F486359
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 942 | 451 | 923 | 115 |
Family's Representative Sequence
| Representative Sequence | 3300009101|Ga0105247_10675222|Ga0105247_106752222 |
| Length | 114 |
| Sequence | VIGLPAETRVWLAAGATDMRKGFDGLAMAVQERLRQDPFSGHVFVFRGRGDLIKVLWWSGDGLCLFAKRLERGRFVWPGTQAGVAHLSAAQLSMLLEGIDWRHPARTWRPEFAG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513237083 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 2 | 2515154123 | Trinickia symbiotica JPY347 | Isolate | Nodule |
| 3 | 2600255067 | Paraburkholderia kururiensis thiooxydans NBRC 107107 | Isolate | Unclassified |
| 4 | 2643221645 | Massilia sp. Root351 | Isolate | Unclassified |
| 5 | 2858688981 | Cupriavidus sp. UYMMa02A | Isolate | Unclassified |
| 6 | 2870068957 | Burkholderia sp. JP2-270 | Isolate | Unclassified |
| 7 | 2885266251 | Ralstonia sp. SET104 | Isolate | Nodule |
| 8 | 2904615490 | Paraburkholderia franconis CNPSo 3157 | Isolate | Unclassified |
| 9 | 2928058823 | Ralstonia sp. 1138 | Isolate | Unclassified |
| 10 | 2928108538 | Paraburkholderia terricola 1595 | Isolate | Rhizosphere |
| 11 | 2928135762 | Paraburkholderia terricola 1988 | Isolate | Unclassified |
| 12 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 13 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 14 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 15 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 16 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 17 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 18 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 19 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 20 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 21 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 22 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 23 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 24 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 25 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 26 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 27 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 28 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 29 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 30 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 31 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 32 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 33 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 34 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 38 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 41 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 44 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 54 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 64 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 65 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 66 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 68 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 69 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 71 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 73 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 76 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 78 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 79 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 80 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 82 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 83 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 84 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 85 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 86 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 87 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 88 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 89 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 90 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 91 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 93 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 94 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 96 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 97 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 98 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 99 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 100 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 102 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 103 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 116 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 130 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 133 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 134 | 3300016635 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 | Metagenome | Rhizosphere |
| 135 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 137 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 138 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 139 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 140 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 141 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 142 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 143 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 146 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 147 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 148 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 149 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 150 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 151 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 212 | 3300028023 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 | Metagenome | Rhizosphere |
| 213 | 3300028036 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 | Metagenome | Rhizosphere |
| 214 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 218 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 219 | 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 220 | 3300031018 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 221 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 222 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 223 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 224 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 225 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 226 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 227 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 228 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 229 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 230 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 231 | 3300033544 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 | Metagenome | Unclassified |
| 232 | 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Metagenome | Unclassified |
| 233 | 3300033546 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE2 | Metagenome | Unclassified |
| 234 | 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Metagenome | Unclassified |
| 235 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 236 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 237 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 238 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 239 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 240 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 241 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 242 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 243 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 244 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 245 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 246 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 247 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 248 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 249 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 250 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 251 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 252 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 253 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 254 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 255 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 256 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 257 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 258 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 259 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 260 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 261 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 262 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 263 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 264 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 265 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 266 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 267 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 268 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 269 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 270 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 271 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 272 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 273 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 274 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 275 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 276 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 277 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 278 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 279 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 376 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 377 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 378 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 379 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 380 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 381 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 382 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 383 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 384 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 385 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 386 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 387 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 388 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 389 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 390 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 391 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 392 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 393 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 394 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 395 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 396 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 397 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 398 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 399 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 400 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 401 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 402 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 405 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 406 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 407 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 408 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 409 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 410 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 411 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 412 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 413 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 414 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 415 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 416 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 417 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 418 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 419 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 420 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 421 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 422 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 423 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 424 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 425 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 426 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 429 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 430 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 431 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 432 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 433 | 3300053127 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere | Metagenome | Endosphere |
| 434 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 435 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 436 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 437 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 438 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 439 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 440 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 441 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 442 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 443 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 444 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 445 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 446 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 447 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 448 | 644736347 | Cupriavidus taiwanensis LMG 19424 | Isolate | Nodule |
| 449 | 8003955200 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 450 | 8020953355 | Burkholderia sp. BE24 | Isolate | Rhizosphere |
| 451 | 8021120328 | Burkholderia sp. LS-044 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.13 |
| Metatranscriptomes | 0.85 |
| Isolates | 2.02 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.82 |
| Nodule | 0.74 |
| Rhizoplane | 5.94 |
| Rhizosphere | 83.55 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.94 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24741J21665_1005042 | 3300001915 | Bacteria | 2825 |
| 2 | JGI24747J21853_1009708 | 3300001978 | Bacteria | 955 |
| 3 | JGI24740J21852_10002727 | 3300001979 | Bacteria | 7899 |
| 4 | JGI24740J21852_10017586 | 3300001979 | Bacteria | 2552 |
| 5 | JGI24739J22299_10016556 | 3300001989 | Bacteria | 2667 |
| 6 | JGI24739J22299_10017427 | 3300001989 | Bacteria | 2591 |
| 7 | JGI24743J22301_10059244 | 3300001991 | Bacteria | 787 |
| 8 | JGI24735J21928_10060995 | 3300002067 | Bacteria | 1083 |
| 9 | JGI24745J21846_1003085 | 3300002073 | Bacteria | 1728 |
| 10 | JGI24748J21848_1001628 | 3300002074 | Bacteria | 2492 |
| 11 | JGI24738J21930_10007688 | 3300002075 | Bacteria | 2476 |
| 12 | JGI24744J21845_10035381 | 3300002077 | Bacteria | 945 |
| 13 | JGI24033J26618_1018913 | 3300002155 | Bacteria | 870 |
| 14 | JGI24034J26672_10002201 | 3300002239 | Bacteria | 2658 |
| 15 | JGI24034J26672_10002230 | 3300002239 | Bacteria | 2642 |
| 16 | JGI24742J22300_10003465 | 3300002244 | Bacteria | 2558 |
| 17 | JGI25156J39149_1000313 | 3300002705 | Bacteria | 32091 |
| 18 | rootL2_10001338 | 3300003322 | Bacteria | 2431 |
| 19 | rootL2_10086943 | 3300003322 | Bacteria | 3631 |
| 20 | Ga0055527_1003008 | 3300003760 | Bacteria | 2632 |
| 21 | Ga0055542_1031490 | 3300003762 | Bacteria | 676 |
| 22 | Ga0055526_1011534 | 3300003771 | Bacteria | 3967 |
| 23 | Ga0055526_1025228 | 3300003771 | Bacteria | 1913 |
| 24 | Ga0055537_1003426 | 3300003773 | Bacteria | 4881 |
| 25 | Ga0055524_1000607 | 3300003775 | Bacteria | 25734 |
| 26 | Ga0055534_1000305 | 3300003784 | Bacteria | 32979 |
| 27 | Ga0055534_1001282 | 3300003784 | Bacteria | 10195 |
| 28 | JGI25405J52794_10002528 | 3300003911 | Bacteria | 3158 |
| 29 | Ga0070658_10002107 | 3300005327 | Bacteria | 16688 |
| 30 | Ga0070658_10081384 | 3300005327 | Bacteria | 2660 |
| 31 | Ga0070658_10277305 | 3300005327 | Bacteria | 1427 |
| 32 | Ga0070676_10026136 | 3300005328 | Bacteria | 3304 |
| 33 | Ga0070676_10165545 | 3300005328 | Bacteria | 1426 |
| 34 | Ga0070683_100278467 | 3300005329 | Bacteria | 1591 |
| 35 | Ga0070683_100547981 | 3300005329 | Bacteria | 1106 |
| 36 | Ga0070690_100465991 | 3300005330 | Bacteria | 939 |
| 37 | Ga0070670_100214660 | 3300005331 | Bacteria | 1673 |
| 38 | Ga0070677_10033549 | 3300005333 | Bacteria | 1977 |
| 39 | Ga0068869_101255126 | 3300005334 | Bacteria | 652 |
| 40 | Ga0070680_100094871 | 3300005336 | Bacteria | 2473 |
| 41 | Ga0070680_100792647 | 3300005336 | Unclassified | 816 |
| 42 | Ga0070682_100015375 | 3300005337 | Bacteria | 4433 |
| 43 | Ga0070682_100022657 | 3300005337 | Bacteria | 3723 |
| 44 | Ga0070682_101290290 | 3300005337 | Bacteria | 620 |
| 45 | Ga0068868_100490428 | 3300005338 | Bacteria | 1075 |
| 46 | Ga0070660_100088326 | 3300005339 | Bacteria | 2441 |
| 47 | Ga0070660_100109490 | 3300005339 | Bacteria | 2196 |
| 48 | Ga0070660_100149293 | 3300005339 | Bacteria | 1879 |
| 49 | Ga0070660_100238177 | 3300005339 | Bacteria | 1482 |
| 50 | Ga0070687_100017936 | 3300005343 | Bacteria | 3265 |
| 51 | Ga0070661_100000020 | 3300005344 | Bacteria | 132014 |
| 52 | Ga0070661_100055823 | 3300005344 | Bacteria | 2892 |
| 53 | Ga0070661_100109110 | 3300005344 | Bacteria | 2065 |
| 54 | Ga0070661_100335314 | 3300005344 | Bacteria | 1184 |
| 55 | Ga0070661_100505789 | 3300005344 | Bacteria | 967 |
| 56 | Ga0070668_100054856 | 3300005347 | Bacteria | 3075 |
| 57 | Ga0070669_100044463 | 3300005353 | Bacteria | 3236 |
| 58 | Ga0070669_100297475 | 3300005353 | Bacteria | 1297 |
| 59 | Ga0070675_100060346 | 3300005354 | Bacteria | 3131 |
| 60 | Ga0070671_100044576 | 3300005355 | Bacteria | 3685 |
| 61 | Ga0070674_100040302 | 3300005356 | Bacteria | 3159 |
| 62 | Ga0070673_100062935 | 3300005364 | Bacteria | 2950 |
| 63 | Ga0070688_100020352 | 3300005365 | Bacteria | 3857 |
| 64 | Ga0070659_100034303 | 3300005366 | Bacteria | 3947 |
| 65 | Ga0070659_100040676 | 3300005366 | Bacteria | 3633 |
| 66 | Ga0070659_100314025 | 3300005366 | Bacteria | 1309 |
| 67 | Ga0070659_100453758 | 3300005366 | Bacteria | 1088 |
| 68 | Ga0070667_100010218 | 3300005367 | Bacteria | 7754 |
| 69 | Ga0070713_100988745 | 3300005436 | Bacteria | 811 |
| 70 | Ga0070713_101500065 | 3300005436 | Bacteria | 654 |
| 71 | Ga0070701_10295304 | 3300005438 | Bacteria | 994 |
| 72 | Ga0070711_100058711 | 3300005439 | Bacteria | 2668 |
| 73 | Ga0070700_100308832 | 3300005441 | Bacteria | 1157 |
| 74 | Ga0070663_100013217 | 3300005455 | Bacteria | 5254 |
| 75 | Ga0070663_100055957 | 3300005455 | Bacteria | 2825 |
| 76 | Ga0070663_100351459 | 3300005455 | Bacteria | 1193 |
| 77 | Ga0070678_100033208 | 3300005456 | Bacteria | 3580 |
| 78 | Ga0070678_101237162 | 3300005456 | Bacteria | 693 |
| 79 | Ga0070662_100033646 | 3300005457 | Bacteria | 3611 |
| 80 | Ga0070681_10096477 | 3300005458 | Bacteria | 2904 |
| 81 | Ga0070681_10111126 | 3300005458 | Bacteria | 2679 |
| 82 | Ga0070681_11775728 | 3300005458 | Bacteria | 544 |
| 83 | Ga0068867_100446445 | 3300005459 | Bacteria | 1101 |
| 84 | Ga0068867_101239220 | 3300005459 | Bacteria | 686 |
| 85 | Ga0070685_10148733 | 3300005466 | Bacteria | 1482 |
| 86 | Ga0070699_100973035 | 3300005518 | Bacteria | 778 |
| 87 | Ga0070679_100102337 | 3300005530 | Bacteria | 2850 |
| 88 | Ga0070679_100104373 | 3300005530 | Bacteria | 2820 |
| 89 | Ga0070679_100383559 | 3300005530 | Bacteria | 1352 |
| 90 | Ga0070684_100440712 | 3300005535 | Bacteria | 1203 |
| 91 | Ga0070684_100593730 | 3300005535 | Bacteria | 1029 |
| 92 | Ga0070697_101132858 | 3300005536 | Unclassified | 697 |
| 93 | Ga0068853_100091722 | 3300005539 | Bacteria | 2672 |
| 94 | Ga0068853_100187251 | 3300005539 | Bacteria | 1879 |
| 95 | Ga0070672_100046874 | 3300005543 | Bacteria | 3351 |
| 96 | Ga0070686_100075436 | 3300005544 | Bacteria | 2218 |
| 97 | Ga0070696_101079236 | 3300005546 | Unclassified | 674 |
| 98 | Ga0070665_100057831 | 3300005548 | Bacteria | 3887 |
| 99 | Ga0070665_100656436 | 3300005548 | Bacteria | 1062 |
| 100 | Ga0070665_100834483 | 3300005548 | Bacteria | 935 |
| 101 | Ga0068855_100439959 | 3300005563 | Bacteria | 1424 |
| 102 | Ga0068855_100592503 | 3300005563 | Bacteria | 1196 |
| 103 | Ga0070664_100079351 | 3300005564 | Bacteria | 2825 |
| 104 | Ga0070664_100081382 | 3300005564 | Bacteria | 2791 |
| 105 | Ga0070664_100217327 | 3300005564 | Bacteria | 1709 |
| 106 | Ga0070664_100472264 | 3300005564 | Bacteria | 1153 |
| 107 | Ga0068857_100054050 | 3300005577 | Bacteria | 3562 |
| 108 | Ga0068854_100027418 | 3300005578 | Bacteria | 3926 |
| 109 | Ga0068856_100000127 | 3300005614 | Bacteria | 76855 |
| 110 | Ga0068856_100468748 | 3300005614 | Bacteria | 1280 |
| 111 | Ga0070702_101144189 | 3300005615 | Bacteria | 624 |
| 112 | Ga0068852_100097176 | 3300005616 | Bacteria | 2649 |
| 113 | Ga0068852_100098280 | 3300005616 | Bacteria | 2635 |
| 114 | Ga0068852_100226719 | 3300005616 | Bacteria | 1779 |
| 115 | Ga0068852_100753746 | 3300005616 | Bacteria | 986 |
| 116 | Ga0068859_100111372 | 3300005617 | Bacteria | 2800 |
| 117 | Ga0068859_100119564 | 3300005617 | Bacteria | 2701 |
| 118 | Ga0068864_100101906 | 3300005618 | Bacteria | 2547 |
| 119 | Ga0068866_10125161 | 3300005718 | Bacteria | 1454 |
| 120 | Ga0068870_10124438 | 3300005840 | Bacteria | 1489 |
| 121 | Ga0068863_100086189 | 3300005841 | Bacteria | 2976 |
| 122 | Ga0068858_100088874 | 3300005842 | Bacteria | 2875 |
| 123 | Ga0068860_100061555 | 3300005843 | Bacteria | 3566 |
| 124 | Ga0068860_100392246 | 3300005843 | Bacteria | 1372 |
| 125 | Ga0068862_100012213 | 3300005844 | Bacteria | 7099 |
| 126 | Ga0068862_100077462 | 3300005844 | Bacteria | 2879 |
| 127 | Ga0068862_100095089 | 3300005844 | Bacteria | 2599 |
| 128 | Ga0068862_100431088 | 3300005844 | Bacteria | 1239 |
| 129 | Ga0081455_10077489 | 3300005937 | Bacteria | 2734 |
| 130 | Ga0070717_10081587 | 3300006028 | Plasmid | 2716 |
| 131 | Ga0075432_10018212 | 3300006058 | Bacteria | 2395 |
| 132 | Ga0070716_100245039 | 3300006173 | Bacteria | 1217 |
| 133 | Ga0097621_100242812 | 3300006237 | Bacteria | 1575 |
| 134 | Ga0075370_10153883 | 3300006353 | Bacteria | 1348 |
| 135 | Ga0068871_100037116 | 3300006358 | Bacteria | 3884 |
| 136 | Ga0075430_100004131 | 3300006846 | Bacteria | 12251 |
| 137 | Ga0075434_100495629 | 3300006871 | Unclassified | 1242 |
| 138 | Ga0075436_100066233 | 3300006914 | Bacteria | 2496 |
| 139 | Ga0097620_100111374 | 3300006931 | Bacteria | 2800 |
| 140 | Ga0097620_100119564 | 3300006931 | Bacteria | 2701 |
| 141 | Ga0099794_10639793 | 3300007265 | Unclassified | 564 |
| 142 | Ga0099795_10102393 | 3300007788 | Bacteria | 1125 |
| 143 | Ga0105251_10018978 | 3300009011 | Bacteria | 3642 |
| 144 | Ga0105251_10021475 | 3300009011 | Bacteria | 3369 |
| 145 | Ga0105244_10022263 | 3300009036 | Bacteria | 3490 |
| 146 | Ga0105250_10018493 | 3300009092 | Bacteria | 2822 |
| 147 | Ga0105240_10104334 | 3300009093 | Bacteria | 3443 |
| 148 | Ga0105240_10400197 | 3300009093 | Bacteria | 1547 |
| 149 | Ga0105240_10596767 | 3300009093 | Bacteria | 1216 |
| 150 | Ga0105240_11509117 | 3300009093 | Bacteria | 704 |
| 151 | Ga0105240_12140601 | 3300009093 | Bacteria | 580 |
| 152 | Ga0105247_10039970 | 3300009101 | Bacteria | 2866 |
| 153 | Ga0105247_10675222 | 3300009101 | Bacteria | 775 |
| 154 | Ga0105243_10197329 | 3300009148 | Bacteria | 1763 |
| 155 | Ga0105241_10052885 | 3300009174 | Bacteria | 3103 |
| 156 | Ga0105242_10024912 | 3300009176 | Bacteria | 4729 |
| 157 | Ga0105242_10206975 | 3300009176 | Bacteria | 1746 |
| 158 | Ga0105248_10011481 | 3300009177 | Bacteria | 9760 |
| 159 | Ga0105248_10017781 | 3300009177 | Bacteria | 7844 |
| 160 | Ga0105237_10145609 | 3300009545 | Bacteria | 2364 |
| 161 | Ga0105237_10167714 | 3300009545 | Bacteria | 2195 |
| 162 | Ga0105237_10380695 | 3300009545 | Bacteria | 1416 |
| 163 | Ga0105238_10069777 | 3300009551 | Bacteria | 3515 |
| 164 | Ga0105238_10084820 | 3300009551 | Bacteria | 3157 |
| 165 | Ga0105238_10196670 | 3300009551 | Bacteria | 1992 |
| 166 | Ga0105238_12884830 | 3300009551 | Unclassified | 517 |
| 167 | Ga0105249_10098303 | 3300009553 | Bacteria | 2748 |
| 168 | Ga0105249_10200163 | 3300009553 | Bacteria | 1954 |
| 169 | Ga0105249_12305342 | 3300009553 | Bacteria | 611 |
| 170 | Ga0099796_10110077 | 3300010159 | Bacteria | 1047 |
| 171 | Ga0099796_10168903 | 3300010159 | Unclassified | 871 |
| 172 | Ga0105239_10130517 | 3300010375 | Bacteria | 2795 |
| 173 | Ga0105239_10251230 | 3300010375 | Bacteria | 1986 |
| 174 | Ga0105239_10272471 | 3300010375 | Bacteria | 1904 |
| 175 | Ga0105239_10983805 | 3300010375 | Bacteria | 970 |
| 176 | Ga0105239_11147064 | 3300010375 | Bacteria | 895 |
| 177 | Ga0105239_11209608 | 3300010375 | Bacteria | 871 |
| 178 | Ga0105246_10019099 | 3300011119 | Bacteria | 4374 |
| 179 | Ga0157373_10000025 | 3300013100 | Bacteria | 146728 |
| 180 | Ga0157373_10060878 | 3300013100 | Bacteria | 2674 |
| 181 | Ga0157371_10054973 | 3300013102 | Bacteria | 2825 |
| 182 | Ga0157371_10084086 | 3300013102 | Bacteria | 2254 |
| 183 | Ga0157371_10484236 | 3300013102 | Bacteria | 912 |
| 184 | Ga0157370_10000027 | 3300013104 | Bacteria | 146729 |
| 185 | Ga0157369_10000167 | 3300013105 | Bacteria | 93483 |
| 186 | Ga0157369_10093201 | 3300013105 | Bacteria | 3215 |
| 187 | Ga0157369_10173487 | 3300013105 | Bacteria | 2271 |
| 188 | Ga0157369_10933260 | 3300013105 | Bacteria | 890 |
| 189 | Ga0157374_10081431 | 3300013296 | Bacteria | 3072 |
| 190 | Ga0157378_10071387 | 3300013297 | Bacteria | 3118 |
| 191 | Ga0163162_10000496 | 3300013306 | Bacteria | 36591 |
| 192 | Ga0163162_10182801 | 3300013306 | Bacteria | 2223 |
| 193 | Ga0163162_10641163 | 3300013306 | Bacteria | 1186 |
| 194 | Ga0163162_11366250 | 3300013306 | Bacteria | 806 |
| 195 | Ga0163162_11771038 | 3300013306 | Bacteria | 706 |
| 196 | Ga0157372_10136489 | 3300013307 | Bacteria | 2825 |
| 197 | Ga0157372_10369673 | 3300013307 | Bacteria | 1671 |
| 198 | Ga0157372_10594254 | 3300013307 | Bacteria | 1290 |
| 199 | Ga0157375_10144458 | 3300013308 | Bacteria | 2509 |
| 200 | Ga0157375_10346616 | 3300013308 | Bacteria | 1651 |
| 201 | Ga0163163_10126276 | 3300014325 | Bacteria | 2596 |
| 202 | Ga0157380_10265433 | 3300014326 | Bacteria | 1562 |
| 203 | Ga0182008_10042135 | 3300014497 | Unclassified | 2275 |
| 204 | Ga0182008_10138165 | 3300014497 | Bacteria | 1218 |
| 205 | Ga0182008_10152553 | 3300014497 | Bacteria | 1159 |
| 206 | Ga0182008_10193742 | 3300014497 | Bacteria | 1032 |
| 207 | Ga0157377_11099273 | 3300014745 | Bacteria | 609 |
| 208 | Ga0157376_10057043 | 3300014969 | Bacteria | 3265 |
| 209 | Ga0157376_10103782 | 3300014969 | Bacteria | 2490 |
| 210 | Ga0157376_11265735 | 3300014969 | Bacteria | 767 |
| 211 | Ga0182006_1002778 | 3300015261 | Bacteria | 9353 |
| 212 | Ga0182007_10014896 | 3300015262 | Bacteria | 2916 |
| 213 | Ga0182007_10055886 | 3300015262 | Bacteria | 1297 |
| 214 | Ga0182007_10062331 | 3300015262 | Bacteria | 1222 |
| 215 | Ga0182007_10095006 | 3300015262 | Bacteria | 983 |
| 216 | Ga0183361_10008 | 3300016635 | Bacteria | 259171 |
| 217 | Ga0163161_10004159 | 3300017792 | Bacteria | 10119 |
| 218 | Ga0163161_10055839 | 3300017792 | Bacteria | 2867 |
| 219 | Ga0154015_1022863 | 3300020610 | Bacteria | 22537 |
| 220 | Ga0213873_10020690 | 3300021358 | Bacteria | 1539 |
| 221 | Ga0213873_10049147 | 3300021358 | Bacteria | 1111 |
| 222 | Ga0213872_10005360 | 3300021361 | Bacteria | 6619 |
| 223 | Ga0213872_10019547 | 3300021361 | Bacteria | 3118 |
| 224 | Ga0213872_10243586 | 3300021361 | Bacteria | 759 |
| 225 | Ga0213874_10010242 | 3300021377 | Bacteria | 2342 |
| 226 | Ga0213874_10011948 | 3300021377 | Bacteria | 2214 |
| 227 | Ga0213876_10158967 | 3300021384 | Bacteria | 1202 |
| 228 | Ga0224572_1021203 | 3300024225 | Bacteria | 1247 |
| 229 | Ga0224572_1023066 | 3300024225 | Bacteria | 1195 |
| 230 | Ga0228598_1005334 | 3300024227 | Plasmid | 2690 |
| 231 | Ga0228598_1009477 | 3300024227 | Bacteria | 1951 |
| 232 | Ga0228598_1019584 | 3300024227 | Bacteria | 1333 |
| 233 | Ga0209672_101662 | 3300025228 | Bacteria | 7236 |
| 234 | Ga0209148_1001334 | 3300025254 | Bacteria | 13077 |
| 235 | Ga0209759_1000562 | 3300025256 | Bacteria | 37533 |
| 236 | Ga0209565_1000094 | 3300025263 | Bacteria | 134853 |
| 237 | Ga0209673_1005825 | 3300025273 | Bacteria | 6109 |
| 238 | Ga0209675_1000145 | 3300025291 | Bacteria | 93978 |
| 239 | Ga0209675_1002086 | 3300025291 | Bacteria | 10622 |
| 240 | Ga0209564_1000119 | 3300025295 | Bacteria | 204926 |
| 241 | Ga0209564_1000509 | 3300025295 | Bacteria | 63951 |
| 242 | Ga0209256_1001721 | 3300025299 | Bacteria | 20987 |
| 243 | Ga0207697_10151032 | 3300025315 | Bacteria | 1011 |
| 244 | Ga0207696_1014964 | 3300025711 | Bacteria | 2642 |
| 245 | Ga0207655_1020250 | 3300025728 | Bacteria | 3427 |
| 246 | Ga0207713_1021650 | 3300025735 | Bacteria | 3076 |
| 247 | Ga0207682_10035286 | 3300025893 | Bacteria | 2020 |
| 248 | Ga0207642_10108918 | 3300025899 | Bacteria | 1407 |
| 249 | Ga0207710_10023555 | 3300025900 | Bacteria | 2647 |
| 250 | Ga0207688_10070359 | 3300025901 | Bacteria | 1984 |
| 251 | Ga0207680_10017137 | 3300025903 | Bacteria | 3821 |
| 252 | Ga0207647_10047227 | 3300025904 | Bacteria | 2679 |
| 253 | Ga0207647_10210967 | 3300025904 | Bacteria | 1121 |
| 254 | Ga0207645_10015542 | 3300025907 | Bacteria | 5054 |
| 255 | Ga0207645_10318662 | 3300025907 | Bacteria | 1037 |
| 256 | Ga0207705_10000555 | 3300025909 | Bacteria | 31400 |
| 257 | Ga0207705_10032073 | 3300025909 | Bacteria | 3753 |
| 258 | Ga0207705_10087143 | 3300025909 | Bacteria | 2282 |
| 259 | Ga0207654_10039578 | 3300025911 | Bacteria | 2652 |
| 260 | Ga0207707_10076195 | 3300025912 | Bacteria | 2927 |
| 261 | Ga0207707_10099636 | 3300025912 | Bacteria | 2540 |
| 262 | Ga0207707_10352893 | 3300025912 | Bacteria | 1267 |
| 263 | Ga0207707_11551017 | 3300025912 | Bacteria | 523 |
| 264 | Ga0207695_10028067 | 3300025913 | Bacteria | 6251 |
| 265 | Ga0207695_10095130 | 3300025913 | Bacteria | 2984 |
| 266 | Ga0207695_10280026 | 3300025913 | Bacteria | 1561 |
| 267 | Ga0207695_10952416 | 3300025913 | Bacteria | 738 |
| 268 | Ga0207671_10061896 | 3300025914 | Bacteria | 2778 |
| 269 | Ga0207671_10148567 | 3300025914 | Bacteria | 1809 |
| 270 | Ga0207671_10161675 | 3300025914 | Bacteria | 1734 |
| 271 | Ga0207663_10079303 | 3300025916 | Unclassified | 2143 |
| 272 | Ga0207660_10077345 | 3300025917 | Bacteria | 2436 |
| 273 | Ga0207657_10070312 | 3300025919 | Bacteria | 2967 |
| 274 | Ga0207657_10070381 | 3300025919 | Bacteria | 2965 |
| 275 | Ga0207657_10229292 | 3300025919 | Bacteria | 1486 |
| 276 | Ga0207649_10000059 | 3300025920 | Bacteria | 99273 |
| 277 | Ga0207649_10022386 | 3300025920 | Bacteria | 3650 |
| 278 | Ga0207649_10283152 | 3300025920 | Bacteria | 1206 |
| 279 | Ga0207652_10100649 | 3300025921 | Bacteria | 2551 |
| 280 | Ga0207652_10503561 | 3300025921 | Unclassified | 1090 |
| 281 | Ga0207646_10289944 | 3300025922 | Bacteria | 1479 |
| 282 | Ga0207681_10029071 | 3300025923 | Bacteria | 3585 |
| 283 | Ga0207694_10074681 | 3300025924 | Bacteria | 2653 |
| 284 | Ga0207650_10180087 | 3300025925 | Bacteria | 1684 |
| 285 | Ga0207659_10070485 | 3300025926 | Bacteria | 2549 |
| 286 | Ga0207687_10077351 | 3300025927 | Bacteria | 2393 |
| 287 | Ga0207700_10198550 | 3300025928 | Bacteria | 1689 |
| 288 | Ga0207700_10351353 | 3300025928 | Bacteria | 1284 |
| 289 | Ga0207644_10035196 | 3300025931 | Bacteria | 3507 |
| 290 | Ga0207690_10118505 | 3300025932 | Bacteria | 1919 |
| 291 | Ga0207690_10183749 | 3300025932 | Bacteria | 1576 |
| 292 | Ga0207690_10657510 | 3300025932 | Bacteria | 859 |
| 293 | Ga0207706_10063895 | 3300025933 | Bacteria | 3241 |
| 294 | Ga0207706_10601590 | 3300025933 | Bacteria | 944 |
| 295 | Ga0207686_10017592 | 3300025934 | Bacteria | 4031 |
| 296 | Ga0207686_10241097 | 3300025934 | Bacteria | 1316 |
| 297 | Ga0207709_10050849 | 3300025935 | Bacteria | 2537 |
| 298 | Ga0207670_10046909 | 3300025936 | Bacteria | 2873 |
| 299 | Ga0207669_10022048 | 3300025937 | Bacteria | 3375 |
| 300 | Ga0207665_10095927 | 3300025939 | Bacteria | 2062 |
| 301 | Ga0207691_10090905 | 3300025940 | Bacteria | 2736 |
| 302 | Ga0207711_10006542 | 3300025941 | Bacteria | 9812 |
| 303 | Ga0207711_10085731 | 3300025941 | Bacteria | 2760 |
| 304 | Ga0207689_10162074 | 3300025942 | Bacteria | 1842 |
| 305 | Ga0207661_10376807 | 3300025944 | Bacteria | 1284 |
| 306 | Ga0207679_10043701 | 3300025945 | Bacteria | 3228 |
| 307 | Ga0207679_10059952 | 3300025945 | Bacteria | 2825 |
| 308 | Ga0207679_10060822 | 3300025945 | Bacteria | 2808 |
| 309 | Ga0207679_10154573 | 3300025945 | Bacteria | 1872 |
| 310 | Ga0207667_10008962 | 3300025949 | Bacteria | 11837 |
| 311 | Ga0207651_10075404 | 3300025960 | Bacteria | 2406 |
| 312 | Ga0207712_10062612 | 3300025961 | Bacteria | 2645 |
| 313 | Ga0207668_10078971 | 3300025972 | Bacteria | 2378 |
| 314 | Ga0207640_10000175 | 3300025981 | Bacteria | 46495 |
| 315 | Ga0207658_10017015 | 3300025986 | Bacteria | 5005 |
| 316 | Ga0207703_10094456 | 3300026035 | Bacteria | 2521 |
| 317 | Ga0207639_10267809 | 3300026041 | Bacteria | 1497 |
| 318 | Ga0207639_10514659 | 3300026041 | Bacteria | 1095 |
| 319 | Ga0207678_10000009 | 3300026067 | Bacteria | 156690 |
| 320 | Ga0207678_10067563 | 3300026067 | Bacteria | 3068 |
| 321 | Ga0207678_10356406 | 3300026067 | Bacteria | 1262 |
| 322 | Ga0207708_10221807 | 3300026075 | Bacteria | 1515 |
| 323 | Ga0207702_10000896 | 3300026078 | Bacteria | 30934 |
| 324 | Ga0207702_11291968 | 3300026078 | Bacteria | 724 |
| 325 | Ga0207641_10101348 | 3300026088 | Bacteria | 2537 |
| 326 | Ga0207648_10783482 | 3300026089 | Bacteria | 887 |
| 327 | Ga0207648_11551748 | 3300026089 | Bacteria | 622 |
| 328 | Ga0207676_10106592 | 3300026095 | Bacteria | 2335 |
| 329 | Ga0207674_10071938 | 3300026116 | Bacteria | 3474 |
| 330 | Ga0207683_10072667 | 3300026121 | Bacteria | 3042 |
| 331 | Ga0207683_10999560 | 3300026121 | Bacteria | 776 |
| 332 | Ga0207698_10103485 | 3300026142 | Bacteria | 2366 |
| 333 | Ga0207698_10530163 | 3300026142 | Bacteria | 1151 |
| 334 | Ga0207698_10827067 | 3300026142 | Bacteria | 930 |
| 335 | Ga0207698_11512581 | 3300026142 | Bacteria | 687 |
| 336 | Ga0209996_1040785 | 3300027395 | Unclassified | 690 |
| 337 | Ga0209974_10134153 | 3300027876 | Bacteria | 884 |
| 338 | Ga0207428_10077306 | 3300027907 | Bacteria | 2606 |
| 339 | Ga0265357_1002288 | 3300028023 | Bacteria | 1547 |
| 340 | Ga0265355_1000247 | 3300028036 | Bacteria | 2523 |
| 341 | Ga0268266_10034730 | 3300028379 | Bacteria | 4288 |
| 342 | Ga0268266_10833020 | 3300028379 | Bacteria | 891 |
| 343 | Ga0268265_10008523 | 3300028380 | Bacteria | 6931 |
| 344 | Ga0268265_10053875 | 3300028380 | Bacteria | 3049 |
| 345 | Ga0268265_10424989 | 3300028380 | Bacteria | 1235 |
| 346 | Ga0268265_11094164 | 3300028380 | Bacteria | 791 |
| 347 | Ga0268264_10838429 | 3300028381 | Bacteria | 920 |
| 348 | Ga0268264_11102276 | 3300028381 | Bacteria | 802 |
| 349 | Ga0307517_10200381 | 3300028786 | Bacteria | 1249 |
| 350 | Ga0265762_1024088 | 3300030760 | Bacteria | 1130 |
| 351 | Ga0265763_1035902 | 3300030763 | Unclassified | 581 |
| 352 | Ga0265773_1006515 | 3300031018 | Unclassified | 885 |
| 353 | Ga0265773_1022953 | 3300031018 | Bacteria | 627 |
| 354 | Ga0265760_10005309 | 3300031090 | Bacteria | 3694 |
| 355 | Ga0265760_10026231 | 3300031090 | Unclassified | 1704 |
| 356 | Ga0265760_10034003 | 3300031090 | Bacteria | 1507 |
| 357 | Ga0265330_10175831 | 3300031235 | Bacteria | 907 |
| 358 | Ga0265331_10215290 | 3300031250 | Bacteria | 864 |
| 359 | Ga0307509_10004447 | 3300031507 | Bacteria | 20206 |
| 360 | Ga0307408_100395406 | 3300031548 | Bacteria | 1185 |
| 361 | Ga0307408_101161592 | 3300031548 | Bacteria | 719 |
| 362 | Ga0307508_10469166 | 3300031616 | Bacteria | 852 |
| 363 | Ga0265314_10036097 | 3300031711 | Bacteria | 3596 |
| 364 | Ga0265342_10229190 | 3300031712 | Unclassified | 998 |
| 365 | Ga0307516_10167601 | 3300031730 | Bacteria | 1940 |
| 366 | Ga0307414_10457975 | 3300032004 | Bacteria | 1120 |
| 367 | Ga0316215_1009276 | 3300033544 | Unclassified | 968 |
| 368 | Ga0316214_1015175 | 3300033545 | Bacteria | 1061 |
| 369 | Ga0316213_1002203 | 3300033546 | Unclassified | 1325 |
| 370 | Ga0316212_1010904 | 3300033547 | Bacteria | 1300 |
| 371 | Ga0373936_0449115 | 3300035113 | Bacteria | 596 |
| 372 | Ga0373956_0467300 | 3300035119 | Unclassified | 602 |
| 373 | Ga0373937_0076075 | 3300036401 | Bacteria | 3100 |
| 374 | Ga0373937_0082509 | 3300036401 | Bacteria | 2974 |
| 375 | Ga0373925_0615709 | 3300037068 | Unclassified | 894 |
| 376 | Ga0395899_0239709 | 3300037312 | Bacteria | 1248 |
| 377 | Ga0395899_0272635 | 3300037312 | Bacteria | 1154 |
| 378 | Ga0395900_0079562 | 3300037418 | Bacteria | 3368 |
| 379 | Ga0395900_0218868 | 3300037418 | Bacteria | 1920 |
| 380 | Ga0395900_0351838 | 3300037418 | Bacteria | 1447 |
| 381 | Ga0395900_0478379 | 3300037418 | Bacteria | 1198 |
| 382 | Ga0395900_0530271 | 3300037418 | Bacteria | 1124 |
| 383 | Ga0395898_0024501 | 3300037466 | Bacteria | 6086 |
| 384 | Ga0395898_0059019 | 3300037466 | Bacteria | 3734 |
| 385 | Ga0395898_0123525 | 3300037466 | Bacteria | 2480 |
| 386 | Ga0395898_0284458 | 3300037466 | Bacteria | 1577 |
| 387 | Ga0395898_1019444 | 3300037466 | Bacteria | 763 |
| 388 | Ga0395905_0037832 | 3300037471 | Bacteria | 4528 |
| 389 | Ga0395905_1314473 | 3300037471 | Bacteria | 627 |
| 390 | Ga0395905_1445528 | 3300037471 | Bacteria | 592 |
| 391 | Ga0395905_1855045 | 3300037471 | Bacteria | 509 |
| 392 | Ga0395901_0000023 | 3300038443 | Bacteria | 283968 |
| 393 | Ga0395901_0000105 | 3300038443 | Bacteria | 114318 |
| 394 | Ga0395901_0143056 | 3300038443 | Bacteria | 2514 |
| 395 | Ga0395901_0199859 | 3300038443 | Bacteria | 2095 |
| 396 | Ga0395901_0275673 | 3300038443 | Bacteria | 1748 |
| 397 | Ga0395901_0649269 | 3300038443 | Bacteria | 1059 |
| 398 | Ga0395901_0866070 | 3300038443 | Bacteria | 887 |
| 399 | Ga0395901_0926435 | 3300038443 | Bacteria | 851 |
| 400 | Ga0436365_0781751 | 3300039437 | Unclassified | 2931 |
| 401 | Ga0436360_0273429 | 3300039438 | Bacteria | 523 |
| 402 | Ga0436360_1060060 | 3300039438 | Unclassified | 524 |
| 403 | Ga0436361_0721434 | 3300039447 | Bacteria | 8067 |
| 404 | Ga0436361_0823803 | 3300039447 | Bacteria | 1954 |
| 405 | Ga0436361_0843575 | 3300039447 | Bacteria | 611 |
| 406 | Ga0436361_0851193 | 3300039447 | Bacteria | 3015 |
| 407 | Ga0436361_1039794 | 3300039447 | Bacteria | 833 |
| 408 | Ga0436363_0607979 | 3300039450 | Bacteria | 855 |
| 409 | Ga0436363_1360161 | 3300039450 | Bacteria | 2704 |
| 410 | Ga0436363_1450927 | 3300039450 | Bacteria | 4658 |
| 411 | Ga0436363_1679434 | 3300039450 | Bacteria | 3662 |
| 412 | Ga0436362_0641548 | 3300039453 | Unclassified | 1657 |
| 413 | Ga0436362_0749208 | 3300039453 | Bacteria | 594 |
| 414 | Ga0436362_1005007 | 3300039453 | Bacteria | 1561 |
| 415 | Ga0436362_1044349 | 3300039453 | Bacteria | 3174 |
| 416 | Ga0439439_0026322 | 3300041406 | Bacteria | 1466 |
| 417 | Ga0439465_0295558 | 3300041413 | Bacteria | 605 |
| 418 | Ga0439433_0002877 | 3300041999 | Bacteria | 3679 |
| 419 | Ga0439442_043584 | 3300042002 | Bacteria | 945 |
| 420 | Ga0439448_0014497 | 3300042005 | Bacteria | 2378 |
| 421 | Ga0439448_0149723 | 3300042005 | Bacteria | 809 |
| 422 | Ga0439448_0245364 | 3300042005 | Bacteria | 632 |
| 423 | Ga0439449_0010320 | 3300042007 | Bacteria | 3525 |
| 424 | Ga0439449_0062439 | 3300042007 | Bacteria | 1374 |
| 425 | Ga0439450_000217 | 3300042008 | Bacteria | 6866 |
| 426 | Ga0439455_0005009 | 3300042012 | Bacteria | 2666 |
| 427 | Ga0439455_0010315 | 3300042012 | Bacteria | 2052 |
| 428 | Ga0450911_003223 | 3300042115 | Bacteria | 2933 |
| 429 | Ga0450898_024603 | 3300042134 | Bacteria | 1077 |
| 430 | Ga0450905_003261 | 3300042142 | Bacteria | 2128 |
| 431 | Ga0439458_0006674 | 3300042157 | Bacteria | 2572 |
| 432 | Ga0439458_0053094 | 3300042157 | Bacteria | 1002 |
| 433 | Ga0451577_1842415 | 3300042876 | Bacteria | 530 |
| 434 | Ga0466969_0018995 | 3300044656 | Bacteria | 3577 |
| 435 | Ga0466969_0186541 | 3300044656 | Bacteria | 948 |
| 436 | Ga0466969_0378083 | 3300044656 | Unclassified | 642 |
| 437 | Ga0466972_0173606 | 3300044658 | Bacteria | 1011 |
| 438 | Ga0466972_0246013 | 3300044658 | Bacteria | 836 |
| 439 | Ga0466982_0064206 | 3300044672 | Bacteria | 2262 |
| 440 | Ga0453683_0213246 | 3300044673 | Bacteria | 1227 |
| 441 | Ga0466965_0015140 | 3300044683 | Bacteria | 3661 |
| 442 | Ga0466965_0023906 | 3300044683 | Bacteria | 2953 |
| 443 | Ga0466965_0046292 | 3300044683 | Bacteria | 2153 |
| 444 | Ga0466966_0033747 | 3300044684 | Bacteria | 3312 |
| 445 | Ga0466966_0070701 | 3300044684 | Bacteria | 2188 |
| 446 | Ga0466966_0093831 | 3300044684 | Bacteria | 1861 |
| 447 | Ga0466966_0174614 | 3300044684 | Bacteria | 1305 |
| 448 | Ga0466966_0259859 | 3300044684 | Bacteria | 1045 |
| 449 | Ga0466966_0325281 | 3300044684 | Bacteria | 924 |
| 450 | Ga0466961_0089480 | 3300044693 | Bacteria | 1944 |
| 451 | Ga0466961_0260940 | 3300044693 | Bacteria | 1062 |
| 452 | Ga0466963_1350092 | 3300044694 | Bacteria | 500 |
| 453 | Ga0466964_0000035 | 3300044706 | Bacteria | 27756 |
| 454 | Ga0466964_0005016 | 3300044706 | Bacteria | 4894 |
| 455 | Ga0466964_0005415 | 3300044706 | Bacteria | 4737 |
| 456 | Ga0466964_0343684 | 3300044706 | Bacteria | 765 |
| 457 | Ga0453684_0724410 | 3300044712 | Bacteria | 1079 |
| 458 | Ga0466971_0032184 | 3300044719 | Bacteria | 2349 |
| 459 | Ga0466971_0142382 | 3300044719 | Bacteria | 1117 |
| 460 | Ga0466968_0012992 | 3300044735 | Bacteria | 3267 |
| 461 | Ga0466968_0014843 | 3300044735 | Bacteria | 3082 |
| 462 | Ga0466968_0041383 | 3300044735 | Bacteria | 1944 |
| 463 | Ga0466970_0055984 | 3300044765 | Bacteria | 2107 |
| 464 | Ga0466970_0081370 | 3300044765 | Bacteria | 1751 |
| 465 | Ga0466970_0117674 | 3300044765 | Bacteria | 1454 |
| 466 | Ga0466970_0131464 | 3300044765 | Unclassified | 1375 |
| 467 | Ga0466957_0014638 | 3300044842 | Bacteria | 4570 |
| 468 | Ga0466957_0151327 | 3300044842 | Bacteria | 1501 |
| 469 | Ga0466957_0189773 | 3300044842 | Bacteria | 1346 |
| 470 | Ga0466960_0086260 | 3300044901 | Bacteria | 1591 |
| 471 | Ga0466960_0312730 | 3300044901 | Bacteria | 888 |
| 472 | Ga0466960_0580726 | 3300044901 | Bacteria | 664 |
| 473 | Ga0466959_0035768 | 3300045049 | Bacteria | 3670 |
| 474 | Ga0466959_0050047 | 3300045049 | Bacteria | 3069 |
| 475 | Ga0466959_0058440 | 3300045049 | Bacteria | 2809 |
| 476 | Ga0466959_0090104 | 3300045049 | Bacteria | 2203 |
| 477 | Ga0466959_0139529 | 3300045049 | Bacteria | 1714 |
| 478 | Ga0466959_0556910 | 3300045049 | Bacteria | 773 |
| 479 | Ga0466959_0678362 | 3300045049 | Unclassified | 691 |
| 480 | Ga0466967_0011229 | 3300045976 | Bacteria | 6769 |
| 481 | Ga0466967_0067035 | 3300045976 | Bacteria | 3200 |
| 482 | Ga0466967_0111411 | 3300045976 | Bacteria | 2515 |
| 483 | Ga0495617_002089 | 3300046452 | Bacteria | 8259 |
| 484 | Ga0495617_009096 | 3300046452 | Bacteria | 3416 |
| 485 | Ga0495592_0039002 | 3300046454 | Bacteria | 3570 |
| 486 | Ga0495603_0028018 | 3300046455 | Bacteria | 3397 |
| 487 | Ga0495603_0067447 | 3300046455 | Bacteria | 2106 |
| 488 | Ga0495590_0004639 | 3300046457 | Bacteria | 5520 |
| 489 | Ga0495590_0014771 | 3300046457 | Bacteria | 2847 |
| 490 | Ga0495590_0018469 | 3300046457 | Bacteria | 2496 |
| 491 | Ga0495590_0070217 | 3300046457 | Bacteria | 1228 |
| 492 | Ga0495590_0079035 | 3300046457 | Bacteria | 1158 |
| 493 | Ga0495590_0135660 | 3300046457 | Bacteria | 886 |
| 494 | Ga0495591_012212 | 3300046458 | Bacteria | 3209 |
| 495 | Ga0495629_0036558 | 3300046459 | Bacteria | 3465 |
| 496 | Ga0495629_0038996 | 3300046459 | Bacteria | 3345 |
| 497 | Ga0495638_0003375 | 3300046460 | Bacteria | 12592 |
| 498 | Ga0495638_0006209 | 3300046460 | Bacteria | 8729 |
| 499 | Ga0495638_0038693 | 3300046460 | Bacteria | 3029 |
| 500 | Ga0495638_0357931 | 3300046460 | Bacteria | 768 |
| 501 | Ga0495641_0061356 | 3300046461 | Bacteria | 1697 |
| 502 | Ga0495651_0042549 | 3300046462 | Bacteria | 3526 |
| 503 | Ga0495651_0090162 | 3300046462 | Bacteria | 2300 |
| 504 | Ga0495651_0813807 | 3300046462 | Bacteria | 576 |
| 505 | Ga0495653_0000904 | 3300046463 | Bacteria | 22963 |
| 506 | Ga0495653_0038449 | 3300046463 | Bacteria | 3756 |
| 507 | Ga0495650_0020333 | 3300046471 | Bacteria | 3240 |
| 508 | Ga0495650_0042496 | 3300046471 | Bacteria | 1934 |
| 509 | Ga0495650_0197099 | 3300046471 | Bacteria | 701 |
| 510 | Ga0495580_0027988 | 3300046472 | Bacteria | 4099 |
| 511 | Ga0495580_0051213 | 3300046472 | Bacteria | 2919 |
| 512 | Ga0495580_0252584 | 3300046472 | Bacteria | 1207 |
| 513 | Ga0495580_0256771 | 3300046472 | Bacteria | 1195 |
| 514 | Ga0495580_0566960 | 3300046472 | Unclassified | 753 |
| 515 | Ga0495582_0022394 | 3300046473 | Bacteria | 3457 |
| 516 | Ga0495605_0001545 | 3300046474 | Bacteria | 14952 |
| 517 | Ga0495605_0002454 | 3300046474 | Bacteria | 11474 |
| 518 | Ga0495605_0017299 | 3300046474 | Bacteria | 3886 |
| 519 | Ga0495605_0017447 | 3300046474 | Bacteria | 3864 |
| 520 | Ga0495605_0100104 | 3300046474 | Bacteria | 1333 |
| 521 | Ga0495605_0155107 | 3300046474 | Bacteria | 1019 |
| 522 | Ga0495639_0076427 | 3300046475 | Unclassified | 1553 |
| 523 | Ga0495639_0763616 | 3300046475 | Bacteria | 501 |
| 524 | Ga0495662_0081022 | 3300046476 | Bacteria | 1578 |
| 525 | Ga0495664_0023340 | 3300046477 | Bacteria | 3590 |
| 526 | Ga0495664_0047467 | 3300046477 | Bacteria | 2548 |
| 527 | Ga0495584_0000480 | 3300046491 | Bacteria | 27451 |
| 528 | Ga0495584_0004824 | 3300046491 | Bacteria | 7206 |
| 529 | Ga0495584_0005179 | 3300046491 | Bacteria | 6922 |
| 530 | Ga0495584_0019301 | 3300046491 | Bacteria | 3462 |
| 531 | Ga0495584_0020687 | 3300046491 | Bacteria | 3342 |
| 532 | Ga0495585_0000270 | 3300046492 | Bacteria | 52046 |
| 533 | Ga0495585_0005492 | 3300046492 | Bacteria | 7983 |
| 534 | Ga0495585_0015645 | 3300046492 | Bacteria | 4405 |
| 535 | Ga0495585_0020937 | 3300046492 | Bacteria | 3757 |
| 536 | Ga0495585_0188565 | 3300046492 | Bacteria | 1056 |
| 537 | Ga0495594_0393526 | 3300046499 | Unclassified | 789 |
| 538 | Ga0495596_0000497 | 3300046500 | Bacteria | 24946 |
| 539 | Ga0495596_0000704 | 3300046500 | Bacteria | 20713 |
| 540 | Ga0495596_0014856 | 3300046500 | Bacteria | 3274 |
| 541 | Ga0495596_0022061 | 3300046500 | Bacteria | 2594 |
| 542 | Ga0495596_0035740 | 3300046500 | Bacteria | 1969 |
| 543 | Ga0495596_0219659 | 3300046500 | Bacteria | 738 |
| 544 | Ga0495607_0001328 | 3300046501 | Bacteria | 22065 |
| 545 | Ga0495607_0001369 | 3300046501 | Bacteria | 21701 |
| 546 | Ga0495607_0058183 | 3300046501 | Bacteria | 2211 |
| 547 | Ga0495607_0154780 | 3300046501 | Bacteria | 1170 |
| 548 | Ga0495583_0000063 | 3300046506 | Bacteria | 194362 |
| 549 | Ga0495583_0002987 | 3300046506 | Bacteria | 13556 |
| 550 | Ga0495583_0015161 | 3300046506 | Bacteria | 4205 |
| 551 | Ga0495583_0029908 | 3300046506 | Bacteria | 2660 |
| 552 | Ga0495583_0042111 | 3300046506 | Bacteria | 2135 |
| 553 | Ga0495583_0284392 | 3300046506 | Bacteria | 659 |
| 554 | Ga0495606_0000827 | 3300046507 | Bacteria | 46975 |
| 555 | Ga0495606_0005749 | 3300046507 | Bacteria | 11724 |
| 556 | Ga0495606_0029616 | 3300046507 | Bacteria | 3839 |
| 557 | Ga0495606_0043834 | 3300046507 | Bacteria | 2979 |
| 558 | Ga0495606_0044805 | 3300046507 | Bacteria | 2939 |
| 559 | Ga0495606_0244685 | 3300046507 | Bacteria | 998 |
| 560 | Ga0495608_0028688 | 3300046511 | Bacteria | 3781 |
| 561 | Ga0495608_0052056 | 3300046511 | Bacteria | 2711 |
| 562 | Ga0495608_0679396 | 3300046511 | Bacteria | 614 |
| 563 | Ga0495610_0017926 | 3300046512 | Bacteria | 4017 |
| 564 | Ga0495610_0028855 | 3300046512 | Bacteria | 2929 |
| 565 | Ga0495616_0000142 | 3300046513 | Bacteria | 62829 |
| 566 | Ga0495616_0000318 | 3300046513 | Bacteria | 38489 |
| 567 | Ga0495616_0008734 | 3300046513 | Bacteria | 5971 |
| 568 | Ga0495616_0012698 | 3300046513 | Bacteria | 4770 |
| 569 | Ga0495616_0028689 | 3300046513 | Bacteria | 2944 |
| 570 | Ga0495616_0032586 | 3300046513 | Bacteria | 2720 |
| 571 | Ga0495616_0035023 | 3300046513 | Bacteria | 2601 |
| 572 | Ga0495616_0059207 | 3300046513 | Bacteria | 1884 |
| 573 | Ga0495618_0021096 | 3300046514 | Bacteria | 4015 |
| 574 | Ga0495618_0029480 | 3300046514 | Bacteria | 3424 |
| 575 | Ga0495620_0014187 | 3300046515 | Bacteria | 4057 |
| 576 | Ga0495628_0003133 | 3300046516 | Bacteria | 14840 |
| 577 | Ga0495628_0004405 | 3300046516 | Bacteria | 12493 |
| 578 | Ga0495628_0070083 | 3300046516 | Bacteria | 2734 |
| 579 | Ga0495628_0276374 | 3300046516 | Bacteria | 1248 |
| 580 | Ga0495630_0075708 | 3300046517 | Bacteria | 2535 |
| 581 | Ga0495630_1168774 | 3300046517 | Bacteria | 582 |
| 582 | Ga0495631_0007702 | 3300046518 | Bacteria | 5466 |
| 583 | Ga0495631_0302922 | 3300046518 | Bacteria | 680 |
| 584 | Ga0495632_0016552 | 3300046519 | Bacteria | 4098 |
| 585 | Ga0495632_0069459 | 3300046519 | Bacteria | 1696 |
| 586 | Ga0495632_0156819 | 3300046519 | Bacteria | 1050 |
| 587 | Ga0495632_0333368 | 3300046519 | Bacteria | 669 |
| 588 | Ga0495637_0020999 | 3300046520 | Bacteria | 2996 |
| 589 | Ga0495643_0034384 | 3300046522 | Bacteria | 2798 |
| 590 | Ga0495644_0007935 | 3300046523 | Bacteria | 4085 |
| 591 | Ga0495644_0111414 | 3300046523 | Bacteria | 1038 |
| 592 | Ga0495644_0125908 | 3300046523 | Bacteria | 976 |
| 593 | Ga0495648_0015040 | 3300046524 | Bacteria | 5635 |
| 594 | Ga0495648_0028873 | 3300046524 | Bacteria | 3688 |
| 595 | Ga0495648_0095887 | 3300046524 | Bacteria | 1649 |
| 596 | Ga0495666_0003858 | 3300046526 | Bacteria | 7584 |
| 597 | Ga0495666_0111677 | 3300046526 | Bacteria | 1283 |
| 598 | Ga0495642_0000906 | 3300046528 | Bacteria | 13909 |
| 599 | Ga0495642_0002663 | 3300046528 | Bacteria | 7184 |
| 600 | Ga0495642_0006132 | 3300046528 | Bacteria | 4618 |
| 601 | Ga0495642_0128510 | 3300046528 | Bacteria | 1090 |
| 602 | Ga0495642_0168322 | 3300046528 | Bacteria | 952 |
| 603 | Ga0495642_0501085 | 3300046528 | Bacteria | 537 |
| 604 | Ga0495652_0013991 | 3300046529 | Bacteria | 7210 |
| 605 | Ga0495652_0029479 | 3300046529 | Bacteria | 4820 |
| 606 | Ga0495652_0039467 | 3300046529 | Bacteria | 4082 |
| 607 | Ga0495654_0015394 | 3300046530 | Bacteria | 4060 |
| 608 | Ga0495654_0089845 | 3300046530 | Bacteria | 1427 |
| 609 | Ga0495665_0039180 | 3300046531 | Bacteria | 2524 |
| 610 | Ga0495665_0086267 | 3300046531 | Bacteria | 1650 |
| 611 | Ga0495640_0126729 | 3300046533 | Bacteria | 1655 |
| 612 | Ga0495640_0712970 | 3300046533 | Bacteria | 601 |
| 613 | Ga0495586_0050816 | 3300046535 | Bacteria | 2243 |
| 614 | Ga0495587_0038821 | 3300046536 | Bacteria | 2852 |
| 615 | Ga0495587_0418367 | 3300046536 | Bacteria | 744 |
| 616 | Ga0495598_0013357 | 3300046537 | Bacteria | 2034 |
| 617 | Ga0495609_0000124 | 3300046538 | Bacteria | 84411 |
| 618 | Ga0495609_0000198 | 3300046538 | Bacteria | 59995 |
| 619 | Ga0495609_0002629 | 3300046538 | Bacteria | 10905 |
| 620 | Ga0495609_0010675 | 3300046538 | Bacteria | 4396 |
| 621 | Ga0495609_0033648 | 3300046538 | Bacteria | 2326 |
| 622 | Ga0495609_0078845 | 3300046538 | Bacteria | 1441 |
| 623 | Ga0495621_0059188 | 3300046539 | Bacteria | 1387 |
| 624 | Ga0495597_0002102 | 3300046542 | Bacteria | 13234 |
| 625 | Ga0495597_0009836 | 3300046542 | Bacteria | 4704 |
| 626 | Ga0495597_0067599 | 3300046542 | Bacteria | 1545 |
| 627 | Ga0495597_0075662 | 3300046542 | Bacteria | 1444 |
| 628 | Ga0495597_0091925 | 3300046542 | Bacteria | 1287 |
| 629 | Ga0495645_0013110 | 3300046543 | Bacteria | 5858 |
| 630 | Ga0495645_0035731 | 3300046543 | Bacteria | 3622 |
| 631 | Ga0495645_0153874 | 3300046543 | Bacteria | 1595 |
| 632 | Ga0495633_0019298 | 3300046558 | Bacteria | 3449 |
| 633 | Ga0495633_0064479 | 3300046558 | Bacteria | 1712 |
| 634 | Ga0495633_0119778 | 3300046558 | Bacteria | 1219 |
| 635 | Ga0495633_0507277 | 3300046558 | Bacteria | 544 |
| 636 | Ga0495667_0095248 | 3300046559 | Bacteria | 1928 |
| 637 | Ga0495656_0001645 | 3300046615 | Bacteria | 7311 |
| 638 | Ga0495656_0004323 | 3300046615 | Bacteria | 4856 |
| 639 | Ga0495656_0015609 | 3300046615 | Bacteria | 2870 |
| 640 | Ga0495668_0003297 | 3300046616 | Bacteria | 12232 |
| 641 | Ga0495668_0033957 | 3300046616 | Bacteria | 2864 |
| 642 | Ga0495668_0046705 | 3300046616 | Bacteria | 2405 |
| 643 | Ga0495634_0027598 | 3300046642 | Bacteria | 3949 |
| 644 | Ga0495634_0285512 | 3300046642 | Bacteria | 1001 |
| 645 | Ga0495611_0003551 | 3300046648 | Bacteria | 6853 |
| 646 | Ga0495611_0010156 | 3300046648 | Bacteria | 3982 |
| 647 | Ga0495611_0013558 | 3300046648 | Bacteria | 3472 |
| 648 | Ga0495611_0023533 | 3300046648 | Bacteria | 2674 |
| 649 | Ga0495611_0025019 | 3300046648 | Bacteria | 2599 |
| 650 | Ga0495611_0123644 | 3300046648 | Bacteria | 1206 |
| 651 | Ga0495625_0030388 | 3300046660 | Bacteria | 4031 |
| 652 | Ga0495625_0033452 | 3300046660 | Bacteria | 3802 |
| 653 | Ga0495625_0036850 | 3300046660 | Bacteria | 3591 |
| 654 | Ga0495625_0056188 | 3300046660 | Bacteria | 2803 |
| 655 | Ga0495625_0066568 | 3300046660 | Bacteria | 2537 |
| 656 | Ga0495625_0667481 | 3300046660 | Bacteria | 617 |
| 657 | Ga0495635_0019487 | 3300046663 | Bacteria | 4728 |
| 658 | Ga0495635_0055785 | 3300046663 | Bacteria | 2721 |
| 659 | Ga0495659_0002026 | 3300046664 | Bacteria | 6645 |
| 660 | Ga0495659_0144937 | 3300046664 | Bacteria | 950 |
| 661 | Ga0495659_0529885 | 3300046664 | Bacteria | 518 |
| 662 | Ga0495661_0000094 | 3300046665 | Bacteria | 109394 |
| 663 | Ga0495661_0000552 | 3300046665 | Bacteria | 38730 |
| 664 | Ga0495661_0001579 | 3300046665 | Bacteria | 18768 |
| 665 | Ga0495661_0001921 | 3300046665 | Bacteria | 16534 |
| 666 | Ga0495661_0020567 | 3300046665 | Bacteria | 4307 |
| 667 | Ga0495661_0022141 | 3300046665 | Bacteria | 4137 |
| 668 | Ga0495661_0022865 | 3300046665 | Bacteria | 4063 |
| 669 | Ga0495661_0035235 | 3300046665 | Bacteria | 3142 |
| 670 | Ga0495661_0048331 | 3300046665 | Bacteria | 2585 |
| 671 | Ga0495661_0062275 | 3300046665 | Bacteria | 2211 |
| 672 | Ga0495588_0029702 | 3300046674 | Bacteria | 2744 |
| 673 | Ga0495588_0032067 | 3300046674 | Bacteria | 2647 |
| 674 | Ga0495588_0036636 | 3300046674 | Bacteria | 2489 |
| 675 | Ga0495588_0491843 | 3300046674 | Bacteria | 643 |
| 676 | Ga0495588_0717751 | 3300046674 | Bacteria | 523 |
| 677 | Ga0495657_0049897 | 3300046675 | Bacteria | 2816 |
| 678 | Ga0495657_0154856 | 3300046675 | Bacteria | 1421 |
| 679 | Ga0495599_0006702 | 3300046678 | Bacteria | 6955 |
| 680 | Ga0495599_0012778 | 3300046678 | Bacteria | 5180 |
| 681 | Ga0495599_0905053 | 3300046678 | Bacteria | 500 |
| 682 | Ga0495623_0002298 | 3300046679 | Bacteria | 12738 |
| 683 | Ga0495623_0004679 | 3300046679 | Bacteria | 8992 |
| 684 | Ga0495623_0055673 | 3300046679 | Bacteria | 2492 |
| 685 | Ga0495623_0279367 | 3300046679 | Bacteria | 929 |
| 686 | Ga0495646_0022385 | 3300046680 | Bacteria | 3987 |
| 687 | Ga0495646_0045828 | 3300046680 | Bacteria | 2668 |
| 688 | Ga0495646_0445311 | 3300046680 | Bacteria | 669 |
| 689 | Ga0495658_0039145 | 3300046683 | Bacteria | 2629 |
| 690 | Ga0495669_0012868 | 3300046684 | Bacteria | 3562 |
| 691 | Ga0495669_0019560 | 3300046684 | Bacteria | 2923 |
| 692 | Ga0495613_0201083 | 3300046689 | Bacteria | 1405 |
| 693 | Ga0495624_0018634 | 3300046690 | Bacteria | 4642 |
| 694 | Ga0495624_0023699 | 3300046690 | Bacteria | 4045 |
| 695 | Ga0495624_0046656 | 3300046690 | Bacteria | 2754 |
| 696 | Ga0495624_0177172 | 3300046690 | Bacteria | 1300 |
| 697 | Ga0495670_0001628 | 3300046691 | Bacteria | 10990 |
| 698 | Ga0495670_0002782 | 3300046691 | Bacteria | 8648 |
| 699 | Ga0495670_0063357 | 3300046691 | Bacteria | 1861 |
| 700 | Ga0495670_0373731 | 3300046691 | Bacteria | 768 |
| 701 | Ga0495671_0001063 | 3300046692 | Bacteria | 19007 |
| 702 | Ga0495671_0001619 | 3300046692 | Bacteria | 14797 |
| 703 | Ga0495671_0031412 | 3300046692 | Bacteria | 2715 |
| 704 | Ga0495671_0365027 | 3300046692 | Bacteria | 692 |
| 705 | Ga0495649_0039034 | 3300046694 | Bacteria | 2603 |
| 706 | Ga0495589_0000019 | 3300046794 | Bacteria | 200814 |
| 707 | Ga0495589_0000168 | 3300046794 | Bacteria | 59857 |
| 708 | Ga0495589_0040176 | 3300046794 | Bacteria | 2336 |
| 709 | Ga0495589_0206494 | 3300046794 | Bacteria | 926 |
| 710 | Ga0495589_0467725 | 3300046794 | Bacteria | 576 |
| 711 | Ga0495600_0018195 | 3300046809 | Bacteria | 4473 |
| 712 | Ga0495600_0050734 | 3300046809 | Bacteria | 2707 |
| 713 | Ga0495660_0010031 | 3300046810 | Bacteria | 5510 |
| 714 | Ga0495660_0026837 | 3300046810 | Bacteria | 3260 |
| 715 | Ga0495581_0231999 | 3300047315 | Bacteria | 1079 |
| 716 | Ga0495604_0001624 | 3300047317 | Bacteria | 18543 |
| 717 | Ga0495604_0021041 | 3300047317 | Bacteria | 5204 |
| 718 | Ga0495604_0051512 | 3300047317 | Bacteria | 3190 |
| 719 | Ga0495604_0129603 | 3300047317 | Bacteria | 1815 |
| 720 | Ga0495604_0192417 | 3300047317 | Bacteria | 1420 |
| 721 | Ga0495636_0000468 | 3300047318 | Bacteria | 14947 |
| 722 | Ga0495636_0008126 | 3300047318 | Bacteria | 4136 |
| 723 | Ga0495636_0046138 | 3300047318 | Bacteria | 1817 |
| 724 | Ga0495636_0298789 | 3300047318 | Bacteria | 753 |
| 725 | Ga0495674_0061459 | 3300047319 | Bacteria | 3273 |
| 726 | Ga0495674_0086568 | 3300047319 | Bacteria | 2682 |
| 727 | Ga0495674_1100601 | 3300047319 | Bacteria | 605 |
| 728 | Ga0495672_0002278 | 3300047320 | Bacteria | 17821 |
| 729 | Ga0495672_0091244 | 3300047320 | Bacteria | 1672 |
| 730 | Ga0495672_0342135 | 3300047320 | Bacteria | 697 |
| 731 | Ga0495676_0015951 | 3300047321 | Bacteria | 6677 |
| 732 | Ga0495676_0021020 | 3300047321 | Bacteria | 5712 |
| 733 | Ga0495680_0078210 | 3300047322 | Bacteria | 2503 |
| 734 | Ga0495683_0000433 | 3300047323 | Bacteria | 33196 |
| 735 | Ga0495683_0020851 | 3300047323 | Bacteria | 3379 |
| 736 | Ga0495683_0022417 | 3300047323 | Bacteria | 3247 |
| 737 | Ga0495683_0194430 | 3300047323 | Bacteria | 918 |
| 738 | Ga0495683_0246107 | 3300047323 | Bacteria | 786 |
| 739 | Ga0495683_0308931 | 3300047323 | Bacteria | 677 |
| 740 | Ga0495687_000132 | 3300047443 | Bacteria | 114685 |
| 741 | Ga0495687_000313 | 3300047443 | Bacteria | 63173 |
| 742 | Ga0495687_001190 | 3300047443 | Bacteria | 24980 |
| 743 | Ga0495687_002442 | 3300047443 | Bacteria | 14933 |
| 744 | Ga0495687_002529 | 3300047443 | Bacteria | 14512 |
| 745 | Ga0495687_023200 | 3300047443 | Bacteria | 2967 |
| 746 | Ga0495687_065366 | 3300047443 | Bacteria | 1481 |
| 747 | Ga0495687_091651 | 3300047443 | Bacteria | 1162 |
| 748 | Ga0495675_0002982 | 3300047444 | Bacteria | 10161 |
| 749 | Ga0495675_0038294 | 3300047444 | Bacteria | 3053 |
| 750 | Ga0495675_0823391 | 3300047444 | Bacteria | 512 |
| 751 | Ga0495677_0000062 | 3300047445 | Bacteria | 60952 |
| 752 | Ga0495677_0000469 | 3300047445 | Bacteria | 17293 |
| 753 | Ga0495677_0001719 | 3300047445 | Bacteria | 8784 |
| 754 | Ga0495677_0013773 | 3300047445 | Bacteria | 2943 |
| 755 | Ga0495677_0058567 | 3300047445 | Bacteria | 1425 |
| 756 | Ga0495679_006340 | 3300047446 | Bacteria | 5111 |
| 757 | Ga0495679_008563 | 3300047446 | Bacteria | 4148 |
| 758 | Ga0495685_010587 | 3300047447 | Bacteria | 3097 |
| 759 | Ga0495673_0004330 | 3300047469 | Bacteria | 8935 |
| 760 | Ga0495673_0055701 | 3300047469 | Bacteria | 1714 |
| 761 | Ga0495673_0119454 | 3300047469 | Bacteria | 1045 |
| 762 | Ga0495681_0016121 | 3300047470 | Bacteria | 4204 |
| 763 | Ga0495681_0113802 | 3300047470 | Bacteria | 1168 |
| 764 | Ga0495686_0026896 | 3300047472 | Bacteria | 3761 |
| 765 | Ga0495686_0287814 | 3300047472 | Bacteria | 911 |
| 766 | Ga0495686_0391165 | 3300047472 | Bacteria | 748 |
| 767 | Ga0495593_0008837 | 3300047673 | Bacteria | 5847 |
| 768 | Ga0495602_0004438 | 3300048088 | Bacteria | 14645 |
| 769 | Ga0495602_0012465 | 3300048088 | Bacteria | 8735 |
| 770 | Ga0495602_0075575 | 3300048088 | Bacteria | 2858 |
| 771 | Ga0495602_0093324 | 3300048088 | Bacteria | 2490 |
| 772 | Ga0495602_0122130 | 3300048088 | Bacteria | 2094 |
| 773 | Ga0495602_0203194 | 3300048088 | Unclassified | 1510 |
| 774 | Ga0495602_0858199 | 3300048088 | Bacteria | 606 |
| 775 | Ga0495614_0024521 | 3300048089 | Bacteria | 2603 |
| 776 | Ga0495615_0007722 | 3300048090 | Bacteria | 2053 |
| 777 | Ga0495615_0243950 | 3300048090 | Bacteria | 567 |
| 778 | Ga0495626_0000376 | 3300048091 | Bacteria | 46584 |
| 779 | Ga0495626_0004004 | 3300048091 | Bacteria | 9207 |
| 780 | Ga0495626_0004364 | 3300048091 | Bacteria | 8713 |
| 781 | Ga0495626_0019959 | 3300048091 | Bacteria | 3343 |
| 782 | Ga0495626_0071066 | 3300048091 | Bacteria | 1565 |
| 783 | Ga0496100_0052778 | 3300048903 | Bacteria | 2644 |
| 784 | Ga0496100_0465463 | 3300048903 | Bacteria | 971 |
| 785 | Ga0496100_0720310 | 3300048903 | Bacteria | 779 |
| 786 | Ga0496100_0843311 | 3300048903 | Bacteria | 719 |
| 787 | Ga0496101_0055040 | 3300048904 | Bacteria | 2872 |
| 788 | Ga0496101_0056586 | 3300048904 | Bacteria | 2835 |
| 789 | Ga0496101_0226250 | 3300048904 | Bacteria | 1453 |
| 790 | Ga0496101_0325751 | 3300048904 | Unclassified | 1206 |
| 791 | Ga0496101_0338492 | 3300048904 | Bacteria | 1181 |
| 792 | Ga0496102_0126999 | 3300048905 | Bacteria | 2384 |
| 793 | Ga0496102_0458767 | 3300048905 | Bacteria | 1195 |
| 794 | Ga0496103_0030793 | 3300048906 | Bacteria | 3266 |
| 795 | Ga0496103_0154570 | 3300048906 | Bacteria | 1470 |
| 796 | Ga0496103_0821650 | 3300048906 | Bacteria | 585 |
| 797 | Ga0496104_0034826 | 3300048907 | Bacteria | 4697 |
| 798 | Ga0496104_0110040 | 3300048907 | Bacteria | 2640 |
| 799 | Ga0496104_0630228 | 3300048907 | Bacteria | 981 |
| 800 | Ga0496104_0658745 | 3300048907 | Bacteria | 956 |
| 801 | Ga0496105_0016422 | 3300048908 | Bacteria | 5912 |
| 802 | Ga0496105_0082069 | 3300048908 | Bacteria | 2663 |
| 803 | Ga0496105_0132118 | 3300048908 | Bacteria | 2058 |
| 804 | Ga0496105_0214227 | 3300048908 | Bacteria | 1569 |
| 805 | Ga0496105_0973034 | 3300048908 | Bacteria | 636 |
| 806 | Ga0496106_0008060 | 3300048909 | Bacteria | 7779 |
| 807 | Ga0496106_0030441 | 3300048909 | Bacteria | 4024 |
| 808 | Ga0496107_0047701 | 3300048910 | Bacteria | 3084 |
| 809 | Ga0496107_0049393 | 3300048910 | Bacteria | 3031 |
| 810 | Ga0496107_0406728 | 3300048910 | Bacteria | 1012 |
| 811 | Ga0496108_0193368 | 3300048911 | Bacteria | 1764 |
| 812 | Ga0496108_0340416 | 3300048911 | Bacteria | 1308 |
| 813 | Ga0496109_0102971 | 3300048912 | Bacteria | 2649 |
| 814 | Ga0496110_0051889 | 3300048913 | Bacteria | 3604 |
| 815 | Ga0496110_0074102 | 3300048913 | Bacteria | 3022 |
| 816 | Ga0496110_0166659 | 3300048913 | Bacteria | 1998 |
| 817 | Ga0496110_0247473 | 3300048913 | Bacteria | 1622 |
| 818 | Ga0496110_1005981 | 3300048913 | Bacteria | 741 |
| 819 | Ga0496111_0038362 | 3300048914 | Bacteria | 3433 |
| 820 | Ga0496111_0214351 | 3300048914 | Bacteria | 1430 |
| 821 | Ga0496111_0218308 | 3300048914 | Bacteria | 1416 |
| 822 | Ga0496111_0999124 | 3300048914 | Bacteria | 600 |
| 823 | Ga0496112_0103867 | 3300048915 | Bacteria | 2812 |
| 824 | Ga0496112_0265873 | 3300048915 | Bacteria | 1664 |
| 825 | Ga0496112_0433379 | 3300048915 | Bacteria | 1253 |
| 826 | Ga0496112_0734001 | 3300048915 | Bacteria | 914 |
| 827 | Ga0496113_0071565 | 3300048916 | Bacteria | 2637 |
| 828 | Ga0496113_0120066 | 3300048916 | Bacteria | 2054 |
| 829 | Ga0496113_0215747 | 3300048916 | Bacteria | 1528 |
| 830 | Ga0496113_0394215 | 3300048916 | Bacteria | 1111 |
| 831 | Ga0496114_0122539 | 3300048917 | Bacteria | 2237 |
| 832 | Ga0496114_0169462 | 3300048917 | Bacteria | 1902 |
| 833 | Ga0496114_0416344 | 3300048917 | Bacteria | 1190 |
| 834 | Ga0496114_0473585 | 3300048917 | Bacteria | 1108 |
| 835 | Ga0496115_0048461 | 3300048918 | Bacteria | 3398 |
| 836 | Ga0496115_0077631 | 3300048918 | Plasmid | 2701 |
| 837 | Ga0496115_0131288 | 3300048918 | Bacteria | 2065 |
| 838 | Ga0496115_0528245 | 3300048918 | Bacteria | 945 |
| 839 | Ga0496116_0062898 | 3300048919 | Bacteria | 2394 |
| 840 | Ga0496116_0157678 | 3300048919 | Bacteria | 1250 |
| 841 | Ga0496117_0030556 | 3300048920 | Bacteria | 4131 |
| 842 | Ga0496117_0054340 | 3300048920 | Bacteria | 2806 |
| 843 | Ga0496117_0055484 | 3300048920 | Bacteria | 2768 |
| 844 | Ga0496117_0093436 | 3300048920 | Bacteria | 1929 |
| 845 | Ga0496117_0230373 | 3300048920 | Bacteria | 1024 |
| 846 | Ga0496118_0002539 | 3300048921 | Bacteria | 24435 |
| 847 | Ga0496118_0037829 | 3300048921 | Bacteria | 3877 |
| 848 | Ga0496118_0048253 | 3300048921 | Bacteria | 3291 |
| 849 | Ga0496119_0047105 | 3300048922 | Bacteria | 2685 |
| 850 | Ga0496120_0074997 | 3300048923 | Bacteria | 1847 |
| 851 | Ga0496121_0002981 | 3300048924 | Bacteria | 24617 |
| 852 | Ga0496121_0041344 | 3300048924 | Bacteria | 4029 |
| 853 | Ga0496121_0064085 | 3300048924 | Bacteria | 2998 |
| 854 | Ga0496121_0069997 | 3300048924 | Bacteria | 2828 |
| 855 | Ga0496121_0226110 | 3300048924 | Bacteria | 1314 |
| 856 | Ga0496122_0044840 | 3300048925 | Bacteria | 3446 |
| 857 | Ga0496123_0102400 | 3300048926 | Bacteria | 1662 |
| 858 | Ga0496124_0048622 | 3300048927 | Bacteria | 3623 |
| 859 | Ga0496125_0104160 | 3300048928 | Bacteria | 2079 |
| 860 | Ga0496126_0004806 | 3300048929 | Bacteria | 15874 |
| 861 | Ga0496126_0075322 | 3300048929 | Bacteria | 2995 |
| 862 | Ga0496126_0285849 | 3300048929 | Bacteria | 1365 |
| 863 | Ga0496126_0399193 | 3300048929 | Bacteria | 1116 |
| 864 | Ga0496126_0906114 | 3300048929 | Bacteria | 668 |
| 865 | Ga0495678_006049 | 3300049459 | Bacteria | 6517 |
| 866 | Ga0495678_013689 | 3300049459 | Bacteria | 3798 |
| 867 | Ga0495678_014134 | 3300049459 | Bacteria | 3720 |
| 868 | Ga0495678_016841 | 3300049459 | Bacteria | 3328 |
| 869 | Ga0495678_035409 | 3300049459 | Bacteria | 2047 |
| 870 | Ga0495682_0002880 | 3300049460 | Bacteria | 7908 |
| 871 | Ga0495682_0089062 | 3300049460 | Bacteria | 1109 |
| 872 | Ga0495682_0091089 | 3300049460 | Bacteria | 1095 |
| 873 | Ga0495682_0238523 | 3300049460 | Bacteria | 643 |
| 874 | Ga0501034_0070007 | 3300049571 | Bacteria | 3519 |
| 875 | Ga0501034_0596046 | 3300049571 | Bacteria | 1011 |
| 876 | Ga0501034_1472533 | 3300049571 | Bacteria | 555 |
| 877 | Ga0501036_0059691 | 3300049572 | Bacteria | 3231 |
| 878 | Ga0501038_0246178 | 3300049574 | Bacteria | 1418 |
| 879 | Ga0501043_0180248 | 3300049579 | Bacteria | 1646 |
| 880 | Ga0501067_0108649 | 3300049583 | Bacteria | 1542 |
| 881 | Ga0501068_0042701 | 3300049584 | Bacteria | 2726 |
| 882 | Ga0501069_0025746 | 3300049585 | Bacteria | 3217 |
| 883 | Ga0501070_0301025 | 3300049586 | Bacteria | 1306 |
| 884 | Ga0501071_0407525 | 3300049587 | Bacteria | 1038 |
| 885 | Ga0501072_0134330 | 3300049588 | Bacteria | 1973 |
| 886 | Ga0501073_0043805 | 3300049589 | Bacteria | 3155 |
| 887 | Ga0501073_0337674 | 3300049589 | Bacteria | 1040 |
| 888 | Ga0501074_0045009 | 3300049590 | Bacteria | 3193 |
| 889 | Ga0501077_0203562 | 3300049593 | Bacteria | 1257 |
| 890 | Ga0501079_0062029 | 3300049741 | Bacteria | 2883 |
| 891 | Ga0501080_0090643 | 3300049742 | Bacteria | 2839 |
| 892 | Ga0501081_0379398 | 3300049743 | Bacteria | 1044 |
| 893 | Ga0501083_0053773 | 3300049744 | Bacteria | 2703 |
| 894 | Ga0501044_0086320 | 3300049823 | Bacteria | 3170 |
| 895 | Ga0501044_0121643 | 3300049823 | Bacteria | 2611 |
| 896 | nmdc:mga07m45_125479_c1 | 3300050496 | Bacteria | 1484 |
| 897 | nmdc:mga0qj67_3522_c1 | 3300050509 | Bacteria | 11300 |
| 898 | nmdc:mga0n895_878377_c1 | 3300050512 | Unclassified | 883 |
| 899 | nmdc:mga08x19_424869_c1 | 3300050514 | Bacteria | 934 |
| 900 | Ga0495601_0009084 | 3300053077 | Bacteria | 5870 |
| 901 | Ga0495655_0017319 | 3300053083 | Bacteria | 1567 |
| 902 | Ga0500578_0082049 | 3300053086 | Bacteria | 2050 |
| 903 | Ga0500644_0157612 | 3300053088 | Bacteria | 915 |
| 904 | Ga0500583_0073287 | 3300053092 | Bacteria | 1642 |
| 905 | Ga0500555_070560 | 3300053103 | Bacteria | 923 |
| 906 | Ga0500593_013458 | 3300053117 | Bacteria | 3495 |
| 907 | Ga0500593_026954 | 3300053117 | Bacteria | 2563 |
| 908 | Ga0500623_276708 | 3300053127 | Bacteria | 534 |
| 909 | Ga0500658_0196046 | 3300053134 | Bacteria | 923 |
| 910 | Ga0500573_0066218 | 3300053140 | Bacteria | 2065 |
| 911 | Ga0500574_000311 | 3300053141 | Bacteria | 5981 |
| 912 | Ga0500577_0072013 | 3300053142 | Bacteria | 1358 |
| 913 | Ga0500600_0181090 | 3300053149 | Bacteria | 1014 |
| 914 | Ga0500604_0147593 | 3300053151 | Bacteria | 797 |
| 915 | Ga0500616_0120499 | 3300053153 | Bacteria | 1254 |
| 916 | Ga0500619_008007 | 3300053154 | Bacteria | 2540 |
| 917 | Ga0500633_0168239 | 3300053160 | Bacteria | 823 |
| 918 | Ga0500596_049249 | 3300053735 | Unclassified | 686 |
| 919 | Ga0501084_0075728 | 3300054114 | Bacteria | 2819 |
| 920 | Ga0501082_0089660 | 3300060353 | Bacteria | 2655 |
| 921 | Ga0466962_0042455 | 3300061719 | Bacteria | 2176 |
| 922 | Ga0466962_0102881 | 3300061719 | Bacteria | 1372 |
| 923 | Ga0530510_0035482 | 3300061734 | Bacteria | 3594 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005339 | Ga0070660_100238177 | Ga0070660_1002381773 | 102 |
| 2 | 3300005344 | Ga0070661_100335314 | Ga0070661_1003353141 | 102 |
| 3 | 3300005366 | Ga0070659_100314025 | Ga0070659_1003140251 | 102 |
| 4 | 3300005564 | Ga0070664_100217327 | Ga0070664_1002173273 | 102 |
| 5 | 3300025919 | Ga0207657_10229292 | Ga0207657_102292921 | 102 |
| 6 | 3300025920 | Ga0207649_10283152 | Ga0207649_102831522 | 102 |
| 7 | 3300025945 | Ga0207679_10043701 | Ga0207679_100437012 | 102 |
| 8 | 3300032004 | Ga0307414_10457975 | Ga0307414_104579752 | 102 |
| 9 | 3300036401 | Ga0373937_0082509 | Ga0373937_0082509_2201_2509 | 102 |
| 10 | 3300046536 | Ga0495587_0038821 | Ga0495587_0038821_103_411 | 102 |
| 11 | 3300048921 | Ga0496118_0002539 | Ga0496118_0002539_14280_14594 | 104 |
| 12 | 3300049823 | Ga0501044_0086320 | Ga0501044_0086320_1898_2215 | 105 |
| 13 | 3300013306 | Ga0163162_11771038 | Ga0163162_117710381 | 106 |
| 14 | 3300025942 | Ga0207689_10162074 | Ga0207689_101620742 | 106 |
| 15 | 3300039438 | Ga0436360_0273429 | Ga0436360_0273429_43_366 | 106 |
| 16 | 3300046516 | Ga0495628_0276374 | Ga0495628_0276374_904_1224 | 106 |
| 17 | 3300046542 | Ga0495597_0002102 | Ga0495597_0002102_6830_7189 | 106 |
| 18 | 3300048904 | Ga0496101_0226250 | Ga0496101_0226250_988_1308 | 106 |
| 19 | 3300048920 | Ga0496117_0030556 | Ga0496117_0030556_2237_2557 | 106 |
| 20 | 3300048924 | Ga0496121_0226110 | Ga0496121_0226110_190_510 | 106 |
| 21 | 3300049579 | Ga0501043_0180248 | Ga0501043_0180248_910_1230 | 106 |
| 22 | 3300046519 | Ga0495632_0333368 | Ga0495632_0333368_129_455 | 108 |
| 23 | 3300046538 | Ga0495609_0078845 | Ga0495609_0078845_373_699 | 108 |
| 24 | 3300046660 | Ga0495625_0033452 | Ga0495625_0033452_1091_1417 | 108 |
| 25 | 3300053117 | Ga0500593_026954 | Ga0500593_026954_1238_1564 | 108 |
| 26 | 3300001979 | JGI24740J21852_10002727 | JGI24740J21852_100027273 | 111 |
| 27 | iso_pu_bacteria | 2513237083 | 2513566294 | 111 |
| 28 | iso_pu_bacteria | 2515154123 | 2515689569 | 111 |
| 29 | iso_pu_bacteria | 2600255067 | 2600815577 | 111 |
| 30 | iso_pu_bacteria | 2643221645 | 2644251713 | 111 |
| 31 | iso_pu_bacteria | 2858688981 | 2858695468 | 111 |
| 32 | iso_pu_bacteria | 2858688981 | 2858698095 | 111 |
| 33 | iso_pu_bacteria | 2870068957 | 2870073033 | 111 |
| 34 | iso_pu_bacteria | 2870068957 | 2870076373 | 111 |
| 35 | iso_pu_bacteria | 2885266251 | 2885270449 | 111 |
| 36 | iso_pu_bacteria | 2904615490 | 2904623125 | 111 |
| 37 | iso_pu_bacteria | 2928058823 | 2928063983 | 111 |
| 38 | iso_pu_bacteria | 644736347 | 644749646 | 111 |
| 39 | iso_pu_bacteria | 644736347 | 644749949 | 111 |
| 40 | iso_pu_bacteria | 644736347 | 644749959 | 111 |
| 41 | iso_pu_bacteria | 8003955200 | 8003962500 | 111 |
| 42 | 3300024227 | Ga0228598_1005334 | Ga0228598_10053342 | 112 |
| 43 | iso_pu_bacteria | 8020953355 | 8020959371 | 112 |
| 44 | iso_pu_bacteria | 8021120328 | 8021128420 | 112 |
| 45 | 3300010375 | Ga0105239_11209608 | Ga0105239_112096081 | 113 |
| 46 | 3300006914 | Ga0075436_100066233 | Ga0075436_1000662333 | 114 |
| 47 | 3300009101 | Ga0105247_10675222 | Ga0105247_106752222 | 114 |
| 48 | 3300021361 | Ga0213872_10019547 | Ga0213872_100195473 | 114 |
| 49 | 3300039447 | Ga0436361_0851193 | Ga0436361_0851193_628_972 | 114 |
| 50 | 3300044656 | Ga0466969_0186541 | Ga0466969_0186541_152_496 | 114 |
| 51 | 3300044683 | Ga0466965_0023906 | Ga0466965_0023906_878_1222 | 114 |
| 52 | 3300044765 | Ga0466970_0131464 | Ga0466970_0131464_94_438 | 114 |
| 53 | 3300045049 | Ga0466959_0035768 | Ga0466959_0035768_1850_2194 | 114 |
| 54 | 3300048904 | Ga0496101_0325751 | Ga0496101_0325751_774_1118 | 114 |
| 55 | 3300048907 | Ga0496104_0658745 | Ga0496104_0658745_73_417 | 114 |
| 56 | 3300049823 | Ga0501044_0121643 | Ga0501044_0121643_356_700 | 114 |
| 57 | 3300050514 | nmdc:mga08x19_424869_c1 | nmdc:mga08x19_424869_c1_468_812 | 114 |
| 58 | 3300001915 | JGI24741J21665_1005042 | JGI24741J21665_10050422 | 115 |
| 59 | 3300001978 | JGI24747J21853_1009708 | JGI24747J21853_10097082 | 115 |
| 60 | 3300001979 | JGI24740J21852_10017586 | JGI24740J21852_100175862 | 115 |
| 61 | 3300001989 | JGI24739J22299_10016556 | JGI24739J22299_100165562 | 115 |
| 62 | 3300001989 | JGI24739J22299_10017427 | JGI24739J22299_100174272 | 115 |
| 63 | 3300001991 | JGI24743J22301_10059244 | JGI24743J22301_100592442 | 115 |
| 64 | 3300002067 | JGI24735J21928_10060995 | JGI24735J21928_100609952 | 115 |
| 65 | 3300002073 | JGI24745J21846_1003085 | JGI24745J21846_10030852 | 115 |
| 66 | 3300002074 | JGI24748J21848_1001628 | JGI24748J21848_10016282 | 115 |
| 67 | 3300002075 | JGI24738J21930_10007688 | JGI24738J21930_100076882 | 115 |
| 68 | 3300002077 | JGI24744J21845_10035381 | JGI24744J21845_100353812 | 115 |
| 69 | 3300002155 | JGI24033J26618_1018913 | JGI24033J26618_10189132 | 115 |
| 70 | 3300002239 | JGI24034J26672_10002201 | JGI24034J26672_100022012 | 115 |
| 71 | 3300002239 | JGI24034J26672_10002230 | JGI24034J26672_100022302 | 115 |
| 72 | 3300002244 | JGI24742J22300_10003465 | JGI24742J22300_100034652 | 115 |
| 73 | 3300002705 | JGI25156J39149_1000313 | JGI25156J39149_10003139 | 115 |
| 74 | 3300003322 | rootL2_10001338 | rootL2_100013382 | 115 |
| 75 | 3300003322 | rootL2_10086943 | rootL2_100869434 | 115 |
| 76 | 3300003760 | Ga0055527_1003008 | Ga0055527_10030084 | 115 |
| 77 | 3300003762 | Ga0055542_1031490 | Ga0055542_10314902 | 115 |
| 78 | 3300003771 | Ga0055526_1011534 | Ga0055526_10115345 | 115 |
| 79 | 3300003771 | Ga0055526_1025228 | Ga0055526_10252282 | 115 |
| 80 | 3300003773 | Ga0055537_1003426 | Ga0055537_10034264 | 115 |
| 81 | 3300003775 | Ga0055524_1000607 | Ga0055524_100060714 | 115 |
| 82 | 3300003784 | Ga0055534_1000305 | Ga0055534_100030513 | 115 |
| 83 | 3300003784 | Ga0055534_1001282 | Ga0055534_10012827 | 115 |
| 84 | 3300003911 | JGI25405J52794_10002528 | JGI25405J52794_100025283 | 115 |
| 85 | 3300005327 | Ga0070658_10002107 | Ga0070658_100021078 | 115 |
| 86 | 3300005327 | Ga0070658_10081384 | Ga0070658_100813843 | 115 |
| 87 | 3300005327 | Ga0070658_10277305 | Ga0070658_102773052 | 115 |
| 88 | 3300005328 | Ga0070676_10026136 | Ga0070676_100261363 | 115 |
| 89 | 3300005328 | Ga0070676_10165545 | Ga0070676_101655452 | 115 |
| 90 | 3300005329 | Ga0070683_100278467 | Ga0070683_1002784672 | 115 |
| 91 | 3300005329 | Ga0070683_100547981 | Ga0070683_1005479812 | 115 |
| 92 | 3300005330 | Ga0070690_100465991 | Ga0070690_1004659912 | 115 |
| 93 | 3300005331 | Ga0070670_100214660 | Ga0070670_1002146602 | 115 |
| 94 | 3300005333 | Ga0070677_10033549 | Ga0070677_100335492 | 115 |
| 95 | 3300005334 | Ga0068869_101255126 | Ga0068869_1012551261 | 115 |
| 96 | 3300005336 | Ga0070680_100094871 | Ga0070680_1000948713 | 115 |
| 97 | 3300005336 | Ga0070680_100792647 | Ga0070680_1007926471 | 115 |
| 98 | 3300005337 | Ga0070682_100015375 | Ga0070682_1000153755 | 115 |
| 99 | 3300005337 | Ga0070682_100022657 | Ga0070682_1000226573 | 115 |
| 100 | 3300005337 | Ga0070682_101290290 | Ga0070682_1012902901 | 115 |
| 101 | 3300005338 | Ga0068868_100490428 | Ga0068868_1004904282 | 115 |
| 102 | 3300005339 | Ga0070660_100088326 | Ga0070660_1000883262 | 115 |
| 103 | 3300005339 | Ga0070660_100109490 | Ga0070660_1001094902 | 115 |
| 104 | 3300005339 | Ga0070660_100149293 | Ga0070660_1001492933 | 115 |
| 105 | 3300005343 | Ga0070687_100017936 | Ga0070687_1000179362 | 115 |
| 106 | 3300005344 | Ga0070661_100000020 | Ga0070661_10000002090 | 115 |
| 107 | 3300005344 | Ga0070661_100055823 | Ga0070661_1000558233 | 115 |
| 108 | 3300005344 | Ga0070661_100109110 | Ga0070661_1001091103 | 115 |
| 109 | 3300005344 | Ga0070661_100505789 | Ga0070661_1005057892 | 115 |
| 110 | 3300005347 | Ga0070668_100054856 | Ga0070668_1000548562 | 115 |
| 111 | 3300005353 | Ga0070669_100044463 | Ga0070669_1000444632 | 115 |
| 112 | 3300005353 | Ga0070669_100297475 | Ga0070669_1002974752 | 115 |
| 113 | 3300005354 | Ga0070675_100060346 | Ga0070675_1000603463 | 115 |
| 114 | 3300005355 | Ga0070671_100044576 | Ga0070671_1000445762 | 115 |
| 115 | 3300005356 | Ga0070674_100040302 | Ga0070674_1000403022 | 115 |
| 116 | 3300005364 | Ga0070673_100062935 | Ga0070673_1000629352 | 115 |
| 117 | 3300005365 | Ga0070688_100020352 | Ga0070688_1000203523 | 115 |
| 118 | 3300005366 | Ga0070659_100034303 | Ga0070659_1000343033 | 115 |
| 119 | 3300005366 | Ga0070659_100040676 | Ga0070659_1000406762 | 115 |
| 120 | 3300005366 | Ga0070659_100453758 | Ga0070659_1004537583 | 115 |
| 121 | 3300005367 | Ga0070667_100010218 | Ga0070667_1000102188 | 115 |
| 122 | 3300005436 | Ga0070713_100988745 | Ga0070713_1009887452 | 115 |
| 123 | 3300005436 | Ga0070713_101500065 | Ga0070713_1015000652 | 115 |
| 124 | 3300005438 | Ga0070701_10295304 | Ga0070701_102953042 | 115 |
| 125 | 3300005439 | Ga0070711_100058711 | Ga0070711_1000587112 | 115 |
| 126 | 3300005441 | Ga0070700_100308832 | Ga0070700_1003088321 | 115 |
| 127 | 3300005455 | Ga0070663_100013217 | Ga0070663_1000132174 | 115 |
| 128 | 3300005455 | Ga0070663_100055957 | Ga0070663_1000559572 | 115 |
| 129 | 3300005455 | Ga0070663_100351459 | Ga0070663_1003514592 | 115 |
| 130 | 3300005456 | Ga0070678_100033208 | Ga0070678_1000332082 | 115 |
| 131 | 3300005456 | Ga0070678_101237162 | Ga0070678_1012371622 | 115 |
| 132 | 3300005457 | Ga0070662_100033646 | Ga0070662_1000336463 | 115 |
| 133 | 3300005458 | Ga0070681_10096477 | Ga0070681_100964772 | 115 |
| 134 | 3300005458 | Ga0070681_10111126 | Ga0070681_101111263 | 115 |
| 135 | 3300005458 | Ga0070681_11775728 | Ga0070681_117757282 | 115 |
| 136 | 3300005459 | Ga0068867_100446445 | Ga0068867_1004464452 | 115 |
| 137 | 3300005459 | Ga0068867_101239220 | Ga0068867_1012392201 | 115 |
| 138 | 3300005466 | Ga0070685_10148733 | Ga0070685_101487332 | 115 |
| 139 | 3300005518 | Ga0070699_100973035 | Ga0070699_1009730352 | 115 |
| 140 | 3300005530 | Ga0070679_100102337 | Ga0070679_1001023373 | 115 |
| 141 | 3300005530 | Ga0070679_100104373 | Ga0070679_1001043733 | 115 |
| 142 | 3300005530 | Ga0070679_100383559 | Ga0070679_1003835591 | 115 |
| 143 | 3300005535 | Ga0070684_100440712 | Ga0070684_1004407122 | 115 |
| 144 | 3300005535 | Ga0070684_100593730 | Ga0070684_1005937302 | 115 |
| 145 | 3300005536 | Ga0070697_101132858 | Ga0070697_1011328582 | 115 |
| 146 | 3300005539 | Ga0068853_100091722 | Ga0068853_1000917223 | 115 |
| 147 | 3300005539 | Ga0068853_100187251 | Ga0068853_1001872512 | 115 |
| 148 | 3300005543 | Ga0070672_100046874 | Ga0070672_1000468743 | 115 |
| 149 | 3300005544 | Ga0070686_100075436 | Ga0070686_1000754362 | 115 |
| 150 | 3300005546 | Ga0070696_101079236 | Ga0070696_1010792362 | 115 |
| 151 | 3300005548 | Ga0070665_100057831 | Ga0070665_1000578315 | 115 |
| 152 | 3300005548 | Ga0070665_100656436 | Ga0070665_1006564362 | 115 |
| 153 | 3300005548 | Ga0070665_100834483 | Ga0070665_1008344831 | 115 |
| 154 | 3300005563 | Ga0068855_100439959 | Ga0068855_1004399592 | 115 |
| 155 | 3300005563 | Ga0068855_100592503 | Ga0068855_1005925032 | 115 |
| 156 | 3300005564 | Ga0070664_100079351 | Ga0070664_1000793512 | 115 |
| 157 | 3300005564 | Ga0070664_100081382 | Ga0070664_1000813822 | 115 |
| 158 | 3300005564 | Ga0070664_100472264 | Ga0070664_1004722642 | 115 |
| 159 | 3300005577 | Ga0068857_100054050 | Ga0068857_1000540506 | 115 |
| 160 | 3300005578 | Ga0068854_100027418 | Ga0068854_1000274187 | 115 |
| 161 | 3300005614 | Ga0068856_100000127 | Ga0068856_1000001273 | 115 |
| 162 | 3300005614 | Ga0068856_100468748 | Ga0068856_1004687482 | 115 |
| 163 | 3300005615 | Ga0070702_101144189 | Ga0070702_1011441892 | 115 |
| 164 | 3300005616 | Ga0068852_100097176 | Ga0068852_1000971762 | 115 |
| 165 | 3300005616 | Ga0068852_100098280 | Ga0068852_1000982803 | 115 |
| 166 | 3300005616 | Ga0068852_100226719 | Ga0068852_1002267193 | 115 |
| 167 | 3300005616 | Ga0068852_100753746 | Ga0068852_1007537462 | 115 |
| 168 | 3300005617 | Ga0068859_100111372 | Ga0068859_1001113722 | 115 |
| 169 | 3300005617 | Ga0068859_100119564 | Ga0068859_1001195642 | 115 |
| 170 | 3300005618 | Ga0068864_100101906 | Ga0068864_1001019063 | 115 |
| 171 | 3300005718 | Ga0068866_10125161 | Ga0068866_101251612 | 115 |
| 172 | 3300005840 | Ga0068870_10124438 | Ga0068870_101244382 | 115 |
| 173 | 3300005841 | Ga0068863_100086189 | Ga0068863_1000861893 | 115 |
| 174 | 3300005842 | Ga0068858_100088874 | Ga0068858_1000888743 | 115 |
| 175 | 3300005843 | Ga0068860_100061555 | Ga0068860_1000615552 | 115 |
| 176 | 3300005843 | Ga0068860_100392246 | Ga0068860_1003922461 | 115 |
| 177 | 3300005844 | Ga0068862_100012213 | Ga0068862_1000122136 | 115 |
| 178 | 3300005844 | Ga0068862_100077462 | Ga0068862_1000774622 | 115 |
| 179 | 3300005844 | Ga0068862_100095089 | Ga0068862_1000950892 | 115 |
| 180 | 3300005844 | Ga0068862_100431088 | Ga0068862_1004310882 | 115 |
| 181 | 3300005937 | Ga0081455_10077489 | Ga0081455_100774893 | 115 |
| 182 | 3300006028 | Ga0070717_10081587 | Ga0070717_100815873 | 115 |
| 183 | 3300006058 | Ga0075432_10018212 | Ga0075432_100182123 | 115 |
| 184 | 3300006173 | Ga0070716_100245039 | Ga0070716_1002450392 | 115 |
| 185 | 3300006237 | Ga0097621_100242812 | Ga0097621_1002428122 | 115 |
| 186 | 3300006353 | Ga0075370_10153883 | Ga0075370_101538834 | 115 |
| 187 | 3300006358 | Ga0068871_100037116 | Ga0068871_1000371162 | 115 |
| 188 | 3300006846 | Ga0075430_100004131 | Ga0075430_10000413111 | 115 |
| 189 | 3300006871 | Ga0075434_100495629 | Ga0075434_1004956292 | 115 |
| 190 | 3300006931 | Ga0097620_100111374 | Ga0097620_1001113742 | 115 |
| 191 | 3300006931 | Ga0097620_100119564 | Ga0097620_1001195643 | 115 |
| 192 | 3300007265 | Ga0099794_10639793 | Ga0099794_106397931 | 115 |
| 193 | 3300007788 | Ga0099795_10102393 | Ga0099795_101023932 | 115 |
| 194 | 3300009011 | Ga0105251_10018978 | Ga0105251_100189783 | 115 |
| 195 | 3300009011 | Ga0105251_10021475 | Ga0105251_100214753 | 115 |
| 196 | 3300009036 | Ga0105244_10022263 | Ga0105244_100222633 | 115 |
| 197 | 3300009092 | Ga0105250_10018493 | Ga0105250_100184933 | 115 |
| 198 | 3300009093 | Ga0105240_10104334 | Ga0105240_101043344 | 115 |
| 199 | 3300009093 | Ga0105240_10400197 | Ga0105240_104001972 | 115 |
| 200 | 3300009093 | Ga0105240_10596767 | Ga0105240_105967672 | 115 |
| 201 | 3300009093 | Ga0105240_11509117 | Ga0105240_115091172 | 115 |
| 202 | 3300009093 | Ga0105240_12140601 | Ga0105240_121406012 | 115 |
| 203 | 3300009101 | Ga0105247_10039970 | Ga0105247_100399702 | 115 |
| 204 | 3300009148 | Ga0105243_10197329 | Ga0105243_101973292 | 115 |
| 205 | 3300009174 | Ga0105241_10052885 | Ga0105241_100528852 | 115 |
| 206 | 3300009176 | Ga0105242_10024912 | Ga0105242_100249123 | 115 |
| 207 | 3300009176 | Ga0105242_10206975 | Ga0105242_102069753 | 115 |
| 208 | 3300009177 | Ga0105248_10011481 | Ga0105248_1001148110 | 115 |
| 209 | 3300009177 | Ga0105248_10017781 | Ga0105248_100177815 | 115 |
| 210 | 3300009545 | Ga0105237_10145609 | Ga0105237_101456093 | 115 |
| 211 | 3300009545 | Ga0105237_10167714 | Ga0105237_101677143 | 115 |
| 212 | 3300009545 | Ga0105237_10380695 | Ga0105237_103806952 | 115 |
| 213 | 3300009551 | Ga0105238_10069777 | Ga0105238_100697773 | 115 |
| 214 | 3300009551 | Ga0105238_10084820 | Ga0105238_100848203 | 115 |
| 215 | 3300009551 | Ga0105238_10196670 | Ga0105238_101966702 | 115 |
| 216 | 3300009551 | Ga0105238_12884830 | Ga0105238_128848301 | 115 |
| 217 | 3300009553 | Ga0105249_10098303 | Ga0105249_100983032 | 115 |
| 218 | 3300009553 | Ga0105249_10200163 | Ga0105249_102001632 | 115 |
| 219 | 3300009553 | Ga0105249_12305342 | Ga0105249_123053422 | 115 |
| 220 | 3300010159 | Ga0099796_10110077 | Ga0099796_101100772 | 115 |
| 221 | 3300010159 | Ga0099796_10168903 | Ga0099796_101689032 | 115 |
| 222 | 3300010375 | Ga0105239_10130517 | Ga0105239_101305172 | 115 |
| 223 | 3300010375 | Ga0105239_10251230 | Ga0105239_102512303 | 115 |
| 224 | 3300010375 | Ga0105239_10272471 | Ga0105239_102724712 | 115 |
| 225 | 3300010375 | Ga0105239_10983805 | Ga0105239_109838052 | 115 |
| 226 | 3300010375 | Ga0105239_11147064 | Ga0105239_111470642 | 115 |
| 227 | 3300011119 | Ga0105246_10019099 | Ga0105246_100190992 | 115 |
| 228 | 3300013100 | Ga0157373_10000025 | Ga0157373_1000002566 | 115 |
| 229 | 3300013100 | Ga0157373_10060878 | Ga0157373_100608782 | 115 |
| 230 | 3300013102 | Ga0157371_10054973 | Ga0157371_100549732 | 115 |
| 231 | 3300013102 | Ga0157371_10084086 | Ga0157371_100840862 | 115 |
| 232 | 3300013102 | Ga0157371_10484236 | Ga0157371_104842362 | 115 |
| 233 | 3300013104 | Ga0157370_10000027 | Ga0157370_1000002766 | 115 |
| 234 | 3300013105 | Ga0157369_10000167 | Ga0157369_1000016785 | 115 |
| 235 | 3300013105 | Ga0157369_10093201 | Ga0157369_100932014 | 115 |
| 236 | 3300013105 | Ga0157369_10173487 | Ga0157369_101734872 | 115 |
| 237 | 3300013105 | Ga0157369_10933260 | Ga0157369_109332602 | 115 |
| 238 | 3300013296 | Ga0157374_10081431 | Ga0157374_100814313 | 115 |
| 239 | 3300013297 | Ga0157378_10071387 | Ga0157378_100713874 | 115 |
| 240 | 3300013306 | Ga0163162_10000496 | Ga0163162_100004962 | 115 |
| 241 | 3300013306 | Ga0163162_10182801 | Ga0163162_101828012 | 115 |
| 242 | 3300013306 | Ga0163162_10641163 | Ga0163162_106411632 | 115 |
| 243 | 3300013306 | Ga0163162_11366250 | Ga0163162_113662502 | 115 |
| 244 | 3300013307 | Ga0157372_10136489 | Ga0157372_101364892 | 115 |
| 245 | 3300013307 | Ga0157372_10369673 | Ga0157372_103696732 | 115 |
| 246 | 3300013307 | Ga0157372_10594254 | Ga0157372_105942542 | 115 |
| 247 | 3300013308 | Ga0157375_10144458 | Ga0157375_101444582 | 115 |
| 248 | 3300013308 | Ga0157375_10346616 | Ga0157375_103466162 | 115 |
| 249 | 3300014325 | Ga0163163_10126276 | Ga0163163_101262762 | 115 |
| 250 | 3300014326 | Ga0157380_10265433 | Ga0157380_102654332 | 115 |
| 251 | 3300014497 | Ga0182008_10042135 | Ga0182008_100421352 | 115 |
| 252 | 3300014497 | Ga0182008_10138165 | Ga0182008_101381651 | 115 |
| 253 | 3300014497 | Ga0182008_10152553 | Ga0182008_101525532 | 115 |
| 254 | 3300014497 | Ga0182008_10193742 | Ga0182008_101937421 | 115 |
| 255 | 3300014745 | Ga0157377_11099273 | Ga0157377_110992732 | 115 |
| 256 | 3300014969 | Ga0157376_10057043 | Ga0157376_100570432 | 115 |
| 257 | 3300014969 | Ga0157376_10103782 | Ga0157376_101037822 | 115 |
| 258 | 3300014969 | Ga0157376_11265735 | Ga0157376_112657352 | 115 |
| 259 | 3300015261 | Ga0182006_1002778 | Ga0182006_10027788 | 115 |
| 260 | 3300015262 | Ga0182007_10014896 | Ga0182007_100148964 | 115 |
| 261 | 3300015262 | Ga0182007_10055886 | Ga0182007_100558862 | 115 |
| 262 | 3300015262 | Ga0182007_10062331 | Ga0182007_100623312 | 115 |
| 263 | 3300015262 | Ga0182007_10095006 | Ga0182007_100950062 | 115 |
| 264 | 3300016635 | Ga0183361_10008 | Ga0183361_10008132 | 115 |
| 265 | 3300017792 | Ga0163161_10004159 | Ga0163161_100041598 | 115 |
| 266 | 3300017792 | Ga0163161_10055839 | Ga0163161_100558393 | 115 |
| 267 | 3300020610 | Ga0154015_1022863 | Ga0154015_102286314 | 115 |
| 268 | 3300021358 | Ga0213873_10020690 | Ga0213873_100206902 | 115 |
| 269 | 3300021358 | Ga0213873_10049147 | Ga0213873_100491472 | 115 |
| 270 | 3300021361 | Ga0213872_10005360 | Ga0213872_100053602 | 115 |
| 271 | 3300021361 | Ga0213872_10243586 | Ga0213872_102435861 | 115 |
| 272 | 3300021377 | Ga0213874_10010242 | Ga0213874_100102422 | 115 |
| 273 | 3300021377 | Ga0213874_10011948 | Ga0213874_100119482 | 115 |
| 274 | 3300021384 | Ga0213876_10158967 | Ga0213876_101589672 | 115 |
| 275 | 3300024225 | Ga0224572_1021203 | Ga0224572_10212032 | 115 |
| 276 | 3300024225 | Ga0224572_1023066 | Ga0224572_10230662 | 115 |
| 277 | 3300024227 | Ga0228598_1009477 | Ga0228598_10094772 | 115 |
| 278 | 3300024227 | Ga0228598_1019584 | Ga0228598_10195842 | 115 |
| 279 | 3300025228 | Ga0209672_101662 | Ga0209672_10166210 | 115 |
| 280 | 3300025254 | Ga0209148_1001334 | Ga0209148_100133411 | 115 |
| 281 | 3300025256 | Ga0209759_1000562 | Ga0209759_100056226 | 115 |
| 282 | 3300025263 | Ga0209565_1000094 | Ga0209565_100009469 | 115 |
| 283 | 3300025273 | Ga0209673_1005825 | Ga0209673_10058252 | 115 |
| 284 | 3300025291 | Ga0209675_1000145 | Ga0209675_100014549 | 115 |
| 285 | 3300025291 | Ga0209675_1002086 | Ga0209675_10020867 | 115 |
| 286 | 3300025295 | Ga0209564_1000119 | Ga0209564_100011949 | 115 |
| 287 | 3300025295 | Ga0209564_1000509 | Ga0209564_100050949 | 115 |
| 288 | 3300025299 | Ga0209256_1001721 | Ga0209256_10017217 | 115 |
| 289 | 3300025315 | Ga0207697_10151032 | Ga0207697_101510322 | 115 |
| 290 | 3300025711 | Ga0207696_1014964 | Ga0207696_10149642 | 115 |
| 291 | 3300025728 | Ga0207655_1020250 | Ga0207655_10202503 | 115 |
| 292 | 3300025735 | Ga0207713_1021650 | Ga0207713_10216503 | 115 |
| 293 | 3300025893 | Ga0207682_10035286 | Ga0207682_100352862 | 115 |
| 294 | 3300025899 | Ga0207642_10108918 | Ga0207642_101089182 | 115 |
| 295 | 3300025900 | Ga0207710_10023555 | Ga0207710_100235552 | 115 |
| 296 | 3300025901 | Ga0207688_10070359 | Ga0207688_100703593 | 115 |
| 297 | 3300025903 | Ga0207680_10017137 | Ga0207680_100171372 | 115 |
| 298 | 3300025904 | Ga0207647_10047227 | Ga0207647_100472272 | 115 |
| 299 | 3300025904 | Ga0207647_10210967 | Ga0207647_102109672 | 115 |
| 300 | 3300025907 | Ga0207645_10015542 | Ga0207645_100155426 | 115 |
| 301 | 3300025907 | Ga0207645_10318662 | Ga0207645_103186622 | 115 |
| 302 | 3300025909 | Ga0207705_10000555 | Ga0207705_100005559 | 115 |
| 303 | 3300025909 | Ga0207705_10032073 | Ga0207705_100320732 | 115 |
| 304 | 3300025909 | Ga0207705_10087143 | Ga0207705_100871433 | 115 |
| 305 | 3300025911 | Ga0207654_10039578 | Ga0207654_100395782 | 115 |
| 306 | 3300025912 | Ga0207707_10076195 | Ga0207707_100761953 | 115 |
| 307 | 3300025912 | Ga0207707_10099636 | Ga0207707_100996362 | 115 |
| 308 | 3300025912 | Ga0207707_10352893 | Ga0207707_103528931 | 115 |
| 309 | 3300025912 | Ga0207707_11551017 | Ga0207707_115510172 | 115 |
| 310 | 3300025913 | Ga0207695_10028067 | Ga0207695_100280676 | 115 |
| 311 | 3300025913 | Ga0207695_10095130 | Ga0207695_100951302 | 115 |
| 312 | 3300025913 | Ga0207695_10280026 | Ga0207695_102800262 | 115 |
| 313 | 3300025913 | Ga0207695_10952416 | Ga0207695_109524162 | 115 |
| 314 | 3300025914 | Ga0207671_10061896 | Ga0207671_100618963 | 115 |
| 315 | 3300025914 | Ga0207671_10148567 | Ga0207671_101485672 | 115 |
| 316 | 3300025914 | Ga0207671_10161675 | Ga0207671_101616753 | 115 |
| 317 | 3300025916 | Ga0207663_10079303 | Ga0207663_100793032 | 115 |
| 318 | 3300025917 | Ga0207660_10077345 | Ga0207660_100773452 | 115 |
| 319 | 3300025919 | Ga0207657_10070312 | Ga0207657_100703123 | 115 |
| 320 | 3300025919 | Ga0207657_10070381 | Ga0207657_100703812 | 115 |
| 321 | 3300025920 | Ga0207649_10000059 | Ga0207649_1000005916 | 115 |
| 322 | 3300025920 | Ga0207649_10022386 | Ga0207649_100223865 | 115 |
| 323 | 3300025921 | Ga0207652_10100649 | Ga0207652_101006492 | 115 |
| 324 | 3300025921 | Ga0207652_10503561 | Ga0207652_105035612 | 115 |
| 325 | 3300025922 | Ga0207646_10289944 | Ga0207646_102899443 | 115 |
| 326 | 3300025923 | Ga0207681_10029071 | Ga0207681_100290713 | 115 |
| 327 | 3300025924 | Ga0207694_10074681 | Ga0207694_100746812 | 115 |
| 328 | 3300025925 | Ga0207650_10180087 | Ga0207650_101800872 | 115 |
| 329 | 3300025926 | Ga0207659_10070485 | Ga0207659_100704852 | 115 |
| 330 | 3300025927 | Ga0207687_10077351 | Ga0207687_100773512 | 115 |
| 331 | 3300025928 | Ga0207700_10198550 | Ga0207700_101985502 | 115 |
| 332 | 3300025928 | Ga0207700_10351353 | Ga0207700_103513531 | 115 |
| 333 | 3300025931 | Ga0207644_10035196 | Ga0207644_100351963 | 115 |
| 334 | 3300025932 | Ga0207690_10118505 | Ga0207690_101185052 | 115 |
| 335 | 3300025932 | Ga0207690_10183749 | Ga0207690_101837492 | 115 |
| 336 | 3300025932 | Ga0207690_10657510 | Ga0207690_106575102 | 115 |
| 337 | 3300025933 | Ga0207706_10063895 | Ga0207706_100638953 | 115 |
| 338 | 3300025933 | Ga0207706_10601590 | Ga0207706_106015902 | 115 |
| 339 | 3300025934 | Ga0207686_10017592 | Ga0207686_100175924 | 115 |
| 340 | 3300025934 | Ga0207686_10241097 | Ga0207686_102410972 | 115 |
| 341 | 3300025935 | Ga0207709_10050849 | Ga0207709_100508492 | 115 |
| 342 | 3300025936 | Ga0207670_10046909 | Ga0207670_100469092 | 115 |
| 343 | 3300025937 | Ga0207669_10022048 | Ga0207669_100220483 | 115 |
| 344 | 3300025939 | Ga0207665_10095927 | Ga0207665_100959272 | 115 |
| 345 | 3300025940 | Ga0207691_10090905 | Ga0207691_100909052 | 115 |
| 346 | 3300025941 | Ga0207711_10006542 | Ga0207711_1000654210 | 115 |
| 347 | 3300025941 | Ga0207711_10085731 | Ga0207711_100857313 | 115 |
| 348 | 3300025944 | Ga0207661_10376807 | Ga0207661_103768072 | 115 |
| 349 | 3300025945 | Ga0207679_10059952 | Ga0207679_100599522 | 115 |
| 350 | 3300025945 | Ga0207679_10060822 | Ga0207679_100608222 | 115 |
| 351 | 3300025945 | Ga0207679_10154573 | Ga0207679_101545732 | 115 |
| 352 | 3300025949 | Ga0207667_10008962 | Ga0207667_100089626 | 115 |
| 353 | 3300025960 | Ga0207651_10075404 | Ga0207651_100754042 | 115 |
| 354 | 3300025961 | Ga0207712_10062612 | Ga0207712_100626122 | 115 |
| 355 | 3300025972 | Ga0207668_10078971 | Ga0207668_100789712 | 115 |
| 356 | 3300025981 | Ga0207640_10000175 | Ga0207640_1000017539 | 115 |
| 357 | 3300025986 | Ga0207658_10017015 | Ga0207658_100170155 | 115 |
| 358 | 3300026035 | Ga0207703_10094456 | Ga0207703_100944562 | 115 |
| 359 | 3300026041 | Ga0207639_10267809 | Ga0207639_102678092 | 115 |
| 360 | 3300026041 | Ga0207639_10514659 | Ga0207639_105146591 | 115 |
| 361 | 3300026067 | Ga0207678_10000009 | Ga0207678_10000009141 | 115 |
| 362 | 3300026067 | Ga0207678_10067563 | Ga0207678_100675632 | 115 |
| 363 | 3300026067 | Ga0207678_10356406 | Ga0207678_103564062 | 115 |
| 364 | 3300026075 | Ga0207708_10221807 | Ga0207708_102218072 | 115 |
| 365 | 3300026078 | Ga0207702_10000896 | Ga0207702_100008963 | 115 |
| 366 | 3300026078 | Ga0207702_11291968 | Ga0207702_112919682 | 115 |
| 367 | 3300026088 | Ga0207641_10101348 | Ga0207641_101013482 | 115 |
| 368 | 3300026089 | Ga0207648_10783482 | Ga0207648_107834822 | 115 |
| 369 | 3300026089 | Ga0207648_11551748 | Ga0207648_115517482 | 115 |
| 370 | 3300026095 | Ga0207676_10106592 | Ga0207676_101065922 | 115 |
| 371 | 3300026116 | Ga0207674_10071938 | Ga0207674_100719386 | 115 |
| 372 | 3300026121 | Ga0207683_10072667 | Ga0207683_100726673 | 115 |
| 373 | 3300026121 | Ga0207683_10999560 | Ga0207683_109995602 | 115 |
| 374 | 3300026142 | Ga0207698_10103485 | Ga0207698_101034852 | 115 |
| 375 | 3300026142 | Ga0207698_10530163 | Ga0207698_105301632 | 115 |
| 376 | 3300026142 | Ga0207698_10827067 | Ga0207698_108270672 | 115 |
| 377 | 3300026142 | Ga0207698_11512581 | Ga0207698_115125812 | 115 |
| 378 | 3300027395 | Ga0209996_1040785 | Ga0209996_10407852 | 115 |
| 379 | 3300027876 | Ga0209974_10134153 | Ga0209974_101341532 | 115 |
| 380 | 3300027907 | Ga0207428_10077306 | Ga0207428_100773062 | 115 |
| 381 | 3300028023 | Ga0265357_1002288 | Ga0265357_10022882 | 115 |
| 382 | 3300028036 | Ga0265355_1000247 | Ga0265355_10002472 | 115 |
| 383 | 3300028379 | Ga0268266_10034730 | Ga0268266_100347303 | 115 |
| 384 | 3300028379 | Ga0268266_10833020 | Ga0268266_108330202 | 115 |
| 385 | 3300028380 | Ga0268265_10008523 | Ga0268265_100085236 | 115 |
| 386 | 3300028380 | Ga0268265_10053875 | Ga0268265_100538753 | 115 |
| 387 | 3300028380 | Ga0268265_10424989 | Ga0268265_104249892 | 115 |
| 388 | 3300028380 | Ga0268265_11094164 | Ga0268265_110941641 | 115 |
| 389 | 3300028381 | Ga0268264_10838429 | Ga0268264_108384292 | 115 |
| 390 | 3300028381 | Ga0268264_11102276 | Ga0268264_111022762 | 115 |
| 391 | 3300028786 | Ga0307517_10200381 | Ga0307517_102003812 | 115 |
| 392 | 3300030760 | Ga0265762_1024088 | Ga0265762_10240882 | 115 |
| 393 | 3300030763 | Ga0265763_1035902 | Ga0265763_10359022 | 115 |
| 394 | 3300031018 | Ga0265773_1006515 | Ga0265773_10065152 | 115 |
| 395 | 3300031018 | Ga0265773_1022953 | Ga0265773_10229532 | 115 |
| 396 | 3300031090 | Ga0265760_10005309 | Ga0265760_100053093 | 115 |
| 397 | 3300031090 | Ga0265760_10026231 | Ga0265760_100262312 | 115 |
| 398 | 3300031090 | Ga0265760_10034003 | Ga0265760_100340033 | 115 |
| 399 | 3300031235 | Ga0265330_10175831 | Ga0265330_101758312 | 115 |
| 400 | 3300031250 | Ga0265331_10215290 | Ga0265331_102152902 | 115 |
| 401 | 3300031507 | Ga0307509_10004447 | Ga0307509_1000444711 | 115 |
| 402 | 3300031548 | Ga0307408_100395406 | Ga0307408_1003954062 | 115 |
| 403 | 3300031548 | Ga0307408_101161592 | Ga0307408_1011615922 | 115 |
| 404 | 3300031616 | Ga0307508_10469166 | Ga0307508_104691662 | 115 |
| 405 | 3300031711 | Ga0265314_10036097 | Ga0265314_100360971 | 115 |
| 406 | 3300031712 | Ga0265342_10229190 | Ga0265342_102291902 | 115 |
| 407 | 3300031730 | Ga0307516_10167601 | Ga0307516_101676012 | 115 |
| 408 | 3300033544 | Ga0316215_1009276 | Ga0316215_10092762 | 115 |
| 409 | 3300033545 | Ga0316214_1015175 | Ga0316214_10151752 | 115 |
| 410 | 3300033546 | Ga0316213_1002203 | Ga0316213_10022032 | 115 |
| 411 | 3300033547 | Ga0316212_1010904 | Ga0316212_10109042 | 115 |
| 412 | 3300035113 | Ga0373936_0449115 | Ga0373936_0449115_70_417 | 115 |
| 413 | 3300035119 | Ga0373956_0467300 | Ga0373956_0467300_204_551 | 115 |
| 414 | 3300036401 | Ga0373937_0076075 | Ga0373937_0076075_1753_2100 | 115 |
| 415 | 3300037068 | Ga0373925_0615709 | Ga0373925_0615709_489_836 | 115 |
| 416 | 3300037312 | Ga0395899_0239709 | Ga0395899_0239709_876_1223 | 115 |
| 417 | 3300037312 | Ga0395899_0272635 | Ga0395899_0272635_643_990 | 115 |
| 418 | 3300037418 | Ga0395900_0079562 | Ga0395900_0079562_2996_3343 | 115 |
| 419 | 3300037418 | Ga0395900_0218868 | Ga0395900_0218868_205_552 | 115 |
| 420 | 3300037418 | Ga0395900_0351838 | Ga0395900_0351838_522_869 | 115 |
| 421 | 3300037418 | Ga0395900_0478379 | Ga0395900_0478379_831_1178 | 115 |
| 422 | 3300037418 | Ga0395900_0530271 | Ga0395900_0530271_128_475 | 115 |
| 423 | 3300037466 | Ga0395898_0024501 | Ga0395898_0024501_741_1088 | 115 |
| 424 | 3300037466 | Ga0395898_0059019 | Ga0395898_0059019_955_1302 | 115 |
| 425 | 3300037466 | Ga0395898_0123525 | Ga0395898_0123525_488_835 | 115 |
| 426 | 3300037466 | Ga0395898_0284458 | Ga0395898_0284458_629_976 | 115 |
| 427 | 3300037466 | Ga0395898_1019444 | Ga0395898_1019444_111_458 | 115 |
| 428 | 3300037471 | Ga0395905_0037832 | Ga0395905_0037832_523_870 | 115 |
| 429 | 3300037471 | Ga0395905_1314473 | Ga0395905_1314473_224_571 | 115 |
| 430 | 3300037471 | Ga0395905_1445528 | Ga0395905_1445528_108_455 | 115 |
| 431 | 3300037471 | Ga0395905_1855045 | Ga0395905_1855045_96_443 | 115 |
| 432 | 3300038443 | Ga0395901_0000023 | Ga0395901_0000023_4374_4721 | 115 |
| 433 | 3300038443 | Ga0395901_0000105 | Ga0395901_0000105_113955_114302 | 115 |
| 434 | 3300038443 | Ga0395901_0143056 | Ga0395901_0143056_1084_1431 | 115 |
| 435 | 3300038443 | Ga0395901_0199859 | Ga0395901_0199859_1062_1409 | 115 |
| 436 | 3300038443 | Ga0395901_0275673 | Ga0395901_0275673_468_815 | 115 |
| 437 | 3300038443 | Ga0395901_0649269 | Ga0395901_0649269_611_958 | 115 |
| 438 | 3300038443 | Ga0395901_0866070 | Ga0395901_0866070_53_400 | 115 |
| 439 | 3300038443 | Ga0395901_0926435 | Ga0395901_0926435_17_364 | 115 |
| 440 | 3300039437 | Ga0436365_0781751 | Ga0436365_0781751_293_640 | 115 |
| 441 | 3300039438 | Ga0436360_1060060 | Ga0436360_1060060_55_402 | 115 |
| 442 | 3300039447 | Ga0436361_0721434 | Ga0436361_0721434_6560_6907 | 115 |
| 443 | 3300039447 | Ga0436361_0823803 | Ga0436361_0823803_596_943 | 115 |
| 444 | 3300039447 | Ga0436361_0843575 | Ga0436361_0843575_74_430 | 115 |
| 445 | 3300039447 | Ga0436361_1039794 | Ga0436361_1039794_318_665 | 115 |
| 446 | 3300039450 | Ga0436363_0607979 | Ga0436363_0607979_398_745 | 115 |
| 447 | 3300039450 | Ga0436363_1360161 | Ga0436363_1360161_659_1006 | 115 |
| 448 | 3300039450 | Ga0436363_1450927 | Ga0436363_1450927_1287_1634 | 115 |
| 449 | 3300039450 | Ga0436363_1679434 | Ga0436363_1679434_1193_1540 | 115 |
| 450 | 3300039453 | Ga0436362_0641548 | Ga0436362_0641548_99_458 | 115 |
| 451 | 3300039453 | Ga0436362_0749208 | Ga0436362_0749208_190_537 | 115 |
| 452 | 3300039453 | Ga0436362_1005007 | Ga0436362_1005007_518_865 | 115 |
| 453 | 3300039453 | Ga0436362_1044349 | Ga0436362_1044349_1116_1463 | 115 |
| 454 | 3300041406 | Ga0439439_0026322 | Ga0439439_0026322_1059_1406 | 115 |
| 455 | 3300041413 | Ga0439465_0295558 | Ga0439465_0295558_42_389 | 115 |
| 456 | 3300041999 | Ga0439433_0002877 | Ga0439433_0002877_948_1295 | 115 |
| 457 | 3300042002 | Ga0439442_043584 | Ga0439442_043584_19_366 | 115 |
| 458 | 3300042005 | Ga0439448_0014497 | Ga0439448_0014497_1227_1574 | 115 |
| 459 | 3300042005 | Ga0439448_0149723 | Ga0439448_0149723_414_761 | 115 |
| 460 | 3300042005 | Ga0439448_0245364 | Ga0439448_0245364_264_611 | 115 |
| 461 | 3300042007 | Ga0439449_0010320 | Ga0439449_0010320_1341_1688 | 115 |
| 462 | 3300042007 | Ga0439449_0062439 | Ga0439449_0062439_873_1220 | 115 |
| 463 | 3300042008 | Ga0439450_000217 | Ga0439450_000217_2606_2953 | 115 |
| 464 | 3300042012 | Ga0439455_0005009 | Ga0439455_0005009_458_805 | 115 |
| 465 | 3300042012 | Ga0439455_0010315 | Ga0439455_0010315_574_921 | 115 |
| 466 | 3300042115 | Ga0450911_003223 | Ga0450911_003223_871_1218 | 115 |
| 467 | 3300042134 | Ga0450898_024603 | Ga0450898_024603_669_1016 | 115 |
| 468 | 3300042142 | Ga0450905_003261 | Ga0450905_003261_1303_1650 | 115 |
| 469 | 3300042157 | Ga0439458_0006674 | Ga0439458_0006674_1634_1981 | 115 |
| 470 | 3300042157 | Ga0439458_0053094 | Ga0439458_0053094_151_498 | 115 |
| 471 | 3300042876 | Ga0451577_1842415 | Ga0451577_1842415_153_500 | 115 |
| 472 | 3300044656 | Ga0466969_0018995 | Ga0466969_0018995_763_1110 | 115 |
| 473 | 3300044656 | Ga0466969_0378083 | Ga0466969_0378083_98_445 | 115 |
| 474 | 3300044658 | Ga0466972_0173606 | Ga0466972_0173606_151_498 | 115 |
| 475 | 3300044658 | Ga0466972_0246013 | Ga0466972_0246013_312_659 | 115 |
| 476 | 3300044672 | Ga0466982_0064206 | Ga0466982_0064206_1516_1863 | 115 |
| 477 | 3300044673 | Ga0453683_0213246 | Ga0453683_0213246_684_1031 | 115 |
| 478 | 3300044683 | Ga0466965_0015140 | Ga0466965_0015140_312_659 | 115 |
| 479 | 3300044683 | Ga0466965_0046292 | Ga0466965_0046292_1565_1912 | 115 |
| 480 | 3300044684 | Ga0466966_0033747 | Ga0466966_0033747_1987_2334 | 115 |
| 481 | 3300044684 | Ga0466966_0070701 | Ga0466966_0070701_1368_1715 | 115 |
| 482 | 3300044684 | Ga0466966_0093831 | Ga0466966_0093831_767_1114 | 115 |
| 483 | 3300044684 | Ga0466966_0174614 | Ga0466966_0174614_567_914 | 115 |
| 484 | 3300044684 | Ga0466966_0259859 | Ga0466966_0259859_306_653 | 115 |
| 485 | 3300044684 | Ga0466966_0325281 | Ga0466966_0325281_250_597 | 115 |
| 486 | 3300044693 | Ga0466961_0089480 | Ga0466961_0089480_438_785 | 115 |
| 487 | 3300044693 | Ga0466961_0260940 | Ga0466961_0260940_96_443 | 115 |
| 488 | 3300044694 | Ga0466963_1350092 | Ga0466963_1350092_16_363 | 115 |
| 489 | 3300044706 | Ga0466964_0000035 | Ga0466964_0000035_10303_10650 | 115 |
| 490 | 3300044706 | Ga0466964_0005016 | Ga0466964_0005016_2520_2867 | 115 |
| 491 | 3300044706 | Ga0466964_0005415 | Ga0466964_0005415_1853_2200 | 115 |
| 492 | 3300044706 | Ga0466964_0343684 | Ga0466964_0343684_337_684 | 115 |
| 493 | 3300044712 | Ga0453684_0724410 | Ga0453684_0724410_641_988 | 115 |
| 494 | 3300044719 | Ga0466971_0032184 | Ga0466971_0032184_465_812 | 115 |
| 495 | 3300044719 | Ga0466971_0142382 | Ga0466971_0142382_192_539 | 115 |
| 496 | 3300044735 | Ga0466968_0012992 | Ga0466968_0012992_651_998 | 115 |
| 497 | 3300044735 | Ga0466968_0014843 | Ga0466968_0014843_1895_2242 | 115 |
| 498 | 3300044735 | Ga0466968_0041383 | Ga0466968_0041383_1034_1381 | 115 |
| 499 | 3300044765 | Ga0466970_0055984 | Ga0466970_0055984_339_686 | 115 |
| 500 | 3300044765 | Ga0466970_0081370 | Ga0466970_0081370_803_1150 | 115 |
| 501 | 3300044765 | Ga0466970_0117674 | Ga0466970_0117674_132_479 | 115 |
| 502 | 3300044842 | Ga0466957_0014638 | Ga0466957_0014638_3081_3428 | 115 |
| 503 | 3300044842 | Ga0466957_0151327 | Ga0466957_0151327_498_845 | 115 |
| 504 | 3300044842 | Ga0466957_0189773 | Ga0466957_0189773_553_900 | 115 |
| 505 | 3300044901 | Ga0466960_0086260 | Ga0466960_0086260_515_862 | 115 |
| 506 | 3300044901 | Ga0466960_0312730 | Ga0466960_0312730_373_720 | 115 |
| 507 | 3300044901 | Ga0466960_0580726 | Ga0466960_0580726_239_586 | 115 |
| 508 | 3300045049 | Ga0466959_0050047 | Ga0466959_0050047_1169_1516 | 115 |
| 509 | 3300045049 | Ga0466959_0058440 | Ga0466959_0058440_564_911 | 115 |
| 510 | 3300045049 | Ga0466959_0090104 | Ga0466959_0090104_876_1223 | 115 |
| 511 | 3300045049 | Ga0466959_0139529 | Ga0466959_0139529_405_752 | 115 |
| 512 | 3300045049 | Ga0466959_0556910 | Ga0466959_0556910_108_455 | 115 |
| 513 | 3300045049 | Ga0466959_0678362 | Ga0466959_0678362_293_640 | 115 |
| 514 | 3300045976 | Ga0466967_0011229 | Ga0466967_0011229_1907_2254 | 115 |
| 515 | 3300045976 | Ga0466967_0067035 | Ga0466967_0067035_559_906 | 115 |
| 516 | 3300045976 | Ga0466967_0111411 | Ga0466967_0111411_354_701 | 115 |
| 517 | 3300046452 | Ga0495617_002089 | Ga0495617_002089_2626_2973 | 115 |
| 518 | 3300046452 | Ga0495617_009096 | Ga0495617_009096_2476_2823 | 115 |
| 519 | 3300046454 | Ga0495592_0039002 | Ga0495592_0039002_2327_2674 | 115 |
| 520 | 3300046455 | Ga0495603_0028018 | Ga0495603_0028018_2153_2500 | 115 |
| 521 | 3300046455 | Ga0495603_0067447 | Ga0495603_0067447_1262_1633 | 115 |
| 522 | 3300046457 | Ga0495590_0004639 | Ga0495590_0004639_517_864 | 115 |
| 523 | 3300046457 | Ga0495590_0014771 | Ga0495590_0014771_1737_2084 | 115 |
| 524 | 3300046457 | Ga0495590_0018469 | Ga0495590_0018469_1675_2022 | 115 |
| 525 | 3300046457 | Ga0495590_0070217 | Ga0495590_0070217_687_1034 | 115 |
| 526 | 3300046457 | Ga0495590_0079035 | Ga0495590_0079035_448_795 | 115 |
| 527 | 3300046457 | Ga0495590_0135660 | Ga0495590_0135660_33_380 | 115 |
| 528 | 3300046458 | Ga0495591_012212 | Ga0495591_012212_2083_2430 | 115 |
| 529 | 3300046459 | Ga0495629_0036558 | Ga0495629_0036558_996_1343 | 115 |
| 530 | 3300046459 | Ga0495629_0038996 | Ga0495629_0038996_1303_1674 | 115 |
| 531 | 3300046460 | Ga0495638_0003375 | Ga0495638_0003375_2374_2721 | 115 |
| 532 | 3300046460 | Ga0495638_0006209 | Ga0495638_0006209_8293_8640 | 115 |
| 533 | 3300046460 | Ga0495638_0038693 | Ga0495638_0038693_601_948 | 115 |
| 534 | 3300046460 | Ga0495638_0357931 | Ga0495638_0357931_211_558 | 115 |
| 535 | 3300046461 | Ga0495641_0061356 | Ga0495641_0061356_504_875 | 115 |
| 536 | 3300046462 | Ga0495651_0042549 | Ga0495651_0042549_2695_3042 | 115 |
| 537 | 3300046462 | Ga0495651_0090162 | Ga0495651_0090162_1694_2065 | 115 |
| 538 | 3300046462 | Ga0495651_0813807 | Ga0495651_0813807_18_365 | 115 |
| 539 | 3300046463 | Ga0495653_0000904 | Ga0495653_0000904_3757_4128 | 115 |
| 540 | 3300046463 | Ga0495653_0038449 | Ga0495653_0038449_1752_2099 | 115 |
| 541 | 3300046471 | Ga0495650_0020333 | Ga0495650_0020333_2661_3020 | 115 |
| 542 | 3300046471 | Ga0495650_0042496 | Ga0495650_0042496_211_558 | 115 |
| 543 | 3300046471 | Ga0495650_0197099 | Ga0495650_0197099_162_509 | 115 |
| 544 | 3300046472 | Ga0495580_0027988 | Ga0495580_0027988_2948_3295 | 115 |
| 545 | 3300046472 | Ga0495580_0051213 | Ga0495580_0051213_1549_1896 | 115 |
| 546 | 3300046472 | Ga0495580_0252584 | Ga0495580_0252584_502_852 | 115 |
| 547 | 3300046472 | Ga0495580_0256771 | Ga0495580_0256771_304_651 | 115 |
| 548 | 3300046472 | Ga0495580_0566960 | Ga0495580_0566960_326_673 | 115 |
| 549 | 3300046473 | Ga0495582_0022394 | Ga0495582_0022394_2136_2507 | 115 |
| 550 | 3300046474 | Ga0495605_0001545 | Ga0495605_0001545_10277_10624 | 115 |
| 551 | 3300046474 | Ga0495605_0002454 | Ga0495605_0002454_10509_10856 | 115 |
| 552 | 3300046474 | Ga0495605_0017299 | Ga0495605_0017299_1140_1487 | 115 |
| 553 | 3300046474 | Ga0495605_0017447 | Ga0495605_0017447_2573_2920 | 115 |
| 554 | 3300046474 | Ga0495605_0100104 | Ga0495605_0100104_232_579 | 115 |
| 555 | 3300046474 | Ga0495605_0155107 | Ga0495605_0155107_207_554 | 115 |
| 556 | 3300046475 | Ga0495639_0076427 | Ga0495639_0076427_552_899 | 115 |
| 557 | 3300046475 | Ga0495639_0763616 | Ga0495639_0763616_122_469 | 115 |
| 558 | 3300046476 | Ga0495662_0081022 | Ga0495662_0081022_442_813 | 115 |
| 559 | 3300046477 | Ga0495664_0023340 | Ga0495664_0023340_1959_2330 | 115 |
| 560 | 3300046477 | Ga0495664_0047467 | Ga0495664_0047467_1842_2213 | 115 |
| 561 | 3300046491 | Ga0495584_0000480 | Ga0495584_0000480_8918_9265 | 115 |
| 562 | 3300046491 | Ga0495584_0004824 | Ga0495584_0004824_4247_4594 | 115 |
| 563 | 3300046491 | Ga0495584_0005179 | Ga0495584_0005179_2020_2367 | 115 |
| 564 | 3300046491 | Ga0495584_0019301 | Ga0495584_0019301_1792_2139 | 115 |
| 565 | 3300046491 | Ga0495584_0020687 | Ga0495584_0020687_2324_2671 | 115 |
| 566 | 3300046492 | Ga0495585_0000270 | Ga0495585_0000270_1288_1635 | 115 |
| 567 | 3300046492 | Ga0495585_0005492 | Ga0495585_0005492_6449_6796 | 115 |
| 568 | 3300046492 | Ga0495585_0015645 | Ga0495585_0015645_942_1289 | 115 |
| 569 | 3300046492 | Ga0495585_0020937 | Ga0495585_0020937_211_558 | 115 |
| 570 | 3300046492 | Ga0495585_0188565 | Ga0495585_0188565_608_955 | 115 |
| 571 | 3300046499 | Ga0495594_0393526 | Ga0495594_0393526_389_736 | 115 |
| 572 | 3300046500 | Ga0495596_0000497 | Ga0495596_0000497_2562_2909 | 115 |
| 573 | 3300046500 | Ga0495596_0000704 | Ga0495596_0000704_3875_4222 | 115 |
| 574 | 3300046500 | Ga0495596_0014856 | Ga0495596_0014856_655_1002 | 115 |
| 575 | 3300046500 | Ga0495596_0022061 | Ga0495596_0022061_1195_1542 | 115 |
| 576 | 3300046500 | Ga0495596_0035740 | Ga0495596_0035740_28_399 | 115 |
| 577 | 3300046500 | Ga0495596_0219659 | Ga0495596_0219659_198_545 | 115 |
| 578 | 3300046501 | Ga0495607_0001328 | Ga0495607_0001328_18123_18470 | 115 |
| 579 | 3300046501 | Ga0495607_0001369 | Ga0495607_0001369_20733_21080 | 115 |
| 580 | 3300046501 | Ga0495607_0058183 | Ga0495607_0058183_211_558 | 115 |
| 581 | 3300046501 | Ga0495607_0154780 | Ga0495607_0154780_199_546 | 115 |
| 582 | 3300046506 | Ga0495583_0000063 | Ga0495583_0000063_17000_17347 | 115 |
| 583 | 3300046506 | Ga0495583_0002987 | Ga0495583_0002987_3072_3419 | 115 |
| 584 | 3300046506 | Ga0495583_0015161 | Ga0495583_0015161_1787_2134 | 115 |
| 585 | 3300046506 | Ga0495583_0029908 | Ga0495583_0029908_1697_2044 | 115 |
| 586 | 3300046506 | Ga0495583_0042111 | Ga0495583_0042111_46_393 | 115 |
| 587 | 3300046506 | Ga0495583_0284392 | Ga0495583_0284392_176_523 | 115 |
| 588 | 3300046507 | Ga0495606_0000827 | Ga0495606_0000827_10835_11182 | 115 |
| 589 | 3300046507 | Ga0495606_0005749 | Ga0495606_0005749_8003_8350 | 115 |
| 590 | 3300046507 | Ga0495606_0029616 | Ga0495606_0029616_2741_3088 | 115 |
| 591 | 3300046507 | Ga0495606_0043834 | Ga0495606_0043834_841_1188 | 115 |
| 592 | 3300046507 | Ga0495606_0044805 | Ga0495606_0044805_2085_2432 | 115 |
| 593 | 3300046507 | Ga0495606_0244685 | Ga0495606_0244685_85_432 | 115 |
| 594 | 3300046511 | Ga0495608_0028688 | Ga0495608_0028688_2919_3266 | 115 |
| 595 | 3300046511 | Ga0495608_0052056 | Ga0495608_0052056_448_819 | 115 |
| 596 | 3300046511 | Ga0495608_0679396 | Ga0495608_0679396_198_545 | 115 |
| 597 | 3300046512 | Ga0495610_0017926 | Ga0495610_0017926_2185_2532 | 115 |
| 598 | 3300046512 | Ga0495610_0028855 | Ga0495610_0028855_742_1113 | 115 |
| 599 | 3300046513 | Ga0495616_0000142 | Ga0495616_0000142_969_1316 | 115 |
| 600 | 3300046513 | Ga0495616_0000318 | Ga0495616_0000318_37520_37867 | 115 |
| 601 | 3300046513 | Ga0495616_0008734 | Ga0495616_0008734_5148_5495 | 115 |
| 602 | 3300046513 | Ga0495616_0012698 | Ga0495616_0012698_497_844 | 115 |
| 603 | 3300046513 | Ga0495616_0028689 | Ga0495616_0028689_2045_2392 | 115 |
| 604 | 3300046513 | Ga0495616_0032586 | Ga0495616_0032586_2162_2509 | 115 |
| 605 | 3300046513 | Ga0495616_0035023 | Ga0495616_0035023_546_893 | 115 |
| 606 | 3300046513 | Ga0495616_0059207 | Ga0495616_0059207_1082_1429 | 115 |
| 607 | 3300046514 | Ga0495618_0021096 | Ga0495618_0021096_2161_2532 | 115 |
| 608 | 3300046514 | Ga0495618_0029480 | Ga0495618_0029480_2501_2848 | 115 |
| 609 | 3300046515 | Ga0495620_0014187 | Ga0495620_0014187_737_1084 | 115 |
| 610 | 3300046516 | Ga0495628_0003133 | Ga0495628_0003133_3868_4239 | 115 |
| 611 | 3300046516 | Ga0495628_0004405 | Ga0495628_0004405_9127_9474 | 115 |
| 612 | 3300046516 | Ga0495628_0070083 | Ga0495628_0070083_2114_2473 | 115 |
| 613 | 3300046517 | Ga0495630_0075708 | Ga0495630_0075708_475_846 | 115 |
| 614 | 3300046517 | Ga0495630_1168774 | Ga0495630_1168774_190_549 | 115 |
| 615 | 3300046518 | Ga0495631_0007702 | Ga0495631_0007702_2793_3140 | 115 |
| 616 | 3300046518 | Ga0495631_0302922 | Ga0495631_0302922_206_553 | 115 |
| 617 | 3300046519 | Ga0495632_0016552 | Ga0495632_0016552_385_732 | 115 |
| 618 | 3300046519 | Ga0495632_0069459 | Ga0495632_0069459_757_1104 | 115 |
| 619 | 3300046519 | Ga0495632_0156819 | Ga0495632_0156819_483_830 | 115 |
| 620 | 3300046520 | Ga0495637_0020999 | Ga0495637_0020999_569_916 | 115 |
| 621 | 3300046522 | Ga0495643_0034384 | Ga0495643_0034384_336_683 | 115 |
| 622 | 3300046523 | Ga0495644_0007935 | Ga0495644_0007935_1353_1700 | 115 |
| 623 | 3300046523 | Ga0495644_0111414 | Ga0495644_0111414_629_976 | 115 |
| 624 | 3300046523 | Ga0495644_0125908 | Ga0495644_0125908_320_667 | 115 |
| 625 | 3300046524 | Ga0495648_0015040 | Ga0495648_0015040_4239_4586 | 115 |
| 626 | 3300046524 | Ga0495648_0028873 | Ga0495648_0028873_2820_3167 | 115 |
| 627 | 3300046524 | Ga0495648_0095887 | Ga0495648_0095887_932_1279 | 115 |
| 628 | 3300046526 | Ga0495666_0003858 | Ga0495666_0003858_6679_7050 | 115 |
| 629 | 3300046526 | Ga0495666_0111677 | Ga0495666_0111677_291_638 | 115 |
| 630 | 3300046528 | Ga0495642_0000906 | Ga0495642_0000906_13352_13699 | 115 |
| 631 | 3300046528 | Ga0495642_0002663 | Ga0495642_0002663_1616_1963 | 115 |
| 632 | 3300046528 | Ga0495642_0006132 | Ga0495642_0006132_1780_2127 | 115 |
| 633 | 3300046528 | Ga0495642_0128510 | Ga0495642_0128510_539_886 | 115 |
| 634 | 3300046528 | Ga0495642_0168322 | Ga0495642_0168322_288_635 | 115 |
| 635 | 3300046528 | Ga0495642_0501085 | Ga0495642_0501085_107_454 | 115 |
| 636 | 3300046529 | Ga0495652_0013991 | Ga0495652_0013991_6378_6725 | 115 |
| 637 | 3300046529 | Ga0495652_0029479 | Ga0495652_0029479_3988_4335 | 115 |
| 638 | 3300046529 | Ga0495652_0039467 | Ga0495652_0039467_634_1005 | 115 |
| 639 | 3300046530 | Ga0495654_0015394 | Ga0495654_0015394_532_879 | 115 |
| 640 | 3300046530 | Ga0495654_0089845 | Ga0495654_0089845_546_893 | 115 |
| 641 | 3300046531 | Ga0495665_0039180 | Ga0495665_0039180_479_850 | 115 |
| 642 | 3300046531 | Ga0495665_0086267 | Ga0495665_0086267_823_1194 | 115 |
| 643 | 3300046533 | Ga0495640_0126729 | Ga0495640_0126729_722_1093 | 115 |
| 644 | 3300046533 | Ga0495640_0712970 | Ga0495640_0712970_222_569 | 115 |
| 645 | 3300046535 | Ga0495586_0050816 | Ga0495586_0050816_1520_1891 | 115 |
| 646 | 3300046536 | Ga0495587_0418367 | Ga0495587_0418367_306_677 | 115 |
| 647 | 3300046537 | Ga0495598_0013357 | Ga0495598_0013357_1178_1525 | 115 |
| 648 | 3300046538 | Ga0495609_0000124 | Ga0495609_0000124_623_970 | 115 |
| 649 | 3300046538 | Ga0495609_0000198 | Ga0495609_0000198_969_1316 | 115 |
| 650 | 3300046538 | Ga0495609_0002629 | Ga0495609_0002629_2325_2672 | 115 |
| 651 | 3300046538 | Ga0495609_0010675 | Ga0495609_0010675_3595_3942 | 115 |
| 652 | 3300046538 | Ga0495609_0033648 | Ga0495609_0033648_35_406 | 115 |
| 653 | 3300046539 | Ga0495621_0059188 | Ga0495621_0059188_797_1144 | 115 |
| 654 | 3300046542 | Ga0495597_0009836 | Ga0495597_0009836_2020_2367 | 115 |
| 655 | 3300046542 | Ga0495597_0067599 | Ga0495597_0067599_99_446 | 115 |
| 656 | 3300046542 | Ga0495597_0075662 | Ga0495597_0075662_1015_1362 | 115 |
| 657 | 3300046542 | Ga0495597_0091925 | Ga0495597_0091925_434_781 | 115 |
| 658 | 3300046543 | Ga0495645_0013110 | Ga0495645_0013110_2643_2990 | 115 |
| 659 | 3300046543 | Ga0495645_0035731 | Ga0495645_0035731_2764_3135 | 115 |
| 660 | 3300046543 | Ga0495645_0153874 | Ga0495645_0153874_600_971 | 115 |
| 661 | 3300046558 | Ga0495633_0019298 | Ga0495633_0019298_655_1002 | 115 |
| 662 | 3300046558 | Ga0495633_0064479 | Ga0495633_0064479_469_816 | 115 |
| 663 | 3300046558 | Ga0495633_0119778 | Ga0495633_0119778_364_711 | 115 |
| 664 | 3300046558 | Ga0495633_0507277 | Ga0495633_0507277_95_442 | 115 |
| 665 | 3300046559 | Ga0495667_0095248 | Ga0495667_0095248_691_1062 | 115 |
| 666 | 3300046615 | Ga0495656_0001645 | Ga0495656_0001645_1086_1433 | 115 |
| 667 | 3300046615 | Ga0495656_0004323 | Ga0495656_0004323_3638_3985 | 115 |
| 668 | 3300046615 | Ga0495656_0015609 | Ga0495656_0015609_2045_2392 | 115 |
| 669 | 3300046616 | Ga0495668_0003297 | Ga0495668_0003297_11447_11794 | 115 |
| 670 | 3300046616 | Ga0495668_0033957 | Ga0495668_0033957_726_1073 | 115 |
| 671 | 3300046616 | Ga0495668_0046705 | Ga0495668_0046705_1584_1931 | 115 |
| 672 | 3300046642 | Ga0495634_0027598 | Ga0495634_0027598_1968_2339 | 115 |
| 673 | 3300046642 | Ga0495634_0285512 | Ga0495634_0285512_357_704 | 115 |
| 674 | 3300046648 | Ga0495611_0003551 | Ga0495611_0003551_5837_6184 | 115 |
| 675 | 3300046648 | Ga0495611_0010156 | Ga0495611_0010156_2649_2996 | 115 |
| 676 | 3300046648 | Ga0495611_0013558 | Ga0495611_0013558_2095_2442 | 115 |
| 677 | 3300046648 | Ga0495611_0023533 | Ga0495611_0023533_548_895 | 115 |
| 678 | 3300046648 | Ga0495611_0025019 | Ga0495611_0025019_569_916 | 115 |
| 679 | 3300046648 | Ga0495611_0123644 | Ga0495611_0123644_416_763 | 115 |
| 680 | 3300046660 | Ga0495625_0030388 | Ga0495625_0030388_90_437 | 115 |
| 681 | 3300046660 | Ga0495625_0036850 | Ga0495625_0036850_2466_2813 | 115 |
| 682 | 3300046660 | Ga0495625_0056188 | Ga0495625_0056188_2059_2406 | 115 |
| 683 | 3300046660 | Ga0495625_0066568 | Ga0495625_0066568_1612_1959 | 115 |
| 684 | 3300046660 | Ga0495625_0667481 | Ga0495625_0667481_156_503 | 115 |
| 685 | 3300046663 | Ga0495635_0019487 | Ga0495635_0019487_483_854 | 115 |
| 686 | 3300046663 | Ga0495635_0055785 | Ga0495635_0055785_1676_2023 | 115 |
| 687 | 3300046664 | Ga0495659_0002026 | Ga0495659_0002026_3650_3997 | 115 |
| 688 | 3300046664 | Ga0495659_0144937 | Ga0495659_0144937_319_666 | 115 |
| 689 | 3300046664 | Ga0495659_0529885 | Ga0495659_0529885_70_417 | 115 |
| 690 | 3300046665 | Ga0495661_0000094 | Ga0495661_0000094_107188_107535 | 115 |
| 691 | 3300046665 | Ga0495661_0000552 | Ga0495661_0000552_1676_2023 | 115 |
| 692 | 3300046665 | Ga0495661_0001579 | Ga0495661_0001579_17797_18144 | 115 |
| 693 | 3300046665 | Ga0495661_0001921 | Ga0495661_0001921_11064_11411 | 115 |
| 694 | 3300046665 | Ga0495661_0020567 | Ga0495661_0020567_511_858 | 115 |
| 695 | 3300046665 | Ga0495661_0022141 | Ga0495661_0022141_3041_3388 | 115 |
| 696 | 3300046665 | Ga0495661_0022865 | Ga0495661_0022865_3552_3899 | 115 |
| 697 | 3300046665 | Ga0495661_0035235 | Ga0495661_0035235_1077_1424 | 115 |
| 698 | 3300046665 | Ga0495661_0048331 | Ga0495661_0048331_1771_2118 | 115 |
| 699 | 3300046665 | Ga0495661_0062275 | Ga0495661_0062275_136_483 | 115 |
| 700 | 3300046674 | Ga0495588_0029702 | Ga0495588_0029702_1852_2199 | 115 |
| 701 | 3300046674 | Ga0495588_0032067 | Ga0495588_0032067_1792_2139 | 115 |
| 702 | 3300046674 | Ga0495588_0036636 | Ga0495588_0036636_1712_2062 | 115 |
| 703 | 3300046674 | Ga0495588_0491843 | Ga0495588_0491843_274_621 | 115 |
| 704 | 3300046674 | Ga0495588_0717751 | Ga0495588_0717751_81_428 | 115 |
| 705 | 3300046675 | Ga0495657_0049897 | Ga0495657_0049897_1961_2308 | 115 |
| 706 | 3300046675 | Ga0495657_0154856 | Ga0495657_0154856_439_810 | 115 |
| 707 | 3300046678 | Ga0495599_0006702 | Ga0495599_0006702_1520_1867 | 115 |
| 708 | 3300046678 | Ga0495599_0012778 | Ga0495599_0012778_4490_4837 | 115 |
| 709 | 3300046678 | Ga0495599_0905053 | Ga0495599_0905053_26_373 | 115 |
| 710 | 3300046679 | Ga0495623_0002298 | Ga0495623_0002298_3601_3948 | 115 |
| 711 | 3300046679 | Ga0495623_0004679 | Ga0495623_0004679_2344_2715 | 115 |
| 712 | 3300046679 | Ga0495623_0055673 | Ga0495623_0055673_1597_1944 | 115 |
| 713 | 3300046679 | Ga0495623_0279367 | Ga0495623_0279367_523_870 | 115 |
| 714 | 3300046680 | Ga0495646_0022385 | Ga0495646_0022385_1443_1814 | 115 |
| 715 | 3300046680 | Ga0495646_0045828 | Ga0495646_0045828_660_1007 | 115 |
| 716 | 3300046680 | Ga0495646_0445311 | Ga0495646_0445311_148_519 | 115 |
| 717 | 3300046683 | Ga0495658_0039145 | Ga0495658_0039145_467_814 | 115 |
| 718 | 3300046684 | Ga0495669_0012868 | Ga0495669_0012868_933_1280 | 115 |
| 719 | 3300046684 | Ga0495669_0019560 | Ga0495669_0019560_2366_2713 | 115 |
| 720 | 3300046689 | Ga0495613_0201083 | Ga0495613_0201083_344_715 | 115 |
| 721 | 3300046690 | Ga0495624_0018634 | Ga0495624_0018634_458_805 | 115 |
| 722 | 3300046690 | Ga0495624_0023699 | Ga0495624_0023699_1981_2352 | 115 |
| 723 | 3300046690 | Ga0495624_0046656 | Ga0495624_0046656_531_878 | 115 |
| 724 | 3300046690 | Ga0495624_0177172 | Ga0495624_0177172_795_1166 | 115 |
| 725 | 3300046691 | Ga0495670_0001628 | Ga0495670_0001628_9456_9803 | 115 |
| 726 | 3300046691 | Ga0495670_0002782 | Ga0495670_0002782_2287_2634 | 115 |
| 727 | 3300046691 | Ga0495670_0063357 | Ga0495670_0063357_705_1052 | 115 |
| 728 | 3300046691 | Ga0495670_0373731 | Ga0495670_0373731_211_558 | 115 |
| 729 | 3300046692 | Ga0495671_0001063 | Ga0495671_0001063_17948_18295 | 115 |
| 730 | 3300046692 | Ga0495671_0001619 | Ga0495671_0001619_4061_4408 | 115 |
| 731 | 3300046692 | Ga0495671_0031412 | Ga0495671_0031412_2158_2505 | 115 |
| 732 | 3300046692 | Ga0495671_0365027 | Ga0495671_0365027_221_568 | 115 |
| 733 | 3300046694 | Ga0495649_0039034 | Ga0495649_0039034_249_596 | 115 |
| 734 | 3300046794 | Ga0495589_0000019 | Ga0495589_0000019_1860_2207 | 115 |
| 735 | 3300046794 | Ga0495589_0000168 | Ga0495589_0000168_831_1178 | 115 |
| 736 | 3300046794 | Ga0495589_0040176 | Ga0495589_0040176_211_558 | 115 |
| 737 | 3300046794 | Ga0495589_0206494 | Ga0495589_0206494_58_405 | 115 |
| 738 | 3300046794 | Ga0495589_0467725 | Ga0495589_0467725_189_536 | 115 |
| 739 | 3300046809 | Ga0495600_0018195 | Ga0495600_0018195_485_832 | 115 |
| 740 | 3300046809 | Ga0495600_0050734 | Ga0495600_0050734_567_938 | 115 |
| 741 | 3300046810 | Ga0495660_0010031 | Ga0495660_0010031_876_1223 | 115 |
| 742 | 3300046810 | Ga0495660_0026837 | Ga0495660_0026837_1696_2043 | 115 |
| 743 | 3300047315 | Ga0495581_0231999 | Ga0495581_0231999_530_901 | 115 |
| 744 | 3300047317 | Ga0495604_0001624 | Ga0495604_0001624_17866_18237 | 115 |
| 745 | 3300047317 | Ga0495604_0021041 | Ga0495604_0021041_1659_2006 | 115 |
| 746 | 3300047317 | Ga0495604_0051512 | Ga0495604_0051512_511_858 | 115 |
| 747 | 3300047317 | Ga0495604_0129603 | Ga0495604_0129603_1167_1514 | 115 |
| 748 | 3300047317 | Ga0495604_0192417 | Ga0495604_0192417_468_815 | 115 |
| 749 | 3300047318 | Ga0495636_0000468 | Ga0495636_0000468_7679_8026 | 115 |
| 750 | 3300047318 | Ga0495636_0008126 | Ga0495636_0008126_2619_2966 | 115 |
| 751 | 3300047318 | Ga0495636_0046138 | Ga0495636_0046138_892_1239 | 115 |
| 752 | 3300047318 | Ga0495636_0298789 | Ga0495636_0298789_75_422 | 115 |
| 753 | 3300047319 | Ga0495674_0061459 | Ga0495674_0061459_2170_2541 | 115 |
| 754 | 3300047319 | Ga0495674_0086568 | Ga0495674_0086568_1867_2238 | 115 |
| 755 | 3300047319 | Ga0495674_1100601 | Ga0495674_1100601_55_402 | 115 |
| 756 | 3300047320 | Ga0495672_0002278 | Ga0495672_0002278_13791_14138 | 115 |
| 757 | 3300047320 | Ga0495672_0091244 | Ga0495672_0091244_520_867 | 115 |
| 758 | 3300047320 | Ga0495672_0342135 | Ga0495672_0342135_34_381 | 115 |
| 759 | 3300047321 | Ga0495676_0015951 | Ga0495676_0015951_4326_4697 | 115 |
| 760 | 3300047321 | Ga0495676_0021020 | Ga0495676_0021020_584_931 | 115 |
| 761 | 3300047322 | Ga0495680_0078210 | Ga0495680_0078210_467_838 | 115 |
| 762 | 3300047323 | Ga0495683_0000433 | Ga0495683_0000433_5148_5495 | 115 |
| 763 | 3300047323 | Ga0495683_0020851 | Ga0495683_0020851_2306_2677 | 115 |
| 764 | 3300047323 | Ga0495683_0022417 | Ga0495683_0022417_1193_1540 | 115 |
| 765 | 3300047323 | Ga0495683_0194430 | Ga0495683_0194430_442_789 | 115 |
| 766 | 3300047323 | Ga0495683_0246107 | Ga0495683_0246107_268_615 | 115 |
| 767 | 3300047323 | Ga0495683_0308931 | Ga0495683_0308931_120_467 | 115 |
| 768 | 3300047443 | Ga0495687_000132 | Ga0495687_000132_112479_112826 | 115 |
| 769 | 3300047443 | Ga0495687_000313 | Ga0495687_000313_61271_61618 | 115 |
| 770 | 3300047443 | Ga0495687_001190 | Ga0495687_001190_15131_15478 | 115 |
| 771 | 3300047443 | Ga0495687_002442 | Ga0495687_002442_4556_4903 | 115 |
| 772 | 3300047443 | Ga0495687_002529 | Ga0495687_002529_6159_6506 | 115 |
| 773 | 3300047443 | Ga0495687_023200 | Ga0495687_023200_586_957 | 115 |
| 774 | 3300047443 | Ga0495687_065366 | Ga0495687_065366_991_1338 | 115 |
| 775 | 3300047443 | Ga0495687_091651 | Ga0495687_091651_460_807 | 115 |
| 776 | 3300047444 | Ga0495675_0002982 | Ga0495675_0002982_1472_1843 | 115 |
| 777 | 3300047444 | Ga0495675_0038294 | Ga0495675_0038294_411_758 | 115 |
| 778 | 3300047444 | Ga0495675_0823391 | Ga0495675_0823391_89_436 | 115 |
| 779 | 3300047445 | Ga0495677_0000062 | Ga0495677_0000062_59050_59397 | 115 |
| 780 | 3300047445 | Ga0495677_0000469 | Ga0495677_0000469_1860_2207 | 115 |
| 781 | 3300047445 | Ga0495677_0001719 | Ga0495677_0001719_6189_6536 | 115 |
| 782 | 3300047445 | Ga0495677_0013773 | Ga0495677_0013773_561_908 | 115 |
| 783 | 3300047445 | Ga0495677_0058567 | Ga0495677_0058567_587_934 | 115 |
| 784 | 3300047446 | Ga0495679_006340 | Ga0495679_006340_4578_4925 | 115 |
| 785 | 3300047446 | Ga0495679_008563 | Ga0495679_008563_865_1212 | 115 |
| 786 | 3300047447 | Ga0495685_010587 | Ga0495685_010587_2214_2561 | 115 |
| 787 | 3300047469 | Ga0495673_0004330 | Ga0495673_0004330_4807_5154 | 115 |
| 788 | 3300047469 | Ga0495673_0055701 | Ga0495673_0055701_515_862 | 115 |
| 789 | 3300047469 | Ga0495673_0119454 | Ga0495673_0119454_171_518 | 115 |
| 790 | 3300047470 | Ga0495681_0016121 | Ga0495681_0016121_2616_2963 | 115 |
| 791 | 3300047470 | Ga0495681_0113802 | Ga0495681_0113802_375_722 | 115 |
| 792 | 3300047472 | Ga0495686_0026896 | Ga0495686_0026896_2908_3255 | 115 |
| 793 | 3300047472 | Ga0495686_0287814 | Ga0495686_0287814_269_616 | 115 |
| 794 | 3300047472 | Ga0495686_0391165 | Ga0495686_0391165_317_664 | 115 |
| 795 | 3300047673 | Ga0495593_0008837 | Ga0495593_0008837_3865_4236 | 115 |
| 796 | 3300048088 | Ga0495602_0004438 | Ga0495602_0004438_9126_9497 | 115 |
| 797 | 3300048088 | Ga0495602_0012465 | Ga0495602_0012465_3975_4322 | 115 |
| 798 | 3300048088 | Ga0495602_0075575 | Ga0495602_0075575_854_1201 | 115 |
| 799 | 3300048088 | Ga0495602_0093324 | Ga0495602_0093324_1659_2006 | 115 |
| 800 | 3300048088 | Ga0495602_0122130 | Ga0495602_0122130_273_644 | 115 |
| 801 | 3300048088 | Ga0495602_0203194 | Ga0495602_0203194_670_1017 | 115 |
| 802 | 3300048088 | Ga0495602_0858199 | Ga0495602_0858199_163_510 | 115 |
| 803 | 3300048089 | Ga0495614_0024521 | Ga0495614_0024521_527_898 | 115 |
| 804 | 3300048090 | Ga0495615_0007722 | Ga0495615_0007722_1624_1971 | 115 |
| 805 | 3300048090 | Ga0495615_0243950 | Ga0495615_0243950_123_470 | 115 |
| 806 | 3300048091 | Ga0495626_0000376 | Ga0495626_0000376_23552_23899 | 115 |
| 807 | 3300048091 | Ga0495626_0004004 | Ga0495626_0004004_6196_6543 | 115 |
| 808 | 3300048091 | Ga0495626_0004364 | Ga0495626_0004364_1731_2078 | 115 |
| 809 | 3300048091 | Ga0495626_0019959 | Ga0495626_0019959_2483_2830 | 115 |
| 810 | 3300048091 | Ga0495626_0071066 | Ga0495626_0071066_334_681 | 115 |
| 811 | 3300048903 | Ga0496100_0052778 | Ga0496100_0052778_1792_2139 | 115 |
| 812 | 3300048903 | Ga0496100_0465463 | Ga0496100_0465463_64_411 | 115 |
| 813 | 3300048903 | Ga0496100_0720310 | Ga0496100_0720310_196_567 | 115 |
| 814 | 3300048903 | Ga0496100_0843311 | Ga0496100_0843311_322_669 | 115 |
| 815 | 3300048904 | Ga0496101_0055040 | Ga0496101_0055040_559_906 | 115 |
| 816 | 3300048904 | Ga0496101_0056586 | Ga0496101_0056586_1809_2180 | 115 |
| 817 | 3300048904 | Ga0496101_0338492 | Ga0496101_0338492_609_980 | 115 |
| 818 | 3300048905 | Ga0496102_0126999 | Ga0496102_0126999_339_686 | 115 |
| 819 | 3300048905 | Ga0496102_0458767 | Ga0496102_0458767_638_985 | 115 |
| 820 | 3300048906 | Ga0496103_0030793 | Ga0496103_0030793_577_924 | 115 |
| 821 | 3300048906 | Ga0496103_0154570 | Ga0496103_0154570_282_629 | 115 |
| 822 | 3300048906 | Ga0496103_0821650 | Ga0496103_0821650_167_514 | 115 |
| 823 | 3300048907 | Ga0496104_0034826 | Ga0496104_0034826_2848_3195 | 115 |
| 824 | 3300048907 | Ga0496104_0110040 | Ga0496104_0110040_623_970 | 115 |
| 825 | 3300048907 | Ga0496104_0630228 | Ga0496104_0630228_604_951 | 115 |
| 826 | 3300048908 | Ga0496105_0016422 | Ga0496105_0016422_2665_3012 | 115 |
| 827 | 3300048908 | Ga0496105_0082069 | Ga0496105_0082069_560_907 | 115 |
| 828 | 3300048908 | Ga0496105_0132118 | Ga0496105_0132118_556_903 | 115 |
| 829 | 3300048908 | Ga0496105_0214227 | Ga0496105_0214227_588_935 | 115 |
| 830 | 3300048908 | Ga0496105_0973034 | Ga0496105_0973034_12_371 | 115 |
| 831 | 3300048909 | Ga0496106_0008060 | Ga0496106_0008060_610_957 | 115 |
| 832 | 3300048909 | Ga0496106_0030441 | Ga0496106_0030441_1709_2056 | 115 |
| 833 | 3300048910 | Ga0496107_0047701 | Ga0496107_0047701_1376_1723 | 115 |
| 834 | 3300048910 | Ga0496107_0049393 | Ga0496107_0049393_1792_2139 | 115 |
| 835 | 3300048910 | Ga0496107_0406728 | Ga0496107_0406728_105_452 | 115 |
| 836 | 3300048911 | Ga0496108_0193368 | Ga0496108_0193368_801_1148 | 115 |
| 837 | 3300048911 | Ga0496108_0340416 | Ga0496108_0340416_733_1080 | 115 |
| 838 | 3300048912 | Ga0496109_0102971 | Ga0496109_0102971_1792_2139 | 115 |
| 839 | 3300048913 | Ga0496110_0051889 | Ga0496110_0051889_540_887 | 115 |
| 840 | 3300048913 | Ga0496110_0074102 | Ga0496110_0074102_1719_2066 | 115 |
| 841 | 3300048913 | Ga0496110_0166659 | Ga0496110_0166659_1084_1431 | 115 |
| 842 | 3300048913 | Ga0496110_0247473 | Ga0496110_0247473_699_1046 | 115 |
| 843 | 3300048913 | Ga0496110_1005981 | Ga0496110_1005981_42_389 | 115 |
| 844 | 3300048914 | Ga0496111_0038362 | Ga0496111_0038362_486_833 | 115 |
| 845 | 3300048914 | Ga0496111_0214351 | Ga0496111_0214351_732_1079 | 115 |
| 846 | 3300048914 | Ga0496111_0218308 | Ga0496111_0218308_912_1259 | 115 |
| 847 | 3300048914 | Ga0496111_0999124 | Ga0496111_0999124_188_535 | 115 |
| 848 | 3300048915 | Ga0496112_0103867 | Ga0496112_0103867_1914_2261 | 115 |
| 849 | 3300048915 | Ga0496112_0265873 | Ga0496112_0265873_706_1053 | 115 |
| 850 | 3300048915 | Ga0496112_0433379 | Ga0496112_0433379_536_883 | 115 |
| 851 | 3300048915 | Ga0496112_0734001 | Ga0496112_0734001_171_518 | 115 |
| 852 | 3300048916 | Ga0496113_0071565 | Ga0496113_0071565_507_854 | 115 |
| 853 | 3300048916 | Ga0496113_0120066 | Ga0496113_0120066_1538_1885 | 115 |
| 854 | 3300048916 | Ga0496113_0215747 | Ga0496113_0215747_572_919 | 115 |
| 855 | 3300048916 | Ga0496113_0394215 | Ga0496113_0394215_248_595 | 115 |
| 856 | 3300048917 | Ga0496114_0122539 | Ga0496114_0122539_211_558 | 115 |
| 857 | 3300048917 | Ga0496114_0169462 | Ga0496114_0169462_1438_1785 | 115 |
| 858 | 3300048917 | Ga0496114_0416344 | Ga0496114_0416344_282_629 | 115 |
| 859 | 3300048917 | Ga0496114_0473585 | Ga0496114_0473585_288_635 | 115 |
| 860 | 3300048918 | Ga0496115_0048461 | Ga0496115_0048461_1707_2054 | 115 |
| 861 | 3300048918 | Ga0496115_0077631 | Ga0496115_0077631_1774_2121 | 115 |
| 862 | 3300048918 | Ga0496115_0131288 | Ga0496115_0131288_644_991 | 115 |
| 863 | 3300048918 | Ga0496115_0528245 | Ga0496115_0528245_481_828 | 115 |
| 864 | 3300048919 | Ga0496116_0062898 | Ga0496116_0062898_1673_2020 | 115 |
| 865 | 3300048919 | Ga0496116_0157678 | Ga0496116_0157678_445_816 | 115 |
| 866 | 3300048920 | Ga0496117_0054340 | Ga0496117_0054340_741_1088 | 115 |
| 867 | 3300048920 | Ga0496117_0055484 | Ga0496117_0055484_1821_2192 | 115 |
| 868 | 3300048920 | Ga0496117_0093436 | Ga0496117_0093436_1537_1896 | 115 |
| 869 | 3300048920 | Ga0496117_0230373 | Ga0496117_0230373_551_922 | 115 |
| 870 | 3300048921 | Ga0496118_0037829 | Ga0496118_0037829_2917_3288 | 115 |
| 871 | 3300048921 | Ga0496118_0048253 | Ga0496118_0048253_517_864 | 115 |
| 872 | 3300048922 | Ga0496119_0047105 | Ga0496119_0047105_1759_2106 | 115 |
| 873 | 3300048923 | Ga0496120_0074997 | Ga0496120_0074997_130_501 | 115 |
| 874 | 3300048924 | Ga0496121_0002981 | Ga0496121_0002981_1643_2014 | 115 |
| 875 | 3300048924 | Ga0496121_0041344 | Ga0496121_0041344_2304_2675 | 115 |
| 876 | 3300048924 | Ga0496121_0064085 | Ga0496121_0064085_860_1207 | 115 |
| 877 | 3300048924 | Ga0496121_0069997 | Ga0496121_0069997_773_1144 | 115 |
| 878 | 3300048925 | Ga0496122_0044840 | Ga0496122_0044840_519_866 | 115 |
| 879 | 3300048926 | Ga0496123_0102400 | Ga0496123_0102400_226_573 | 115 |
| 880 | 3300048927 | Ga0496124_0048622 | Ga0496124_0048622_1623_1970 | 115 |
| 881 | 3300048928 | Ga0496125_0104160 | Ga0496125_0104160_1253_1600 | 115 |
| 882 | 3300048929 | Ga0496126_0004806 | Ga0496126_0004806_868_1239 | 115 |
| 883 | 3300048929 | Ga0496126_0075322 | Ga0496126_0075322_1937_2284 | 115 |
| 884 | 3300048929 | Ga0496126_0285849 | Ga0496126_0285849_720_1091 | 115 |
| 885 | 3300048929 | Ga0496126_0399193 | Ga0496126_0399193_93_440 | 115 |
| 886 | 3300048929 | Ga0496126_0906114 | Ga0496126_0906114_214_585 | 115 |
| 887 | 3300049459 | Ga0495678_006049 | Ga0495678_006049_4388_4735 | 115 |
| 888 | 3300049459 | Ga0495678_013689 | Ga0495678_013689_804_1151 | 115 |
| 889 | 3300049459 | Ga0495678_014134 | Ga0495678_014134_1015_1362 | 115 |
| 890 | 3300049459 | Ga0495678_016841 | Ga0495678_016841_2486_2833 | 115 |
| 891 | 3300049459 | Ga0495678_035409 | Ga0495678_035409_732_1079 | 115 |
| 892 | 3300049460 | Ga0495682_0002880 | Ga0495682_0002880_7107_7454 | 115 |
| 893 | 3300049460 | Ga0495682_0089062 | Ga0495682_0089062_605_952 | 115 |
| 894 | 3300049460 | Ga0495682_0091089 | Ga0495682_0091089_47_394 | 115 |
| 895 | 3300049460 | Ga0495682_0238523 | Ga0495682_0238523_164_511 | 115 |
| 896 | 3300049571 | Ga0501034_0070007 | Ga0501034_0070007_2399_2746 | 115 |
| 897 | 3300049571 | Ga0501034_0596046 | Ga0501034_0596046_467_814 | 115 |
| 898 | 3300049571 | Ga0501034_1472533 | Ga0501034_1472533_50_397 | 115 |
| 899 | 3300049572 | Ga0501036_0059691 | Ga0501036_0059691_1211_1558 | 115 |
| 900 | 3300049574 | Ga0501038_0246178 | Ga0501038_0246178_1045_1392 | 115 |
| 901 | 3300049583 | Ga0501067_0108649 | Ga0501067_0108649_1124_1471 | 115 |
| 902 | 3300049584 | Ga0501068_0042701 | Ga0501068_0042701_1851_2198 | 115 |
| 903 | 3300049585 | Ga0501069_0025746 | Ga0501069_0025746_1828_2175 | 115 |
| 904 | 3300049586 | Ga0501070_0301025 | Ga0501070_0301025_446_793 | 115 |
| 905 | 3300049587 | Ga0501071_0407525 | Ga0501071_0407525_130_477 | 115 |
| 906 | 3300049588 | Ga0501072_0134330 | Ga0501072_0134330_1487_1834 | 115 |
| 907 | 3300049589 | Ga0501073_0043805 | Ga0501073_0043805_1913_2260 | 115 |
| 908 | 3300049589 | Ga0501073_0337674 | Ga0501073_0337674_51_398 | 115 |
| 909 | 3300049590 | Ga0501074_0045009 | Ga0501074_0045009_2194_2541 | 115 |
| 910 | 3300049593 | Ga0501077_0203562 | Ga0501077_0203562_332_679 | 115 |
| 911 | 3300049741 | Ga0501079_0062029 | Ga0501079_0062029_1984_2331 | 115 |
| 912 | 3300049742 | Ga0501080_0090643 | Ga0501080_0090643_1930_2277 | 115 |
| 913 | 3300049743 | Ga0501081_0379398 | Ga0501081_0379398_461_808 | 115 |
| 914 | 3300049744 | Ga0501083_0053773 | Ga0501083_0053773_671_1018 | 115 |
| 915 | 3300050496 | nmdc:mga07m45_125479_c1 | nmdc:mga07m45_125479_c1_721_1068 | 115 |
| 916 | 3300050509 | nmdc:mga0qj67_3522_c1 | nmdc:mga0qj67_3522_c1_4348_4695 | 115 |
| 917 | 3300050512 | nmdc:mga0n895_878377_c1 | nmdc:mga0n895_878377_c1_500_847 | 115 |
| 918 | 3300053077 | Ga0495601_0009084 | Ga0495601_0009084_1863_2210 | 115 |
| 919 | 3300053083 | Ga0495655_0017319 | Ga0495655_0017319_468_815 | 115 |
| 920 | 3300053086 | Ga0500578_0082049 | Ga0500578_0082049_1083_1430 | 115 |
| 921 | 3300053088 | Ga0500644_0157612 | Ga0500644_0157612_409_756 | 115 |
| 922 | 3300053092 | Ga0500583_0073287 | Ga0500583_0073287_777_1124 | 115 |
| 923 | 3300053103 | Ga0500555_070560 | Ga0500555_070560_152_499 | 115 |
| 924 | 3300053117 | Ga0500593_013458 | Ga0500593_013458_2531_2878 | 115 |
| 925 | 3300053127 | Ga0500623_276708 | Ga0500623_276708_171_518 | 115 |
| 926 | 3300053134 | Ga0500658_0196046 | Ga0500658_0196046_425_772 | 115 |
| 927 | 3300053140 | Ga0500573_0066218 | Ga0500573_0066218_1118_1465 | 115 |
| 928 | 3300053141 | Ga0500574_000311 | Ga0500574_000311_3732_4079 | 115 |
| 929 | 3300053142 | Ga0500577_0072013 | Ga0500577_0072013_923_1270 | 115 |
| 930 | 3300053149 | Ga0500600_0181090 | Ga0500600_0181090_528_875 | 115 |
| 931 | 3300053151 | Ga0500604_0147593 | Ga0500604_0147593_66_413 | 115 |
| 932 | 3300053153 | Ga0500616_0120499 | Ga0500616_0120499_452_823 | 115 |
| 933 | 3300053154 | Ga0500619_008007 | Ga0500619_008007_493_840 | 115 |
| 934 | 3300053160 | Ga0500633_0168239 | Ga0500633_0168239_320_667 | 115 |
| 935 | 3300053735 | Ga0500596_049249 | Ga0500596_049249_151_498 | 115 |
| 936 | 3300054114 | Ga0501084_0075728 | Ga0501084_0075728_600_947 | 115 |
| 937 | 3300060353 | Ga0501082_0089660 | Ga0501082_0089660_1732_2079 | 115 |
| 938 | 3300061719 | Ga0466962_0042455 | Ga0466962_0042455_435_782 | 115 |
| 939 | 3300061719 | Ga0466962_0102881 | Ga0466962_0102881_672_1019 | 115 |
| 940 | 3300061734 | Ga0530510_0035482 | Ga0530510_0035482_1180_1527 | 115 |
| 941 | iso_pu_bacteria | 2928108538 | 2928110696 | 115 |
| 942 | iso_pu_bacteria | 2928135762 | 2928140212 | 115 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4buj-assembly2.cif.gz_H | crystal structure of the s. cerevisiae ski2-3-8 complex | 0.7526 | 44 | 75 |
| 4rzk-assembly1.cif.gz_B | crystal structure of sulfolobus solfataricus hsp20.1 acd | 0.7425 | 43 | 72 |
| 7aht-assembly1.cif.gz_A | structure of the n-domain of the k+/h+ antiporter subunit khtt at ph 7.5 | 0.7396 | 45 | 70 |
| 4buj-assembly1.cif.gz_D | crystal structure of the s. cerevisiae ski2-3-8 complex | 0.7376 | 44 | 75 |
| 1zyk-assembly2.cif.gz_B | anthranilate phosphoribosyltransferase in complex with prpp, anthranilate and magnesium | 0.7359 | 42 | 70 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q86KI1_749_872_2.60.40.1230 | Mainly Beta;Sandwich;Immunoglobulin-like;Gamma-adaptin ear (GAE) domain | 0.9046 | 53 | 71 | 2.60.40.1230 |
| af_K7LBL5_48_252_2.130.10.10 | Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase | 0.8077 | 42 | 73 | 2.130.10.10 |
| af_U4PRP0_4_217_1.20.140.150 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; | 0.8031 | 45 | 73 | 1.20.140.150 |
| af_U4PRP0_9_201_1.20.140.150 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; | 0.8031 | 45 | 73 | 1.20.140.150 |
| 1mdcA00 | Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain | 0.7621 | 43 | 72 | 2.40.128.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A442SJG8-F1-model_v4 | IS66 family insertion sequence element accessory protein TnpB (Transposase) | 0.9564 | 2 | 97 |
|
| AF-A0A318Q4A7-F1-model_v4 | Transposase | 0.9556 | 1 | 72 |
|
| AF-A0A826MPA9-F1-model_v4 | deleted | 0.9532 | 1 | 96 |
|
| AF-A0A828FAU1-F1-model_v4 | deleted | 0.9486 | 1 | 102 |
|
| AF-A0A844W933-F1-model_v4 | deleted | 0.9484 | 1 | 72 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar