 Ga0209588_1007152 3300027671 Bacteria 3272
452 Ga0209588_1103705 3300027671 Bacteria 914
453 Ga0209813_10048738 3300027866 Bacteria 1316
454 Ga0209813_10076396 3300027866 Bacteria 1099
455 Ga0268266_10001169 3300028379 Bacteria 32459
456 Ga0268266_10004410 3300028379 Bacteria 13483
457 Ga0268266_10128610 3300028379 Bacteria 2263
458 Ga0268266_10187688 3300028379 Bacteria 1886
459 Ga0268266_10423045 3300028379 Bacteria 1262
460 Ga0268266_10650406 3300028379 Bacteria 1014
461 Ga0268266_11429858 3300028379 Bacteria 667
462 Ga0268265_10166656 3300028380 Bacteria 1878
463 Ga0268265_10201606 3300028380 Bacteria 1726
464 Ga0268265_10504698 3300028380 Bacteria 1140
465 Ga0268265_10764737 3300028380 Bacteria 939
466 Ga0268264_10266929 3300028381 Bacteria 1597
467 Ga0268264_10984873 3300028381 Bacteria 849
468 Ga0268264_11110664 3300028381 Bacteria 799
469 Ga0307517_10000196 3300028786 Bacteria 102384
470 Ga0307515_10313659 3300028794 Bacteria 1241
471 Ga0307515_10331623 3300028794 Bacteria 1180
472 Ga0265338_10766228 3300028800 Bacteria 663
473 Ga0307511_10246706 3300030521 Bacteria 863
474 Ga0265339_10008955 3300031249 Bacteria 6331
475 Ga0307513_10259903 3300031456 Bacteria 1526
476 Ga0307513_10841790 3300031456 Bacteria 624
477 Ga0307513_11082275 3300031456 Bacteria 513
478 Ga0307509_10058650 3300031507 Bacteria 4075
479 Ga0307509_10226911 3300031507 Bacteria 1674
480 Ga0307509_10666021 3300031507 Bacteria 709
481 Ga0307408_100440679 3300031548 Bacteria 1128
482 Ga0307408_100451018 3300031548 Bacteria 1116
483 Ga0307408_101626484 3300031548 Bacteria 614
484 Ga0307408_101708435 3300031548 Bacteria 600
485 Ga0307508_10062370 3300031616 Bacteria 3291
486 Ga0307508_10363116 3300031616 Bacteria 1039
487 Ga0307508_10599783 3300031616 Bacteria 703
488 Ga0265314_10012750 3300031711 Bacteria 6832
489 Ga0265314_10058077 3300031711 Bacteria 2653
490 Ga0307516_10017558 3300031730 Bacteria 7457
491 Ga0307516_10298240 3300031730 Bacteria 1288
492 Ga0307516_10802633 3300031730 Bacteria 603
493 Ga0307405_10843211 3300031731 Bacteria 771
494 Ga0307413_10179663 3300031824 Bacteria 1507
495 Ga0307413_11441240 3300031824 Bacteria 607
496 Ga0307410_10111654 3300031852 Bacteria 1979
497 Ga0307410_10484838 3300031852 Bacteria 1015
498 Ga0307410_11319726 3300031852 Bacteria 631
499 Ga0307406_11038588 3300031901 Bacteria 705
500 Ga0307406_11358640 3300031901 Bacteria 622
501 Ga0307406_11713345 3300031901 Bacteria 557
502 Ga0307412_10521727 3300031911 Bacteria 993
503 Ga0307412_10539200 3300031911 Bacteria 978
504 Ga0307416_100842317 3300032002 Bacteria 1015
505 Ga0307414_10147924 3300032004 Bacteria 1849
506 Ga0307411_10291364 3300032005 Bacteria 1304
507 Ga0307415_100937520 3300032126 Bacteria 800
508 Ga0307507_10034314 3300033179 Bacteria 5244
509 Ga0307510_10068345 3300033180 Bacteria 3566
510 Ga0307510_10292492 3300033180 Bacteria 1094
511 Ga0307510_10651431 3300033180 Bacteria 511
512 Ga0373959_0016194 3300034820 Bacteria 1379
513 Ga0373926_0032374 3300035083 Bacteria 1845
514 Ga0373928_0069269 3300035084 Bacteria 869
515 Ga0373928_0111584 3300035084 Bacteria 724
516 Ga0373944_0016229 3300035089 Bacteria 2097
517 Ga0373952_0060205 3300035092 Bacteria 927
518 Ga0373939_0312041 3300035114 Bacteria 630
519 Ga0373941_0103406 3300035115 Bacteria 995
520 Ga0373945_0178017 3300035116 Bacteria 874
521 Ga0373954_0047624 3300035118 Bacteria 2007
522 Ga0373956_0115320 3300035119 Bacteria 1252
523 Ga0373956_0144456 3300035119 Bacteria 1118
524 Ga0373960_0124288 3300035121 Bacteria 859
525 Ga0373955_0038779 3300035172 Bacteria 2540
526 Ga0373955_0869487 3300035172 Bacteria 554
527 Ga0373924_0022689 3300035410 Bacteria 2455
528 Ga0373924_0316214 3300035410 Bacteria 694
529 Ga0373931_0001507 3300035691 Bacteria 10029
530 Ga0373931_0717719 3300035691 Bacteria 661
531 Ga0373935_0058156 3300035692 Bacteria 2469
532 Ga0373935_0169561 3300035692 Bacteria 1492
533 Ga0373935_0422697 3300035692 Bacteria 959
534 Ga0373927_0022900 3300035695 Bacteria 4092
535 Ga0373927_0040140 3300035695 Bacteria 3037
536 Ga0373927_0270038 3300035695 Bacteria 1118
537 Ga0373927_0452191 3300035695 Bacteria 848
538 Ga0373933_0000127 3300035724 Bacteria 48988
539 Ga0373933_0231209 3300035724 Bacteria 1188
540 Ga0373947_0074998 3300035725 Bacteria 2082
541 Ga0372808_024360 3300036459 Bacteria 868
542 Ga0373925_0214042 3300037068 Bacteria 1536
543 Ga0373925_0266020 3300037068 Bacteria 1378
544 Ga0373925_0404684 3300037068 Bacteria 1113
545 Ga0395899_0362000 3300037312 Bacteria 968
546 Ga0395900_0098922 3300037418 Bacteria 2997
547 Ga0395900_0180907 3300037418 Bacteria 2142
548 Ga0395898_0564554 3300037466 Bacteria 1080
549 Ga0395905_0273824 3300037471 Bacteria 1574
550 Ga0395905_0449342 3300037471 Bacteria 1187
551 Ga0436364_0617263 3300037853 Bacteria 927
552 Ga0395901_0146055 3300038443 Bacteria 2486
553 Ga0436365_0070478 3300039437 Bacteria 3097
554 Ga0436365_0232459 3300039437 Bacteria 11864
555 Ga0436365_1733827 3300039437 Bacteria 505
556 Ga0436360_0030458 3300039438 Bacteria 2142
557 Ga0436360_0603876 3300039438 Bacteria 518
558 Ga0436360_1347898 3300039438 Bacteria 938
559 Ga0436361_0173867 3300039447 Bacteria 585
560 Ga0436361_0515155 3300039447 Bacteria 1800
561 Ga0436361_1010144 3300039447 Bacteria 523
562 Ga0436361_1163158 3300039447 Bacteria 2422
563 Ga0436363_0416978 3300039450 Bacteria 653
564 Ga0439466_0198615 3300041411 Bacteria 610
565 Ga0439465_0282000 3300041413 Bacteria 619
566 Ga0451787_639311 3300041441 Bacteria 558
567 Ga0451791_0214399 3300041451 Bacteria 793
568 Ga0451793_0861193 3300041452 Bacteria 1071
569 Ga0451800_1596037 3300041459 Bacteria 682
570 Ga0451807_1871645 3300041486 Bacteria 589
571 Ga0451839_1579377 3300041496 Bacteria 663
572 Ga0451843_0852966 3300041509 Bacteria 511
573 Ga0451853_0619022 3300041512 Bacteria 794
574 Ga0451853_3538731 3300041512 Bacteria 551
575 Ga0439431_0090641 3300041997 Bacteria 833
576 Ga0439448_0157866 3300042005 Bacteria 789
577 Ga0439459_0239788 3300042438 Bacteria 509
578 Ga0466963_0043252 3300044694 Bacteria 2961
579 Ga0466963_0197475 3300044694 Bacteria 1407
580 Ga0466964_0839787 3300044706 Bacteria 522
581 Ga0466971_0183154 3300044719 Bacteria 985
582 Ga0466957_0492247 3300044842 Bacteria 849
583 Ga0466959_0181574 3300045049 Bacteria 1471
584 Ga0466959_0812881 3300045049 Bacteria 625
585 Ga0466967_0869336 3300045976 Bacteria 896
586 Ga0466967_1029171 3300045976 Bacteria 820
587 Ga0466967_1759153 3300045976 Bacteria 617
588 Ga0495617_056540 3300046452 Bacteria 1301
589 Ga0495592_0659867 3300046454 Bacteria 633
590 Ga0495603_0002225 3300046455 Bacteria 11403
591 Ga0495603_0063846 3300046455 Bacteria 2172
592 Ga0495603_0111043 3300046455 Bacteria 1599
593 Ga0495603_0276620 3300046455 Bacteria 965
594 Ga0495603_0428118 3300046455 Bacteria 758
595 Ga0495629_0047705 3300046459 Bacteria 3004
596 Ga0495638_0170513 3300046460 Bacteria 1249
597 Ga0495638_0173453 3300046460 Bacteria 1236
598 Ga0495651_0113225 3300046462 Bacteria 2003
599 Ga0495653_0573918 3300046463 Bacteria 696
600 Ga0495580_0081569 3300046472 Bacteria 2254
601 Ga0495580_0235505 3300046472 Bacteria 1256
602 Ga0495580_0261704 3300046472 Bacteria 1183
603 Ga0495582_0001981 3300046473 Bacteria 11486
604 Ga0495605_0185075 3300046474 Bacteria 914
605 Ga0495639_0015180 3300046475 Bacteria 3338
606 Ga0495639_0016962 3300046475 Bacteria 3162
607 Ga0495664_0057297 3300046477 Bacteria 2318
608 Ga0495664_0058557 3300046477 Bacteria 2292
609 Ga0495664_0476837 3300046477 Bacteria 746
610 Ga0495664_0656294 3300046477 Bacteria 621
611 Ga0495584_0112577 3300046491 Bacteria 1377
612 Ga0495584_0154916 3300046491 Bacteria 1164
613 Ga0495584_0269377 3300046491 Bacteria 866
614 Ga0495584_0288033 3300046491 Bacteria 834
615 Ga0495584_0317247 3300046491 Bacteria 791
616 Ga0495585_0132887 3300046492 Bacteria 1308
617 Ga0495585_0159836 3300046492 Bacteria 1170
618 Ga0495585_0210289 3300046492 Bacteria 986
619 Ga0495594_0015789 3300046499 Bacteria 3971
620 Ga0495594_0141800 3300046499 Bacteria 1363
621 Ga0495596_0194619 3300046500 Bacteria 788
622 Ga0495607_0077511 3300046501 Bacteria 1836
623 Ga0495606_0205701 3300046507 Bacteria 1119
624 Ga0495606_0254588 3300046507 Bacteria 972
625 Ga0495616_0166872 3300046513 Bacteria 987
626 Ga0495616_0290212 3300046513 Bacteria 693
627 Ga0495618_0008061 3300046514 Bacteria 6378
628 Ga0495620_0204749 3300046515 Bacteria 758
629 Ga0495628_0859018 3300046516 Bacteria 632
630 Ga0495632_0087390 3300046519 Bacteria 1482
631 Ga0495632_0173562 3300046519 Bacteria 989
632 Ga0495643_0467139 3300046522 Bacteria 547
633 Ga0495644_0051745 3300046523 Bacteria 1542
634 Ga0495644_0123022 3300046523 Bacteria 987
635 Ga0495644_0211181 3300046523 Bacteria 749
636 Ga0495644_0354152 3300046523 Bacteria 578
637 Ga0495648_0385208 3300046524 Bacteria 631
638 Ga0495663_0036657 3300046525 Bacteria 1477
639 Ga0495666_0027831 3300046526 Bacteria 2782
640 Ga0495666_0267491 3300046526 Bacteria 777
641 Ga0495642_0160810 3300046528 Bacteria 974
642 Ga0495652_0310644 3300046529 Bacteria 1142
643 Ga0495652_0618198 3300046529 Bacteria 737
644 Ga0495654_0447354 3300046530 Bacteria 509
645 Ga0495665_0018879 3300046531 Bacteria 3705
646 Ga0495665_0246262 3300046531 Bacteria 921
647 Ga0495665_0270421 3300046531 Bacteria 873
648 Ga0495640_0086162 3300046533 Bacteria 2080
649 Ga0495640_0109487 3300046533 Bacteria 1806
650 Ga0495586_0107736 3300046535 Bacteria 1550
651 Ga0495586_0221906 3300046535 Bacteria 1074
652 Ga0495586_0703636 3300046535 Bacteria 583
653 Ga0495587_0463606 3300046536 Bacteria 701
654 Ga0495598_0021419 3300046537 Bacteria 1719
655 Ga0495598_0031095 3300046537 Bacteria 1500
656 Ga0495621_0027019 3300046539 Bacteria 1940
657 Ga0495645_0256998 3300046543 Bacteria 1158
658 Ga0495622_0022028 3300046557 Bacteria 2969
659 Ga0495622_0023913 3300046557 Bacteria 2851
660 Ga0495622_0054519 3300046557 Bacteria 1855
661 Ga0495622_0403098 3300046557 Bacteria 589
662 Ga0495633_0047706 3300046558 Bacteria 2024
663 Ga0495633_0215568 3300046558 Bacteria 879
664 Ga0495667_0237822 3300046559 Bacteria 1160
665 Ga0495656_0056279 3300046615 Bacteria 1699
666 Ga0495656_0107919 3300046615 Bacteria 1297
667 Ga0495656_0136116 3300046615 Bacteria 1173
668 Ga0495656_0141225 3300046615 Bacteria 1155
669 Ga0495656_0177399 3300046615 Bacteria 1045
670 Ga0495656_0281265 3300046615 Bacteria 848
671 Ga0495668_0098495 3300046616 Bacteria 1600
672 Ga0495668_0175188 3300046616 Bacteria 1175
673 Ga0495634_0045652 3300046642 Bacteria 2961
674 Ga0495611_0097279 3300046648 Bacteria 1364
675 Ga0495625_0446907 3300046660 Bacteria 799
676 Ga0495625_0554312 3300046660 Bacteria 696
677 Ga0495625_0596430 3300046660 Bacteria 664
678 Ga0495625_0856628 3300046660 Bacteria 524
679 Ga0495635_0057480 3300046663 Bacteria 2676
680 Ga0495635_0428759 3300046663 Bacteria 876
681 Ga0495659_0082134 3300046664 Bacteria 1224
682 Ga0495659_0115177 3300046664 Bacteria 1053
683 Ga0495659_0333850 3300046664 Bacteria 645
684 Ga0495588_0177619 3300046674 Bacteria 1125
685 Ga0495588_0189120 3300046674 Bacteria 1087
686 Ga0495588_0244197 3300046674 Bacteria 947
687 Ga0495657_0172439 3300046675 Bacteria 1331
688 Ga0495599_0397633 3300046678 Bacteria 821
689 Ga0495623_0180206 3300046679 Bacteria 1228
690 Ga0495646_0072828 3300046680 Bacteria 2020
691 Ga0495646_0095456 3300046680 Bacteria 1711
692 Ga0495647_0012829 3300046681 Bacteria 2891
693 Ga0495647_0137405 3300046681 Bacteria 1040
694 Ga0495647_0434925 3300046681 Bacteria 606
695 Ga0495669_0011460 3300046684 Bacteria 3764
696 Ga0495669_0065479 3300046684 Bacteria 1650
697 Ga0495613_0557147 3300046689 Bacteria 766
698 Ga0495624_0147682 3300046690 Bacteria 1438
699 Ga0495670_0072948 3300046691 Bacteria 1739
700 Ga0495671_0410843 3300046692 Bacteria 648
701 Ga0495649_0167243 3300046694 Bacteria 1152
702 Ga0495589_0105453 3300046794 Bacteria 1362
703 Ga0495600_0513426 3300046809 Bacteria 735
704 Ga0495660_0155290 3300046810 Bacteria 1127
705 Ga0495581_0038654 3300047315 Bacteria 2762
706 Ga0495581_0080059 3300047315 Bacteria 1890
707 Ga0495604_0395137 3300047317 Bacteria 911
708 Ga0495636_0147342 3300047318 Bacteria 1054
709 Ga0495674_0075474 3300047319 Bacteria 2901
710 Ga0495674_0253762 3300047319 Bacteria 1447
711 Ga0495674_0966025 3300047319 Bacteria 655
712 Ga0495674_1131574 3300047319 Bacteria 595
713 Ga0495676_0087701 3300047321 Bacteria 2337
714 Ga0495676_0297801 3300047321 Bacteria 1088
715 Ga0495676_0919691 3300047321 Bacteria 560
716 Ga0495683_0083150 3300047323 Bacteria 1559
717 Ga0495675_0040682 3300047444 Bacteria 2962
718 Ga0495675_0580374 3300047444 Bacteria 637
719 Ga0495677_0133337 3300047445 Bacteria 951
720 Ga0495685_304580 3300047447 Bacteria 500
721 Ga0495673_0128905 3300047469 Bacteria 996
722 Ga0495673_0223408 3300047469 Bacteria 696
723 Ga0495684_0188431 3300047471 Bacteria 1526
724 Ga0495684_0685016 3300047471 Bacteria 682
725 Ga0495686_0679148 3300047472 Bacteria 527
726 Ga0495614_0309967 3300048089 Bacteria 731
727 Ga0495615_0020007 3300048090 Bacteria 1494
728 Ga0496100_0110588 3300048903 Bacteria 1908
729 Ga0496100_0483831 3300048903 Bacteria 952
730 Ga0496100_1686253 3300048903 Bacteria 501
731 Ga0496101_0085992 3300048904 Bacteria 2331
732 Ga0496101_0277556 3300048904 Bacteria 1309
733 Ga0496101_0622234 3300048904 Bacteria 853
734 Ga0496102_0109788 3300048905 Bacteria 2571
735 Ga0496102_0114415 3300048905 Bacteria 2517
736 Ga0496102_0147891 3300048905 Bacteria 2206
737 Ga0496102_0266646 3300048905 Bacteria 1614
738 Ga0496102_0511368 3300048905 Bacteria 1123
739 Ga0496102_0590674 3300048905 Bacteria 1033
740 Ga0496102_0642027 3300048905 Bacteria 985
741 Ga0496103_0347390 3300048906 Bacteria 954
742 Ga0496103_0770067 3300048906 Bacteria 608
743 Ga0496103_0947906 3300048906 Bacteria 538
744 Ga0496104_0239530 3300048907 Bacteria 1726
745 Ga0496104_0507226 3300048907 Bacteria 1117
746 Ga0496105_0184845 3300048908 Bacteria 1706
747 Ga0496106_0000590 3300048909 Bacteria 25948
748 Ga0496106_0101921 3300048909 Bacteria 2227
749 Ga0496106_0292425 3300048909 Bacteria 1306
750 Ga0496106_0356515 3300048909 Bacteria 1175
751 Ga0496107_0010715 3300048910 Bacteria 6376
752 Ga0496107_0182159 3300048910 Bacteria 1560
753 Ga0496107_0280753 3300048910 Bacteria 1240
754 Ga0496107_0467597 3300048910 Bacteria 936
755 Ga0496107_0843351 3300048910 Bacteria 670
756 Ga0496108_0160930 3300048911 Bacteria 1940
757 Ga0496108_0661806 3300048911 Bacteria 907
758 Ga0496109_0154202 3300048912 Bacteria 2151
759 Ga0496109_0293108 3300048912 Bacteria 1534
760 Ga0496109_0446660 3300048912 Bacteria 1221
761 Ga0496110_0418282 3300048913 Bacteria 1222
762 Ga0496110_0499728 3300048913 Bacteria 1107
763 Ga0496110_0547990 3300048913 Bacteria 1051
764 Ga0496110_1050933 3300048913 Bacteria 722
765 Ga0496111_0211997 3300048914 Bacteria 1439
766 Ga0496111_0230976 3300048914 Bacteria 1374
767 Ga0496111_0695762 3300048914 Bacteria 740
768 Ga0496112_0386236 3300048915 Bacteria 1341
769 Ga0496112_1905028 3300048915 Bacteria 506
770 Ga0496113_0059717 3300048916 Bacteria 2873
771 Ga0496113_0463409 3300048916 Bacteria 1018
772 Ga0496114_0046729 3300048917 Bacteria 3598
773 Ga0496114_1046545 3300048917 Bacteria 700
774 Ga0496115_0119240 3300048918 Bacteria 2170
775 Ga0496115_0142482 3300048918 Bacteria 1978
776 Ga0496115_0284032 3300048918 Bacteria 1358
777 Ga0496115_0718262 3300048918 Bacteria 784
778 Ga0496115_1408345 3300048918 Bacteria 514
779 Ga0496117_0038406 3300048920 Bacteria 3550
780 Ga0496117_0144041 3300048920 Bacteria 1422
781 Ga0496118_0006276 3300048921 Bacteria 13144
782 Ga0496118_0131146 3300048921 Bacteria 1609
783 Ga0496119_0125806 3300048922 Bacteria 1403
784 Ga0496121_0000125 3300048924 Bacteria 169274
785 Ga0496121_0001272 3300048924 Bacteria 43421
786 Ga0496121_0011876 3300048924 Bacteria 9593
787 Ga0496121_0016516 3300048924 Bacteria 7616
788 Ga0496121_0038808 3300048924 Bacteria 4209
789 Ga0496121_0052585 3300048924 Bacteria 3419
790 Ga0496121_0073165 3300048924 Bacteria 2748
791 Ga0496121_0079299 3300048924 Bacteria 2607
792 Ga0496121_0092025 3300048924 Bacteria 2365
793 Ga0496121_0130668 3300048924 Bacteria 1880
794 Ga0496121_0423620 3300048924 Bacteria 865
795 Ga0496121_0426765 3300048924 Bacteria 861
796 Ga0496121_0442138 3300048924 Bacteria 840
797 Ga0496121_0451111 3300048924 Bacteria 829
798 Ga0496121_0836851 3300048924 Bacteria 537
799 Ga0496121_0889698 3300048924 Bacteria 513
800 Ga0496122_0145289 3300048925 Bacteria 1475
801 Ga0496124_0001012 3300048927 Bacteria 44554
802 Ga0496124_0203582 3300048927 Bacteria 1503
803 Ga0496124_0286092 3300048927 Bacteria 1199
804 Ga0496124_0439091 3300048927 Bacteria 894
805 Ga0496125_0204030 3300048928 Bacteria 1291
806 Ga0496125_0221165 3300048928 Bacteria 1220
807 Ga0496125_0767295 3300048928 Bacteria 503
808 Ga0496126_0003769 3300048929 Bacteria 18829
809 Ga0496126_0022781 3300048929 Bacteria 6084
810 Ga0496126_0027415 3300048929 Bacteria 5440
811 Ga0496126_0032789 3300048929 Bacteria 4890
812 Ga0496126_0047832 3300048929 Bacteria 3914
813 Ga0496126_0145106 3300048929 Bacteria 2039
814 Ga0496126_0169384 3300048929 Bacteria 1862
815 Ga0496126_0343375 3300048929 Bacteria 1223
816 Ga0496126_0434521 3300048929 Bacteria 1059
817 Ga0496126_0828206 3300048929 Bacteria 708
818 Ga0496126_1182503 3300048929 Bacteria 563
819 Ga0495678_133834 3300049459 Bacteria 819
820 Ga0501031_0000720 3300049568 Bacteria 19831
821 Ga0501032_0001318 3300049569 Bacteria 19897
822 Ga0501033_0000060 3300049570 Bacteria 103159
823 Ga0501034_0000117 3300049571 Bacteria 144865
824 Ga0501036_0000349 3300049572 Bacteria 32571
825 Ga0501037_0000561 3300049573 Bacteria 29494
826 Ga0501038_0000570 3300049574 Bacteria 32618
827 Ga0501039_0001028 3300049575 Bacteria 20380
828 Ga0501040_0512429 3300049576 Bacteria 865
829 Ga0501042_0151132 3300049578 Bacteria 1674
830 Ga0501043_0000972 3300049579 Bacteria 25318
831 Ga0501046_0000214 3300049580 Bacteria 60379
832 Ga0501047_0000246 3300049581 Bacteria 64361
833 Ga0501048_0000899 3300049582 Bacteria 21965
834 Ga0501067_0001865 3300049583 Bacteria 11573
835 Ga0501068_0010061 3300049584 Bacteria 5308
836 Ga0501069_0013881 3300049585 Bacteria 4300
837 Ga0501070_0006127 3300049586 Bacteria 10250
838 Ga0501071_0123602 3300049587 Bacteria 1919
839 Ga0501072_0002027 3300049588 Bacteria 15079
840 Ga0501073_0000093 3300049589 Bacteria 56882
841 Ga0501074_0000410 3300049590 Bacteria 25626
842 Ga0501076_0076261 3300049592 Bacteria 2689
843 Ga0501206_074929 3300049653 Bacteria 579
844 Ga0501079_0003486 3300049741 Bacteria 11566
845 Ga0501080_0021702 3300049742 Bacteria 5946
846 Ga0501081_1332107 3300049743 Bacteria 545
847 Ga0501083_0001291 3300049744 Bacteria 16946
848 Ga0501035_0002394 3300049822 Bacteria 18396
849 Ga0501035_1181636 3300049822 Bacteria 594
850 Ga0501044_0001196 3300049823 Bacteria 30769
851 Ga0501045_0006983 3300049824 Bacteria 7830
852 nmdc:mga03683_118379_c1 3300050489 Bacteria 1176
853 nmdc:mga03683_386861_c1 3300050489 Bacteria 666
854 nmdc:mga03n38_410435_c1 3300050490 Bacteria 747
855 nmdc:mga03n38_4113_c1 3300050490 Bacteria 4777
856 nmdc:mga03n38_430252_c1 3300050490 Bacteria 731
857 nmdc:mga00v17_225823_c1 3300050491 Bacteria 1213
858 nmdc:mga0yw44_19629_c1 3300050492 Bacteria 3731
859 nmdc:mga0yw44_350464_c1 3300050492 Bacteria 994
860 nmdc:mga0yw44_611864_c1 3300050492 Bacteria 740
861 nmdc:mga0yw44_941962_c1 3300050492 Bacteria 585
862 nmdc:mga0k408_722634_c1 3300050493 Bacteria 583
863 nmdc:mga0k408_806534_c1 3300050493 Bacteria 547
864 nmdc:mga0k408_899414_c1 3300050493 Bacteria 514
865 nmdc:mga06z11_31231_c1 3300050494 Bacteria 2586
866 nmdc:mga06z11_38397_c1 3300050494 Bacteria 2378
867 nmdc:mga06z11_603081_c1 3300050494 Bacteria 668
868 nmdc:mga06z11_71563_c1 3300050494 Bacteria 1836
869 nmdc:mga06z11_77383_c1 3300050494 Bacteria 1776
870 nmdc:mga04h51_26513_c1 3300050495 Bacteria 1793
871 nmdc:mga04h51_292870_c1 3300050495 Bacteria 662
872 nmdc:mga04h51_8029_c1 3300050495 Bacteria 2811
873 nmdc:mga07m45_23727_c1 3300050496 Bacteria 3355
874 nmdc:mga07m45_25511_c1 3300050496 Bacteria 3242
875 nmdc:mga07m45_317433_c1 3300050496 Bacteria 906
876 nmdc:mga07m45_62351_c1 3300050496 Bacteria 2113
877 nmdc:mga05p37_987128_c1 3300050507 Bacteria 896
878 nmdc:mga0n895_168788_c1 3300050512 Bacteria 2220
879 nmdc:mga0n895_767238_c1 3300050512 Bacteria 956
880 nmdc:mga08x19_762986_c1 3300050514 Bacteria 687
881 nmdc:mga08x19_77303_c1 3300050514 Bacteria 2180
882 nmdc:mga0a205_1147625_c1 3300050515 Bacteria 624
883 nmdc:mga0sz30_107309_c1 3300050516 Bacteria 1222
884 nmdc:mga0sz30_153992_c1 3300050516 Bacteria 1017
885 nmdc:mga0sz30_16040_c1 3300050516 Bacteria 2967
886 Ga0495601_0128582 3300053077 Bacteria 1649
887 Ga0495612_0037955 3300053078 Bacteria 1957
888 Ga0495612_0425992 3300053078 Bacteria 605
889 Ga0495655_0096258 3300053083 Bacteria 870
890 Ga0495655_0172314 3300053083 Bacteria 693
891 Ga0495655_0292050 3300053083 Bacteria 558
892 Ga0500578_0220529 3300053086 Bacteria 1153
893 Ga0500643_139681 3300053087 Bacteria 651
894 Ga0500644_0547979 3300053088 Bacteria 511
895 Ga0500581_228087 3300053089 Bacteria 802
896 Ga0500646_0104591 3300053090 Bacteria 893
897 Ga0500583_0107356 3300053092 Bacteria 1372
898 Ga0500583_0344896 3300053092 Bacteria 722
899 Ga0500566_0037689 3300053094 Bacteria 2800
900 Ga0500641_0002883 3300053096 Bacteria 6098
901 Ga0500641_0162580 3300053096 Bacteria 962
902 Ga0500554_010861 3300053102 Bacteria 2236
903 Ga0500562_138856 3300053108 Bacteria 662
904 Ga0500572_000343 3300053111 Bacteria 16647
905 Ga0500575_233472 3300053112 Bacteria 531
906 Ga0500594_0199739 3300053118 Bacteria 657
907 Ga0500595_002526 3300053119 Bacteria 9002
908 Ga0500595_002841 3300053119 Bacteria 8317
909 Ga0500595_014884 3300053119 Bacteria 2938
910 Ga0500595_069573 3300053119 Bacteria 1047
911 Ga0500642_0057963 3300053130 Bacteria 1730
912 Ga0500658_0118958 3300053134 Bacteria 1170
913 Ga0500658_0428799 3300053134 Bacteria 603
914 Ga0500559_0000552 3300053136 Bacteria 25939
915 Ga0500559_0428251 3300053136 Bacteria 613
916 Ga0500559_0507412 3300053136 Bacteria 553
917 Ga0500568_0128311 3300053139 Bacteria 943
918 Ga0500573_0332473 3300053140 Bacteria 745
919 Ga0500577_0217013 3300053142 Bacteria 827
920 Ga0500588_0078753 3300053146 Bacteria 1098
921 Ga0500622_0148078 3300053156 Bacteria 1113
922 Ga0500622_0429427 3300053156 Bacteria 530
923 Ga0500627_0336523 3300053158 Bacteria 653
924 Ga0500634_0307132 3300053161 Bacteria 626
925 Ga0500636_0073845 3300053177 Bacteria 1974
926 Ga0500636_0181875 3300053177 Bacteria 1128
927 Ga0500636_0345823 3300053177 Bacteria 712
928 Ga0500637_0068782 3300053178 Bacteria 2034
929 Ga0500637_0534856 3300053178 Bacteria 571
930 Ga0500576_033159 3300053725 Bacteria 2341
931 Ga0500611_066118 3300053727 Bacteria 869
932 Ga0500645_043769 3300053730 Bacteria 1318
933 Ga0500645_187404 3300053730 Bacteria 561
934 Ga0500552_024084 3300053733 Bacteria 892
935 Ga0500596_006906 3300053735 Bacteria 1886
936 Ga0500596_039259 3300053735 Bacteria 752
937 Ga0501084_0030229 3300054114 Bacteria 4530
938 Ga0500661_001357 3300055283 Bacteria 4570
939 Ga0501082_0011824 3300060353 Bacteria 7502
940 Ga0466962_0049345 3300061719 Bacteria 2012
941 2509147942 2508501128 Bacteria 8613869
942 2513655720 2513237096 Bacteria 8722461
943 2513916202 2513237145 Bacteria 8979722
944 2671121645 2667528175 Bacteria 7532676
945 2793067835 2791355197 Bacteria 8420563
946 2906663592 2906660503 Bacteria 8595048
947 Ga0209455_1003000
948 JGI24740J21852_10007504
949 JGI24737J22298_10006778
950 JGI24738J21930_10016886
951 JGI24744J21845_10034538
952 JGI24742J22300_10016342
953 JGI25406J46586_10000956
954 rootH1_10038988
955 JGI25404J52841_10003671
956 JGI25404J52841_10070669
957 JGI25404J52841_10081077
958 JGI25404J52841_10085617
959 Ga0055539_1004922
960 Ga0070676_10114424
961 Ga0070676_10207713
962 Ga0070683_101213114
963 Ga0070683_101842261
964 Ga0070677_10586106
965 Ga0068869_100018657
966 Ga0070680_100194286
967 Ga0070680_100875655
968 Ga0070680_100941606
969 Ga0068868_100450302
970 Ga0068868_100752924
971 Ga0068868_100894101
972 Ga0070660_100165206
973 Ga0070689_100141126
974 Ga0070689_100381639
975 Ga0070691_10493469
976 Ga0070668_100107147
977 Ga0070668_100134320
978 Ga0070668_100136644
979 Ga0070668_100327291
980 Ga0070668_100370565
981 Ga0070668_100376387
982 Ga0070668_100447015
983 Ga0070669_100259747
984 Ga0070675_100171599
985 Ga0070674_100028523
986 Ga0070688_100079079
987 Ga0070688_100756760
988 Ga0070659_100675857
989 Ga0070667_100704448
990 Ga0070667_100772038
991 Ga0070667_102015315
992 Ga0070714_100264434
993 Ga0070701_10069769
994 Ga0070711_100023363
995 Ga0070711_100471322
996 Ga0070694_100691614
997 Ga0070663_100012138
998 Ga0070663_100035437
999 Ga0070663_100307132
1000 Ga0070663_100310803
1001 Ga0070678_100526600
1002 Ga0070678_100672389
1003 Ga0070662_100014560
1004 Ga0070662_100443906
1005 Ga0070662_100559903
1006 Ga0070681_10117173
1007 Ga0070681_10357152
1008 Ga0070681_10385368
1009 Ga0070681_10470440
1010 Ga0070681_10917034
1011 Ga0070681_11330267
1012 Ga0070681_11397638
1013 Ga0068867_100509516
1014 Ga0068867_100825937
1015 Ga0070685_10037284
1016 Ga0070685_10712761
1017 Ga0070706_100127509
1018 Ga0070698_100787651
1019 Ga0070699_101290466
1020 Ga0070679_100033018
1021 Ga0070679_100090031
1022 Ga0070679_100168109
1023 Ga0070679_101058975
1024 Ga0070684_100002732
1025 Ga0070684_100327575
1026 Ga0070684_101536260
1027 Ga0070697_100584576
1028 Ga0068853_100020846
1029 Ga0068853_100069457
1030 Ga0068853_100082526
1031 Ga0070696_101321432
1032 Ga0070665_100002394
1033 Ga0070665_100005213
1034 Ga0070665_100269421
1035 Ga0070665_100721984
1036 Ga0070665_101613230
1037 Ga0070665_101630821
1038 Ga0070665_101775003
1039 Ga0068855_100029025
1040 Ga0068855_100054469
1041 Ga0068855_100174563
1042 Ga0068855_100254556
1043 Ga0070664_100675305
1044 Ga0070664_100804598
1045 Ga0070664_100906766
1046 Ga0070664_101229753
1047 Ga0068857_100026813
1048 Ga0068857_100063005
1049 Ga0068854_100017345
1050 Ga0068854_100033447
1051 Ga0068854_101124485
1052 Ga0068856_100010975
1053 Ga0068856_100031583
1054 Ga0068856_100196810
1055 Ga0070702_100266176
1056 Ga0068852_100011898
1057 Ga0068852_100119073
1058 Ga0068852_100369521
1059 Ga0068852_100395770
1060 Ga0068852_101009414
1061 Ga0068859_100017410
1062 Ga0068859_100560682
1063 Ga0068864_100019927
1064 Ga0068864_100706888
1065 Ga0068861_101227502
1066 Ga0068851_10000403
1067 Ga0068851_10025246
1068 Ga0068870_11006227
1069 Ga0068863_100764433
1070 Ga0068863_101420972
1071 Ga0068858_100007998
1072 Ga0068858_100107479
1073 Ga0068858_100155901
1074 Ga0068858_100176894
1075 Ga0068858_100614207
1076 Ga0068858_101048155
1077 Ga0068858_101449369
1078 Ga0068860_100152128
1079 Ga0068860_100219622
1080 Ga0068860_100522922
1081 Ga0068862_100228704
1082 Ga0068862_101270213
1083 Ga0068862_102739439
1084 Ga0068862_102739440
1085 Ga0081455_10026317
1086 Ga0081455_10035588
1087 Ga0081455_10071617
1088 Ga0081538_10038623
1089 Ga0081540_1004293
1090 Ga0081540_1005288
1091 Ga0081540_1009614
1092 Ga0081540_1018656
1093 Ga0081540_1025191
1094 Ga0081540_1082684
1095 Ga0081540_1122422
1096 Ga0081539_10001182
1097 Ga0075365_10070950
1098 Ga0075365_10427914
1099 Ga0075365_11122621
1100 Ga0075368_10018320
1101 Ga0075368_10075241
1102 Ga0075368_10103152
1103 Ga0075368_10241313
1104 Ga0075363_100003500
1105 Ga0075363_100571594
1106 Ga0075364_10092780
1107 Ga0070712_100099670
1108 Ga0070712_100495166
1109 Ga0075362_10149549
1110 Ga0075362_10368851
1111 Ga0075362_10462183
1112 Ga0075367_10008328
1113 Ga0075367_10017360
1114 Ga0075367_10077209
1115 Ga0075367_10105429
1116 Ga0075369_10123558
1117 Ga0075366_10071521
1118 Ga0075366_10206316
1119 Ga0075366_10298482
1120 Ga0075366_10882939
1121 Ga0097621_100157741
1122 Ga0097621_101063016
1123 Ga0075370_10017740
1124 Ga0075370_10120759
1125 Ga0075370_10196466
1126 Ga0075428_100244669
1127 Ga0075434_100086670
1128 Ga0075434_101140749
1129 Ga0075434_102423048
1130 Ga0075436_100112638
1131 Ga0075436_101209240
1132 Ga0097620_100017410
1133 Ga0097620_100560685
1134 Ga0099824_1021760
1135 Ga0099822_1005624
1136 Ga0075435_101482933
1137 Ga0099794_10017013
1138 Ga0099794_10061337
1139 Ga0099794_10166842
1140 Ga0099794_10295284
1141 Ga0099795_10087520
1142 Ga0099795_10090695
1143 Ga0099795_10143857
1144 Ga0099795_10240080
1145 Ga0099795_10346109
1146 Ga0105240_10004842
1147 Ga0105240_10068783
1148 Ga0105240_10161440
1149 Ga0111539_10964432
1150 Ga0111539_11526398
1151 Ga0105245_10029960
1152 Ga0105245_11052101
1153 Ga0105245_11505708
1154 Ga0105247_10029834
1155 Ga0105247_10163403
1156 Ga0105247_10392042
1157 Ga0105247_11134489
1158 Ga0114129_10693999
1159 Ga0114129_11586707
1160 Ga0114129_13369805
1161 Ga0105243_10056145
1162 Ga0105243_10229673
1163 Ga0105241_10001414
1164 Ga0105241_10005266
1165 Ga0105241_10686572
1166 Ga0105242_10366713
1167 Ga0105242_10499240
1168 Ga0105242_11894830
1169 Ga0105248_10039015
1170 Ga0105248_10134904
1171 Ga0105248_11648953
1172 Ga0105248_11784142
1173 Ga0105237_10039842
1174 Ga0105237_10167517
1175 Ga0105237_10177618
1176 Ga0105237_10249867
1177 Ga0105237_11468351
1178 Ga0105237_11737551
1179 Ga0105238_10003351
1180 Ga0105238_10040294
1181 Ga0105238_10045520
1182 Ga0105238_10054116
1183 Ga0105238_10876428
1184 Ga0105238_12323608
1185 Ga0105249_10191179
1186 Ga0099796_10144493
1187 Ga0105239_10025763
1188 Ga0105239_10025860
1189 Ga0105239_10044086
1190 Ga0105239_10189157
1191 Ga0105239_10745550
1192 Ga0105239_10793620
1193 Ga0105239_11922797
1194 Ga0105246_10007720
1195 Ga0157316_1019030
1196 Ga0157371_10213067
1197 Ga0157370_10055928
1198 Ga0157370_10950941
1199 Ga0157369_10076057
1200 Ga0157369_10085372
1201 Ga0157369_11111955
1202 Ga0157369_11878731
1203 Ga0157374_11734617
1204 Ga0157378_10002606
1205 Ga0157378_11050013
1206 Ga0157378_11753442
1207 Ga0157378_12006647
1208 Ga0163162_10244401
1209 Ga0163162_10807910
1210 Ga0163162_10881717
1211 Ga0163162_11879372
1212 Ga0157372_10154049
1213 Ga0157372_10957403
1214 Ga0157372_12016687
1215 Ga0157375_10393063
1216 Ga0157375_10620944
1217 Ga0157375_10909717
1218 Ga0163163_10007726
1219 Ga0163163_10310213
1220 Ga0163163_10329233
1221 Ga0163163_11048232
1222 Ga0157380_11157059
1223 Ga0157380_11971940
1224 Ga0157377_10213064
1225 Ga0157379_10149247
1226 Ga0157379_10176913
1227 Ga0157376_10122270
1228 Ga0157376_10197254
1229 Ga0157376_10668822
1230 Ga0163161_10182604
1231 Ga0163161_10367312
1232 Ga0213872_10154075
1233 Ga0213876_10018004
1234 Ga0209677_100740
1235 Ga0209233_1001693
1236 Ga0209233_1007637
1237 Ga0209758_1086475
1238 Ga0207656_10001759
1239 Ga0207653_10310484
1240 Ga0207682_10079391
1241 Ga0207682_10237661
1242 Ga0207642_10107535
1243 Ga0207642_10290539
1244 Ga0207710_10071082
1245 Ga0207710_10375419
1246 Ga0207688_10005613
1247 Ga0207680_10052456
1248 Ga0207647_10001152
1249 Ga0207647_10342165
1250 Ga0207685_10208187
1251 Ga0207699_10045165
1252 Ga0207699_10487033
1253 Ga0207699_10601896
1254 Ga0207645_10042112
1255 Ga0207645_10134674
1256 Ga0207645_10558878
1257 Ga0207643_10737152
1258 Ga0207643_10823352
1259 Ga0207643_10896376
1260 Ga0207705_10098865
1261 Ga0207705_10653700
1262 Ga0207684_10240599
1263 Ga0207684_10938785
1264 Ga0207654_10000303
1265 Ga0207654_10016251
1266 Ga0207654_10651408
1267 Ga0207707_10020923
1268 Ga0207707_10106738
1269 Ga0207695_10000430
1270 Ga0207695_10122330
1271 Ga0207695_10273769
1272 Ga0207695_11282202
1273 Ga0207671_10016753
1274 Ga0207671_10058733
1275 Ga0207671_10147864
1276 Ga0207671_10742771
1277 Ga0207693_10097036
1278 Ga0207693_10302534
1279 Ga0207663_10030206
1280 Ga0207660_10066037
1281 Ga0207660_10118700
1282 Ga0207657_10021413
1283 Ga0207657_11056205
1284 Ga0207652_10070496
1285 Ga0207652_10116582
1286 Ga0207652_11404054
1287 Ga0207681_11294850
1288 Ga0207694_10000183
1289 Ga0207694_10050840
1290 Ga0207694_11321190
1291 Ga0207650_10050504
1292 Ga0207650_11172316
1293 Ga0207659_10180253
1294 Ga0207687_10032471
1295 Ga0207687_10142616
1296 Ga0207664_10109944
1297 Ga0207664_11415038
1298 Ga0207644_10281859
1299 Ga0207644_10341843
1300 Ga0207644_10486226
1301 Ga0207644_11401294
1302 Ga0207690_10085694
1303 Ga0207690_10201128
1304 Ga0207690_10652469
1305 Ga0207706_10014567
1306 Ga0207706_10108760
1307 Ga0207706_10444488
1308 Ga0207686_10268276
1309 Ga0207709_10091077
1310 Ga0207670_10417332
1311 Ga0207669_10003952
1312 Ga0207669_10732098
1313 Ga0207704_10044473
1314 Ga0207704_10741386
1315 Ga0207691_10327491
1316 Ga0207711_10287083
1317 Ga0207711_11525873
1318 Ga0207689_10007618
1319 Ga0207689_10029218
1320 Ga0207689_10081909
1321 Ga0207661_10088320
1322 Ga0207661_10976717
1323 Ga0207679_10420298
1324 Ga0207679_10434834
1325 Ga0207679_10713968
1326 Ga0207667_10008851
1327 Ga0207667_10048202
1328 Ga0207667_10049954
1329 Ga0207667_10932561
1330 Ga0207667_11316288
1331 Ga0207667_11682603
1332 Ga0207712_10079020
1333 Ga0207712_10118653
1334 Ga0207668_10195524
1335 Ga0207668_10337287
1336 Ga0207668_11157712
1337 Ga0207640_10363396
1338 Ga0207640_10409714
1339 Ga0207640_10996268
1340 Ga0207658_10111105
1341 Ga0207658_10839033
1342 Ga0207658_12055542
1343 Ga0207677_10808170
1344 Ga0207677_10848736
1345 Ga0207677_11086719
1346 Ga0207703_10006563
1347 Ga0207703_10201715
1348 Ga0207703_10235392
1349 Ga0207703_11249855
1350 Ga0207639_10007256
1351 Ga0207639_10370320
1352 Ga0207639_10500110
1353 Ga0207639_10862032
1354 Ga0207678_10091211
1355 Ga0207678_10105055
1356 Ga0207678_10170006
1357 Ga0207678_10345188
1358 Ga0207678_10393092
1359 Ga0207678_10670843
1360 Ga0207678_10829086
1361 Ga0207678_11282962
1362 Ga0207678_11283048
1363 Ga0207678_11541164
1364 Ga0207708_10117108
1365 Ga0207702_10000006
1366 Ga0207702_10008332
1367 Ga0207702_10222400
1368 Ga0207702_10415875
1369 Ga0207702_10714012
1370 Ga0207641_10144496
1371 Ga0207648_10029907
1372 Ga0207648_10080640
1373 Ga0207648_11338143
1374 Ga0207648_11341738
1375 Ga0207676_11090952
1376 Ga0207674_10014170
1377 Ga0207674_10023755
1378 Ga0207674_10059205
1379 Ga0207674_10095997
1380 Ga0207674_10109680
1381 Ga0207675_100042611
1382 Ga0207675_100257993
1383 Ga0207675_100315279
1384 Ga0207675_100455007
1385 Ga0207683_10154618
1386 Ga0207683_10385726
1387 Ga0207683_10408003
1388 Ga0207683_10685161
1389 Ga0207683_11306820
1390 Ga0207698_10074157
1391 Ga0207698_10092547
1392 Ga0207698_10362167
1393 Ga0209589_1000007
1394 Ga0209489_100008
1395 Ga0209700_100009
1396 Ga0209179_1025881
1397 Ga0209588_1007152
1398 Ga0209588_1103705
1399 Ga0209813_10048738
1400 Ga0209813_10076396
1401 Ga0268266_10001169
1402 Ga0268266_10004410
1403 Ga0268266_10128610
1404 Ga0268266_10187688
1405 Ga0268266_10423045
1406 Ga0268266_10650406
1407 Ga0268266_11429858
1408 Ga0268265_10166656
1409 Ga0268265_10201606
1410 Ga0268265_10504698
1411 Ga0268265_10764737
1412 Ga0268264_10266929
1413 Ga0268264_10984873
1414 Ga0268264_11110664
1415 Ga0307517_10000196
1416 Ga0307515_10313659
1417 Ga0307515_10331623
1418 Ga0265338_10766228
1419 Ga0307511_10246706
1420 Ga0265339_10008955
1421 Ga0307513_10259903
1422 Ga0307513_10841790
1423 Ga0307513_11082275
1424 Ga0307509_10058650
1425 Ga0307509_10226911
1426 Ga0307509_10666021
1427 Ga0307408_100440679
1428 Ga0307408_100451018
1429 Ga0307408_101626484
1430 Ga0307408_101708435
1431 Ga0307508_10062370
1432 Ga0307508_10363116
1433 Ga0307508_10599783
1434 Ga0265314_10012750
1435 Ga0265314_10058077
1436 Ga0307516_10017558
1437 Ga0307516_10298240
1438 Ga0307516_10802633
1439 Ga0307405_10843211
1440 Ga0307413_10179663
1441 Ga0307413_11441240
1442 Ga0307410_10111654
1443 Ga0307410_10484838
1444 Ga0307410_11319726
1445 Ga0307406_11038588
1446 Ga0307406_11358640
1447 Ga0307406_11713345
1448 Ga0307412_10521727
1449 Ga0307412_10539200
1450 Ga0307416_100842317
1451 Ga0307414_10147924
1452 Ga0307411_10291364
1453 Ga0307415_100937520
1454 Ga0307507_10034314
1455 Ga0307510_10068345
1456 Ga0307510_10292492
1457 Ga0307510_10651431
1458 Ga0373959_0016194
1459 Ga0373926_0032374
1460 Ga0373928_0069269
1461 Ga0373928_0111584
1462 Ga0373944_0016229
1463 Ga0373952_0060205
1464 Ga0373939_0312041
1465 Ga0373941_0103406
1466 Ga0373945_0178017
1467 Ga0373954_0047624
1468 Ga0373956_0115320
1469 Ga0373956_0144456
1470 Ga0373960_0124288
1471 Ga0373955_0038779
1472 Ga0373955_0869487
1473 Ga0373924_0022689
1474 Ga0373924_0316214
1475 Ga0373931_0001507
1476 Ga0373931_0717719
1477 Ga0373935_0058156
1478 Ga0373935_0169561
1479 Ga0373935_0422697
1480 Ga0373927_0022900
1481 Ga0373927_0040140
1482 Ga0373927_0270038
1483 Ga0373927_0452191
1484 Ga0373933_0000127
1485 Ga0373933_0231209
1486 Ga0373947_0074998
1487 Ga0372808_024360
1488 Ga0373925_0214042
1489 Ga0373925_0266020
1490 Ga0373925_0404684
1491 Ga0395899_0362000
1492 Ga0395900_0098922
1493 Ga0395900_0180907
1494 Ga0395898_0564554
1495 Ga0395905_0273824
1496 Ga0395905_0449342
1497 Ga0436364_0617263
1498 Ga0395901_0146055
1499 Ga0436365_0070478
1500 Ga0436365_0232459
1501 Ga0436365_1733827
1502 Ga0436360_0030458
1503 Ga0436360_0603876
1504 Ga0436360_1347898
1505 Ga0436361_0173867
1506 Ga0436361_0515155
1507 Ga0436361_1010144
1508 Ga0436361_1163158
1509 Ga0436363_0416978
1510 Ga0439466_0198615
1511 Ga0439465_0282000
1512 Ga0451787_639311
1513 Ga0451791_0214399
1514 Ga0451793_0861193
1515 Ga0451800_1596037
1516 Ga0451807_1871645
1517 Ga0451839_1579377
1518 Ga0451843_0852966
1519 Ga0451853_0619022
1520 Ga0451853_3538731
1521 Ga0439431_0090641
1522 Ga0439448_0157866
1523 Ga0439459_0239788
1524 Ga0466963_0043252
1525 Ga0466963_0197475
1526 Ga0466964_0839787
1527 Ga0466971_0183154
1528 Ga0466957_0492247
1529 Ga0466959_0181574
1530 Ga0466959_0812881
1531 Ga0466967_0869336
1532 Ga0466967_1029171
1533 Ga0466967_1759153
1534 Ga0495617_056540
1535 Ga0495592_0659867
1536 Ga0495603_0002225
1537 Ga0495603_0063846
1538 Ga0495603_0111043
1539 Ga0495603_0276620
1540 Ga0495603_0428118
1541 Ga0495629_0047705
1542 Ga0495638_0170513
1543 Ga0495638_0173453
1544 Ga0495651_0113225
1545 Ga0495653_0573918
1546 Ga0495580_0081569
1547 Ga0495580_0235505
1548 Ga0495580_0261704
1549 Ga0495582_0001981
1550 Ga0495605_0185075
1551 Ga0495639_0015180
1552 Ga0495639_0016962
1553 Ga0495664_0057297
1554 Ga0495664_0058557
1555 Ga0495664_0476837
1556 Ga0495664_0656294
1557 Ga0495584_0112577
1558 Ga0495584_0154916
1559 Ga0495584_0269377
1560 Ga0495584_0288033
1561 Ga0495584_0317247
1562 Ga0495585_0132887
1563 Ga0495585_0159836
1564 Ga0495585_0210289
1565 Ga0495594_0015789
1566 Ga0495594_0141800
1567 Ga0495596_0194619
1568 Ga0495607_0077511
1569 Ga0495606_0205701
1570 Ga0495606_0254588
1571 Ga0495616_0166872
1572 Ga0495616_0290212
1573 Ga0495618_0008061
1574 Ga0495620_0204749
1575 Ga0495628_0859018
1576 Ga0495632_0087390
1577 Ga0495632_0173562
1578 Ga0495643_0467139
1579 Ga0495644_0051745
1580 Ga0495644_0123022
1581 Ga0495644_0211181
1582 Ga0495644_0354152
1583 Ga0495648_0385208
1584 Ga0495663_0036657
1585 Ga0495666_0027831
1586 Ga0495666_0267491
1587 Ga0495642_0160810
1588 Ga0495652_0310644
1589 Ga0495652_0618198
1590 Ga0495654_0447354
1591 Ga0495665_0018879
1592 Ga0495665_0246262
1593 Ga0495665_0270421
1594 Ga0495640_0086162
1595 Ga0495640_0109487
1596 Ga0495586_0107736
1597 Ga0495586_0221906
1598 Ga0495586_0703636
1599 Ga0495587_0463606
1600 Ga0495598_0021419
1601 Ga0495598_0031095
1602 Ga0495621_0027019
1603 Ga0495645_0256998
1604 Ga0495622_0022028
1605 Ga0495622_0023913
1606 Ga0495622_0054519
1607 Ga0495622_0403098
1608 Ga0495633_0047706
1609 Ga0495633_0215568
1610 Ga0495667_0237822
1611 Ga0495656_0056279
1612 Ga0495656_0107919
1613 Ga0495656_0136116
1614 Ga0495656_0141225
1615 Ga0495656_0177399
1616 Ga0495656_0281265
1617 Ga0495668_0098495
1618 Ga0495668_0175188
1619 Ga0495634_0045652
1620 Ga0495611_0097279
1621 Ga0495625_0446907
1622 Ga0495625_0554312
1623 Ga0495625_0596430
1624 Ga0495625_0856628
1625 Ga0495635_0057480
1626 Ga0495635_0428759
1627 Ga0495659_0082134
1628 Ga0495659_0115177
1629 Ga0495659_0333850
1630 Ga0495588_0177619
1631 Ga0495588_0189120
1632 Ga0495588_0244197
1633 Ga0495657_0172439
1634 Ga0495599_0397633
1635 Ga0495623_0180206
1636 Ga0495646_0072828
1637 Ga0495646_0095456
1638 Ga0495647_0012829
1639 Ga0495647_0137405
1640 Ga0495647_0434925
1641 Ga0495669_0011460
1642 Ga0495669_0065479
1643 Ga0495613_0557147
1644 Ga0495624_0147682
1645 Ga0495670_0072948
1646 Ga0495671_0410843
1647 Ga0495649_0167243
1648 Ga0495589_0105453
1649 Ga0495600_0513426
1650 Ga0495660_0155290
1651 Ga0495581_0038654
1652 Ga0495581_0080059
1653 Ga0495604_0395137
1654 Ga0495636_0147342
1655 Ga0495674_0075474
1656 Ga0495674_0253762
1657 Ga0495674_0966025
1658 Ga0495674_1131574
1659 Ga0495676_0087701
1660 Ga0495676_0297801
1661 Ga0495676_0919691
1662 Ga0495683_0083150
1663 Ga0495675_0040682
1664 Ga0495675_0580374
1665 Ga0495677_0133337
1666 Ga0495685_304580
1667 Ga0495673_0128905
1668 Ga0495673_0223408
1669 Ga0495684_0188431
1670 Ga0495684_0685016
1671 Ga0495686_0679148
1672 Ga0495614_0309967
1673 Ga0495615_0020007
1674 Ga0496100_0110588
1675 Ga0496100_0483831
1676 Ga0496100_1686253
1677 Ga0496101_0085992
1678 Ga0496101_0277556
1679 Ga0496101_0622234
1680 Ga0496102_0109788
1681 Ga0496102_0114415
1682 Ga0496102_0147891
1683 Ga0496102_0266646
1684 Ga0496102_0511368
1685 Ga0496102_0590674
1686 Ga0496102_0642027
1687 Ga0496103_0347390
1688 Ga0496103_0770067
1689 Ga0496103_0947906
1690 Ga0496104_0239530
1691 Ga0496104_0507226
1692 Ga0496105_0184845
1693 Ga0496106_0000590
1694 Ga0496106_0101921
1695 Ga0496106_0292425
1696 Ga0496106_0356515
1697 Ga0496107_0010715
1698 Ga0496107_0182159
1699 Ga0496107_0280753
1700 Ga0496107_0467597
1701 Ga0496107_0843351
1702 Ga0496108_0160930
1703 Ga0496108_0661806
1704 Ga0496109_0154202
1705 Ga0496109_0293108
1706 Ga0496109_0446660
1707 Ga0496110_0418282
1708 Ga0496110_0499728
1709 Ga0496110_0547990
1710 Ga0496110_1050933
1711 Ga0496111_0211997
1712 Ga0496111_0230976
1713 Ga0496111_0695762
1714 Ga0496112_0386236
1715 Ga0496112_1905028
1716 Ga0496113_0059717
1717 Ga0496113_0463409
1718 Ga0496114_0046729
1719 Ga0496114_1046545
1720 Ga0496115_0119240
1721 Ga0496115_0142482
1722 Ga0496115_0284032
1723 Ga0496115_0718262
1724 Ga0496115_1408345
1725 Ga0496117_0038406
1726 Ga0496117_0144041
1727 Ga0496118_0006276
1728 Ga0496118_0131146
1729 Ga0496119_0125806
1730 Ga0496121_0000125
1731 Ga0496121_0001272
1732 Ga0496121_0011876
1733 Ga0496121_0016516
1734 Ga0496121_0038808
1735 Ga0496121_0052585
1736 Ga0496121_0073165
1737 Ga0496121_0079299
1738 Ga0496121_0092025
1739 Ga0496121_0130668
1740 Ga0496121_0423620
1741 Ga0496121_0426765
1742 Ga0496121_0442138
1743 Ga0496121_0451111
1744 Ga0496121_0836851
1745 Ga0496121_0889698
1746 Ga0496122_0145289
1747 Ga0496124_0001012
1748 Ga0496124_0203582
1749 Ga0496124_0286092
1750 Ga0496124_0439091
1751 Ga0496125_0204030
1752 Ga0496125_0221165
1753 Ga0496125_0767295
1754 Ga0496126_0003769
1755 Ga0496126_0022781
1756 Ga0496126_0027415
1757 Ga0496126_0032789
1758 Ga0496126_0047832
1759 Ga0496126_0145106
1760 Ga0496126_0169384
1761 Ga0496126_0343375
1762 Ga0496126_0434521
1763 Ga0496126_0828206
1764 Ga0496126_1182503
1765 Ga0495678_133834
1766 Ga0501031_0000720
1767 Ga0501032_0001318
1768 Ga0501033_0000060
1769 Ga0501034_0000117
1770 Ga0501036_0000349
1771 Ga0501037_0000561
1772 Ga0501038_0000570
1773 Ga0501039_0001028
1774 Ga0501040_0512429
1775 Ga0501042_0151132
1776 Ga0501043_0000972
1777 Ga0501046_0000214
1778 Ga0501047_0000246
1779 Ga0501048_0000899
1780 Ga0501067_0001865
1781 Ga0501068_0010061
1782 Ga0501069_0013881
1783 Ga0501070_0006127
1784 Ga0501071_0123602
1785 Ga0501072_0002027
1786 Ga0501073_0000093
1787 Ga0501074_0000410
1788 Ga0501076_0076261
1789 Ga0501206_074929
1790 Ga0501079_0003486
1791 Ga0501080_0021702
1792 Ga0501081_1332107
1793 Ga0501083_0001291
1794 Ga0501035_0002394
1795 Ga0501035_1181636
1796 Ga0501044_0001196
1797 Ga0501045_0006983
1798 nmdc:mga03683_118379_c1
1799 nmdc:mga03683_386861_c1
1800 nmdc:mga03n38_410435_c1
1801 nmdc:mga03n38_4113_c1
1802 nmdc:mga03n38_430252_c1
1803 nmdc:mga00v17_225823_c1
1804 nmdc:mga0yw44_19629_c1
1805 nmdc:mga0yw44_350464_c1
1806 nmdc:mga0yw44_611864_c1
1807 nmdc:mga0yw44_941962_c1
1808 nmdc:mga0k408_722634_c1
1809 nmdc:mga0k408_806534_c1
1810 nmdc:mga0k408_899414_c1
1811 nmdc:mga06z11_31231_c1
1812 nmdc:mga06z11_38397_c1
1813 nmdc:mga06z11_603081_c1
1814 nmdc:mga06z11_71563_c1
1815 nmdc:mga06z11_77383_c1
1816 nmdc:mga04h51_26513_c1
1817 nmdc:mga04h51_292870_c1
1818 nmdc:mga04h51_8029_c1
1819 nmdc:mga07m45_23727_c1
1820 nmdc:mga07m45_25511_c1
1821 nmdc:mga07m45_317433_c1
1822 nmdc:mga07m45_62351_c1
1823 nmdc:mga05p37_987128_c1
1824 nmdc:mga0n895_168788_c1
1825 nmdc:mga0n895_767238_c1
1826 nmdc:mga08x19_762986_c1
1827 nmdc:mga08x19_77303_c1
1828 nmdc:mga0a205_1147625_c1
1829 nmdc:mga0sz30_107309_c1
1830 nmdc:mga0sz30_153992_c1
1831 nmdc:mga0sz30_16040_c1
1832 Ga0495601_0128582
1833 Ga0495612_0037955
1834 Ga0495612_0425992
1835 Ga0495655_0096258
1836 Ga0495655_0172314
1837 Ga0495655_0292050
1838 Ga0500578_0220529
1839 Ga0500643_139681
1840 Ga0500644_0547979
1841 Ga0500581_228087
1842 Ga0500646_0104591
1843 Ga0500583_0107356
1844 Ga0500583_0344896
1845 Ga0500566_0037689
1846 Ga0500641_0002883
1847 Ga0500641_0162580
1848 Ga0500554_010861
1849 Ga0500562_138856
1850 Ga0500572_000343
1851 Ga0500575_233472
1852 Ga0500594_0199739
1853 Ga0500595_002526
1854 Ga0500595_002841
1855 Ga0500595_014884
1856 Ga0500595_069573
1857 Ga0500642_0057963
1858 Ga0500658_0118958
1859 Ga0500658_0428799
1860 Ga0500559_0000552
1861 Ga0500559_0428251
1862 Ga0500559_0507412
1863 Ga0500568_0128311
1864 Ga0500573_0332473
1865 Ga0500577_0217013
1866 Ga0500588_0078753
1867 Ga0500622_0148078
1868 Ga0500622_0429427
1869 Ga0500627_0336523
1870 Ga0500634_0307132
1871 Ga0500636_0073845
1872 Ga0500636_0181875
1873 Ga0500636_0345823
1874 Ga0500637_0068782
1875 Ga0500637_0534856
1876 Ga0500576_033159
1877 Ga0500611_066118
1878 Ga0500645_043769
1879 Ga0500645_187404
1880 Ga0500552_024084
1881 Ga0500596_006906
1882 Ga0500596_039259
1883 Ga0501084_0030229
1884 Ga0500661_001357
1885 Ga0501082_0011824
1886 Ga0466962_0049345
1887 2509147942
1888 2513655720
1889 2513916202
1890 2671121645
1891 2793067835
1892 2906663592

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06094

GGACT

Gamma-glutamyl cyclotransferase, AIG2-like

39

152

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qik-assembly1.cif.gz_A crystal structure of ykqa from bacillus subtilis. northeast structural genomics target sr631 0.863 2 129
1v30-assembly1.cif.gz_A crystal structure of uncharacterized protein ph0828 from pyrococcus horikoshii 0.7869 3 129
1xhs-assembly1.cif.gz_A solution nmr structure of protein ytfp from escherichia coli. northeast structural genomics consortium target er111. 0.7544 5 131
1vkb-assembly1.cif.gz_A crystal structure of an aig2-like protein (a2ld1, ggact, mgc7867) from mus musculus at 1.90 a resolution 0.744 4 132
5c5z-assembly1.cif.gz_B crystal structure analysis of c4763, a uropathogenic e. coli-specific protein 0.7312 1 128
ID Description Score Start End Superfamily
2qikA01 Alpha Beta;Roll;Hypothetical upf0131 protein ytfp;Gamma-glutamyl cyclotransferase-like 0.8618 3 129 3.10.490.10
af_Q58909_1_120_3.10.490.10 Alpha Beta;Roll;Hypothetical upf0131 protein ytfp;Gamma-glutamyl cyclotransferase-like 0.855 3 129 3.10.490.10
2qikA01 Alpha Beta;Roll;Hypothetical upf0131 protein ytfp;Gamma-glutamyl cyclotransferase-like 0.8251 3 129 3.10.490.10
af_Q58909_1_120_3.10.490.10 Alpha Beta;Roll;Hypothetical upf0131 protein ytfp;Gamma-glutamyl cyclotransferase-like 0.8158 3 129 3.10.490.10
af_Q9MBH1_1_115_3.10.490.10 Alpha Beta;Roll;Hypothetical upf0131 protein ytfp;Gamma-glutamyl cyclotransferase-like 0.7997 2 114 3.10.490.10
ID Description Score Start End GO Terms
AF-A0A1X3H7V9-F1-model_v4 Gamma-glutamylcyclotransferase family protein 0.9859 1 130 GO:0005829
GO:0016740
GO:0061929
AF-A0A5P6P2L2-F1-model_v4 Gamma-glutamylcyclotransferase family protein 0.9817 1 131 GO:0005829
GO:0016740
GO:0061929
AF-A0A2U8PNR9-F1-model_v4 Gamma-glutamylcyclotransferase family protein 0.9788 1 132 GO:0005829
GO:0016740
GO:0061929
AF-Q07SS2-F1-model_v4 Gamma-glutamylcyclotransferase AIG2-like domain-containing protein 0.9787 2 132
AF-A0A7Y4RVP0-F1-model_v4 Gamma-glutamylcyclotransferase 0.9768 4 124 GO:0016740

Map