F486359

General Info

Members Datasets Scaffolds Average Seq Length
942 451 923 115

Family's Representative Sequence

Representative Sequence 3300009101|Ga0105247_10675222|Ga0105247_106752222
Length 114
Sequence VIGLPAETRVWLAAGATDMRKGFDGLAMAVQERLRQDPFSGHVFVFRGRGDLIKVLWWSGDGLCLFAKRLERGRFVWPGTQAGVAHLSAAQLSMLLEGIDWRHPARTWRPEFAG

Samples

Sample ID Description Type Environment
1 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
2 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
3 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
4 2643221645 Massilia sp. Root351 Isolate Unclassified
5 2858688981 Cupriavidus sp. UYMMa02A Isolate Unclassified
6 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
7 2885266251 Ralstonia sp. SET104 Isolate Nodule
8 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
9 2928058823 Ralstonia sp. 1138 Isolate Unclassified
10 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
11 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
12 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
13 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
14 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
15 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
16 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
17 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
18 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
19 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
20 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
21 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
22 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
23 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
24 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
25 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
26 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
27 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
28 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
29 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
30 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
31 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
32 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
33 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
34 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
35 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
36 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
37 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
38 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
39 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
40 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
41 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
42 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
43 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
44 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
45 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
46 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
47 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
48 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
49 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
50 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
51 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
52 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
53 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
54 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
55 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
56 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
57 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
58 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
59 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
60 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
61 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
62 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
63 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
64 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
65 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
66 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
67 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
68 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
69 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
70 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
71 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
72 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
73 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
74 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
75 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
76 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
77 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
78 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
79 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
80 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
81 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
82 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
83 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
84 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
85 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
86 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
87 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
88 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
89 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
90 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
91 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
92 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
93 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
94 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
96 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
97 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
98 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
99 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
100 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
101 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
102 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
103 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
104 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
105 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
106 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
107 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
108 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
109 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
110 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
111 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
112 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
113 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
114 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
115 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
116 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
117 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
118 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
119 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
120 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
121 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
122 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
123 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
124 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
125 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
126 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
127 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
128 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
129 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
130 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
131 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
132 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
133 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
134 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
135 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
136 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
137 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
138 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
139 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
140 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
141 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
142 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
143 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
146 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
147 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
148 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
149 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
150 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
151 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
212 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
213 3300028036 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 Metagenome Rhizosphere
214 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
218 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
219 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
220 3300031018 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
221 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
222 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
223 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
224 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
225 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
226 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
227 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
228 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
229 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
230 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
231 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
232 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
233 3300033546 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE2 Metagenome Unclassified
234 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
235 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
236 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
237 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
238 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
239 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
240 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
241 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
242 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
243 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
244 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
245 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
246 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
247 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
248 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
249 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
250 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
251 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
252 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
253 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
254 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
255 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
256 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
257 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
258 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
259 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
260 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
261 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
262 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
263 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
264 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
265 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
266 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
267 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
268 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
269 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
270 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
271 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
272 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
273 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
274 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
275 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
276 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
277 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
278 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
279 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
280 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
281 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
282 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
283 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
284 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
285 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
286 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
287 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
288 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
289 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
290 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
291 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
292 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
293 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
294 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
295 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
296 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
297 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
298 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
299 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
300 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
301 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
302 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
303 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
304 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
305 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
306 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
307 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
308 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
309 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
310 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
311 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
312 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
313 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
314 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
315 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
316 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
317 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
318 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
319 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
320 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
321 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
322 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
323 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
324 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
325 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
326 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
327 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
328 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
329 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
330 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
331 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
332 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
333 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
334 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
335 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
336 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
337 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
338 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
339 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
340 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
341 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
342 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
343 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
344 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
345 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
346 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
347 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
348 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
349 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
350 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
351 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
352 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
353 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
354 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
355 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
356 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
357 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
358 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
359 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
360 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
361 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
362 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
363 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
364 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
365 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
366 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
367 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
368 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
369 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
370 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
371 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
372 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
373 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
374 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
375 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
376 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
377 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
378 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
379 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
380 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
381 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
382 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
383 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
384 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
385 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
386 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
387 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
388 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
389 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
390 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
391 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
392 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
393 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
394 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
395 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
396 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
397 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
398 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
399 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
400 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
401 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
402 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
403 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
404 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
405 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
406 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
407 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
408 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
409 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
410 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
411 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
412 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
413 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
414 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
415 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
416 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
417 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
418 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
419 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
420 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
421 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
422 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
423 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
424 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
425 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
426 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
427 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
428 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
429 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
430 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
431 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
432 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
433 3300053127 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere Metagenome Endosphere
434 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
435 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
436 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
437 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
438 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
439 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
440 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
441 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
442 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
443 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
444 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
445 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
446 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
447 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
448 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
449 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
450 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
451 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.13
Metatranscriptomes 0.85
Isolates 2.02

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.82
Nodule 0.74
Rhizoplane 5.94
Rhizosphere 83.55
Stem 0
Stem Tuber 0
Unclassified 5.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1005042 3300001915 Bacteria 2825
2 JGI24747J21853_1009708 3300001978 Bacteria 955
3 JGI24740J21852_10002727 3300001979 Bacteria 7899
4 JGI24740J21852_10017586 3300001979 Bacteria 2552
5 JGI24739J22299_10016556 3300001989 Bacteria 2667
6 JGI24739J22299_10017427 3300001989 Bacteria 2591
7 JGI24743J22301_10059244 3300001991 Bacteria 787
8 JGI24735J21928_10060995 3300002067 Bacteria 1083
9 JGI24745J21846_1003085 3300002073 Bacteria 1728
10 JGI24748J21848_1001628 3300002074 Bacteria 2492
11 JGI24738J21930_10007688 3300002075 Bacteria 2476
12 JGI24744J21845_10035381 3300002077 Bacteria 945
13 JGI24033J26618_1018913 3300002155 Bacteria 870
14 JGI24034J26672_10002201 3300002239 Bacteria 2658
15 JGI24034J26672_10002230 3300002239 Bacteria 2642
16 JGI24742J22300_10003465 3300002244 Bacteria 2558
17 JGI25156J39149_1000313 3300002705 Bacteria 32091
18 rootL2_10001338 3300003322 Bacteria 2431
19 rootL2_10086943 3300003322 Bacteria 3631
20 Ga0055527_1003008 3300003760 Bacteria 2632
21 Ga0055542_1031490 3300003762 Bacteria 676
22 Ga0055526_1011534 3300003771 Bacteria 3967
23 Ga0055526_1025228 3300003771 Bacteria 1913
24 Ga0055537_1003426 3300003773 Bacteria 4881
25 Ga0055524_1000607 3300003775 Bacteria 25734
26 Ga0055534_1000305 3300003784 Bacteria 32979
27 Ga0055534_1001282 3300003784 Bacteria 10195
28 JGI25405J52794_10002528 3300003911 Bacteria 3158
29 Ga0070658_10002107 3300005327 Bacteria 16688
30 Ga0070658_10081384 3300005327 Bacteria 2660
31 Ga0070658_10277305 3300005327 Bacteria 1427
32 Ga0070676_10026136 3300005328 Bacteria 3304
33 Ga0070676_10165545 3300005328 Bacteria 1426
34 Ga0070683_100278467 3300005329 Bacteria 1591
35 Ga0070683_100547981 3300005329 Bacteria 1106
36 Ga0070690_100465991 3300005330 Bacteria 939
37 Ga0070670_100214660 3300005331 Bacteria 1673
38 Ga0070677_10033549 3300005333 Bacteria 1977
39 Ga0068869_101255126 3300005334 Bacteria 652
40 Ga0070680_100094871 3300005336 Bacteria 2473
41 Ga0070680_100792647 3300005336 Unclassified 816
42 Ga0070682_100015375 3300005337 Bacteria 4433
43 Ga0070682_100022657 3300005337 Bacteria 3723
44 Ga0070682_101290290 3300005337 Bacteria 620
45 Ga0068868_100490428 3300005338 Bacteria 1075
46 Ga0070660_100088326 3300005339 Bacteria 2441
47 Ga0070660_100109490 3300005339 Bacteria 2196
48 Ga0070660_100149293 3300005339 Bacteria 1879
49 Ga0070660_100238177 3300005339 Bacteria 1482
50 Ga0070687_100017936 3300005343 Bacteria 3265
51 Ga0070661_100000020 3300005344 Bacteria 132014
52 Ga0070661_100055823 3300005344 Bacteria 2892
53 Ga0070661_100109110 3300005344 Bacteria 2065
54 Ga0070661_100335314 3300005344 Bacteria 1184
55 Ga0070661_100505789 3300005344 Bacteria 967
56 Ga0070668_100054856 3300005347 Bacteria 3075
57 Ga0070669_100044463 3300005353 Bacteria 3236
58 Ga0070669_100297475 3300005353 Bacteria 1297
59 Ga0070675_100060346 3300005354 Bacteria 3131
60 Ga0070671_100044576 3300005355 Bacteria 3685
61 Ga0070674_100040302 3300005356 Bacteria 3159
62 Ga0070673_100062935 3300005364 Bacteria 2950
63 Ga0070688_100020352 3300005365 Bacteria 3857
64 Ga0070659_100034303 3300005366 Bacteria 3947
65 Ga0070659_100040676 3300005366 Bacteria 3633
66 Ga0070659_100314025 3300005366 Bacteria 1309
67 Ga0070659_100453758 3300005366 Bacteria 1088
68 Ga0070667_100010218 3300005367 Bacteria 7754
69 Ga0070713_100988745 3300005436 Bacteria 811
70 Ga0070713_101500065 3300005436 Bacteria 654
71 Ga0070701_10295304 3300005438 Bacteria 994
72 Ga0070711_100058711 3300005439 Bacteria 2668
73 Ga0070700_100308832 3300005441 Bacteria 1157
74 Ga0070663_100013217 3300005455 Bacteria 5254
75 Ga0070663_100055957 3300005455 Bacteria 2825
76 Ga0070663_100351459 3300005455 Bacteria 1193
77 Ga0070678_100033208 3300005456 Bacteria 3580
78 Ga0070678_101237162 3300005456 Bacteria 693
79 Ga0070662_100033646 3300005457 Bacteria 3611
80 Ga0070681_10096477 3300005458 Bacteria 2904
81 Ga0070681_10111126 3300005458 Bacteria 2679
82 Ga0070681_11775728 3300005458 Bacteria 544
83 Ga0068867_100446445 3300005459 Bacteria 1101
84 Ga0068867_101239220 3300005459 Bacteria 686
85 Ga0070685_10148733 3300005466 Bacteria 1482
86 Ga0070699_100973035 3300005518 Bacteria 778
87 Ga0070679_100102337 3300005530 Bacteria 2850
88 Ga0070679_100104373 3300005530 Bacteria 2820
89 Ga0070679_100383559 3300005530 Bacteria 1352
90 Ga0070684_100440712 3300005535 Bacteria 1203
91 Ga0070684_100593730 3300005535 Bacteria 1029
92 Ga0070697_101132858 3300005536 Unclassified 697
93 Ga0068853_100091722 3300005539 Bacteria 2672
94 Ga0068853_100187251 3300005539 Bacteria 1879
95 Ga0070672_100046874 3300005543 Bacteria 3351
96 Ga0070686_100075436 3300005544 Bacteria 2218
97 Ga0070696_101079236 3300005546 Unclassified 674
98 Ga0070665_100057831 3300005548 Bacteria 3887
99 Ga0070665_100656436 3300005548 Bacteria 1062
100 Ga0070665_100834483 3300005548 Bacteria 935
101 Ga0068855_100439959 3300005563 Bacteria 1424
102 Ga0068855_100592503 3300005563 Bacteria 1196
103 Ga0070664_100079351 3300005564 Bacteria 2825
104 Ga0070664_100081382 3300005564 Bacteria 2791
105 Ga0070664_100217327 3300005564 Bacteria 1709
106 Ga0070664_100472264 3300005564 Bacteria 1153
107 Ga0068857_100054050 3300005577 Bacteria 3562
108 Ga0068854_100027418 3300005578 Bacteria 3926
109 Ga0068856_100000127 3300005614 Bacteria 76855
110 Ga0068856_100468748 3300005614 Bacteria 1280
111 Ga0070702_101144189 3300005615 Bacteria 624
112 Ga0068852_100097176 3300005616 Bacteria 2649
113 Ga0068852_100098280 3300005616 Bacteria 2635
114 Ga0068852_100226719 3300005616 Bacteria 1779
115 Ga0068852_100753746 3300005616 Bacteria 986
116 Ga0068859_100111372 3300005617 Bacteria 2800
117 Ga0068859_100119564 3300005617 Bacteria 2701
118 Ga0068864_100101906 3300005618 Bacteria 2547
119 Ga0068866_10125161 3300005718 Bacteria 1454
120 Ga0068870_10124438 3300005840 Bacteria 1489
121 Ga0068863_100086189 3300005841 Bacteria 2976
122 Ga0068858_100088874 3300005842 Bacteria 2875
123 Ga0068860_100061555 3300005843 Bacteria 3566
124 Ga0068860_100392246 3300005843 Bacteria 1372
125 Ga0068862_100012213 3300005844 Bacteria 7099
126 Ga0068862_100077462 3300005844 Bacteria 2879
127 Ga0068862_100095089 3300005844 Bacteria 2599
128 Ga0068862_100431088 3300005844 Bacteria 1239
129 Ga0081455_10077489 3300005937 Bacteria 2734
130 Ga0070717_10081587 3300006028 Plasmid 2716
131 Ga0075432_10018212 3300006058 Bacteria 2395
132 Ga0070716_100245039 3300006173 Bacteria 1217
133 Ga0097621_100242812 3300006237 Bacteria 1575
134 Ga0075370_10153883 3300006353 Bacteria 1348
135 Ga0068871_100037116 3300006358 Bacteria 3884
136 Ga0075430_100004131 3300006846 Bacteria 12251
137 Ga0075434_100495629 3300006871 Unclassified 1242
138 Ga0075436_100066233 3300006914 Bacteria 2496
139 Ga0097620_100111374 3300006931 Bacteria 2800
140 Ga0097620_100119564 3300006931 Bacteria 2701
141 Ga0099794_10639793 3300007265 Unclassified 564
142 Ga0099795_10102393 3300007788 Bacteria 1125
143 Ga0105251_10018978 3300009011 Bacteria 3642
144 Ga0105251_10021475 3300009011 Bacteria 3369
145 Ga0105244_10022263 3300009036 Bacteria 3490
146 Ga0105250_10018493 3300009092 Bacteria 2822
147 Ga0105240_10104334 3300009093 Bacteria 3443
148 Ga0105240_10400197 3300009093 Bacteria 1547
149 Ga0105240_10596767 3300009093 Bacteria 1216
150 Ga0105240_11509117 3300009093 Bacteria 704
151 Ga0105240_12140601 3300009093 Bacteria 580
152 Ga0105247_10039970 3300009101 Bacteria 2866
153 Ga0105247_10675222 3300009101 Bacteria 775
154 Ga0105243_10197329 3300009148 Bacteria 1763
155 Ga0105241_10052885 3300009174 Bacteria 3103
156 Ga0105242_10024912 3300009176 Bacteria 4729
157 Ga0105242_10206975 3300009176 Bacteria 1746
158 Ga0105248_10011481 3300009177 Bacteria 9760
159 Ga0105248_10017781 3300009177 Bacteria 7844
160 Ga0105237_10145609 3300009545 Bacteria 2364
161 Ga0105237_10167714 3300009545 Bacteria 2195
162 Ga0105237_10380695 3300009545 Bacteria 1416
163 Ga0105238_10069777 3300009551 Bacteria 3515
164 Ga0105238_10084820 3300009551 Bacteria 3157
165 Ga0105238_10196670 3300009551 Bacteria 1992
166 Ga0105238_12884830 3300009551 Unclassified 517
167 Ga0105249_10098303 3300009553 Bacteria 2748
168 Ga0105249_10200163 3300009553 Bacteria 1954
169 Ga0105249_12305342 3300009553 Bacteria 611
170 Ga0099796_10110077 3300010159 Bacteria 1047
171 Ga0099796_10168903 3300010159 Unclassified 871
172 Ga0105239_10130517 3300010375 Bacteria 2795
173 Ga0105239_10251230 3300010375 Bacteria 1986
174 Ga0105239_10272471 3300010375 Bacteria 1904
175 Ga0105239_10983805 3300010375 Bacteria 970
176 Ga0105239_11147064 3300010375 Bacteria 895
177 Ga0105239_11209608 3300010375 Bacteria 871
178 Ga0105246_10019099 3300011119 Bacteria 4374
179 Ga0157373_10000025 3300013100 Bacteria 146728
180 Ga0157373_10060878 3300013100 Bacteria 2674
181 Ga0157371_10054973 3300013102 Bacteria 2825
182 Ga0157371_10084086 3300013102 Bacteria 2254
183 Ga0157371_10484236 3300013102 Bacteria 912
184 Ga0157370_10000027 3300013104 Bacteria 146729
185 Ga0157369_10000167 3300013105 Bacteria 93483
186 Ga0157369_10093201 3300013105 Bacteria 3215
187 Ga0157369_10173487 3300013105 Bacteria 2271
188 Ga0157369_10933260 3300013105 Bacteria 890
189 Ga0157374_10081431 3300013296 Bacteria 3072
190 Ga0157378_10071387 3300013297 Bacteria 3118
191 Ga0163162_10000496 3300013306 Bacteria 36591
192 Ga0163162_10182801 3300013306 Bacteria 2223
193 Ga0163162_10641163 3300013306 Bacteria 1186
194 Ga0163162_11366250 3300013306 Bacteria 806
195 Ga0163162_11771038 3300013306 Bacteria 706
196 Ga0157372_10136489 3300013307 Bacteria 2825
197 Ga0157372_10369673 3300013307 Bacteria 1671
198 Ga0157372_10594254 3300013307 Bacteria 1290
199 Ga0157375_10144458 3300013308 Bacteria 2509
200 Ga0157375_10346616 3300013308 Bacteria 1651
201 Ga0163163_10126276 3300014325 Bacteria 2596
202 Ga0157380_10265433 3300014326 Bacteria 1562
203 Ga0182008_10042135 3300014497 Unclassified 2275
204 Ga0182008_10138165 3300014497 Bacteria 1218
205 Ga0182008_10152553 3300014497 Bacteria 1159
206 Ga0182008_10193742 3300014497 Bacteria 1032
207 Ga0157377_11099273 3300014745 Bacteria 609
208 Ga0157376_10057043 3300014969 Bacteria 3265
209 Ga0157376_10103782 3300014969 Bacteria 2490
210 Ga0157376_11265735 3300014969 Bacteria 767
211 Ga0182006_1002778 3300015261 Bacteria 9353
212 Ga0182007_10014896 3300015262 Bacteria 2916
213 Ga0182007_10055886 3300015262 Bacteria 1297
214 Ga0182007_10062331 3300015262 Bacteria 1222
215 Ga0182007_10095006 3300015262 Bacteria 983
216 Ga0183361_10008 3300016635 Bacteria 259171
217 Ga0163161_10004159 3300017792 Bacteria 10119
218 Ga0163161_10055839 3300017792 Bacteria 2867
219 Ga0154015_1022863 3300020610 Bacteria 22537
220 Ga0213873_10020690 3300021358 Bacteria 1539
221 Ga0213873_10049147 3300021358 Bacteria 1111
222 Ga0213872_10005360 3300021361 Bacteria 6619
223 Ga0213872_10019547 3300021361 Bacteria 3118
224 Ga0213872_10243586 3300021361 Bacteria 759
225 Ga0213874_10010242 3300021377 Bacteria 2342
226 Ga0213874_10011948 3300021377 Bacteria 2214
227 Ga0213876_10158967 3300021384 Bacteria 1202
228 Ga0224572_1021203 3300024225 Bacteria 1247
229 Ga0224572_1023066 3300024225 Bacteria 1195
230 Ga0228598_1005334 3300024227 Plasmid 2690
231 Ga0228598_1009477 3300024227 Bacteria 1951
232 Ga0228598_1019584 3300024227 Bacteria 1333
233 Ga0209672_101662 3300025228 Bacteria 7236
234 Ga0209148_1001334 3300025254 Bacteria 13077
235 Ga0209759_1000562 3300025256 Bacteria 37533
236 Ga0209565_1000094 3300025263 Bacteria 134853
237 Ga0209673_1005825 3300025273 Bacteria 6109
238 Ga0209675_1000145 3300025291 Bacteria 93978
239 Ga0209675_1002086 3300025291 Bacteria 10622
240 Ga0209564_1000119 3300025295 Bacteria 204926
241 Ga0209564_1000509 3300025295 Bacteria 63951
242 Ga0209256_1001721 3300025299 Bacteria 20987
243 Ga0207697_10151032 3300025315 Bacteria 1011
244 Ga0207696_1014964 3300025711 Bacteria 2642
245 Ga0207655_1020250 3300025728 Bacteria 3427
246 Ga0207713_1021650 3300025735 Bacteria 3076
247 Ga0207682_10035286 3300025893 Bacteria 2020
248 Ga0207642_10108918 3300025899 Bacteria 1407
249 Ga0207710_10023555 3300025900 Bacteria 2647
250 Ga0207688_10070359 3300025901 Bacteria 1984
251 Ga0207680_10017137 3300025903 Bacteria 3821
252 Ga0207647_10047227 3300025904 Bacteria 2679
253 Ga0207647_10210967 3300025904 Bacteria 1121
254 Ga0207645_10015542 3300025907 Bacteria 5054
255 Ga0207645_10318662 3300025907 Bacteria 1037
256 Ga0207705_10000555 3300025909 Bacteria 31400
257 Ga0207705_10032073 3300025909 Bacteria 3753
258 Ga0207705_10087143 3300025909 Bacteria 2282
259 Ga0207654_10039578 3300025911 Bacteria 2652
260 Ga0207707_10076195 3300025912 Bacteria 2927
261 Ga0207707_10099636 3300025912 Bacteria 2540
262 Ga0207707_10352893 3300025912 Bacteria 1267
263 Ga0207707_11551017 3300025912 Bacteria 523
264 Ga0207695_10028067 3300025913 Bacteria 6251
265 Ga0207695_10095130 3300025913 Bacteria 2984
266 Ga0207695_10280026 3300025913 Bacteria 1561
267 Ga0207695_10952416 3300025913 Bacteria 738
268 Ga0207671_10061896 3300025914 Bacteria 2778
269 Ga0207671_10148567 3300025914 Bacteria 1809
270 Ga0207671_10161675 3300025914 Bacteria 1734
271 Ga0207663_10079303 3300025916 Unclassified 2143
272 Ga0207660_10077345 3300025917 Bacteria 2436
273 Ga0207657_10070312 3300025919 Bacteria 2967
274 Ga0207657_10070381 3300025919 Bacteria 2965
275 Ga0207657_10229292 3300025919 Bacteria 1486
276 Ga0207649_10000059 3300025920 Bacteria 99273
277 Ga0207649_10022386 3300025920 Bacteria 3650
278 Ga0207649_10283152 3300025920 Bacteria 1206
279 Ga0207652_10100649 3300025921 Bacteria 2551
280 Ga0207652_10503561 3300025921 Unclassified 1090
281 Ga0207646_10289944 3300025922 Bacteria 1479
282 Ga0207681_10029071 3300025923 Bacteria 3585
283 Ga0207694_10074681 3300025924 Bacteria 2653
284 Ga0207650_10180087 3300025925 Bacteria 1684
285 Ga0207659_10070485 3300025926 Bacteria 2549
286 Ga0207687_10077351 3300025927 Bacteria 2393
287 Ga0207700_10198550 3300025928 Bacteria 1689
288 Ga0207700_10351353 3300025928 Bacteria 1284
289 Ga0207644_10035196 3300025931 Bacteria 3507
290 Ga0207690_10118505 3300025932 Bacteria 1919
291 Ga0207690_10183749 3300025932 Bacteria 1576
292 Ga0207690_10657510 3300025932 Bacteria 859
293 Ga0207706_10063895 3300025933 Bacteria 3241
294 Ga0207706_10601590 3300025933 Bacteria 944
295 Ga0207686_10017592 3300025934 Bacteria 4031
296 Ga0207686_10241097 3300025934 Bacteria 1316
297 Ga0207709_10050849 3300025935 Bacteria 2537
298 Ga0207670_10046909 3300025936 Bacteria 2873
299 Ga0207669_10022048 3300025937 Bacteria 3375
300 Ga0207665_10095927 3300025939 Bacteria 2062
301 Ga0207691_10090905 3300025940 Bacteria 2736
302 Ga0207711_10006542 3300025941 Bacteria 9812
303 Ga0207711_10085731 3300025941 Bacteria 2760
304 Ga0207689_10162074 3300025942 Bacteria 1842
305 Ga0207661_10376807 3300025944 Bacteria 1284
306 Ga0207679_10043701 3300025945 Bacteria 3228
307 Ga0207679_10059952 3300025945 Bacteria 2825
308 Ga0207679_10060822 3300025945 Bacteria 2808
309 Ga0207679_10154573 3300025945 Bacteria 1872
310 Ga0207667_10008962 3300025949 Bacteria 11837
311 Ga0207651_10075404 3300025960 Bacteria 2406
312 Ga0207712_10062612 3300025961 Bacteria 2645
313 Ga0207668_10078971 3300025972 Bacteria 2378
314 Ga0207640_10000175 3300025981 Bacteria 46495
315 Ga0207658_10017015 3300025986 Bacteria 5005
316 Ga0207703_10094456 3300026035 Bacteria 2521
317 Ga0207639_10267809 3300026041 Bacteria 1497
318 Ga0207639_10514659 3300026041 Bacteria 1095
319 Ga0207678_10000009 3300026067 Bacteria 156690
320 Ga0207678_10067563 3300026067 Bacteria 3068
321 Ga0207678_10356406 3300026067 Bacteria 1262
322 Ga0207708_10221807 3300026075 Bacteria 1515
323 Ga0207702_10000896 3300026078 Bacteria 30934
324 Ga0207702_11291968 3300026078 Bacteria 724
325 Ga0207641_10101348 3300026088 Bacteria 2537
326 Ga0207648_10783482 3300026089 Bacteria 887
327 Ga0207648_11551748 3300026089 Bacteria 622
328 Ga0207676_10106592 3300026095 Bacteria 2335
329 Ga0207674_10071938 3300026116 Bacteria 3474
330 Ga0207683_10072667 3300026121 Bacteria 3042
331 Ga0207683_10999560 3300026121 Bacteria 776
332 Ga0207698_10103485 3300026142 Bacteria 2366
333 Ga0207698_10530163 3300026142 Bacteria 1151
334 Ga0207698_10827067 3300026142 Bacteria 930
335 Ga0207698_11512581 3300026142 Bacteria 687
336 Ga0209996_1040785 3300027395 Unclassified 690
337 Ga0209974_10134153 3300027876 Bacteria 884
338 Ga0207428_10077306 3300027907 Bacteria 2606
339 Ga0265357_1002288 3300028023 Bacteria 1547
340 Ga0265355_1000247 3300028036 Bacteria 2523
341 Ga0268266_10034730 3300028379 Bacteria 4288
342 Ga0268266_10833020 3300028379 Bacteria 891
343 Ga0268265_10008523 3300028380 Bacteria 6931
344 Ga0268265_10053875 3300028380 Bacteria 3049
345 Ga0268265_10424989 3300028380 Bacteria 1235
346 Ga0268265_11094164 3300028380 Bacteria 791
347 Ga0268264_10838429 3300028381 Bacteria 920
348 Ga0268264_11102276 3300028381 Bacteria 802
349 Ga0307517_10200381 3300028786 Bacteria 1249
350 Ga0265762_1024088 3300030760 Bacteria 1130
351 Ga0265763_1035902 3300030763 Unclassified 581
352 Ga0265773_1006515 3300031018 Unclassified 885
353 Ga0265773_1022953 3300031018 Bacteria 627
354 Ga0265760_10005309 3300031090 Bacteria 3694
355 Ga0265760_10026231 3300031090 Unclassified 1704
356 Ga0265760_10034003 3300031090 Bacteria 1507
357 Ga0265330_10175831 3300031235 Bacteria 907
358 Ga0265331_10215290 3300031250 Bacteria 864
359 Ga0307509_10004447 3300031507 Bacteria 20206
360 Ga0307408_100395406 3300031548 Bacteria 1185
361 Ga0307408_101161592 3300031548 Bacteria 719
362 Ga0307508_10469166 3300031616 Bacteria 852
363 Ga0265314_10036097 3300031711 Bacteria 3596
364 Ga0265342_10229190 3300031712 Unclassified 998
365 Ga0307516_10167601 3300031730 Bacteria 1940
366 Ga0307414_10457975 3300032004 Bacteria 1120
367 Ga0316215_1009276 3300033544 Unclassified 968
368 Ga0316214_1015175 3300033545 Bacteria 1061
369 Ga0316213_1002203 3300033546 Unclassified 1325
370 Ga0316212_1010904 3300033547 Bacteria 1300
371 Ga0373936_0449115 3300035113 Bacteria 596
372 Ga0373956_0467300 3300035119 Unclassified 602
373 Ga0373937_0076075 3300036401 Bacteria 3100
374 Ga0373937_0082509 3300036401 Bacteria 2974
375 Ga0373925_0615709 3300037068 Unclassified 894
376 Ga0395899_0239709 3300037312 Bacteria 1248
377 Ga0395899_0272635 3300037312 Bacteria 1154
378 Ga0395900_0079562 3300037418 Bacteria 3368
379 Ga0395900_0218868 3300037418 Bacteria 1920
380 Ga0395900_0351838 3300037418 Bacteria 1447
381 Ga0395900_0478379 3300037418 Bacteria 1198
382 Ga0395900_0530271 3300037418 Bacteria 1124
383 Ga0395898_0024501 3300037466 Bacteria 6086
384 Ga0395898_0059019 3300037466 Bacteria 3734
385 Ga0395898_0123525 3300037466 Bacteria 2480
386 Ga0395898_0284458 3300037466 Bacteria 1577
387 Ga0395898_1019444 3300037466 Bacteria 763
388 Ga0395905_0037832 3300037471 Bacteria 4528
389 Ga0395905_1314473 3300037471 Bacteria 627
390 Ga0395905_1445528 3300037471 Bacteria 592
391 Ga0395905_1855045 3300037471 Bacteria 509
392 Ga0395901_0000023 3300038443 Bacteria 283968
393 Ga0395901_0000105 3300038443 Bacteria 114318
394 Ga0395901_0143056 3300038443 Bacteria 2514
395 Ga0395901_0199859 3300038443 Bacteria 2095
396 Ga0395901_0275673 3300038443 Bacteria 1748
397 Ga0395901_0649269 3300038443 Bacteria 1059
398 Ga0395901_0866070 3300038443 Bacteria 887
399 Ga0395901_0926435 3300038443 Bacteria 851
400 Ga0436365_0781751 3300039437 Unclassified 2931
401 Ga0436360_0273429 3300039438 Bacteria 523
402 Ga0436360_1060060 3300039438 Unclassified 524
403 Ga0436361_0721434 3300039447 Bacteria 8067
404 Ga0436361_0823803 3300039447 Bacteria 1954
405 Ga0436361_0843575 3300039447 Bacteria 611
406 Ga0436361_0851193 3300039447 Bacteria 3015
407 Ga0436361_1039794 3300039447 Bacteria 833
408 Ga0436363_0607979 3300039450 Bacteria 855
409 Ga0436363_1360161 3300039450 Bacteria 2704
410 Ga0436363_1450927 3300039450 Bacteria 4658
411 Ga0436363_1679434 3300039450 Bacteria 3662
412 Ga0436362_0641548 3300039453 Unclassified 1657
413 Ga0436362_0749208 3300039453 Bacteria 594
414 Ga0436362_1005007 3300039453 Bacteria 1561
415 Ga0436362_1044349 3300039453 Bacteria 3174
416 Ga0439439_0026322 3300041406 Bacteria 1466
417 Ga0439465_0295558 3300041413 Bacteria 605
418 Ga0439433_0002877 3300041999 Bacteria 3679
419 Ga0439442_043584 3300042002 Bacteria 945
420 Ga0439448_0014497 3300042005 Bacteria 2378
421 Ga0439448_0149723 3300042005 Bacteria 809
422 Ga0439448_0245364 3300042005 Bacteria 632
423 Ga0439449_0010320 3300042007 Bacteria 3525
424 Ga0439449_0062439 3300042007 Bacteria 1374
425 Ga0439450_000217 3300042008 Bacteria 6866
426 Ga0439455_0005009 3300042012 Bacteria 2666
427 Ga0439455_0010315 3300042012 Bacteria 2052
428 Ga0450911_003223 3300042115 Bacteria 2933
429 Ga0450898_024603 3300042134 Bacteria 1077
430 Ga0450905_003261 3300042142 Bacteria 2128
431 Ga0439458_0006674 3300042157 Bacteria 2572
432 Ga0439458_0053094 3300042157 Bacteria 1002
433 Ga0451577_1842415 3300042876 Bacteria 530
434 Ga0466969_0018995 3300044656 Bacteria 3577
435 Ga0466969_0186541 3300044656 Bacteria 948
436 Ga0466969_0378083 3300044656 Unclassified 642
437 Ga0466972_0173606 3300044658 Bacteria 1011
438 Ga0466972_0246013 3300044658 Bacteria 836
439 Ga0466982_0064206 3300044672 Bacteria 2262
440 Ga0453683_0213246 3300044673 Bacteria 1227
441 Ga0466965_0015140 3300044683 Bacteria 3661
442 Ga0466965_0023906 3300044683 Bacteria 2953
443 Ga0466965_0046292 3300044683 Bacteria 2153
444 Ga0466966_0033747 3300044684 Bacteria 3312
445 Ga0466966_0070701 3300044684 Bacteria 2188
446 Ga0466966_0093831 3300044684 Bacteria 1861
447 Ga0466966_0174614 3300044684 Bacteria 1305
448 Ga0466966_0259859 3300044684 Bacteria 1045
449 Ga0466966_0325281 3300044684 Bacteria 924
450 Ga0466961_0089480 3300044693 Bacteria 1944
451 Ga0466961_0260940 3300044693 Bacteria 1062
452 Ga0466963_1350092 3300044694 Bacteria 500
453 Ga0466964_0000035 3300044706 Bacteria 27756
454 Ga0466964_0005016 3300044706 Bacteria 4894
455 Ga0466964_0005415 3300044706 Bacteria 4737
456 Ga0466964_0343684 3300044706 Bacteria 765
457 Ga0453684_0724410 3300044712 Bacteria 1079
458 Ga0466971_0032184 3300044719 Bacteria 2349
459 Ga0466971_0142382 3300044719 Bacteria 1117
460 Ga0466968_0012992 3300044735 Bacteria 3267
461 Ga0466968_0014843 3300044735 Bacteria 3082
462 Ga0466968_0041383 3300044735 Bacteria 1944
463 Ga0466970_0055984 3300044765 Bacteria 2107
464 Ga0466970_0081370 3300044765 Bacteria 1751
465 Ga0466970_0117674 3300044765 Bacteria 1454
466 Ga0466970_0131464 3300044765 Unclassified 1375
467 Ga0466957_0014638 3300044842 Bacteria 4570
468 Ga0466957_0151327 3300044842 Bacteria 1501
469 Ga0466957_0189773 3300044842 Bacteria 1346
470 Ga0466960_0086260 3300044901 Bacteria 1591
471 Ga0466960_0312730 3300044901 Bacteria 888
472 Ga0466960_0580726 3300044901 Bacteria 664
473 Ga0466959_0035768 3300045049 Bacteria 3670
474 Ga0466959_0050047 3300045049 Bacteria 3069
475 Ga0466959_0058440 3300045049 Bacteria 2809
476 Ga0466959_0090104 3300045049 Bacteria 2203
477 Ga0466959_0139529 3300045049 Bacteria 1714
478 Ga0466959_0556910 3300045049 Bacteria 773
479 Ga0466959_0678362 3300045049 Unclassified 691
480 Ga0466967_0011229 3300045976 Bacteria 6769
481 Ga0466967_0067035 3300045976 Bacteria 3200
482 Ga0466967_0111411 3300045976 Bacteria 2515
483 Ga0495617_002089 3300046452 Bacteria 8259
484 Ga0495617_009096 3300046452 Bacteria 3416
485 Ga0495592_0039002 3300046454 Bacteria 3570
486 Ga0495603_0028018 3300046455 Bacteria 3397
487 Ga0495603_0067447 3300046455 Bacteria 2106
488 Ga0495590_0004639 3300046457 Bacteria 5520
489 Ga0495590_0014771 3300046457 Bacteria 2847
490 Ga0495590_0018469 3300046457 Bacteria 2496
491 Ga0495590_0070217 3300046457 Bacteria 1228
492 Ga0495590_0079035 3300046457 Bacteria 1158
493 Ga0495590_0135660 3300046457 Bacteria 886
494 Ga0495591_012212 3300046458 Bacteria 3209
495 Ga0495629_0036558 3300046459 Bacteria 3465
496 Ga0495629_0038996 3300046459 Bacteria 3345
497 Ga0495638_0003375 3300046460 Bacteria 12592
498 Ga0495638_0006209 3300046460 Bacteria 8729
499 Ga0495638_0038693 3300046460 Bacteria 3029
500 Ga0495638_0357931 3300046460 Bacteria 768
501 Ga0495641_0061356 3300046461 Bacteria 1697
502 Ga0495651_0042549 3300046462 Bacteria 3526
503 Ga0495651_0090162 3300046462 Bacteria 2300
504 Ga0495651_0813807 3300046462 Bacteria 576
505 Ga0495653_0000904 3300046463 Bacteria 22963
506 Ga0495653_0038449 3300046463 Bacteria 3756
507 Ga0495650_0020333 3300046471 Bacteria 3240
508 Ga0495650_0042496 3300046471 Bacteria 1934
509 Ga0495650_0197099 3300046471 Bacteria 701
510 Ga0495580_0027988 3300046472 Bacteria 4099
511 Ga0495580_0051213 3300046472 Bacteria 2919
512 Ga0495580_0252584 3300046472 Bacteria 1207
513 Ga0495580_0256771 3300046472 Bacteria 1195
514 Ga0495580_0566960 3300046472 Unclassified 753
515 Ga0495582_0022394 3300046473 Bacteria 3457
516 Ga0495605_0001545 3300046474 Bacteria 14952
517 Ga0495605_0002454 3300046474 Bacteria 11474
518 Ga0495605_0017299 3300046474 Bacteria 3886
519 Ga0495605_0017447 3300046474 Bacteria 3864
520 Ga0495605_0100104 3300046474 Bacteria 1333
521 Ga0495605_0155107 3300046474 Bacteria 1019
522 Ga0495639_0076427 3300046475 Unclassified 1553
523 Ga0495639_0763616 3300046475 Bacteria 501
524 Ga0495662_0081022 3300046476 Bacteria 1578
525 Ga0495664_0023340 3300046477 Bacteria 3590
526 Ga0495664_0047467 3300046477 Bacteria 2548
527 Ga0495584_0000480 3300046491 Bacteria 27451
528 Ga0495584_0004824 3300046491 Bacteria 7206
529 Ga0495584_0005179 3300046491 Bacteria 6922
530 Ga0495584_0019301 3300046491 Bacteria 3462
531 Ga0495584_0020687 3300046491 Bacteria 3342
532 Ga0495585_0000270 3300046492 Bacteria 52046
533 Ga0495585_0005492 3300046492 Bacteria 7983
534 Ga0495585_0015645 3300046492 Bacteria 4405
535 Ga0495585_0020937 3300046492 Bacteria 3757
536 Ga0495585_0188565 3300046492 Bacteria 1056
537 Ga0495594_0393526 3300046499 Unclassified 789
538 Ga0495596_0000497 3300046500 Bacteria 24946
539 Ga0495596_0000704 3300046500 Bacteria 20713
540 Ga0495596_0014856 3300046500 Bacteria 3274
541 Ga0495596_0022061 3300046500 Bacteria 2594
542 Ga0495596_0035740 3300046500 Bacteria 1969
543 Ga0495596_0219659 3300046500 Bacteria 738
544 Ga0495607_0001328 3300046501 Bacteria 22065
545 Ga0495607_0001369 3300046501 Bacteria 21701
546 Ga0495607_0058183 3300046501 Bacteria 2211
547 Ga0495607_0154780 3300046501 Bacteria 1170
548 Ga0495583_0000063 3300046506 Bacteria 194362
549 Ga0495583_0002987 3300046506 Bacteria 13556
550 Ga0495583_0015161 3300046506 Bacteria 4205
551 Ga0495583_0029908 3300046506 Bacteria 2660
552 Ga0495583_0042111 3300046506 Bacteria 2135
553 Ga0495583_0284392 3300046506 Bacteria 659
554 Ga0495606_0000827 3300046507 Bacteria 46975
555 Ga0495606_0005749 3300046507 Bacteria 11724
556 Ga0495606_0029616 3300046507 Bacteria 3839
557 Ga0495606_0043834 3300046507 Bacteria 2979
558 Ga0495606_0044805 3300046507 Bacteria 2939
559 Ga0495606_0244685 3300046507 Bacteria 998
560 Ga0495608_0028688 3300046511 Bacteria 3781
561 Ga0495608_0052056 3300046511 Bacteria 2711
562 Ga0495608_0679396 3300046511 Bacteria 614
563 Ga0495610_0017926 3300046512 Bacteria 4017
564 Ga0495610_0028855 3300046512 Bacteria 2929
565 Ga0495616_0000142 3300046513 Bacteria 62829
566 Ga0495616_0000318 3300046513 Bacteria 38489
567 Ga0495616_0008734 3300046513 Bacteria 5971
568 Ga0495616_0012698 3300046513 Bacteria 4770
569 Ga0495616_0028689 3300046513 Bacteria 2944
570 Ga0495616_0032586 3300046513 Bacteria 2720
571 Ga0495616_0035023 3300046513 Bacteria 2601
572 Ga0495616_0059207 3300046513 Bacteria 1884
573 Ga0495618_0021096 3300046514 Bacteria 4015
574 Ga0495618_0029480 3300046514 Bacteria 3424
575 Ga0495620_0014187 3300046515 Bacteria 4057
576 Ga0495628_0003133 3300046516 Bacteria 14840
577 Ga0495628_0004405 3300046516 Bacteria 12493
578 Ga0495628_0070083 3300046516 Bacteria 2734
579 Ga0495628_0276374 3300046516 Bacteria 1248
580 Ga0495630_0075708 3300046517 Bacteria 2535
581 Ga0495630_1168774 3300046517 Bacteria 582
582 Ga0495631_0007702 3300046518 Bacteria 5466
583 Ga0495631_0302922 3300046518 Bacteria 680
584 Ga0495632_0016552 3300046519 Bacteria 4098
585 Ga0495632_0069459 3300046519 Bacteria 1696
586 Ga0495632_0156819 3300046519 Bacteria 1050
587 Ga0495632_0333368 3300046519 Bacteria 669
588 Ga0495637_0020999 3300046520 Bacteria 2996
589 Ga0495643_0034384 3300046522 Bacteria 2798
590 Ga0495644_0007935 3300046523 Bacteria 4085
591 Ga0495644_0111414 3300046523 Bacteria 1038
592 Ga0495644_0125908 3300046523 Bacteria 976
593 Ga0495648_0015040 3300046524 Bacteria 5635
594 Ga0495648_0028873 3300046524 Bacteria 3688
595 Ga0495648_0095887 3300046524 Bacteria 1649
596 Ga0495666_0003858 3300046526 Bacteria 7584
597 Ga0495666_0111677 3300046526 Bacteria 1283
598 Ga0495642_0000906 3300046528 Bacteria 13909
599 Ga0495642_0002663 3300046528 Bacteria 7184
600 Ga0495642_0006132 3300046528 Bacteria 4618
601 Ga0495642_0128510 3300046528 Bacteria 1090
602 Ga0495642_0168322 3300046528 Bacteria 952
603 Ga0495642_0501085 3300046528 Bacteria 537
604 Ga0495652_0013991 3300046529 Bacteria 7210
605 Ga0495652_0029479 3300046529 Bacteria 4820
606 Ga0495652_0039467 3300046529 Bacteria 4082
607 Ga0495654_0015394 3300046530 Bacteria 4060
608 Ga0495654_0089845 3300046530 Bacteria 1427
609 Ga0495665_0039180 3300046531 Bacteria 2524
610 Ga0495665_0086267 3300046531 Bacteria 1650
611 Ga0495640_0126729 3300046533 Bacteria 1655
612 Ga0495640_0712970 3300046533 Bacteria 601
613 Ga0495586_0050816 3300046535 Bacteria 2243
614 Ga0495587_0038821 3300046536 Bacteria 2852
615 Ga0495587_0418367 3300046536 Bacteria 744
616 Ga0495598_0013357 3300046537 Bacteria 2034
617 Ga0495609_0000124 3300046538 Bacteria 84411
618 Ga0495609_0000198 3300046538 Bacteria 59995
619 Ga0495609_0002629 3300046538 Bacteria 10905
620 Ga0495609_0010675 3300046538 Bacteria 4396
621 Ga0495609_0033648 3300046538 Bacteria 2326
622 Ga0495609_0078845 3300046538 Bacteria 1441
623 Ga0495621_0059188 3300046539 Bacteria 1387
624 Ga0495597_0002102 3300046542 Bacteria 13234
625 Ga0495597_0009836 3300046542 Bacteria 4704
626 Ga0495597_0067599 3300046542 Bacteria 1545
627 Ga0495597_0075662 3300046542 Bacteria 1444
628 Ga0495597_0091925 3300046542 Bacteria 1287
629 Ga0495645_0013110 3300046543 Bacteria 5858
630 Ga0495645_0035731 3300046543 Bacteria 3622
631 Ga0495645_0153874 3300046543 Bacteria 1595
632 Ga0495633_0019298 3300046558 Bacteria 3449
633 Ga0495633_0064479 3300046558 Bacteria 1712
634 Ga0495633_0119778 3300046558 Bacteria 1219
635 Ga0495633_0507277 3300046558 Bacteria 544
636 Ga0495667_0095248 3300046559 Bacteria 1928
637 Ga0495656_0001645 3300046615 Bacteria 7311
638 Ga0495656_0004323 3300046615 Bacteria 4856
639 Ga0495656_0015609 3300046615 Bacteria 2870
640 Ga0495668_0003297 3300046616 Bacteria 12232
641 Ga0495668_0033957 3300046616 Bacteria 2864
642 Ga0495668_0046705 3300046616 Bacteria 2405
643 Ga0495634_0027598 3300046642 Bacteria 3949
644 Ga0495634_0285512 3300046642 Bacteria 1001
645 Ga0495611_0003551 3300046648 Bacteria 6853
646 Ga0495611_0010156 3300046648 Bacteria 3982
647 Ga0495611_0013558 3300046648 Bacteria 3472
648 Ga0495611_0023533 3300046648 Bacteria 2674
649 Ga0495611_0025019 3300046648 Bacteria 2599
650 Ga0495611_0123644 3300046648 Bacteria 1206
651 Ga0495625_0030388 3300046660 Bacteria 4031
652 Ga0495625_0033452 3300046660 Bacteria 3802
653 Ga0495625_0036850 3300046660 Bacteria 3591
654 Ga0495625_0056188 3300046660 Bacteria 2803
655 Ga0495625_0066568 3300046660 Bacteria 2537
656 Ga0495625_0667481 3300046660 Bacteria 617
657 Ga0495635_0019487 3300046663 Bacteria 4728
658 Ga0495635_0055785 3300046663 Bacteria 2721
659 Ga0495659_0002026 3300046664 Bacteria 6645
660 Ga0495659_0144937 3300046664 Bacteria 950
661 Ga0495659_0529885 3300046664 Bacteria 518
662 Ga0495661_0000094 3300046665 Bacteria 109394
663 Ga0495661_0000552 3300046665 Bacteria 38730
664 Ga0495661_0001579 3300046665 Bacteria 18768
665 Ga0495661_0001921 3300046665 Bacteria 16534
666 Ga0495661_0020567 3300046665 Bacteria 4307
667 Ga0495661_0022141 3300046665 Bacteria 4137
668 Ga0495661_0022865 3300046665 Bacteria 4063
669 Ga0495661_0035235 3300046665 Bacteria 3142
670 Ga0495661_0048331 3300046665 Bacteria 2585
671 Ga0495661_0062275 3300046665 Bacteria 2211
672 Ga0495588_0029702 3300046674 Bacteria 2744
673 Ga0495588_0032067 3300046674 Bacteria 2647
674 Ga0495588_0036636 3300046674 Bacteria 2489
675 Ga0495588_0491843 3300046674 Bacteria 643
676 Ga0495588_0717751 3300046674 Bacteria 523
677 Ga0495657_0049897 3300046675 Bacteria 2816
678 Ga0495657_0154856 3300046675 Bacteria 1421
679 Ga0495599_0006702 3300046678 Bacteria 6955
680 Ga0495599_0012778 3300046678 Bacteria 5180
681 Ga0495599_0905053 3300046678 Bacteria 500
682 Ga0495623_0002298 3300046679 Bacteria 12738
683 Ga0495623_0004679 3300046679 Bacteria 8992
684 Ga0495623_0055673 3300046679 Bacteria 2492
685 Ga0495623_0279367 3300046679 Bacteria 929
686 Ga0495646_0022385 3300046680 Bacteria 3987
687 Ga0495646_0045828 3300046680 Bacteria 2668
688 Ga0495646_0445311 3300046680 Bacteria 669
689 Ga0495658_0039145 3300046683 Bacteria 2629
690 Ga0495669_0012868 3300046684 Bacteria 3562
691 Ga0495669_0019560 3300046684 Bacteria 2923
692 Ga0495613_0201083 3300046689 Bacteria 1405
693 Ga0495624_0018634 3300046690 Bacteria 4642
694 Ga0495624_0023699 3300046690 Bacteria 4045
695 Ga0495624_0046656 3300046690 Bacteria 2754
696 Ga0495624_0177172 3300046690 Bacteria 1300
697 Ga0495670_0001628 3300046691 Bacteria 10990
698 Ga0495670_0002782 3300046691 Bacteria 8648
699 Ga0495670_0063357 3300046691 Bacteria 1861
700 Ga0495670_0373731 3300046691 Bacteria 768
701 Ga0495671_0001063 3300046692 Bacteria 19007
702 Ga0495671_0001619 3300046692 Bacteria 14797
703 Ga0495671_0031412 3300046692 Bacteria 2715
704 Ga0495671_0365027 3300046692 Bacteria 692
705 Ga0495649_0039034 3300046694 Bacteria 2603
706 Ga0495589_0000019 3300046794 Bacteria 200814
707 Ga0495589_0000168 3300046794 Bacteria 59857
708 Ga0495589_0040176 3300046794 Bacteria 2336
709 Ga0495589_0206494 3300046794 Bacteria 926
710 Ga0495589_0467725 3300046794 Bacteria 576
711 Ga0495600_0018195 3300046809 Bacteria 4473
712 Ga0495600_0050734 3300046809 Bacteria 2707
713 Ga0495660_0010031 3300046810 Bacteria 5510
714 Ga0495660_0026837 3300046810 Bacteria 3260
715 Ga0495581_0231999 3300047315 Bacteria 1079
716 Ga0495604_0001624 3300047317 Bacteria 18543
717 Ga0495604_0021041 3300047317 Bacteria 5204
718 Ga0495604_0051512 3300047317 Bacteria 3190
719 Ga0495604_0129603 3300047317 Bacteria 1815
720 Ga0495604_0192417 3300047317 Bacteria 1420
721 Ga0495636_0000468 3300047318 Bacteria 14947
722 Ga0495636_0008126 3300047318 Bacteria 4136
723 Ga0495636_0046138 3300047318 Bacteria 1817
724 Ga0495636_0298789 3300047318 Bacteria 753
725 Ga0495674_0061459 3300047319 Bacteria 3273
726 Ga0495674_0086568 3300047319 Bacteria 2682
727 Ga0495674_1100601 3300047319 Bacteria 605
728 Ga0495672_0002278 3300047320 Bacteria 17821
729 Ga0495672_0091244 3300047320 Bacteria 1672
730 Ga0495672_0342135 3300047320 Bacteria 697
731 Ga0495676_0015951 3300047321 Bacteria 6677
732 Ga0495676_0021020 3300047321 Bacteria 5712
733 Ga0495680_0078210 3300047322 Bacteria 2503
734 Ga0495683_0000433 3300047323 Bacteria 33196
735 Ga0495683_0020851 3300047323 Bacteria 3379
736 Ga0495683_0022417 3300047323 Bacteria 3247
737 Ga0495683_0194430 3300047323 Bacteria 918
738 Ga0495683_0246107 3300047323 Bacteria 786
739 Ga0495683_0308931 3300047323 Bacteria 677
740 Ga0495687_000132 3300047443 Bacteria 114685
741 Ga0495687_000313 3300047443 Bacteria 63173
742 Ga0495687_001190 3300047443 Bacteria 24980
743 Ga0495687_002442 3300047443 Bacteria 14933
744 Ga0495687_002529 3300047443 Bacteria 14512
745 Ga0495687_023200 3300047443 Bacteria 2967
746 Ga0495687_065366 3300047443 Bacteria 1481
747 Ga0495687_091651 3300047443 Bacteria 1162
748 Ga0495675_0002982 3300047444 Bacteria 10161
749 Ga0495675_0038294 3300047444 Bacteria 3053
750 Ga0495675_0823391 3300047444 Bacteria 512
751 Ga0495677_0000062 3300047445 Bacteria 60952
752 Ga0495677_0000469 3300047445 Bacteria 17293
753 Ga0495677_0001719 3300047445 Bacteria 8784
754 Ga0495677_0013773 3300047445 Bacteria 2943
755 Ga0495677_0058567 3300047445 Bacteria 1425
756 Ga0495679_006340 3300047446 Bacteria 5111
757 Ga0495679_008563 3300047446 Bacteria 4148
758 Ga0495685_010587 3300047447 Bacteria 3097
759 Ga0495673_0004330 3300047469 Bacteria 8935
760 Ga0495673_0055701 3300047469 Bacteria 1714
761 Ga0495673_0119454 3300047469 Bacteria 1045
762 Ga0495681_0016121 3300047470 Bacteria 4204
763 Ga0495681_0113802 3300047470 Bacteria 1168
764 Ga0495686_0026896 3300047472 Bacteria 3761
765 Ga0495686_0287814 3300047472 Bacteria 911
766 Ga0495686_0391165 3300047472 Bacteria 748
767 Ga0495593_0008837 3300047673 Bacteria 5847
768 Ga0495602_0004438 3300048088 Bacteria 14645
769 Ga0495602_0012465 3300048088 Bacteria 8735
770 Ga0495602_0075575 3300048088 Bacteria 2858
771 Ga0495602_0093324 3300048088 Bacteria 2490
772 Ga0495602_0122130 3300048088 Bacteria 2094
773 Ga0495602_0203194 3300048088 Unclassified 1510
774 Ga0495602_0858199 3300048088 Bacteria 606
775 Ga0495614_0024521 3300048089 Bacteria 2603
776 Ga0495615_0007722 3300048090 Bacteria 2053
777 Ga0495615_0243950 3300048090 Bacteria 567
778 Ga0495626_0000376 3300048091 Bacteria 46584
779 Ga0495626_0004004 3300048091 Bacteria 9207
780 Ga0495626_0004364 3300048091 Bacteria 8713
781 Ga0495626_0019959 3300048091 Bacteria 3343
782 Ga0495626_0071066 3300048091 Bacteria 1565
783 Ga0496100_0052778 3300048903 Bacteria 2644
784 Ga0496100_0465463 3300048903 Bacteria 971
785 Ga0496100_0720310 3300048903 Bacteria 779
786 Ga0496100_0843311 3300048903 Bacteria 719
787 Ga0496101_0055040 3300048904 Bacteria 2872
788 Ga0496101_0056586 3300048904 Bacteria 2835
789 Ga0496101_0226250 3300048904 Bacteria 1453
790 Ga0496101_0325751 3300048904 Unclassified 1206
791 Ga0496101_0338492 3300048904 Bacteria 1181
792 Ga0496102_0126999 3300048905 Bacteria 2384
793 Ga0496102_0458767 3300048905 Bacteria 1195
794 Ga0496103_0030793 3300048906 Bacteria 3266
795 Ga0496103_0154570 3300048906 Bacteria 1470
796 Ga0496103_0821650 3300048906 Bacteria 585
797 Ga0496104_0034826 3300048907 Bacteria 4697
798 Ga0496104_0110040 3300048907 Bacteria 2640
799 Ga0496104_0630228 3300048907 Bacteria 981
800 Ga0496104_0658745 3300048907 Bacteria 956
801 Ga0496105_0016422 3300048908 Bacteria 5912
802 Ga0496105_0082069 3300048908 Bacteria 2663
803 Ga0496105_0132118 3300048908 Bacteria 2058
804 Ga0496105_0214227 3300048908 Bacteria 1569
805 Ga0496105_0973034 3300048908 Bacteria 636
806 Ga0496106_0008060 3300048909 Bacteria 7779
807 Ga0496106_0030441 3300048909 Bacteria 4024
808 Ga0496107_0047701 3300048910 Bacteria 3084
809 Ga0496107_0049393 3300048910 Bacteria 3031
810 Ga0496107_0406728 3300048910 Bacteria 1012
811 Ga0496108_0193368 3300048911 Bacteria 1764
812 Ga0496108_0340416 3300048911 Bacteria 1308
813 Ga0496109_0102971 3300048912 Bacteria 2649
814 Ga0496110_0051889 3300048913 Bacteria 3604
815 Ga0496110_0074102 3300048913 Bacteria 3022
816 Ga0496110_0166659 3300048913 Bacteria 1998
817 Ga0496110_0247473 3300048913 Bacteria 1622
818 Ga0496110_1005981 3300048913 Bacteria 741
819 Ga0496111_0038362 3300048914 Bacteria 3433
820 Ga0496111_0214351 3300048914 Bacteria 1430
821 Ga0496111_0218308 3300048914 Bacteria 1416
822 Ga0496111_0999124 3300048914 Bacteria 600
823 Ga0496112_0103867 3300048915 Bacteria 2812
824 Ga0496112_0265873 3300048915 Bacteria 1664
825 Ga0496112_0433379 3300048915 Bacteria 1253
826 Ga0496112_0734001 3300048915 Bacteria 914
827 Ga0496113_0071565 3300048916 Bacteria 2637
828 Ga0496113_0120066 3300048916 Bacteria 2054
829 Ga0496113_0215747 3300048916 Bacteria 1528
830 Ga0496113_0394215 3300048916 Bacteria 1111
831 Ga0496114_0122539 3300048917 Bacteria 2237
832 Ga0496114_0169462 3300048917 Bacteria 1902
833 Ga0496114_0416344 3300048917 Bacteria 1190
834 Ga0496114_0473585 3300048917 Bacteria 1108
835 Ga0496115_0048461 3300048918 Bacteria 3398
836 Ga0496115_0077631 3300048918 Plasmid 2701
837 Ga0496115_0131288 3300048918 Bacteria 2065
838 Ga0496115_0528245 3300048918 Bacteria 945
839 Ga0496116_0062898 3300048919 Bacteria 2394
840 Ga0496116_0157678 3300048919 Bacteria 1250
841 Ga0496117_0030556 3300048920 Bacteria 4131
842 Ga0496117_0054340 3300048920 Bacteria 2806
843 Ga0496117_0055484 3300048920 Bacteria 2768
844 Ga0496117_0093436 3300048920 Bacteria 1929
845 Ga0496117_0230373 3300048920 Bacteria 1024
846 Ga0496118_0002539 3300048921 Bacteria 24435
847 Ga0496118_0037829 3300048921 Bacteria 3877
848 Ga0496118_0048253 3300048921 Bacteria 3291
849 Ga0496119_0047105 3300048922 Bacteria 2685
850 Ga0496120_0074997 3300048923 Bacteria 1847
851 Ga0496121_0002981 3300048924 Bacteria 24617
852 Ga0496121_0041344 3300048924 Bacteria 4029
853 Ga0496121_0064085 3300048924 Bacteria 2998
854 Ga0496121_0069997 3300048924 Bacteria 2828
855 Ga0496121_0226110 3300048924 Bacteria 1314
856 Ga0496122_0044840 3300048925 Bacteria 3446
857 Ga0496123_0102400 3300048926 Bacteria 1662
858 Ga0496124_0048622 3300048927 Bacteria 3623
859 Ga0496125_0104160 3300048928 Bacteria 2079
860 Ga0496126_0004806 3300048929 Bacteria 15874
861 Ga0496126_0075322 3300048929 Bacteria 2995
862 Ga0496126_0285849 3300048929 Bacteria 1365
863 Ga0496126_0399193 3300048929 Bacteria 1116
864 Ga0496126_0906114 3300048929 Bacteria 668
865 Ga0495678_006049 3300049459 Bacteria 6517
866 Ga0495678_013689 3300049459 Bacteria 3798
867 Ga0495678_014134 3300049459 Bacteria 3720
868 Ga0495678_016841 3300049459 Bacteria 3328
869 Ga0495678_035409 3300049459 Bacteria 2047
870 Ga0495682_0002880 3300049460 Bacteria 7908
871 Ga0495682_0089062 3300049460 Bacteria 1109
872 Ga0495682_0091089 3300049460 Bacteria 1095
873 Ga0495682_0238523 3300049460 Bacteria 643
874 Ga0501034_0070007 3300049571 Bacteria 3519
875 Ga0501034_0596046 3300049571 Bacteria 1011
876 Ga0501034_1472533 3300049571 Bacteria 555
877 Ga0501036_0059691 3300049572 Bacteria 3231
878 Ga0501038_0246178 3300049574 Bacteria 1418
879 Ga0501043_0180248 3300049579 Bacteria 1646
880 Ga0501067_0108649 3300049583 Bacteria 1542
881 Ga0501068_0042701 3300049584 Bacteria 2726
882 Ga0501069_0025746 3300049585 Bacteria 3217
883 Ga0501070_0301025 3300049586 Bacteria 1306
884 Ga0501071_0407525 3300049587 Bacteria 1038
885 Ga0501072_0134330 3300049588 Bacteria 1973
886 Ga0501073_0043805 3300049589 Bacteria 3155
887 Ga0501073_0337674 3300049589 Bacteria 1040
888 Ga0501074_0045009 3300049590 Bacteria 3193
889 Ga0501077_0203562 3300049593 Bacteria 1257
890 Ga0501079_0062029 3300049741 Bacteria 2883
891 Ga0501080_0090643 3300049742 Bacteria 2839
892 Ga0501081_0379398 3300049743 Bacteria 1044
893 Ga0501083_0053773 3300049744 Bacteria 2703
894 Ga0501044_0086320 3300049823 Bacteria 3170
895 Ga0501044_0121643 3300049823 Bacteria 2611
896 nmdc:mga07m45_125479_c1 3300050496 Bacteria 1484
897 nmdc:mga0qj67_3522_c1 3300050509 Bacteria 11300
898 nmdc:mga0n895_878377_c1 3300050512 Unclassified 883
899 nmdc:mga08x19_424869_c1 3300050514 Bacteria 934
900 Ga0495601_0009084 3300053077 Bacteria 5870
901 Ga0495655_0017319 3300053083 Bacteria 1567
902 Ga0500578_0082049 3300053086 Bacteria 2050
903 Ga0500644_0157612 3300053088 Bacteria 915
904 Ga0500583_0073287 3300053092 Bacteria 1642
905 Ga0500555_070560 3300053103 Bacteria 923
906 Ga0500593_013458 3300053117 Bacteria 3495
907 Ga0500593_026954 3300053117 Bacteria 2563
908 Ga0500623_276708 3300053127 Bacteria 534
909 Ga0500658_0196046 3300053134 Bacteria 923
910 Ga0500573_0066218 3300053140 Bacteria 2065
911 Ga0500574_000311 3300053141 Bacteria 5981
912 Ga0500577_0072013 3300053142 Bacteria 1358
913 Ga0500600_0181090 3300053149 Bacteria 1014
914 Ga0500604_0147593 3300053151 Bacteria 797
915 Ga0500616_0120499 3300053153 Bacteria 1254
916 Ga0500619_008007 3300053154 Bacteria 2540
917 Ga0500633_0168239 3300053160 Bacteria 823
918 Ga0500596_049249 3300053735 Unclassified 686
919 Ga0501084_0075728 3300054114 Bacteria 2819
920 Ga0501082_0089660 3300060353 Bacteria 2655
921 Ga0466962_0042455 3300061719 Bacteria 2176
922 Ga0466962_0102881 3300061719 Bacteria 1372
923 Ga0530510_0035482 3300061734 Bacteria 3594

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005339 Ga0070660_100238177 Ga0070660_1002381773 102
2 3300005344 Ga0070661_100335314 Ga0070661_1003353141 102
3 3300005366 Ga0070659_100314025 Ga0070659_1003140251 102
4 3300005564 Ga0070664_100217327 Ga0070664_1002173273 102
5 3300025919 Ga0207657_10229292 Ga0207657_102292921 102
6 3300025920 Ga0207649_10283152 Ga0207649_102831522 102
7 3300025945 Ga0207679_10043701 Ga0207679_100437012 102
8 3300032004 Ga0307414_10457975 Ga0307414_104579752 102
9 3300036401 Ga0373937_0082509 Ga0373937_0082509_2201_2509 102
10 3300046536 Ga0495587_0038821 Ga0495587_0038821_103_411 102
11 3300048921 Ga0496118_0002539 Ga0496118_0002539_14280_14594 104
12 3300049823 Ga0501044_0086320 Ga0501044_0086320_1898_2215 105
13 3300013306 Ga0163162_11771038 Ga0163162_117710381 106
14 3300025942 Ga0207689_10162074 Ga0207689_101620742 106
15 3300039438 Ga0436360_0273429 Ga0436360_0273429_43_366 106
16 3300046516 Ga0495628_0276374 Ga0495628_0276374_904_1224 106
17 3300046542 Ga0495597_0002102 Ga0495597_0002102_6830_7189 106
18 3300048904 Ga0496101_0226250 Ga0496101_0226250_988_1308 106
19 3300048920 Ga0496117_0030556 Ga0496117_0030556_2237_2557 106
20 3300048924 Ga0496121_0226110 Ga0496121_0226110_190_510 106
21 3300049579 Ga0501043_0180248 Ga0501043_0180248_910_1230 106
22 3300046519 Ga0495632_0333368 Ga0495632_0333368_129_455 108
23 3300046538 Ga0495609_0078845 Ga0495609_0078845_373_699 108
24 3300046660 Ga0495625_0033452 Ga0495625_0033452_1091_1417 108
25 3300053117 Ga0500593_026954 Ga0500593_026954_1238_1564 108
26 3300001979 JGI24740J21852_10002727 JGI24740J21852_100027273 111
27 iso_pu_bacteria 2513237083 2513566294 111
28 iso_pu_bacteria 2515154123 2515689569 111
29 iso_pu_bacteria 2600255067 2600815577 111
30 iso_pu_bacteria 2643221645 2644251713 111
31 iso_pu_bacteria 2858688981 2858695468 111
32 iso_pu_bacteria 2858688981 2858698095 111
33 iso_pu_bacteria 2870068957 2870073033 111
34 iso_pu_bacteria 2870068957 2870076373 111
35 iso_pu_bacteria 2885266251 2885270449 111
36 iso_pu_bacteria 2904615490 2904623125 111
37 iso_pu_bacteria 2928058823 2928063983 111
38 iso_pu_bacteria 644736347 644749646 111
39 iso_pu_bacteria 644736347 644749949 111
40 iso_pu_bacteria 644736347 644749959 111
41 iso_pu_bacteria 8003955200 8003962500 111
42 3300024227 Ga0228598_1005334 Ga0228598_10053342 112
43 iso_pu_bacteria 8020953355 8020959371 112
44 iso_pu_bacteria 8021120328 8021128420 112
45 3300010375 Ga0105239_11209608 Ga0105239_112096081 113
46 3300006914 Ga0075436_100066233 Ga0075436_1000662333 114
47 3300009101 Ga0105247_10675222 Ga0105247_106752222 114
48 3300021361 Ga0213872_10019547 Ga0213872_100195473 114
49 3300039447 Ga0436361_0851193 Ga0436361_0851193_628_972 114
50 3300044656 Ga0466969_0186541 Ga0466969_0186541_152_496 114
51 3300044683 Ga0466965_0023906 Ga0466965_0023906_878_1222 114
52 3300044765 Ga0466970_0131464 Ga0466970_0131464_94_438 114
53 3300045049 Ga0466959_0035768 Ga0466959_0035768_1850_2194 114
54 3300048904 Ga0496101_0325751 Ga0496101_0325751_774_1118 114
55 3300048907 Ga0496104_0658745 Ga0496104_0658745_73_417 114
56 3300049823 Ga0501044_0121643 Ga0501044_0121643_356_700 114
57 3300050514 nmdc:mga08x19_424869_c1 nmdc:mga08x19_424869_c1_468_812 114
58 3300001915 JGI24741J21665_1005042 JGI24741J21665_10050422 115
59 3300001978 JGI24747J21853_1009708 JGI24747J21853_10097082 115
60 3300001979 JGI24740J21852_10017586 JGI24740J21852_100175862 115
61 3300001989 JGI24739J22299_10016556 JGI24739J22299_100165562 115
62 3300001989 JGI24739J22299_10017427 JGI24739J22299_100174272 115
63 3300001991 JGI24743J22301_10059244 JGI24743J22301_100592442 115
64 3300002067 JGI24735J21928_10060995 JGI24735J21928_100609952 115
65 3300002073 JGI24745J21846_1003085 JGI24745J21846_10030852 115
66 3300002074 JGI24748J21848_1001628 JGI24748J21848_10016282 115
67 3300002075 JGI24738J21930_10007688 JGI24738J21930_100076882 115
68 3300002077 JGI24744J21845_10035381 JGI24744J21845_100353812 115
69 3300002155 JGI24033J26618_1018913 JGI24033J26618_10189132 115
70 3300002239 JGI24034J26672_10002201 JGI24034J26672_100022012 115
71 3300002239 JGI24034J26672_10002230 JGI24034J26672_100022302 115
72 3300002244 JGI24742J22300_10003465 JGI24742J22300_100034652 115
73 3300002705 JGI25156J39149_1000313 JGI25156J39149_10003139 115
74 3300003322 rootL2_10001338 rootL2_100013382 115
75 3300003322 rootL2_10086943 rootL2_100869434 115
76 3300003760 Ga0055527_1003008 Ga0055527_10030084 115
77 3300003762 Ga0055542_1031490 Ga0055542_10314902 115
78 3300003771 Ga0055526_1011534 Ga0055526_10115345 115
79 3300003771 Ga0055526_1025228 Ga0055526_10252282 115
80 3300003773 Ga0055537_1003426 Ga0055537_10034264 115
81 3300003775 Ga0055524_1000607 Ga0055524_100060714 115
82 3300003784 Ga0055534_1000305 Ga0055534_100030513 115
83 3300003784 Ga0055534_1001282 Ga0055534_10012827 115
84 3300003911 JGI25405J52794_10002528 JGI25405J52794_100025283 115
85 3300005327 Ga0070658_10002107 Ga0070658_100021078 115
86 3300005327 Ga0070658_10081384 Ga0070658_100813843 115
87 3300005327 Ga0070658_10277305 Ga0070658_102773052 115
88 3300005328 Ga0070676_10026136 Ga0070676_100261363 115
89 3300005328 Ga0070676_10165545 Ga0070676_101655452 115
90 3300005329 Ga0070683_100278467 Ga0070683_1002784672 115
91 3300005329 Ga0070683_100547981 Ga0070683_1005479812 115
92 3300005330 Ga0070690_100465991 Ga0070690_1004659912 115
93 3300005331 Ga0070670_100214660 Ga0070670_1002146602 115
94 3300005333 Ga0070677_10033549 Ga0070677_100335492 115
95 3300005334 Ga0068869_101255126 Ga0068869_1012551261 115
96 3300005336 Ga0070680_100094871 Ga0070680_1000948713 115
97 3300005336 Ga0070680_100792647 Ga0070680_1007926471 115
98 3300005337 Ga0070682_100015375 Ga0070682_1000153755 115
99 3300005337 Ga0070682_100022657 Ga0070682_1000226573 115
100 3300005337 Ga0070682_101290290 Ga0070682_1012902901 115
101 3300005338 Ga0068868_100490428 Ga0068868_1004904282 115
102 3300005339 Ga0070660_100088326 Ga0070660_1000883262 115
103 3300005339 Ga0070660_100109490 Ga0070660_1001094902 115
104 3300005339 Ga0070660_100149293 Ga0070660_1001492933 115
105 3300005343 Ga0070687_100017936 Ga0070687_1000179362 115
106 3300005344 Ga0070661_100000020 Ga0070661_10000002090 115
107 3300005344 Ga0070661_100055823 Ga0070661_1000558233 115
108 3300005344 Ga0070661_100109110 Ga0070661_1001091103 115
109 3300005344 Ga0070661_100505789 Ga0070661_1005057892 115
110 3300005347 Ga0070668_100054856 Ga0070668_1000548562 115
111 3300005353 Ga0070669_100044463 Ga0070669_1000444632 115
112 3300005353 Ga0070669_100297475 Ga0070669_1002974752 115
113 3300005354 Ga0070675_100060346 Ga0070675_1000603463 115
114 3300005355 Ga0070671_100044576 Ga0070671_1000445762 115
115 3300005356 Ga0070674_100040302 Ga0070674_1000403022 115
116 3300005364 Ga0070673_100062935 Ga0070673_1000629352 115
117 3300005365 Ga0070688_100020352 Ga0070688_1000203523 115
118 3300005366 Ga0070659_100034303 Ga0070659_1000343033 115
119 3300005366 Ga0070659_100040676 Ga0070659_1000406762 115
120 3300005366 Ga0070659_100453758 Ga0070659_1004537583 115
121 3300005367 Ga0070667_100010218 Ga0070667_1000102188 115
122 3300005436 Ga0070713_100988745 Ga0070713_1009887452 115
123 3300005436 Ga0070713_101500065 Ga0070713_1015000652 115
124 3300005438 Ga0070701_10295304 Ga0070701_102953042 115
125 3300005439 Ga0070711_100058711 Ga0070711_1000587112 115
126 3300005441 Ga0070700_100308832 Ga0070700_1003088321 115
127 3300005455 Ga0070663_100013217 Ga0070663_1000132174 115
128 3300005455 Ga0070663_100055957 Ga0070663_1000559572 115
129 3300005455 Ga0070663_100351459 Ga0070663_1003514592 115
130 3300005456 Ga0070678_100033208 Ga0070678_1000332082 115
131 3300005456 Ga0070678_101237162 Ga0070678_1012371622 115
132 3300005457 Ga0070662_100033646 Ga0070662_1000336463 115
133 3300005458 Ga0070681_10096477 Ga0070681_100964772 115
134 3300005458 Ga0070681_10111126 Ga0070681_101111263 115
135 3300005458 Ga0070681_11775728 Ga0070681_117757282 115
136 3300005459 Ga0068867_100446445 Ga0068867_1004464452 115
137 3300005459 Ga0068867_101239220 Ga0068867_1012392201 115
138 3300005466 Ga0070685_10148733 Ga0070685_101487332 115
139 3300005518 Ga0070699_100973035 Ga0070699_1009730352 115
140 3300005530 Ga0070679_100102337 Ga0070679_1001023373 115
141 3300005530 Ga0070679_100104373 Ga0070679_1001043733 115
142 3300005530 Ga0070679_100383559 Ga0070679_1003835591 115
143 3300005535 Ga0070684_100440712 Ga0070684_1004407122 115
144 3300005535 Ga0070684_100593730 Ga0070684_1005937302 115
145 3300005536 Ga0070697_101132858 Ga0070697_1011328582 115
146 3300005539 Ga0068853_100091722 Ga0068853_1000917223 115
147 3300005539 Ga0068853_100187251 Ga0068853_1001872512 115
148 3300005543 Ga0070672_100046874 Ga0070672_1000468743 115
149 3300005544 Ga0070686_100075436 Ga0070686_1000754362 115
150 3300005546 Ga0070696_101079236 Ga0070696_1010792362 115
151 3300005548 Ga0070665_100057831 Ga0070665_1000578315 115
152 3300005548 Ga0070665_100656436 Ga0070665_1006564362 115
153 3300005548 Ga0070665_100834483 Ga0070665_1008344831 115
154 3300005563 Ga0068855_100439959 Ga0068855_1004399592 115
155 3300005563 Ga0068855_100592503 Ga0068855_1005925032 115
156 3300005564 Ga0070664_100079351 Ga0070664_1000793512 115
157 3300005564 Ga0070664_100081382 Ga0070664_1000813822 115
158 3300005564 Ga0070664_100472264 Ga0070664_1004722642 115
159 3300005577 Ga0068857_100054050 Ga0068857_1000540506 115
160 3300005578 Ga0068854_100027418 Ga0068854_1000274187 115
161 3300005614 Ga0068856_100000127 Ga0068856_1000001273 115
162 3300005614 Ga0068856_100468748 Ga0068856_1004687482 115
163 3300005615 Ga0070702_101144189 Ga0070702_1011441892 115
164 3300005616 Ga0068852_100097176 Ga0068852_1000971762 115
165 3300005616 Ga0068852_100098280 Ga0068852_1000982803 115
166 3300005616 Ga0068852_100226719 Ga0068852_1002267193 115
167 3300005616 Ga0068852_100753746 Ga0068852_1007537462 115
168 3300005617 Ga0068859_100111372 Ga0068859_1001113722 115
169 3300005617 Ga0068859_100119564 Ga0068859_1001195642 115
170 3300005618 Ga0068864_100101906 Ga0068864_1001019063 115
171 3300005718 Ga0068866_10125161 Ga0068866_101251612 115
172 3300005840 Ga0068870_10124438 Ga0068870_101244382 115
173 3300005841 Ga0068863_100086189 Ga0068863_1000861893 115
174 3300005842 Ga0068858_100088874 Ga0068858_1000888743 115
175 3300005843 Ga0068860_100061555 Ga0068860_1000615552 115
176 3300005843 Ga0068860_100392246 Ga0068860_1003922461 115
177 3300005844 Ga0068862_100012213 Ga0068862_1000122136 115
178 3300005844 Ga0068862_100077462 Ga0068862_1000774622 115
179 3300005844 Ga0068862_100095089 Ga0068862_1000950892 115
180 3300005844 Ga0068862_100431088 Ga0068862_1004310882 115
181 3300005937 Ga0081455_10077489 Ga0081455_100774893 115
182 3300006028 Ga0070717_10081587 Ga0070717_100815873 115
183 3300006058 Ga0075432_10018212 Ga0075432_100182123 115
184 3300006173 Ga0070716_100245039 Ga0070716_1002450392 115
185 3300006237 Ga0097621_100242812 Ga0097621_1002428122 115
186 3300006353 Ga0075370_10153883 Ga0075370_101538834 115
187 3300006358 Ga0068871_100037116 Ga0068871_1000371162 115
188 3300006846 Ga0075430_100004131 Ga0075430_10000413111 115
189 3300006871 Ga0075434_100495629 Ga0075434_1004956292 115
190 3300006931 Ga0097620_100111374 Ga0097620_1001113742 115
191 3300006931 Ga0097620_100119564 Ga0097620_1001195643 115
192 3300007265 Ga0099794_10639793 Ga0099794_106397931 115
193 3300007788 Ga0099795_10102393 Ga0099795_101023932 115
194 3300009011 Ga0105251_10018978 Ga0105251_100189783 115
195 3300009011 Ga0105251_10021475 Ga0105251_100214753 115
196 3300009036 Ga0105244_10022263 Ga0105244_100222633 115
197 3300009092 Ga0105250_10018493 Ga0105250_100184933 115
198 3300009093 Ga0105240_10104334 Ga0105240_101043344 115
199 3300009093 Ga0105240_10400197 Ga0105240_104001972 115
200 3300009093 Ga0105240_10596767 Ga0105240_105967672 115
201 3300009093 Ga0105240_11509117 Ga0105240_115091172 115
202 3300009093 Ga0105240_12140601 Ga0105240_121406012 115
203 3300009101 Ga0105247_10039970 Ga0105247_100399702 115
204 3300009148 Ga0105243_10197329 Ga0105243_101973292 115
205 3300009174 Ga0105241_10052885 Ga0105241_100528852 115
206 3300009176 Ga0105242_10024912 Ga0105242_100249123 115
207 3300009176 Ga0105242_10206975 Ga0105242_102069753 115
208 3300009177 Ga0105248_10011481 Ga0105248_1001148110 115
209 3300009177 Ga0105248_10017781 Ga0105248_100177815 115
210 3300009545 Ga0105237_10145609 Ga0105237_101456093 115
211 3300009545 Ga0105237_10167714 Ga0105237_101677143 115
212 3300009545 Ga0105237_10380695 Ga0105237_103806952 115
213 3300009551 Ga0105238_10069777 Ga0105238_100697773 115
214 3300009551 Ga0105238_10084820 Ga0105238_100848203 115
215 3300009551 Ga0105238_10196670 Ga0105238_101966702 115
216 3300009551 Ga0105238_12884830 Ga0105238_128848301 115
217 3300009553 Ga0105249_10098303 Ga0105249_100983032 115
218 3300009553 Ga0105249_10200163 Ga0105249_102001632 115
219 3300009553 Ga0105249_12305342 Ga0105249_123053422 115
220 3300010159 Ga0099796_10110077 Ga0099796_101100772 115
221 3300010159 Ga0099796_10168903 Ga0099796_101689032 115
222 3300010375 Ga0105239_10130517 Ga0105239_101305172 115
223 3300010375 Ga0105239_10251230 Ga0105239_102512303 115
224 3300010375 Ga0105239_10272471 Ga0105239_102724712 115
225 3300010375 Ga0105239_10983805 Ga0105239_109838052 115
226 3300010375 Ga0105239_11147064 Ga0105239_111470642 115
227 3300011119 Ga0105246_10019099 Ga0105246_100190992 115
228 3300013100 Ga0157373_10000025 Ga0157373_1000002566 115
229 3300013100 Ga0157373_10060878 Ga0157373_100608782 115
230 3300013102 Ga0157371_10054973 Ga0157371_100549732 115
231 3300013102 Ga0157371_10084086 Ga0157371_100840862 115
232 3300013102 Ga0157371_10484236 Ga0157371_104842362 115
233 3300013104 Ga0157370_10000027 Ga0157370_1000002766 115
234 3300013105 Ga0157369_10000167 Ga0157369_1000016785 115
235 3300013105 Ga0157369_10093201 Ga0157369_100932014 115
236 3300013105 Ga0157369_10173487 Ga0157369_101734872 115
237 3300013105 Ga0157369_10933260 Ga0157369_109332602 115
238 3300013296 Ga0157374_10081431 Ga0157374_100814313 115
239 3300013297 Ga0157378_10071387 Ga0157378_100713874 115
240 3300013306 Ga0163162_10000496 Ga0163162_100004962 115
241 3300013306 Ga0163162_10182801 Ga0163162_101828012 115
242 3300013306 Ga0163162_10641163 Ga0163162_106411632 115
243 3300013306 Ga0163162_11366250 Ga0163162_113662502 115
244 3300013307 Ga0157372_10136489 Ga0157372_101364892 115
245 3300013307 Ga0157372_10369673 Ga0157372_103696732 115
246 3300013307 Ga0157372_10594254 Ga0157372_105942542 115
247 3300013308 Ga0157375_10144458 Ga0157375_101444582 115
248 3300013308 Ga0157375_10346616 Ga0157375_103466162 115
249 3300014325 Ga0163163_10126276 Ga0163163_101262762 115
250 3300014326 Ga0157380_10265433 Ga0157380_102654332 115
251 3300014497 Ga0182008_10042135 Ga0182008_100421352 115
252 3300014497 Ga0182008_10138165 Ga0182008_101381651 115
253 3300014497 Ga0182008_10152553 Ga0182008_101525532 115
254 3300014497 Ga0182008_10193742 Ga0182008_101937421 115
255 3300014745 Ga0157377_11099273 Ga0157377_110992732 115
256 3300014969 Ga0157376_10057043 Ga0157376_100570432 115
257 3300014969 Ga0157376_10103782 Ga0157376_101037822 115
258 3300014969 Ga0157376_11265735 Ga0157376_112657352 115
259 3300015261 Ga0182006_1002778 Ga0182006_10027788 115
260 3300015262 Ga0182007_10014896 Ga0182007_100148964 115
261 3300015262 Ga0182007_10055886 Ga0182007_100558862 115
262 3300015262 Ga0182007_10062331 Ga0182007_100623312 115
263 3300015262 Ga0182007_10095006 Ga0182007_100950062 115
264 3300016635 Ga0183361_10008 Ga0183361_10008132 115
265 3300017792 Ga0163161_10004159 Ga0163161_100041598 115
266 3300017792 Ga0163161_10055839 Ga0163161_100558393 115
267 3300020610 Ga0154015_1022863 Ga0154015_102286314 115
268 3300021358 Ga0213873_10020690 Ga0213873_100206902 115
269 3300021358 Ga0213873_10049147 Ga0213873_100491472 115
270 3300021361 Ga0213872_10005360 Ga0213872_100053602 115
271 3300021361 Ga0213872_10243586 Ga0213872_102435861 115
272 3300021377 Ga0213874_10010242 Ga0213874_100102422 115
273 3300021377 Ga0213874_10011948 Ga0213874_100119482 115
274 3300021384 Ga0213876_10158967 Ga0213876_101589672 115
275 3300024225 Ga0224572_1021203 Ga0224572_10212032 115
276 3300024225 Ga0224572_1023066 Ga0224572_10230662 115
277 3300024227 Ga0228598_1009477 Ga0228598_10094772 115
278 3300024227 Ga0228598_1019584 Ga0228598_10195842 115
279 3300025228 Ga0209672_101662 Ga0209672_10166210 115
280 3300025254 Ga0209148_1001334 Ga0209148_100133411 115
281 3300025256 Ga0209759_1000562 Ga0209759_100056226 115
282 3300025263 Ga0209565_1000094 Ga0209565_100009469 115
283 3300025273 Ga0209673_1005825 Ga0209673_10058252 115
284 3300025291 Ga0209675_1000145 Ga0209675_100014549 115
285 3300025291 Ga0209675_1002086 Ga0209675_10020867 115
286 3300025295 Ga0209564_1000119 Ga0209564_100011949 115
287 3300025295 Ga0209564_1000509 Ga0209564_100050949 115
288 3300025299 Ga0209256_1001721 Ga0209256_10017217 115
289 3300025315 Ga0207697_10151032 Ga0207697_101510322 115
290 3300025711 Ga0207696_1014964 Ga0207696_10149642 115
291 3300025728 Ga0207655_1020250 Ga0207655_10202503 115
292 3300025735 Ga0207713_1021650 Ga0207713_10216503 115
293 3300025893 Ga0207682_10035286 Ga0207682_100352862 115
294 3300025899 Ga0207642_10108918 Ga0207642_101089182 115
295 3300025900 Ga0207710_10023555 Ga0207710_100235552 115
296 3300025901 Ga0207688_10070359 Ga0207688_100703593 115
297 3300025903 Ga0207680_10017137 Ga0207680_100171372 115
298 3300025904 Ga0207647_10047227 Ga0207647_100472272 115
299 3300025904 Ga0207647_10210967 Ga0207647_102109672 115
300 3300025907 Ga0207645_10015542 Ga0207645_100155426 115
301 3300025907 Ga0207645_10318662 Ga0207645_103186622 115
302 3300025909 Ga0207705_10000555 Ga0207705_100005559 115
303 3300025909 Ga0207705_10032073 Ga0207705_100320732 115
304 3300025909 Ga0207705_10087143 Ga0207705_100871433 115
305 3300025911 Ga0207654_10039578 Ga0207654_100395782 115
306 3300025912 Ga0207707_10076195 Ga0207707_100761953 115
307 3300025912 Ga0207707_10099636 Ga0207707_100996362 115
308 3300025912 Ga0207707_10352893 Ga0207707_103528931 115
309 3300025912 Ga0207707_11551017 Ga0207707_115510172 115
310 3300025913 Ga0207695_10028067 Ga0207695_100280676 115
311 3300025913 Ga0207695_10095130 Ga0207695_100951302 115
312 3300025913 Ga0207695_10280026 Ga0207695_102800262 115
313 3300025913 Ga0207695_10952416 Ga0207695_109524162 115
314 3300025914 Ga0207671_10061896 Ga0207671_100618963 115
315 3300025914 Ga0207671_10148567 Ga0207671_101485672 115
316 3300025914 Ga0207671_10161675 Ga0207671_101616753 115
317 3300025916 Ga0207663_10079303 Ga0207663_100793032 115
318 3300025917 Ga0207660_10077345 Ga0207660_100773452 115
319 3300025919 Ga0207657_10070312 Ga0207657_100703123 115
320 3300025919 Ga0207657_10070381 Ga0207657_100703812 115
321 3300025920 Ga0207649_10000059 Ga0207649_1000005916 115
322 3300025920 Ga0207649_10022386 Ga0207649_100223865 115
323 3300025921 Ga0207652_10100649 Ga0207652_101006492 115
324 3300025921 Ga0207652_10503561 Ga0207652_105035612 115
325 3300025922 Ga0207646_10289944 Ga0207646_102899443 115
326 3300025923 Ga0207681_10029071 Ga0207681_100290713 115
327 3300025924 Ga0207694_10074681 Ga0207694_100746812 115
328 3300025925 Ga0207650_10180087 Ga0207650_101800872 115
329 3300025926 Ga0207659_10070485 Ga0207659_100704852 115
330 3300025927 Ga0207687_10077351 Ga0207687_100773512 115
331 3300025928 Ga0207700_10198550 Ga0207700_101985502 115
332 3300025928 Ga0207700_10351353 Ga0207700_103513531 115
333 3300025931 Ga0207644_10035196 Ga0207644_100351963 115
334 3300025932 Ga0207690_10118505 Ga0207690_101185052 115
335 3300025932 Ga0207690_10183749 Ga0207690_101837492 115
336 3300025932 Ga0207690_10657510 Ga0207690_106575102 115
337 3300025933 Ga0207706_10063895 Ga0207706_100638953 115
338 3300025933 Ga0207706_10601590 Ga0207706_106015902 115
339 3300025934 Ga0207686_10017592 Ga0207686_100175924 115
340 3300025934 Ga0207686_10241097 Ga0207686_102410972 115
341 3300025935 Ga0207709_10050849 Ga0207709_100508492 115
342 3300025936 Ga0207670_10046909 Ga0207670_100469092 115
343 3300025937 Ga0207669_10022048 Ga0207669_100220483 115
344 3300025939 Ga0207665_10095927 Ga0207665_100959272 115
345 3300025940 Ga0207691_10090905 Ga0207691_100909052 115
346 3300025941 Ga0207711_10006542 Ga0207711_1000654210 115
347 3300025941 Ga0207711_10085731 Ga0207711_100857313 115
348 3300025944 Ga0207661_10376807 Ga0207661_103768072 115
349 3300025945 Ga0207679_10059952 Ga0207679_100599522 115
350 3300025945 Ga0207679_10060822 Ga0207679_100608222 115
351 3300025945 Ga0207679_10154573 Ga0207679_101545732 115
352 3300025949 Ga0207667_10008962 Ga0207667_100089626 115
353 3300025960 Ga0207651_10075404 Ga0207651_100754042 115
354 3300025961 Ga0207712_10062612 Ga0207712_100626122 115
355 3300025972 Ga0207668_10078971 Ga0207668_100789712 115
356 3300025981 Ga0207640_10000175 Ga0207640_1000017539 115
357 3300025986 Ga0207658_10017015 Ga0207658_100170155 115
358 3300026035 Ga0207703_10094456 Ga0207703_100944562 115
359 3300026041 Ga0207639_10267809 Ga0207639_102678092 115
360 3300026041 Ga0207639_10514659 Ga0207639_105146591 115
361 3300026067 Ga0207678_10000009 Ga0207678_10000009141 115
362 3300026067 Ga0207678_10067563 Ga0207678_100675632 115
363 3300026067 Ga0207678_10356406 Ga0207678_103564062 115
364 3300026075 Ga0207708_10221807 Ga0207708_102218072 115
365 3300026078 Ga0207702_10000896 Ga0207702_100008963 115
366 3300026078 Ga0207702_11291968 Ga0207702_112919682 115
367 3300026088 Ga0207641_10101348 Ga0207641_101013482 115
368 3300026089 Ga0207648_10783482 Ga0207648_107834822 115
369 3300026089 Ga0207648_11551748 Ga0207648_115517482 115
370 3300026095 Ga0207676_10106592 Ga0207676_101065922 115
371 3300026116 Ga0207674_10071938 Ga0207674_100719386 115
372 3300026121 Ga0207683_10072667 Ga0207683_100726673 115
373 3300026121 Ga0207683_10999560 Ga0207683_109995602 115
374 3300026142 Ga0207698_10103485 Ga0207698_101034852 115
375 3300026142 Ga0207698_10530163 Ga0207698_105301632 115
376 3300026142 Ga0207698_10827067 Ga0207698_108270672 115
377 3300026142 Ga0207698_11512581 Ga0207698_115125812 115
378 3300027395 Ga0209996_1040785 Ga0209996_10407852 115
379 3300027876 Ga0209974_10134153 Ga0209974_101341532 115
380 3300027907 Ga0207428_10077306 Ga0207428_100773062 115
381 3300028023 Ga0265357_1002288 Ga0265357_10022882 115
382 3300028036 Ga0265355_1000247 Ga0265355_10002472 115
383 3300028379 Ga0268266_10034730 Ga0268266_100347303 115
384 3300028379 Ga0268266_10833020 Ga0268266_108330202 115
385 3300028380 Ga0268265_10008523 Ga0268265_100085236 115
386 3300028380 Ga0268265_10053875 Ga0268265_100538753 115
387 3300028380 Ga0268265_10424989 Ga0268265_104249892 115
388 3300028380 Ga0268265_11094164 Ga0268265_110941641 115
389 3300028381 Ga0268264_10838429 Ga0268264_108384292 115
390 3300028381 Ga0268264_11102276 Ga0268264_111022762 115
391 3300028786 Ga0307517_10200381 Ga0307517_102003812 115
392 3300030760 Ga0265762_1024088 Ga0265762_10240882 115
393 3300030763 Ga0265763_1035902 Ga0265763_10359022 115
394 3300031018 Ga0265773_1006515 Ga0265773_10065152 115
395 3300031018 Ga0265773_1022953 Ga0265773_10229532 115
396 3300031090 Ga0265760_10005309 Ga0265760_100053093 115
397 3300031090 Ga0265760_10026231 Ga0265760_100262312 115
398 3300031090 Ga0265760_10034003 Ga0265760_100340033 115
399 3300031235 Ga0265330_10175831 Ga0265330_101758312 115
400 3300031250 Ga0265331_10215290 Ga0265331_102152902 115
401 3300031507 Ga0307509_10004447 Ga0307509_1000444711 115
402 3300031548 Ga0307408_100395406 Ga0307408_1003954062 115
403 3300031548 Ga0307408_101161592 Ga0307408_1011615922 115
404 3300031616 Ga0307508_10469166 Ga0307508_104691662 115
405 3300031711 Ga0265314_10036097 Ga0265314_100360971 115
406 3300031712 Ga0265342_10229190 Ga0265342_102291902 115
407 3300031730 Ga0307516_10167601 Ga0307516_101676012 115
408 3300033544 Ga0316215_1009276 Ga0316215_10092762 115
409 3300033545 Ga0316214_1015175 Ga0316214_10151752 115
410 3300033546 Ga0316213_1002203 Ga0316213_10022032 115
411 3300033547 Ga0316212_1010904 Ga0316212_10109042 115
412 3300035113 Ga0373936_0449115 Ga0373936_0449115_70_417 115
413 3300035119 Ga0373956_0467300 Ga0373956_0467300_204_551 115
414 3300036401 Ga0373937_0076075 Ga0373937_0076075_1753_2100 115
415 3300037068 Ga0373925_0615709 Ga0373925_0615709_489_836 115
416 3300037312 Ga0395899_0239709 Ga0395899_0239709_876_1223 115
417 3300037312 Ga0395899_0272635 Ga0395899_0272635_643_990 115
418 3300037418 Ga0395900_0079562 Ga0395900_0079562_2996_3343 115
419 3300037418 Ga0395900_0218868 Ga0395900_0218868_205_552 115
420 3300037418 Ga0395900_0351838 Ga0395900_0351838_522_869 115
421 3300037418 Ga0395900_0478379 Ga0395900_0478379_831_1178 115
422 3300037418 Ga0395900_0530271 Ga0395900_0530271_128_475 115
423 3300037466 Ga0395898_0024501 Ga0395898_0024501_741_1088 115
424 3300037466 Ga0395898_0059019 Ga0395898_0059019_955_1302 115
425 3300037466 Ga0395898_0123525 Ga0395898_0123525_488_835 115
426 3300037466 Ga0395898_0284458 Ga0395898_0284458_629_976 115
427 3300037466 Ga0395898_1019444 Ga0395898_1019444_111_458 115
428 3300037471 Ga0395905_0037832 Ga0395905_0037832_523_870 115
429 3300037471 Ga0395905_1314473 Ga0395905_1314473_224_571 115
430 3300037471 Ga0395905_1445528 Ga0395905_1445528_108_455 115
431 3300037471 Ga0395905_1855045 Ga0395905_1855045_96_443 115
432 3300038443 Ga0395901_0000023 Ga0395901_0000023_4374_4721 115
433 3300038443 Ga0395901_0000105 Ga0395901_0000105_113955_114302 115
434 3300038443 Ga0395901_0143056 Ga0395901_0143056_1084_1431 115
435 3300038443 Ga0395901_0199859 Ga0395901_0199859_1062_1409 115
436 3300038443 Ga0395901_0275673 Ga0395901_0275673_468_815 115
437 3300038443 Ga0395901_0649269 Ga0395901_0649269_611_958 115
438 3300038443 Ga0395901_0866070 Ga0395901_0866070_53_400 115
439 3300038443 Ga0395901_0926435 Ga0395901_0926435_17_364 115
440 3300039437 Ga0436365_0781751 Ga0436365_0781751_293_640 115
441 3300039438 Ga0436360_1060060 Ga0436360_1060060_55_402 115
442 3300039447 Ga0436361_0721434 Ga0436361_0721434_6560_6907 115
443 3300039447 Ga0436361_0823803 Ga0436361_0823803_596_943 115
444 3300039447 Ga0436361_0843575 Ga0436361_0843575_74_430 115
445 3300039447 Ga0436361_1039794 Ga0436361_1039794_318_665 115
446 3300039450 Ga0436363_0607979 Ga0436363_0607979_398_745 115
447 3300039450 Ga0436363_1360161 Ga0436363_1360161_659_1006 115
448 3300039450 Ga0436363_1450927 Ga0436363_1450927_1287_1634 115
449 3300039450 Ga0436363_1679434 Ga0436363_1679434_1193_1540 115
450 3300039453 Ga0436362_0641548 Ga0436362_0641548_99_458 115
451 3300039453 Ga0436362_0749208 Ga0436362_0749208_190_537 115
452 3300039453 Ga0436362_1005007 Ga0436362_1005007_518_865 115
453 3300039453 Ga0436362_1044349 Ga0436362_1044349_1116_1463 115
454 3300041406 Ga0439439_0026322 Ga0439439_0026322_1059_1406 115
455 3300041413 Ga0439465_0295558 Ga0439465_0295558_42_389 115
456 3300041999 Ga0439433_0002877 Ga0439433_0002877_948_1295 115
457 3300042002 Ga0439442_043584 Ga0439442_043584_19_366 115
458 3300042005 Ga0439448_0014497 Ga0439448_0014497_1227_1574 115
459 3300042005 Ga0439448_0149723 Ga0439448_0149723_414_761 115
460 3300042005 Ga0439448_0245364 Ga0439448_0245364_264_611 115
461 3300042007 Ga0439449_0010320 Ga0439449_0010320_1341_1688 115
462 3300042007 Ga0439449_0062439 Ga0439449_0062439_873_1220 115
463 3300042008 Ga0439450_000217 Ga0439450_000217_2606_2953 115
464 3300042012 Ga0439455_0005009 Ga0439455_0005009_458_805 115
465 3300042012 Ga0439455_0010315 Ga0439455_0010315_574_921 115
466 3300042115 Ga0450911_003223 Ga0450911_003223_871_1218 115
467 3300042134 Ga0450898_024603 Ga0450898_024603_669_1016 115
468 3300042142 Ga0450905_003261 Ga0450905_003261_1303_1650 115
469 3300042157 Ga0439458_0006674 Ga0439458_0006674_1634_1981 115
470 3300042157 Ga0439458_0053094 Ga0439458_0053094_151_498 115
471 3300042876 Ga0451577_1842415 Ga0451577_1842415_153_500 115
472 3300044656 Ga0466969_0018995 Ga0466969_0018995_763_1110 115
473 3300044656 Ga0466969_0378083 Ga0466969_0378083_98_445 115
474 3300044658 Ga0466972_0173606 Ga0466972_0173606_151_498 115
475 3300044658 Ga0466972_0246013 Ga0466972_0246013_312_659 115
476 3300044672 Ga0466982_0064206 Ga0466982_0064206_1516_1863 115
477 3300044673 Ga0453683_0213246 Ga0453683_0213246_684_1031 115
478 3300044683 Ga0466965_0015140 Ga0466965_0015140_312_659 115
479 3300044683 Ga0466965_0046292 Ga0466965_0046292_1565_1912 115
480 3300044684 Ga0466966_0033747 Ga0466966_0033747_1987_2334 115
481 3300044684 Ga0466966_0070701 Ga0466966_0070701_1368_1715 115
482 3300044684 Ga0466966_0093831 Ga0466966_0093831_767_1114 115
483 3300044684 Ga0466966_0174614 Ga0466966_0174614_567_914 115
484 3300044684 Ga0466966_0259859 Ga0466966_0259859_306_653 115
485 3300044684 Ga0466966_0325281 Ga0466966_0325281_250_597 115
486 3300044693 Ga0466961_0089480 Ga0466961_0089480_438_785 115
487 3300044693 Ga0466961_0260940 Ga0466961_0260940_96_443 115
488 3300044694 Ga0466963_1350092 Ga0466963_1350092_16_363 115
489 3300044706 Ga0466964_0000035 Ga0466964_0000035_10303_10650 115
490 3300044706 Ga0466964_0005016 Ga0466964_0005016_2520_2867 115
491 3300044706 Ga0466964_0005415 Ga0466964_0005415_1853_2200 115
492 3300044706 Ga0466964_0343684 Ga0466964_0343684_337_684 115
493 3300044712 Ga0453684_0724410 Ga0453684_0724410_641_988 115
494 3300044719 Ga0466971_0032184 Ga0466971_0032184_465_812 115
495 3300044719 Ga0466971_0142382 Ga0466971_0142382_192_539 115
496 3300044735 Ga0466968_0012992 Ga0466968_0012992_651_998 115
497 3300044735 Ga0466968_0014843 Ga0466968_0014843_1895_2242 115
498 3300044735 Ga0466968_0041383 Ga0466968_0041383_1034_1381 115
499 3300044765 Ga0466970_0055984 Ga0466970_0055984_339_686 115
500 3300044765 Ga0466970_0081370 Ga0466970_0081370_803_1150 115
501 3300044765 Ga0466970_0117674 Ga0466970_0117674_132_479 115
502 3300044842 Ga0466957_0014638 Ga0466957_0014638_3081_3428 115
503 3300044842 Ga0466957_0151327 Ga0466957_0151327_498_845 115
504 3300044842 Ga0466957_0189773 Ga0466957_0189773_553_900 115
505 3300044901 Ga0466960_0086260 Ga0466960_0086260_515_862 115
506 3300044901 Ga0466960_0312730 Ga0466960_0312730_373_720 115
507 3300044901 Ga0466960_0580726 Ga0466960_0580726_239_586 115
508 3300045049 Ga0466959_0050047 Ga0466959_0050047_1169_1516 115
509 3300045049 Ga0466959_0058440 Ga0466959_0058440_564_911 115
510 3300045049 Ga0466959_0090104 Ga0466959_0090104_876_1223 115
511 3300045049 Ga0466959_0139529 Ga0466959_0139529_405_752 115
512 3300045049 Ga0466959_0556910 Ga0466959_0556910_108_455 115
513 3300045049 Ga0466959_0678362 Ga0466959_0678362_293_640 115
514 3300045976 Ga0466967_0011229 Ga0466967_0011229_1907_2254 115
515 3300045976 Ga0466967_0067035 Ga0466967_0067035_559_906 115
516 3300045976 Ga0466967_0111411 Ga0466967_0111411_354_701 115
517 3300046452 Ga0495617_002089 Ga0495617_002089_2626_2973 115
518 3300046452 Ga0495617_009096 Ga0495617_009096_2476_2823 115
519 3300046454 Ga0495592_0039002 Ga0495592_0039002_2327_2674 115
520 3300046455 Ga0495603_0028018 Ga0495603_0028018_2153_2500 115
521 3300046455 Ga0495603_0067447 Ga0495603_0067447_1262_1633 115
522 3300046457 Ga0495590_0004639 Ga0495590_0004639_517_864 115
523 3300046457 Ga0495590_0014771 Ga0495590_0014771_1737_2084 115
524 3300046457 Ga0495590_0018469 Ga0495590_0018469_1675_2022 115
525 3300046457 Ga0495590_0070217 Ga0495590_0070217_687_1034 115
526 3300046457 Ga0495590_0079035 Ga0495590_0079035_448_795 115
527 3300046457 Ga0495590_0135660 Ga0495590_0135660_33_380 115
528 3300046458 Ga0495591_012212 Ga0495591_012212_2083_2430 115
529 3300046459 Ga0495629_0036558 Ga0495629_0036558_996_1343 115
530 3300046459 Ga0495629_0038996 Ga0495629_0038996_1303_1674 115
531 3300046460 Ga0495638_0003375 Ga0495638_0003375_2374_2721 115
532 3300046460 Ga0495638_0006209 Ga0495638_0006209_8293_8640 115
533 3300046460 Ga0495638_0038693 Ga0495638_0038693_601_948 115
534 3300046460 Ga0495638_0357931 Ga0495638_0357931_211_558 115
535 3300046461 Ga0495641_0061356 Ga0495641_0061356_504_875 115
536 3300046462 Ga0495651_0042549 Ga0495651_0042549_2695_3042 115
537 3300046462 Ga0495651_0090162 Ga0495651_0090162_1694_2065 115
538 3300046462 Ga0495651_0813807 Ga0495651_0813807_18_365 115
539 3300046463 Ga0495653_0000904 Ga0495653_0000904_3757_4128 115
540 3300046463 Ga0495653_0038449 Ga0495653_0038449_1752_2099 115
541 3300046471 Ga0495650_0020333 Ga0495650_0020333_2661_3020 115
542 3300046471 Ga0495650_0042496 Ga0495650_0042496_211_558 115
543 3300046471 Ga0495650_0197099 Ga0495650_0197099_162_509 115
544 3300046472 Ga0495580_0027988 Ga0495580_0027988_2948_3295 115
545 3300046472 Ga0495580_0051213 Ga0495580_0051213_1549_1896 115
546 3300046472 Ga0495580_0252584 Ga0495580_0252584_502_852 115
547 3300046472 Ga0495580_0256771 Ga0495580_0256771_304_651 115
548 3300046472 Ga0495580_0566960 Ga0495580_0566960_326_673 115
549 3300046473 Ga0495582_0022394 Ga0495582_0022394_2136_2507 115
550 3300046474 Ga0495605_0001545 Ga0495605_0001545_10277_10624 115
551 3300046474 Ga0495605_0002454 Ga0495605_0002454_10509_10856 115
552 3300046474 Ga0495605_0017299 Ga0495605_0017299_1140_1487 115
553 3300046474 Ga0495605_0017447 Ga0495605_0017447_2573_2920 115
554 3300046474 Ga0495605_0100104 Ga0495605_0100104_232_579 115
555 3300046474 Ga0495605_0155107 Ga0495605_0155107_207_554 115
556 3300046475 Ga0495639_0076427 Ga0495639_0076427_552_899 115
557 3300046475 Ga0495639_0763616 Ga0495639_0763616_122_469 115
558 3300046476 Ga0495662_0081022 Ga0495662_0081022_442_813 115
559 3300046477 Ga0495664_0023340 Ga0495664_0023340_1959_2330 115
560 3300046477 Ga0495664_0047467 Ga0495664_0047467_1842_2213 115
561 3300046491 Ga0495584_0000480 Ga0495584_0000480_8918_9265 115
562 3300046491 Ga0495584_0004824 Ga0495584_0004824_4247_4594 115
563 3300046491 Ga0495584_0005179 Ga0495584_0005179_2020_2367 115
564 3300046491 Ga0495584_0019301 Ga0495584_0019301_1792_2139 115
565 3300046491 Ga0495584_0020687 Ga0495584_0020687_2324_2671 115
566 3300046492 Ga0495585_0000270 Ga0495585_0000270_1288_1635 115
567 3300046492 Ga0495585_0005492 Ga0495585_0005492_6449_6796 115
568 3300046492 Ga0495585_0015645 Ga0495585_0015645_942_1289 115
569 3300046492 Ga0495585_0020937 Ga0495585_0020937_211_558 115
570 3300046492 Ga0495585_0188565 Ga0495585_0188565_608_955 115
571 3300046499 Ga0495594_0393526 Ga0495594_0393526_389_736 115
572 3300046500 Ga0495596_0000497 Ga0495596_0000497_2562_2909 115
573 3300046500 Ga0495596_0000704 Ga0495596_0000704_3875_4222 115
574 3300046500 Ga0495596_0014856 Ga0495596_0014856_655_1002 115
575 3300046500 Ga0495596_0022061 Ga0495596_0022061_1195_1542 115
576 3300046500 Ga0495596_0035740 Ga0495596_0035740_28_399 115
577 3300046500 Ga0495596_0219659 Ga0495596_0219659_198_545 115
578 3300046501 Ga0495607_0001328 Ga0495607_0001328_18123_18470 115
579 3300046501 Ga0495607_0001369 Ga0495607_0001369_20733_21080 115
580 3300046501 Ga0495607_0058183 Ga0495607_0058183_211_558 115
581 3300046501 Ga0495607_0154780 Ga0495607_0154780_199_546 115
582 3300046506 Ga0495583_0000063 Ga0495583_0000063_17000_17347 115
583 3300046506 Ga0495583_0002987 Ga0495583_0002987_3072_3419 115
584 3300046506 Ga0495583_0015161 Ga0495583_0015161_1787_2134 115
585 3300046506 Ga0495583_0029908 Ga0495583_0029908_1697_2044 115
586 3300046506 Ga0495583_0042111 Ga0495583_0042111_46_393 115
587 3300046506 Ga0495583_0284392 Ga0495583_0284392_176_523 115
588 3300046507 Ga0495606_0000827 Ga0495606_0000827_10835_11182 115
589 3300046507 Ga0495606_0005749 Ga0495606_0005749_8003_8350 115
590 3300046507 Ga0495606_0029616 Ga0495606_0029616_2741_3088 115
591 3300046507 Ga0495606_0043834 Ga0495606_0043834_841_1188 115
592 3300046507 Ga0495606_0044805 Ga0495606_0044805_2085_2432 115
593 3300046507 Ga0495606_0244685 Ga0495606_0244685_85_432 115
594 3300046511 Ga0495608_0028688 Ga0495608_0028688_2919_3266 115
595 3300046511 Ga0495608_0052056 Ga0495608_0052056_448_819 115
596 3300046511 Ga0495608_0679396 Ga0495608_0679396_198_545 115
597 3300046512 Ga0495610_0017926 Ga0495610_0017926_2185_2532 115
598 3300046512 Ga0495610_0028855 Ga0495610_0028855_742_1113 115
599 3300046513 Ga0495616_0000142 Ga0495616_0000142_969_1316 115
600 3300046513 Ga0495616_0000318 Ga0495616_0000318_37520_37867 115
601 3300046513 Ga0495616_0008734 Ga0495616_0008734_5148_5495 115
602 3300046513 Ga0495616_0012698 Ga0495616_0012698_497_844 115
603 3300046513 Ga0495616_0028689 Ga0495616_0028689_2045_2392 115
604 3300046513 Ga0495616_0032586 Ga0495616_0032586_2162_2509 115
605 3300046513 Ga0495616_0035023 Ga0495616_0035023_546_893 115
606 3300046513 Ga0495616_0059207 Ga0495616_0059207_1082_1429 115
607 3300046514 Ga0495618_0021096 Ga0495618_0021096_2161_2532 115
608 3300046514 Ga0495618_0029480 Ga0495618_0029480_2501_2848 115
609 3300046515 Ga0495620_0014187 Ga0495620_0014187_737_1084 115
610 3300046516 Ga0495628_0003133 Ga0495628_0003133_3868_4239 115
611 3300046516 Ga0495628_0004405 Ga0495628_0004405_9127_9474 115
612 3300046516 Ga0495628_0070083 Ga0495628_0070083_2114_2473 115
613 3300046517 Ga0495630_0075708 Ga0495630_0075708_475_846 115
614 3300046517 Ga0495630_1168774 Ga0495630_1168774_190_549 115
615 3300046518 Ga0495631_0007702 Ga0495631_0007702_2793_3140 115
616 3300046518 Ga0495631_0302922 Ga0495631_0302922_206_553 115
617 3300046519 Ga0495632_0016552 Ga0495632_0016552_385_732 115
618 3300046519 Ga0495632_0069459 Ga0495632_0069459_757_1104 115
619 3300046519 Ga0495632_0156819 Ga0495632_0156819_483_830 115
620 3300046520 Ga0495637_0020999 Ga0495637_0020999_569_916 115
621 3300046522 Ga0495643_0034384 Ga0495643_0034384_336_683 115
622 3300046523 Ga0495644_0007935 Ga0495644_0007935_1353_1700 115
623 3300046523 Ga0495644_0111414 Ga0495644_0111414_629_976 115
624 3300046523 Ga0495644_0125908 Ga0495644_0125908_320_667 115
625 3300046524 Ga0495648_0015040 Ga0495648_0015040_4239_4586 115
626 3300046524 Ga0495648_0028873 Ga0495648_0028873_2820_3167 115
627 3300046524 Ga0495648_0095887 Ga0495648_0095887_932_1279 115
628 3300046526 Ga0495666_0003858 Ga0495666_0003858_6679_7050 115
629 3300046526 Ga0495666_0111677 Ga0495666_0111677_291_638 115
630 3300046528 Ga0495642_0000906 Ga0495642_0000906_13352_13699 115
631 3300046528 Ga0495642_0002663 Ga0495642_0002663_1616_1963 115
632 3300046528 Ga0495642_0006132 Ga0495642_0006132_1780_2127 115
633 3300046528 Ga0495642_0128510 Ga0495642_0128510_539_886 115
634 3300046528 Ga0495642_0168322 Ga0495642_0168322_288_635 115
635 3300046528 Ga0495642_0501085 Ga0495642_0501085_107_454 115
636 3300046529 Ga0495652_0013991 Ga0495652_0013991_6378_6725 115
637 3300046529 Ga0495652_0029479 Ga0495652_0029479_3988_4335 115
638 3300046529 Ga0495652_0039467 Ga0495652_0039467_634_1005 115
639 3300046530 Ga0495654_0015394 Ga0495654_0015394_532_879 115
640 3300046530 Ga0495654_0089845 Ga0495654_0089845_546_893 115
641 3300046531 Ga0495665_0039180 Ga0495665_0039180_479_850 115
642 3300046531 Ga0495665_0086267 Ga0495665_0086267_823_1194 115
643 3300046533 Ga0495640_0126729 Ga0495640_0126729_722_1093 115
644 3300046533 Ga0495640_0712970 Ga0495640_0712970_222_569 115
645 3300046535 Ga0495586_0050816 Ga0495586_0050816_1520_1891 115
646 3300046536 Ga0495587_0418367 Ga0495587_0418367_306_677 115
647 3300046537 Ga0495598_0013357 Ga0495598_0013357_1178_1525 115
648 3300046538 Ga0495609_0000124 Ga0495609_0000124_623_970 115
649 3300046538 Ga0495609_0000198 Ga0495609_0000198_969_1316 115
650 3300046538 Ga0495609_0002629 Ga0495609_0002629_2325_2672 115
651 3300046538 Ga0495609_0010675 Ga0495609_0010675_3595_3942 115
652 3300046538 Ga0495609_0033648 Ga0495609_0033648_35_406 115
653 3300046539 Ga0495621_0059188 Ga0495621_0059188_797_1144 115
654 3300046542 Ga0495597_0009836 Ga0495597_0009836_2020_2367 115
655 3300046542 Ga0495597_0067599 Ga0495597_0067599_99_446 115
656 3300046542 Ga0495597_0075662 Ga0495597_0075662_1015_1362 115
657 3300046542 Ga0495597_0091925 Ga0495597_0091925_434_781 115
658 3300046543 Ga0495645_0013110 Ga0495645_0013110_2643_2990 115
659 3300046543 Ga0495645_0035731 Ga0495645_0035731_2764_3135 115
660 3300046543 Ga0495645_0153874 Ga0495645_0153874_600_971 115
661 3300046558 Ga0495633_0019298 Ga0495633_0019298_655_1002 115
662 3300046558 Ga0495633_0064479 Ga0495633_0064479_469_816 115
663 3300046558 Ga0495633_0119778 Ga0495633_0119778_364_711 115
664 3300046558 Ga0495633_0507277 Ga0495633_0507277_95_442 115
665 3300046559 Ga0495667_0095248 Ga0495667_0095248_691_1062 115
666 3300046615 Ga0495656_0001645 Ga0495656_0001645_1086_1433 115
667 3300046615 Ga0495656_0004323 Ga0495656_0004323_3638_3985 115
668 3300046615 Ga0495656_0015609 Ga0495656_0015609_2045_2392 115
669 3300046616 Ga0495668_0003297 Ga0495668_0003297_11447_11794 115
670 3300046616 Ga0495668_0033957 Ga0495668_0033957_726_1073 115
671 3300046616 Ga0495668_0046705 Ga0495668_0046705_1584_1931 115
672 3300046642 Ga0495634_0027598 Ga0495634_0027598_1968_2339 115
673 3300046642 Ga0495634_0285512 Ga0495634_0285512_357_704 115
674 3300046648 Ga0495611_0003551 Ga0495611_0003551_5837_6184 115
675 3300046648 Ga0495611_0010156 Ga0495611_0010156_2649_2996 115
676 3300046648 Ga0495611_0013558 Ga0495611_0013558_2095_2442 115
677 3300046648 Ga0495611_0023533 Ga0495611_0023533_548_895 115
678 3300046648 Ga0495611_0025019 Ga0495611_0025019_569_916 115
679 3300046648 Ga0495611_0123644 Ga0495611_0123644_416_763 115
680 3300046660 Ga0495625_0030388 Ga0495625_0030388_90_437 115
681 3300046660 Ga0495625_0036850 Ga0495625_0036850_2466_2813 115
682 3300046660 Ga0495625_0056188 Ga0495625_0056188_2059_2406 115
683 3300046660 Ga0495625_0066568 Ga0495625_0066568_1612_1959 115
684 3300046660 Ga0495625_0667481 Ga0495625_0667481_156_503 115
685 3300046663 Ga0495635_0019487 Ga0495635_0019487_483_854 115
686 3300046663 Ga0495635_0055785 Ga0495635_0055785_1676_2023 115
687 3300046664 Ga0495659_0002026 Ga0495659_0002026_3650_3997 115
688 3300046664 Ga0495659_0144937 Ga0495659_0144937_319_666 115
689 3300046664 Ga0495659_0529885 Ga0495659_0529885_70_417 115
690 3300046665 Ga0495661_0000094 Ga0495661_0000094_107188_107535 115
691 3300046665 Ga0495661_0000552 Ga0495661_0000552_1676_2023 115
692 3300046665 Ga0495661_0001579 Ga0495661_0001579_17797_18144 115
693 3300046665 Ga0495661_0001921 Ga0495661_0001921_11064_11411 115
694 3300046665 Ga0495661_0020567 Ga0495661_0020567_511_858 115
695 3300046665 Ga0495661_0022141 Ga0495661_0022141_3041_3388 115
696 3300046665 Ga0495661_0022865 Ga0495661_0022865_3552_3899 115
697 3300046665 Ga0495661_0035235 Ga0495661_0035235_1077_1424 115
698 3300046665 Ga0495661_0048331 Ga0495661_0048331_1771_2118 115
699 3300046665 Ga0495661_0062275 Ga0495661_0062275_136_483 115
700 3300046674 Ga0495588_0029702 Ga0495588_0029702_1852_2199 115
701 3300046674 Ga0495588_0032067 Ga0495588_0032067_1792_2139 115
702 3300046674 Ga0495588_0036636 Ga0495588_0036636_1712_2062 115
703 3300046674 Ga0495588_0491843 Ga0495588_0491843_274_621 115
704 3300046674 Ga0495588_0717751 Ga0495588_0717751_81_428 115
705 3300046675 Ga0495657_0049897 Ga0495657_0049897_1961_2308 115
706 3300046675 Ga0495657_0154856 Ga0495657_0154856_439_810 115
707 3300046678 Ga0495599_0006702 Ga0495599_0006702_1520_1867 115
708 3300046678 Ga0495599_0012778 Ga0495599_0012778_4490_4837 115
709 3300046678 Ga0495599_0905053 Ga0495599_0905053_26_373 115
710 3300046679 Ga0495623_0002298 Ga0495623_0002298_3601_3948 115
711 3300046679 Ga0495623_0004679 Ga0495623_0004679_2344_2715 115
712 3300046679 Ga0495623_0055673 Ga0495623_0055673_1597_1944 115
713 3300046679 Ga0495623_0279367 Ga0495623_0279367_523_870 115
714 3300046680 Ga0495646_0022385 Ga0495646_0022385_1443_1814 115
715 3300046680 Ga0495646_0045828 Ga0495646_0045828_660_1007 115
716 3300046680 Ga0495646_0445311 Ga0495646_0445311_148_519 115
717 3300046683 Ga0495658_0039145 Ga0495658_0039145_467_814 115
718 3300046684 Ga0495669_0012868 Ga0495669_0012868_933_1280 115
719 3300046684 Ga0495669_0019560 Ga0495669_0019560_2366_2713 115
720 3300046689 Ga0495613_0201083 Ga0495613_0201083_344_715 115
721 3300046690 Ga0495624_0018634 Ga0495624_0018634_458_805 115
722 3300046690 Ga0495624_0023699 Ga0495624_0023699_1981_2352 115
723 3300046690 Ga0495624_0046656 Ga0495624_0046656_531_878 115
724 3300046690 Ga0495624_0177172 Ga0495624_0177172_795_1166 115
725 3300046691 Ga0495670_0001628 Ga0495670_0001628_9456_9803 115
726 3300046691 Ga0495670_0002782 Ga0495670_0002782_2287_2634 115
727 3300046691 Ga0495670_0063357 Ga0495670_0063357_705_1052 115
728 3300046691 Ga0495670_0373731 Ga0495670_0373731_211_558 115
729 3300046692 Ga0495671_0001063 Ga0495671_0001063_17948_18295 115
730 3300046692 Ga0495671_0001619 Ga0495671_0001619_4061_4408 115
731 3300046692 Ga0495671_0031412 Ga0495671_0031412_2158_2505 115
732 3300046692 Ga0495671_0365027 Ga0495671_0365027_221_568 115
733 3300046694 Ga0495649_0039034 Ga0495649_0039034_249_596 115
734 3300046794 Ga0495589_0000019 Ga0495589_0000019_1860_2207 115
735 3300046794 Ga0495589_0000168 Ga0495589_0000168_831_1178 115
736 3300046794 Ga0495589_0040176 Ga0495589_0040176_211_558 115
737 3300046794 Ga0495589_0206494 Ga0495589_0206494_58_405 115
738 3300046794 Ga0495589_0467725 Ga0495589_0467725_189_536 115
739 3300046809 Ga0495600_0018195 Ga0495600_0018195_485_832 115
740 3300046809 Ga0495600_0050734 Ga0495600_0050734_567_938 115
741 3300046810 Ga0495660_0010031 Ga0495660_0010031_876_1223 115
742 3300046810 Ga0495660_0026837 Ga0495660_0026837_1696_2043 115
743 3300047315 Ga0495581_0231999 Ga0495581_0231999_530_901 115
744 3300047317 Ga0495604_0001624 Ga0495604_0001624_17866_18237 115
745 3300047317 Ga0495604_0021041 Ga0495604_0021041_1659_2006 115
746 3300047317 Ga0495604_0051512 Ga0495604_0051512_511_858 115
747 3300047317 Ga0495604_0129603 Ga0495604_0129603_1167_1514 115
748 3300047317 Ga0495604_0192417 Ga0495604_0192417_468_815 115
749 3300047318 Ga0495636_0000468 Ga0495636_0000468_7679_8026 115
750 3300047318 Ga0495636_0008126 Ga0495636_0008126_2619_2966 115
751 3300047318 Ga0495636_0046138 Ga0495636_0046138_892_1239 115
752 3300047318 Ga0495636_0298789 Ga0495636_0298789_75_422 115
753 3300047319 Ga0495674_0061459 Ga0495674_0061459_2170_2541 115
754 3300047319 Ga0495674_0086568 Ga0495674_0086568_1867_2238 115
755 3300047319 Ga0495674_1100601 Ga0495674_1100601_55_402 115
756 3300047320 Ga0495672_0002278 Ga0495672_0002278_13791_14138 115
757 3300047320 Ga0495672_0091244 Ga0495672_0091244_520_867 115
758 3300047320 Ga0495672_0342135 Ga0495672_0342135_34_381 115
759 3300047321 Ga0495676_0015951 Ga0495676_0015951_4326_4697 115
760 3300047321 Ga0495676_0021020 Ga0495676_0021020_584_931 115
761 3300047322 Ga0495680_0078210 Ga0495680_0078210_467_838 115
762 3300047323 Ga0495683_0000433 Ga0495683_0000433_5148_5495 115
763 3300047323 Ga0495683_0020851 Ga0495683_0020851_2306_2677 115
764 3300047323 Ga0495683_0022417 Ga0495683_0022417_1193_1540 115
765 3300047323 Ga0495683_0194430 Ga0495683_0194430_442_789 115
766 3300047323 Ga0495683_0246107 Ga0495683_0246107_268_615 115
767 3300047323 Ga0495683_0308931 Ga0495683_0308931_120_467 115
768 3300047443 Ga0495687_000132 Ga0495687_000132_112479_112826 115
769 3300047443 Ga0495687_000313 Ga0495687_000313_61271_61618 115
770 3300047443 Ga0495687_001190 Ga0495687_001190_15131_15478 115
771 3300047443 Ga0495687_002442 Ga0495687_002442_4556_4903 115
772 3300047443 Ga0495687_002529 Ga0495687_002529_6159_6506 115
773 3300047443 Ga0495687_023200 Ga0495687_023200_586_957 115
774 3300047443 Ga0495687_065366 Ga0495687_065366_991_1338 115
775 3300047443 Ga0495687_091651 Ga0495687_091651_460_807 115
776 3300047444 Ga0495675_0002982 Ga0495675_0002982_1472_1843 115
777 3300047444 Ga0495675_0038294 Ga0495675_0038294_411_758 115
778 3300047444 Ga0495675_0823391 Ga0495675_0823391_89_436 115
779 3300047445 Ga0495677_0000062 Ga0495677_0000062_59050_59397 115
780 3300047445 Ga0495677_0000469 Ga0495677_0000469_1860_2207 115
781 3300047445 Ga0495677_0001719 Ga0495677_0001719_6189_6536 115
782 3300047445 Ga0495677_0013773 Ga0495677_0013773_561_908 115
783 3300047445 Ga0495677_0058567 Ga0495677_0058567_587_934 115
784 3300047446 Ga0495679_006340 Ga0495679_006340_4578_4925 115
785 3300047446 Ga0495679_008563 Ga0495679_008563_865_1212 115
786 3300047447 Ga0495685_010587 Ga0495685_010587_2214_2561 115
787 3300047469 Ga0495673_0004330 Ga0495673_0004330_4807_5154 115
788 3300047469 Ga0495673_0055701 Ga0495673_0055701_515_862 115
789 3300047469 Ga0495673_0119454 Ga0495673_0119454_171_518 115
790 3300047470 Ga0495681_0016121 Ga0495681_0016121_2616_2963 115
791 3300047470 Ga0495681_0113802 Ga0495681_0113802_375_722 115
792 3300047472 Ga0495686_0026896 Ga0495686_0026896_2908_3255 115
793 3300047472 Ga0495686_0287814 Ga0495686_0287814_269_616 115
794 3300047472 Ga0495686_0391165 Ga0495686_0391165_317_664 115
795 3300047673 Ga0495593_0008837 Ga0495593_0008837_3865_4236 115
796 3300048088 Ga0495602_0004438 Ga0495602_0004438_9126_9497 115
797 3300048088 Ga0495602_0012465 Ga0495602_0012465_3975_4322 115
798 3300048088 Ga0495602_0075575 Ga0495602_0075575_854_1201 115
799 3300048088 Ga0495602_0093324 Ga0495602_0093324_1659_2006 115
800 3300048088 Ga0495602_0122130 Ga0495602_0122130_273_644 115
801 3300048088 Ga0495602_0203194 Ga0495602_0203194_670_1017 115
802 3300048088 Ga0495602_0858199 Ga0495602_0858199_163_510 115
803 3300048089 Ga0495614_0024521 Ga0495614_0024521_527_898 115
804 3300048090 Ga0495615_0007722 Ga0495615_0007722_1624_1971 115
805 3300048090 Ga0495615_0243950 Ga0495615_0243950_123_470 115
806 3300048091 Ga0495626_0000376 Ga0495626_0000376_23552_23899 115
807 3300048091 Ga0495626_0004004 Ga0495626_0004004_6196_6543 115
808 3300048091 Ga0495626_0004364 Ga0495626_0004364_1731_2078 115
809 3300048091 Ga0495626_0019959 Ga0495626_0019959_2483_2830 115
810 3300048091 Ga0495626_0071066 Ga0495626_0071066_334_681 115
811 3300048903 Ga0496100_0052778 Ga0496100_0052778_1792_2139 115
812 3300048903 Ga0496100_0465463 Ga0496100_0465463_64_411 115
813 3300048903 Ga0496100_0720310 Ga0496100_0720310_196_567 115
814 3300048903 Ga0496100_0843311 Ga0496100_0843311_322_669 115
815 3300048904 Ga0496101_0055040 Ga0496101_0055040_559_906 115
816 3300048904 Ga0496101_0056586 Ga0496101_0056586_1809_2180 115
817 3300048904 Ga0496101_0338492 Ga0496101_0338492_609_980 115
818 3300048905 Ga0496102_0126999 Ga0496102_0126999_339_686 115
819 3300048905 Ga0496102_0458767 Ga0496102_0458767_638_985 115
820 3300048906 Ga0496103_0030793 Ga0496103_0030793_577_924 115
821 3300048906 Ga0496103_0154570 Ga0496103_0154570_282_629 115
822 3300048906 Ga0496103_0821650 Ga0496103_0821650_167_514 115
823 3300048907 Ga0496104_0034826 Ga0496104_0034826_2848_3195 115
824 3300048907 Ga0496104_0110040 Ga0496104_0110040_623_970 115
825 3300048907 Ga0496104_0630228 Ga0496104_0630228_604_951 115
826 3300048908 Ga0496105_0016422 Ga0496105_0016422_2665_3012 115
827 3300048908 Ga0496105_0082069 Ga0496105_0082069_560_907 115
828 3300048908 Ga0496105_0132118 Ga0496105_0132118_556_903 115
829 3300048908 Ga0496105_0214227 Ga0496105_0214227_588_935 115
830 3300048908 Ga0496105_0973034 Ga0496105_0973034_12_371 115
831 3300048909 Ga0496106_0008060 Ga0496106_0008060_610_957 115
832 3300048909 Ga0496106_0030441 Ga0496106_0030441_1709_2056 115
833 3300048910 Ga0496107_0047701 Ga0496107_0047701_1376_1723 115
834 3300048910 Ga0496107_0049393 Ga0496107_0049393_1792_2139 115
835 3300048910 Ga0496107_0406728 Ga0496107_0406728_105_452 115
836 3300048911 Ga0496108_0193368 Ga0496108_0193368_801_1148 115
837 3300048911 Ga0496108_0340416 Ga0496108_0340416_733_1080 115
838 3300048912 Ga0496109_0102971 Ga0496109_0102971_1792_2139 115
839 3300048913 Ga0496110_0051889 Ga0496110_0051889_540_887 115
840 3300048913 Ga0496110_0074102 Ga0496110_0074102_1719_2066 115
841 3300048913 Ga0496110_0166659 Ga0496110_0166659_1084_1431 115
842 3300048913 Ga0496110_0247473 Ga0496110_0247473_699_1046 115
843 3300048913 Ga0496110_1005981 Ga0496110_1005981_42_389 115
844 3300048914 Ga0496111_0038362 Ga0496111_0038362_486_833 115
845 3300048914 Ga0496111_0214351 Ga0496111_0214351_732_1079 115
846 3300048914 Ga0496111_0218308 Ga0496111_0218308_912_1259 115
847 3300048914 Ga0496111_0999124 Ga0496111_0999124_188_535 115
848 3300048915 Ga0496112_0103867 Ga0496112_0103867_1914_2261 115
849 3300048915 Ga0496112_0265873 Ga0496112_0265873_706_1053 115
850 3300048915 Ga0496112_0433379 Ga0496112_0433379_536_883 115
851 3300048915 Ga0496112_0734001 Ga0496112_0734001_171_518 115
852 3300048916 Ga0496113_0071565 Ga0496113_0071565_507_854 115
853 3300048916 Ga0496113_0120066 Ga0496113_0120066_1538_1885 115
854 3300048916 Ga0496113_0215747 Ga0496113_0215747_572_919 115
855 3300048916 Ga0496113_0394215 Ga0496113_0394215_248_595 115
856 3300048917 Ga0496114_0122539 Ga0496114_0122539_211_558 115
857 3300048917 Ga0496114_0169462 Ga0496114_0169462_1438_1785 115
858 3300048917 Ga0496114_0416344 Ga0496114_0416344_282_629 115
859 3300048917 Ga0496114_0473585 Ga0496114_0473585_288_635 115
860 3300048918 Ga0496115_0048461 Ga0496115_0048461_1707_2054 115
861 3300048918 Ga0496115_0077631 Ga0496115_0077631_1774_2121 115
862 3300048918 Ga0496115_0131288 Ga0496115_0131288_644_991 115
863 3300048918 Ga0496115_0528245 Ga0496115_0528245_481_828 115
864 3300048919 Ga0496116_0062898 Ga0496116_0062898_1673_2020 115
865 3300048919 Ga0496116_0157678 Ga0496116_0157678_445_816 115
866 3300048920 Ga0496117_0054340 Ga0496117_0054340_741_1088 115
867 3300048920 Ga0496117_0055484 Ga0496117_0055484_1821_2192 115
868 3300048920 Ga0496117_0093436 Ga0496117_0093436_1537_1896 115
869 3300048920 Ga0496117_0230373 Ga0496117_0230373_551_922 115
870 3300048921 Ga0496118_0037829 Ga0496118_0037829_2917_3288 115
871 3300048921 Ga0496118_0048253 Ga0496118_0048253_517_864 115
872 3300048922 Ga0496119_0047105 Ga0496119_0047105_1759_2106 115
873 3300048923 Ga0496120_0074997 Ga0496120_0074997_130_501 115
874 3300048924 Ga0496121_0002981 Ga0496121_0002981_1643_2014 115
875 3300048924 Ga0496121_0041344 Ga0496121_0041344_2304_2675 115
876 3300048924 Ga0496121_0064085 Ga0496121_0064085_860_1207 115
877 3300048924 Ga0496121_0069997 Ga0496121_0069997_773_1144 115
878 3300048925 Ga0496122_0044840 Ga0496122_0044840_519_866 115
879 3300048926 Ga0496123_0102400 Ga0496123_0102400_226_573 115
880 3300048927 Ga0496124_0048622 Ga0496124_0048622_1623_1970 115
881 3300048928 Ga0496125_0104160 Ga0496125_0104160_1253_1600 115
882 3300048929 Ga0496126_0004806 Ga0496126_0004806_868_1239 115
883 3300048929 Ga0496126_0075322 Ga0496126_0075322_1937_2284 115
884 3300048929 Ga0496126_0285849 Ga0496126_0285849_720_1091 115
885 3300048929 Ga0496126_0399193 Ga0496126_0399193_93_440 115
886 3300048929 Ga0496126_0906114 Ga0496126_0906114_214_585 115
887 3300049459 Ga0495678_006049 Ga0495678_006049_4388_4735 115
888 3300049459 Ga0495678_013689 Ga0495678_013689_804_1151 115
889 3300049459 Ga0495678_014134 Ga0495678_014134_1015_1362 115
890 3300049459 Ga0495678_016841 Ga0495678_016841_2486_2833 115
891 3300049459 Ga0495678_035409 Ga0495678_035409_732_1079 115
892 3300049460 Ga0495682_0002880 Ga0495682_0002880_7107_7454 115
893 3300049460 Ga0495682_0089062 Ga0495682_0089062_605_952 115
894 3300049460 Ga0495682_0091089 Ga0495682_0091089_47_394 115
895 3300049460 Ga0495682_0238523 Ga0495682_0238523_164_511 115
896 3300049571 Ga0501034_0070007 Ga0501034_0070007_2399_2746 115
897 3300049571 Ga0501034_0596046 Ga0501034_0596046_467_814 115
898 3300049571 Ga0501034_1472533 Ga0501034_1472533_50_397 115
899 3300049572 Ga0501036_0059691 Ga0501036_0059691_1211_1558 115
900 3300049574 Ga0501038_0246178 Ga0501038_0246178_1045_1392 115
901 3300049583 Ga0501067_0108649 Ga0501067_0108649_1124_1471 115
902 3300049584 Ga0501068_0042701 Ga0501068_0042701_1851_2198 115
903 3300049585 Ga0501069_0025746 Ga0501069_0025746_1828_2175 115
904 3300049586 Ga0501070_0301025 Ga0501070_0301025_446_793 115
905 3300049587 Ga0501071_0407525 Ga0501071_0407525_130_477 115
906 3300049588 Ga0501072_0134330 Ga0501072_0134330_1487_1834 115
907 3300049589 Ga0501073_0043805 Ga0501073_0043805_1913_2260 115
908 3300049589 Ga0501073_0337674 Ga0501073_0337674_51_398 115
909 3300049590 Ga0501074_0045009 Ga0501074_0045009_2194_2541 115
910 3300049593 Ga0501077_0203562 Ga0501077_0203562_332_679 115
911 3300049741 Ga0501079_0062029 Ga0501079_0062029_1984_2331 115
912 3300049742 Ga0501080_0090643 Ga0501080_0090643_1930_2277 115
913 3300049743 Ga0501081_0379398 Ga0501081_0379398_461_808 115
914 3300049744 Ga0501083_0053773 Ga0501083_0053773_671_1018 115
915 3300050496 nmdc:mga07m45_125479_c1 nmdc:mga07m45_125479_c1_721_1068 115
916 3300050509 nmdc:mga0qj67_3522_c1 nmdc:mga0qj67_3522_c1_4348_4695 115
917 3300050512 nmdc:mga0n895_878377_c1 nmdc:mga0n895_878377_c1_500_847 115
918 3300053077 Ga0495601_0009084 Ga0495601_0009084_1863_2210 115
919 3300053083 Ga0495655_0017319 Ga0495655_0017319_468_815 115
920 3300053086 Ga0500578_0082049 Ga0500578_0082049_1083_1430 115
921 3300053088 Ga0500644_0157612 Ga0500644_0157612_409_756 115
922 3300053092 Ga0500583_0073287 Ga0500583_0073287_777_1124 115
923 3300053103 Ga0500555_070560 Ga0500555_070560_152_499 115
924 3300053117 Ga0500593_013458 Ga0500593_013458_2531_2878 115
925 3300053127 Ga0500623_276708 Ga0500623_276708_171_518 115
926 3300053134 Ga0500658_0196046 Ga0500658_0196046_425_772 115
927 3300053140 Ga0500573_0066218 Ga0500573_0066218_1118_1465 115
928 3300053141 Ga0500574_000311 Ga0500574_000311_3732_4079 115
929 3300053142 Ga0500577_0072013 Ga0500577_0072013_923_1270 115
930 3300053149 Ga0500600_0181090 Ga0500600_0181090_528_875 115
931 3300053151 Ga0500604_0147593 Ga0500604_0147593_66_413 115
932 3300053153 Ga0500616_0120499 Ga0500616_0120499_452_823 115
933 3300053154 Ga0500619_008007 Ga0500619_008007_493_840 115
934 3300053160 Ga0500633_0168239 Ga0500633_0168239_320_667 115
935 3300053735 Ga0500596_049249 Ga0500596_049249_151_498 115
936 3300054114 Ga0501084_0075728 Ga0501084_0075728_600_947 115
937 3300060353 Ga0501082_0089660 Ga0501082_0089660_1732_2079 115
938 3300061719 Ga0466962_0042455 Ga0466962_0042455_435_782 115
939 3300061719 Ga0466962_0102881 Ga0466962_0102881_672_1019 115
940 3300061734 Ga0530510_0035482 Ga0530510_0035482_1180_1527 115
941 iso_pu_bacteria 2928108538 2928110696 115
942 iso_pu_bacteria 2928135762 2928140212 115

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05717

TnpB_IS66

IS66 Orf2 like protein

8

106

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4buj-assembly2.cif.gz_H crystal structure of the s. cerevisiae ski2-3-8 complex 0.7526 44 75
4rzk-assembly1.cif.gz_B crystal structure of sulfolobus solfataricus hsp20.1 acd 0.7425 43 72
7aht-assembly1.cif.gz_A structure of the n-domain of the k+/h+ antiporter subunit khtt at ph 7.5 0.7396 45 70
4buj-assembly1.cif.gz_D crystal structure of the s. cerevisiae ski2-3-8 complex 0.7376 44 75
1zyk-assembly2.cif.gz_B anthranilate phosphoribosyltransferase in complex with prpp, anthranilate and magnesium 0.7359 42 70
ID Description Score Start End Superfamily
af_Q86KI1_749_872_2.60.40.1230 Mainly Beta;Sandwich;Immunoglobulin-like;Gamma-adaptin ear (GAE) domain 0.9046 53 71 2.60.40.1230
af_K7LBL5_48_252_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8077 42 73 2.130.10.10
af_U4PRP0_4_217_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.8031 45 73 1.20.140.150
af_U4PRP0_9_201_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.8031 45 73 1.20.140.150
1mdcA00 Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain 0.7621 43 72 2.40.128.20
ID Description Score Start End GO Terms
AF-A0A442SJG8-F1-model_v4 IS66 family insertion sequence element accessory protein TnpB (Transposase) 0.9564 2 97
AF-A0A318Q4A7-F1-model_v4 Transposase 0.9556 1 72
AF-A0A826MPA9-F1-model_v4 deleted 0.9532 1 96
AF-A0A828FAU1-F1-model_v4 deleted 0.9486 1 102
AF-A0A844W933-F1-model_v4 deleted 0.9484 1 72

Feature Viewer

pLDDT pTM Quality
81.09 0.74 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map