F486313
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 940 | 427 | 1880 | 163 |
Family's Representative Sequence
| Representative Sequence | 3300031616|Ga0307508_10572961|Ga0307508_105729611 |
| Length | 187 |
| Sequence | MADAQPVPCLVEIHDDVDVMSGSMNALPNIPTDQQLIDFVIRETRLIDQHRFEEWLELFADDGYYWMPLEWGQTDPRLTTSLMYEDKLLLKIRVERLKGNRTFSQKPKSRCHHVLQTPQVDSRNNTANEYVTWTPMHYLETRLDQQTLYAAWATHTLAVVDGVLKIKLKRVDIVNCDAAFSNIQLFM |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 2 | 2010549000 | Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes | Metagenome | Endosphere |
| 3 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 4 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 5 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 6 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 7 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 8 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 9 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 10 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 11 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 12 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 18 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 21 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 42 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 49 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 54 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 56 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 57 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 59 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 60 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 61 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 62 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 63 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 64 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 65 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 66 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 67 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 68 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 69 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 71 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 72 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 73 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 74 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 75 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 79 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 80 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 81 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 82 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 84 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 85 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 86 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 87 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 88 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 89 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 90 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 92 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 93 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 94 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 108 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300012492 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 | Metagenome | Rhizosphere |
| 111 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 112 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 120 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 123 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 125 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 126 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 131 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 195 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 196 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 200 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 201 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 202 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 203 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 204 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 205 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 206 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 207 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 208 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 209 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 210 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 211 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 212 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 213 | 3300031889 | Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO | Metagenome | Rhizosphere |
| 214 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 215 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 216 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 217 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 218 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 219 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 220 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 221 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 222 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 223 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 224 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 225 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 226 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 227 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 228 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 229 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 230 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 231 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 232 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 233 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 234 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 235 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 236 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 237 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 238 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 239 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 240 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 241 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 242 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 243 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 244 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 245 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 246 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 247 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 248 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 249 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 250 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 251 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 252 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 253 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 254 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 255 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 256 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 257 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 258 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 259 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 330 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 331 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 332 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 333 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 334 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 335 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 336 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 337 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 338 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 339 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 340 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 341 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 342 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 343 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 344 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 345 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 346 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 347 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 348 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 349 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 350 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 351 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 352 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 353 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 354 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 357 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 358 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 359 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 361 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 362 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 363 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 364 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 366 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 367 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 368 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 369 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 370 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 371 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 372 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 373 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 374 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 375 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 376 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 377 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 378 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 379 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 382 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 383 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 386 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 387 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 388 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 389 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 390 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 391 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 392 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 393 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 394 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 395 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 396 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 397 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 398 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 399 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 400 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 401 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 402 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 403 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 404 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 405 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 406 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 407 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 408 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 409 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 410 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 411 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 412 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 413 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 414 | 2599185240 | Burkholderia sp. NFPP32 | Isolate | Rhizoplane |
| 415 | 2599185355 | Burkholderia sp. NFACC33-1 | Isolate | Rhizoplane |
| 416 | 2675903129 | Burkholderia pyrrocinia NFIX32 | Isolate | Rhizoplane |
| 417 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 418 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 419 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 420 | 2887375801 | Parapusillimonas sp. SGNA-6 | Isolate | Rhizosphere |
| 421 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 422 | 8002392321 | Alcaligenes faecalis Mc250 | Isolate | Rhizosphere |
| 423 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 424 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 425 | 8020945358 | Burkholderia sp. BE17 | Isolate | Rhizosphere |
| 426 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 427 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.3 |
| Metatranscriptomes | 0.11 |
| Isolates | 1.6 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 15.85 |
| Nodule | 0.74 |
| Rhizoplane | 8.19 |
| Rhizosphere | 67.13 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.4 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0307508_10572961 | 3300031616 | Bacteria | 728 |
| 2 | RicEn_C2288 | 2010549000 | Bacteria | 1394 |
| 3 | JGI25406J46586_10007733 | 3300003203 | Bacteria | 4889 |
| 4 | JGI25153J46596_10009937 | 3300003215 | Bacteria | 4355 |
| 5 | rootH1_10062104 | 3300003316 | Bacteria | 1386 |
| 6 | rootH2_10082343 | 3300003320 | Bacteria | 4135 |
| 7 | rootL2_10037120 | 3300003322 | Bacteria | 5597 |
| 8 | rootH1_10258310 | 3300003323 | Bacteria | 1332 |
| 9 | Ga0055527_1000417 | 3300003760 | Bacteria | 17581 |
| 10 | Ga0055535_1001078 | 3300003761 | Bacteria | 16794 |
| 11 | Ga0055542_1001702 | 3300003762 | Bacteria | 9544 |
| 12 | Ga0065704_10040826 | 3300005289 | Bacteria | 1019 |
| 13 | Ga0065715_10157121 | 3300005293 | Bacteria | 1664 |
| 14 | Ga0070683_100254921 | 3300005329 | Bacteria | 1669 |
| 15 | Ga0070690_100172410 | 3300005330 | Bacteria | 1490 |
| 16 | Ga0070670_100005241 | 3300005331 | Bacteria | 10914 |
| 17 | Ga0070670_100082724 | 3300005331 | Bacteria | 2759 |
| 18 | Ga0070670_100949216 | 3300005331 | Bacteria | 781 |
| 19 | Ga0070670_100968008 | 3300005331 | Unclassified | 773 |
| 20 | Ga0068869_100022912 | 3300005334 | Bacteria | 4307 |
| 21 | Ga0068869_100156195 | 3300005334 | Bacteria | 1773 |
| 22 | Ga0068869_100351677 | 3300005334 | Unclassified | 1201 |
| 23 | Ga0068869_100596600 | 3300005334 | Bacteria | 932 |
| 24 | Ga0070666_10190029 | 3300005335 | Bacteria | 1443 |
| 25 | Ga0070666_10472266 | 3300005335 | Bacteria | 907 |
| 26 | Ga0070680_100032614 | 3300005336 | Bacteria | 4193 |
| 27 | Ga0068868_100056725 | 3300005338 | Bacteria | 3093 |
| 28 | Ga0068868_100511069 | 3300005338 | Bacteria | 1053 |
| 29 | Ga0070660_100755196 | 3300005339 | Bacteria | 817 |
| 30 | Ga0070689_100335981 | 3300005340 | Bacteria | 1265 |
| 31 | Ga0070691_10286968 | 3300005341 | Bacteria | 895 |
| 32 | Ga0070668_100237900 | 3300005347 | Bacteria | 1507 |
| 33 | Ga0070675_100635482 | 3300005354 | Bacteria | 970 |
| 34 | Ga0070671_100002026 | 3300005355 | Bacteria | 15597 |
| 35 | Ga0070671_100718138 | 3300005355 | Bacteria | 867 |
| 36 | Ga0070673_100019816 | 3300005364 | Bacteria | 4837 |
| 37 | Ga0070673_100440968 | 3300005364 | Bacteria | 1170 |
| 38 | Ga0070673_100569106 | 3300005364 | Bacteria | 1031 |
| 39 | Ga0070673_100822652 | 3300005364 | Bacteria | 858 |
| 40 | Ga0070688_100334649 | 3300005365 | Bacteria | 1104 |
| 41 | Ga0070659_100219456 | 3300005366 | Bacteria | 1569 |
| 42 | Ga0070659_100421717 | 3300005366 | Bacteria | 1128 |
| 43 | Ga0070667_100187596 | 3300005367 | Bacteria | 1830 |
| 44 | Ga0070667_100348847 | 3300005367 | Bacteria | 1339 |
| 45 | Ga0070709_10331292 | 3300005434 | Unclassified | 1120 |
| 46 | Ga0070709_11065472 | 3300005434 | Bacteria | 645 |
| 47 | Ga0070714_100842963 | 3300005435 | Unclassified | 889 |
| 48 | Ga0070714_101175572 | 3300005435 | Bacteria | 748 |
| 49 | Ga0070713_100224686 | 3300005436 | Bacteria | 1704 |
| 50 | Ga0070710_10157192 | 3300005437 | Bacteria | 1407 |
| 51 | Ga0070710_10250650 | 3300005437 | Bacteria | 1138 |
| 52 | Ga0070710_10309714 | 3300005437 | Bacteria | 1033 |
| 53 | Ga0070711_100067451 | 3300005439 | Bacteria | 2510 |
| 54 | Ga0070711_100188427 | 3300005439 | Bacteria | 1584 |
| 55 | Ga0070711_100772862 | 3300005439 | Bacteria | 813 |
| 56 | Ga0070708_100158225 | 3300005445 | Bacteria | 2110 |
| 57 | Ga0070663_100128284 | 3300005455 | Bacteria | 1923 |
| 58 | Ga0070663_100431573 | 3300005455 | Unclassified | 1083 |
| 59 | Ga0070663_100434055 | 3300005455 | Bacteria | 1080 |
| 60 | Ga0070678_100133624 | 3300005456 | Bacteria | 1975 |
| 61 | Ga0070678_100230648 | 3300005456 | Bacteria | 1543 |
| 62 | Ga0070678_100720836 | 3300005456 | Bacteria | 900 |
| 63 | Ga0070662_100231213 | 3300005457 | Bacteria | 1479 |
| 64 | Ga0070681_10045611 | 3300005458 | Bacteria | 4385 |
| 65 | Ga0070681_10507742 | 3300005458 | Bacteria | 1119 |
| 66 | Ga0070681_11316166 | 3300005458 | Bacteria | 645 |
| 67 | Ga0068867_100354905 | 3300005459 | Bacteria | 1225 |
| 68 | Ga0068867_101171219 | 3300005459 | Bacteria | 705 |
| 69 | Ga0070685_10116171 | 3300005466 | Bacteria | 1656 |
| 70 | Ga0070685_10186206 | 3300005466 | Bacteria | 1340 |
| 71 | Ga0070685_10727194 | 3300005466 | Bacteria | 726 |
| 72 | Ga0070706_100001519 | 3300005467 | Bacteria | 24333 |
| 73 | Ga0070707_100146568 | 3300005468 | Bacteria | 2298 |
| 74 | Ga0070698_100103788 | 3300005471 | Bacteria | 2813 |
| 75 | Ga0070699_100077162 | 3300005518 | Bacteria | 2900 |
| 76 | Ga0070699_100700329 | 3300005518 | Bacteria | 925 |
| 77 | Ga0070697_100761345 | 3300005536 | Bacteria | 856 |
| 78 | Ga0068853_100909078 | 3300005539 | Bacteria | 846 |
| 79 | Ga0068853_101066506 | 3300005539 | Bacteria | 779 |
| 80 | Ga0068853_101084321 | 3300005539 | Bacteria | 772 |
| 81 | Ga0068853_101539578 | 3300005539 | Bacteria | 644 |
| 82 | Ga0070672_100031959 | 3300005543 | Bacteria | 3968 |
| 83 | Ga0070672_100116243 | 3300005543 | Bacteria | 2185 |
| 84 | Ga0070672_100132603 | 3300005543 | Bacteria | 2049 |
| 85 | Ga0070696_100001126 | 3300005546 | Bacteria | 17300 |
| 86 | Ga0070696_100089868 | 3300005546 | Bacteria | 2184 |
| 87 | Ga0070665_100001168 | 3300005548 | Bacteria | 32297 |
| 88 | Ga0070665_100008760 | 3300005548 | Bacteria | 10241 |
| 89 | Ga0070665_100023272 | 3300005548 | Bacteria | 6239 |
| 90 | Ga0070665_100104923 | 3300005548 | Bacteria | 2828 |
| 91 | Ga0070665_100165569 | 3300005548 | Bacteria | 2213 |
| 92 | Ga0070665_100253187 | 3300005548 | Bacteria | 1762 |
| 93 | Ga0070665_100331126 | 3300005548 | Bacteria | 1527 |
| 94 | Ga0070665_100533509 | 3300005548 | Bacteria | 1185 |
| 95 | Ga0070704_100081030 | 3300005549 | Bacteria | 2389 |
| 96 | Ga0070704_100826874 | 3300005549 | Bacteria | 829 |
| 97 | Ga0068855_100144386 | 3300005563 | Bacteria | 2711 |
| 98 | Ga0070664_100733496 | 3300005564 | Bacteria | 922 |
| 99 | Ga0068857_100046837 | 3300005577 | Bacteria | 3838 |
| 100 | Ga0068856_100194292 | 3300005614 | Bacteria | 2043 |
| 101 | Ga0068856_100554000 | 3300005614 | Bacteria | 1171 |
| 102 | Ga0070702_100047519 | 3300005615 | Bacteria | 2438 |
| 103 | Ga0068852_100300256 | 3300005616 | Bacteria | 1554 |
| 104 | Ga0068852_101180518 | 3300005616 | Unclassified | 786 |
| 105 | Ga0068859_100031093 | 3300005617 | Bacteria | 5360 |
| 106 | Ga0068859_100553177 | 3300005617 | Bacteria | 1245 |
| 107 | Ga0068859_100957838 | 3300005617 | Bacteria | 939 |
| 108 | Ga0068859_102026297 | 3300005617 | Bacteria | 635 |
| 109 | Ga0068866_10131614 | 3300005718 | Bacteria | 1423 |
| 110 | Ga0068866_10333242 | 3300005718 | Bacteria | 958 |
| 111 | Ga0068866_10762980 | 3300005718 | Bacteria | 669 |
| 112 | Ga0068861_100318109 | 3300005719 | Bacteria | 1354 |
| 113 | Ga0068861_101225968 | 3300005719 | Bacteria | 726 |
| 114 | Ga0068863_100047665 | 3300005841 | Bacteria | 4064 |
| 115 | Ga0068863_101123701 | 3300005841 | Bacteria | 791 |
| 116 | Ga0068863_101815324 | 3300005841 | Bacteria | 619 |
| 117 | Ga0068858_100009170 | 3300005842 | Bacteria | 9458 |
| 118 | Ga0068858_100030212 | 3300005842 | Bacteria | 5032 |
| 119 | Ga0068858_100106653 | 3300005842 | Bacteria | 2615 |
| 120 | Ga0068858_100358649 | 3300005842 | Bacteria | 1397 |
| 121 | Ga0068860_100000371 | 3300005843 | Bacteria | 59118 |
| 122 | Ga0068860_100429365 | 3300005843 | Bacteria | 1311 |
| 123 | Ga0068860_101261294 | 3300005843 | Bacteria | 760 |
| 124 | Ga0068862_100072305 | 3300005844 | Bacteria | 2979 |
| 125 | Ga0068862_100115909 | 3300005844 | Bacteria | 2356 |
| 126 | Ga0068862_100178233 | 3300005844 | Bacteria | 1906 |
| 127 | Ga0068862_100315474 | 3300005844 | Bacteria | 1442 |
| 128 | Ga0068862_100394225 | 3300005844 | Bacteria | 1294 |
| 129 | Ga0068862_100418134 | 3300005844 | Bacteria | 1257 |
| 130 | Ga0068862_101276107 | 3300005844 | Unclassified | 735 |
| 131 | Ga0068862_101446805 | 3300005844 | Bacteria | 691 |
| 132 | Ga0081455_10024630 | 3300005937 | Bacteria | 5568 |
| 133 | Ga0081455_10274437 | 3300005937 | Bacteria | 1221 |
| 134 | Ga0081538_10087765 | 3300005981 | Bacteria | 1622 |
| 135 | Ga0081539_10002040 | 3300005985 | Bacteria | 30429 |
| 136 | Ga0081539_10053494 | 3300005985 | Bacteria | 2260 |
| 137 | Ga0070717_10073245 | 3300006028 | Bacteria | 2862 |
| 138 | Ga0075365_10077896 | 3300006038 | Bacteria | 2240 |
| 139 | Ga0075365_10204544 | 3300006038 | Bacteria | 1383 |
| 140 | Ga0075365_10272920 | 3300006038 | Bacteria | 1189 |
| 141 | Ga0075365_10290379 | 3300006038 | Bacteria | 1150 |
| 142 | Ga0075365_10537715 | 3300006038 | Bacteria | 826 |
| 143 | Ga0075365_10584898 | 3300006038 | Bacteria | 789 |
| 144 | Ga0075368_10012344 | 3300006042 | Bacteria | 3120 |
| 145 | Ga0075368_10111160 | 3300006042 | Bacteria | 1130 |
| 146 | Ga0075368_10221625 | 3300006042 | Bacteria | 804 |
| 147 | Ga0075368_10301229 | 3300006042 | Bacteria | 692 |
| 148 | Ga0075363_100010922 | 3300006048 | Bacteria | 4333 |
| 149 | Ga0075363_100013697 | 3300006048 | Bacteria | 3942 |
| 150 | Ga0075363_100377422 | 3300006048 | Bacteria | 831 |
| 151 | Ga0075363_100482629 | 3300006048 | Bacteria | 735 |
| 152 | Ga0075363_100653730 | 3300006048 | Bacteria | 633 |
| 153 | Ga0075364_10003559 | 3300006051 | Bacteria | 8869 |
| 154 | Ga0075364_10381333 | 3300006051 | Bacteria | 962 |
| 155 | Ga0075432_10128445 | 3300006058 | Bacteria | 958 |
| 156 | Ga0070715_10085500 | 3300006163 | Bacteria | 1441 |
| 157 | Ga0070715_10109493 | 3300006163 | Bacteria | 1301 |
| 158 | Ga0070716_100055570 | 3300006173 | Bacteria | 2266 |
| 159 | Ga0070716_100141053 | 3300006173 | Bacteria | 1537 |
| 160 | Ga0070716_100218864 | 3300006173 | Bacteria | 1278 |
| 161 | Ga0070716_100602234 | 3300006173 | Bacteria | 827 |
| 162 | Ga0070712_100457231 | 3300006175 | Bacteria | 1064 |
| 163 | Ga0070712_100484306 | 3300006175 | Bacteria | 1035 |
| 164 | Ga0070712_100558073 | 3300006175 | Bacteria | 966 |
| 165 | Ga0075362_10001867 | 3300006177 | Bacteria | 6897 |
| 166 | Ga0075362_10003987 | 3300006177 | Bacteria | 5250 |
| 167 | Ga0075362_10005810 | 3300006177 | Bacteria | 4549 |
| 168 | Ga0075362_10012898 | 3300006177 | Bacteria | 3332 |
| 169 | Ga0075362_10045963 | 3300006177 | Bacteria | 1940 |
| 170 | Ga0075362_10133581 | 3300006177 | Bacteria | 1182 |
| 171 | Ga0075367_10004238 | 3300006178 | Bacteria | 6965 |
| 172 | Ga0075367_10024609 | 3300006178 | Bacteria | 3397 |
| 173 | Ga0075367_10051802 | 3300006178 | Bacteria | 2427 |
| 174 | Ga0075367_10059138 | 3300006178 | Bacteria | 2281 |
| 175 | Ga0075367_10149611 | 3300006178 | Bacteria | 1448 |
| 176 | Ga0075367_10184420 | 3300006178 | Bacteria | 1301 |
| 177 | Ga0075367_10192494 | 3300006178 | Bacteria | 1273 |
| 178 | Ga0075367_10596757 | 3300006178 | Bacteria | 702 |
| 179 | Ga0075367_10810066 | 3300006178 | Bacteria | 597 |
| 180 | Ga0075369_10031610 | 3300006186 | Bacteria | 2236 |
| 181 | Ga0075369_10131079 | 3300006186 | Bacteria | 1139 |
| 182 | Ga0075366_10004721 | 3300006195 | Bacteria | 7338 |
| 183 | Ga0075366_10010783 | 3300006195 | Bacteria | 5139 |
| 184 | Ga0075366_10013639 | 3300006195 | Bacteria | 4632 |
| 185 | Ga0075366_10060089 | 3300006195 | Bacteria | 2258 |
| 186 | Ga0075366_10079235 | 3300006195 | Bacteria | 1960 |
| 187 | Ga0075366_10082715 | 3300006195 | Bacteria | 1918 |
| 188 | Ga0075366_10095409 | 3300006195 | Bacteria | 1783 |
| 189 | Ga0075366_10136270 | 3300006195 | Bacteria | 1483 |
| 190 | Ga0075366_10219425 | 3300006195 | Bacteria | 1158 |
| 191 | Ga0097621_100074080 | 3300006237 | Bacteria | 2819 |
| 192 | Ga0097621_100237354 | 3300006237 | Bacteria | 1593 |
| 193 | Ga0075370_10000711 | 3300006353 | Bacteria | 13157 |
| 194 | Ga0075370_10002157 | 3300006353 | Bacteria | 9010 |
| 195 | Ga0075370_10006505 | 3300006353 | Bacteria | 5883 |
| 196 | Ga0075370_10020638 | 3300006353 | Bacteria | 3604 |
| 197 | Ga0075370_10027738 | 3300006353 | Bacteria | 3144 |
| 198 | Ga0075370_10049171 | 3300006353 | Bacteria | 2390 |
| 199 | Ga0075370_10110607 | 3300006353 | Bacteria | 1596 |
| 200 | Ga0075370_10403291 | 3300006353 | Bacteria | 820 |
| 201 | Ga0068871_100295741 | 3300006358 | Bacteria | 1420 |
| 202 | Ga0075428_100025261 | 3300006844 | Bacteria | 6574 |
| 203 | Ga0075430_100741538 | 3300006846 | Bacteria | 810 |
| 204 | Ga0075431_100004883 | 3300006847 | Bacteria | 13205 |
| 205 | Ga0068865_100092989 | 3300006881 | Bacteria | 2192 |
| 206 | Ga0068865_101027572 | 3300006881 | Bacteria | 723 |
| 207 | Ga0075436_100671810 | 3300006914 | Bacteria | 766 |
| 208 | Ga0097620_100031093 | 3300006931 | Bacteria | 5360 |
| 209 | Ga0097620_100553294 | 3300006931 | Bacteria | 1245 |
| 210 | Ga0097620_100957977 | 3300006931 | Bacteria | 939 |
| 211 | Ga0097620_102026270 | 3300006931 | Bacteria | 635 |
| 212 | Ga0075435_100701492 | 3300007076 | Bacteria | 880 |
| 213 | Ga0099794_10000442 | 3300007265 | Bacteria | 13852 |
| 214 | Ga0099795_10000966 | 3300007788 | Bacteria | 5846 |
| 215 | Ga0105244_10500930 | 3300009036 | Bacteria | 559 |
| 216 | Ga0105250_10018498 | 3300009092 | Bacteria | 2821 |
| 217 | Ga0105240_10006809 | 3300009093 | Bacteria | 16710 |
| 218 | Ga0105240_10026644 | 3300009093 | Bacteria | 7586 |
| 219 | Ga0105240_10043543 | 3300009093 | Bacteria | 5711 |
| 220 | Ga0105240_10118414 | 3300009093 | Bacteria | 3191 |
| 221 | Ga0105240_10270002 | 3300009093 | Bacteria | 1959 |
| 222 | Ga0105240_10391995 | 3300009093 | Bacteria | 1566 |
| 223 | Ga0105240_10414441 | 3300009093 | Bacteria | 1515 |
| 224 | Ga0105240_10471381 | 3300009093 | Bacteria | 1401 |
| 225 | Ga0105240_10652328 | 3300009093 | Unclassified | 1153 |
| 226 | Ga0105245_10048817 | 3300009098 | Bacteria | 3787 |
| 227 | Ga0105245_10188396 | 3300009098 | Bacteria | 1975 |
| 228 | Ga0105245_10332764 | 3300009098 | Bacteria | 1499 |
| 229 | Ga0105247_10055529 | 3300009101 | Bacteria | 2444 |
| 230 | Ga0105247_10559129 | 3300009101 | Bacteria | 842 |
| 231 | Ga0114129_10090122 | 3300009147 | Bacteria | 4251 |
| 232 | Ga0105243_10230554 | 3300009148 | Bacteria | 1643 |
| 233 | Ga0105243_10418523 | 3300009148 | Bacteria | 1249 |
| 234 | Ga0105243_11323712 | 3300009148 | Bacteria | 738 |
| 235 | Ga0105241_10085696 | 3300009174 | Bacteria | 2476 |
| 236 | Ga0105241_10120621 | 3300009174 | Bacteria | 2111 |
| 237 | Ga0105241_10349754 | 3300009174 | Unclassified | 1283 |
| 238 | Ga0105242_10546036 | 3300009176 | Bacteria | 1110 |
| 239 | Ga0105248_10146332 | 3300009177 | Bacteria | 2666 |
| 240 | Ga0105248_10357819 | 3300009177 | Bacteria | 1643 |
| 241 | Ga0105248_10589821 | 3300009177 | Bacteria | 1254 |
| 242 | Ga0105248_11843389 | 3300009177 | Bacteria | 686 |
| 243 | Ga0105237_10091285 | 3300009545 | Bacteria | 3035 |
| 244 | Ga0105237_10157191 | 3300009545 | Bacteria | 2271 |
| 245 | Ga0105237_10169986 | 3300009545 | Bacteria | 2179 |
| 246 | Ga0105237_10191072 | 3300009545 | Bacteria | 2048 |
| 247 | Ga0105237_10262331 | 3300009545 | Bacteria | 1730 |
| 248 | Ga0105237_10623308 | 3300009545 | Bacteria | 1086 |
| 249 | Ga0105237_10767295 | 3300009545 | Bacteria | 971 |
| 250 | Ga0105238_10302473 | 3300009551 | Bacteria | 1583 |
| 251 | Ga0105238_10398409 | 3300009551 | Bacteria | 1369 |
| 252 | Ga0105238_10509903 | 3300009551 | Bacteria | 1204 |
| 253 | Ga0105238_10572997 | 3300009551 | Bacteria | 1135 |
| 254 | Ga0105238_11081248 | 3300009551 | Bacteria | 824 |
| 255 | Ga0105249_10040039 | 3300009553 | Bacteria | 4256 |
| 256 | Ga0105249_10087193 | 3300009553 | Bacteria | 2912 |
| 257 | Ga0105249_10629004 | 3300009553 | Bacteria | 1130 |
| 258 | Ga0105249_10975300 | 3300009553 | Bacteria | 916 |
| 259 | Ga0105249_11130230 | 3300009553 | Bacteria | 854 |
| 260 | Ga0099796_10070719 | 3300010159 | Bacteria | 1259 |
| 261 | Ga0099796_10195595 | 3300010159 | Bacteria | 818 |
| 262 | Ga0105239_10150693 | 3300010375 | Bacteria | 2596 |
| 263 | Ga0105239_10154231 | 3300010375 | Bacteria | 2564 |
| 264 | Ga0105239_10278682 | 3300010375 | Bacteria | 1882 |
| 265 | Ga0105239_10753307 | 3300010375 | Bacteria | 1115 |
| 266 | Ga0105239_11037005 | 3300010375 | Bacteria | 943 |
| 267 | Ga0105239_11841851 | 3300010375 | Bacteria | 701 |
| 268 | Ga0105246_10685185 | 3300011119 | Bacteria | 896 |
| 269 | Ga0157335_1004574 | 3300012492 | Bacteria | 936 |
| 270 | Ga0157347_1022954 | 3300012502 | Bacteria | 741 |
| 271 | Ga0157369_10459770 | 3300013105 | Bacteria | 1318 |
| 272 | Ga0157369_10757423 | 3300013105 | Bacteria | 999 |
| 273 | Ga0157374_10171374 | 3300013296 | Bacteria | 2117 |
| 274 | Ga0157374_10532719 | 3300013296 | Bacteria | 1181 |
| 275 | Ga0157374_10831984 | 3300013296 | Bacteria | 940 |
| 276 | Ga0157378_10217349 | 3300013297 | Bacteria | 1815 |
| 277 | Ga0157378_10321917 | 3300013297 | Bacteria | 1502 |
| 278 | Ga0163162_10022525 | 3300013306 | Bacteria | 6208 |
| 279 | Ga0163162_10845071 | 3300013306 | Bacteria | 1031 |
| 280 | Ga0163162_10883254 | 3300013306 | Bacteria | 1008 |
| 281 | Ga0157375_10134352 | 3300013308 | Bacteria | 2596 |
| 282 | Ga0157375_10407926 | 3300013308 | Bacteria | 1525 |
| 283 | Ga0157375_10596691 | 3300013308 | Bacteria | 1264 |
| 284 | Ga0157375_11325440 | 3300013308 | Unclassified | 847 |
| 285 | Ga0163163_10118326 | 3300014325 | Bacteria | 2682 |
| 286 | Ga0163163_10360541 | 3300014325 | Bacteria | 1510 |
| 287 | Ga0163163_10398266 | 3300014325 | Bacteria | 1435 |
| 288 | Ga0163163_11388170 | 3300014325 | Bacteria | 764 |
| 289 | Ga0157380_10263585 | 3300014326 | Bacteria | 1567 |
| 290 | Ga0157380_11094041 | 3300014326 | Bacteria | 836 |
| 291 | Ga0182008_10135092 | 3300014497 | Bacteria | 1231 |
| 292 | Ga0157379_10161974 | 3300014968 | Bacteria | 2019 |
| 293 | Ga0157379_10266766 | 3300014968 | Bacteria | 1556 |
| 294 | Ga0157379_10314154 | 3300014968 | Unclassified | 1430 |
| 295 | Ga0157379_10344676 | 3300014968 | Bacteria | 1363 |
| 296 | Ga0157379_10396549 | 3300014968 | Bacteria | 1268 |
| 297 | Ga0157379_10606760 | 3300014968 | Bacteria | 1022 |
| 298 | Ga0157376_10458591 | 3300014969 | Bacteria | 1245 |
| 299 | Ga0157376_10472995 | 3300014969 | Bacteria | 1227 |
| 300 | Ga0157376_11843223 | 3300014969 | Bacteria | 641 |
| 301 | Ga0182006_1026974 | 3300015261 | Bacteria | 2348 |
| 302 | Ga0163161_10184373 | 3300017792 | Bacteria | 1602 |
| 303 | Ga0163161_10626849 | 3300017792 | Bacteria | 889 |
| 304 | Ga0213872_10186324 | 3300021361 | Bacteria | 895 |
| 305 | Ga0228598_1000670 | 3300024227 | Bacteria | 7214 |
| 306 | Ga0209672_100015 | 3300025228 | Bacteria | 529352 |
| 307 | Ga0209147_100016 | 3300025229 | Bacteria | 527606 |
| 308 | Ga0209258_100026 | 3300025242 | Bacteria | 527606 |
| 309 | Ga0209148_1001962 | 3300025254 | Bacteria | 8265 |
| 310 | Ga0209759_1003001 | 3300025256 | Bacteria | 6987 |
| 311 | Ga0209455_1000812 | 3300025272 | Bacteria | 17050 |
| 312 | Ga0209758_1000240 | 3300025297 | Bacteria | 114169 |
| 313 | Ga0209758_1005019 | 3300025297 | Bacteria | 10546 |
| 314 | Ga0209758_1077614 | 3300025297 | Bacteria | 1017 |
| 315 | Ga0207697_10075807 | 3300025315 | Bacteria | 1413 |
| 316 | Ga0207656_10495171 | 3300025321 | Bacteria | 620 |
| 317 | Ga0207653_10011428 | 3300025885 | Bacteria | 2771 |
| 318 | Ga0207682_10146749 | 3300025893 | Bacteria | 1062 |
| 319 | Ga0207692_10139078 | 3300025898 | Bacteria | 1380 |
| 320 | Ga0207692_10551702 | 3300025898 | Bacteria | 736 |
| 321 | Ga0207710_10091521 | 3300025900 | Bacteria | 1424 |
| 322 | Ga0207710_10121598 | 3300025900 | Bacteria | 1247 |
| 323 | Ga0207710_10155667 | 3300025900 | Bacteria | 1111 |
| 324 | Ga0207688_10071903 | 3300025901 | Bacteria | 1965 |
| 325 | Ga0207680_10367061 | 3300025903 | Bacteria | 1013 |
| 326 | Ga0207680_10436702 | 3300025903 | Bacteria | 928 |
| 327 | Ga0207647_10137293 | 3300025904 | Bacteria | 1434 |
| 328 | Ga0207685_10208835 | 3300025905 | Bacteria | 922 |
| 329 | Ga0207699_10162592 | 3300025906 | Bacteria | 1487 |
| 330 | Ga0207699_10536609 | 3300025906 | Bacteria | 847 |
| 331 | Ga0207645_10115816 | 3300025907 | Bacteria | 1738 |
| 332 | Ga0207684_10013902 | 3300025910 | Bacteria | 6953 |
| 333 | Ga0207684_10522164 | 3300025910 | Bacteria | 1017 |
| 334 | Ga0207654_10005798 | 3300025911 | Bacteria | 6232 |
| 335 | Ga0207654_10175894 | 3300025911 | Bacteria | 1393 |
| 336 | Ga0207654_10182135 | 3300025911 | Bacteria | 1371 |
| 337 | Ga0207707_10724874 | 3300025912 | Bacteria | 833 |
| 338 | Ga0207695_10002871 | 3300025913 | Bacteria | 25012 |
| 339 | Ga0207695_10111961 | 3300025913 | Bacteria | 2708 |
| 340 | Ga0207695_10197006 | 3300025913 | Bacteria | 1930 |
| 341 | Ga0207695_10378063 | 3300025913 | Bacteria | 1302 |
| 342 | Ga0207695_10491880 | 3300025913 | Bacteria | 1109 |
| 343 | Ga0207695_10571542 | 3300025913 | Unclassified | 1012 |
| 344 | Ga0207695_11285764 | 3300025913 | Bacteria | 612 |
| 345 | Ga0207671_10040030 | 3300025914 | Bacteria | 3470 |
| 346 | Ga0207671_10117291 | 3300025914 | Bacteria | 2032 |
| 347 | Ga0207671_10177589 | 3300025914 | Bacteria | 1656 |
| 348 | Ga0207671_10764028 | 3300025914 | Unclassified | 767 |
| 349 | Ga0207693_10035791 | 3300025915 | Bacteria | 3914 |
| 350 | Ga0207693_10135688 | 3300025915 | Bacteria | 1935 |
| 351 | Ga0207693_10175802 | 3300025915 | Bacteria | 1685 |
| 352 | Ga0207693_10252415 | 3300025915 | Bacteria | 1384 |
| 353 | Ga0207663_10171798 | 3300025916 | Bacteria | 1540 |
| 354 | Ga0207663_10221250 | 3300025916 | Bacteria | 1377 |
| 355 | Ga0207662_10178711 | 3300025918 | Bacteria | 1365 |
| 356 | Ga0207649_10070154 | 3300025920 | Bacteria | 2234 |
| 357 | Ga0207652_10070870 | 3300025921 | Bacteria | 3028 |
| 358 | Ga0207646_10187194 | 3300025922 | Bacteria | 1870 |
| 359 | Ga0207681_10799822 | 3300025923 | Unclassified | 788 |
| 360 | Ga0207694_10518297 | 3300025924 | Bacteria | 999 |
| 361 | Ga0207694_10742309 | 3300025924 | Unclassified | 828 |
| 362 | Ga0207694_10817967 | 3300025924 | Bacteria | 787 |
| 363 | Ga0207650_10273758 | 3300025925 | Bacteria | 1373 |
| 364 | Ga0207650_10860355 | 3300025925 | Unclassified | 769 |
| 365 | Ga0207650_11233842 | 3300025925 | Unclassified | 636 |
| 366 | Ga0207659_10532425 | 3300025926 | Bacteria | 997 |
| 367 | Ga0207687_10011613 | 3300025927 | Bacteria | 5755 |
| 368 | Ga0207687_10150722 | 3300025927 | Bacteria | 1774 |
| 369 | Ga0207687_11503913 | 3300025927 | Bacteria | 578 |
| 370 | Ga0207700_10065555 | 3300025928 | Bacteria | 2772 |
| 371 | Ga0207700_10386812 | 3300025928 | Bacteria | 1224 |
| 372 | Ga0207664_10905942 | 3300025929 | Bacteria | 792 |
| 373 | Ga0207644_10014094 | 3300025931 | Bacteria | 5346 |
| 374 | Ga0207644_11071500 | 3300025931 | Bacteria | 677 |
| 375 | Ga0207706_10034459 | 3300025933 | Bacteria | 4504 |
| 376 | Ga0207706_10102321 | 3300025933 | Bacteria | 2520 |
| 377 | Ga0207706_10262770 | 3300025933 | Bacteria | 1507 |
| 378 | Ga0207709_10258641 | 3300025935 | Bacteria | 1275 |
| 379 | Ga0207670_10130274 | 3300025936 | Bacteria | 1842 |
| 380 | Ga0207670_10542674 | 3300025936 | Bacteria | 949 |
| 381 | Ga0207669_10579214 | 3300025937 | Bacteria | 909 |
| 382 | Ga0207704_10301008 | 3300025938 | Bacteria | 1228 |
| 383 | Ga0207704_10610249 | 3300025938 | Bacteria | 894 |
| 384 | Ga0207665_10334722 | 3300025939 | Bacteria | 1139 |
| 385 | Ga0207665_10476951 | 3300025939 | Bacteria | 961 |
| 386 | Ga0207665_10880545 | 3300025939 | Bacteria | 710 |
| 387 | Ga0207691_10114806 | 3300025940 | Bacteria | 2392 |
| 388 | Ga0207691_10183967 | 3300025940 | Bacteria | 1825 |
| 389 | Ga0207691_10234680 | 3300025940 | Bacteria | 1587 |
| 390 | Ga0207691_10306156 | 3300025940 | Bacteria | 1364 |
| 391 | Ga0207711_10127440 | 3300025941 | Bacteria | 2279 |
| 392 | Ga0207711_10372632 | 3300025941 | Bacteria | 1324 |
| 393 | Ga0207711_10518414 | 3300025941 | Bacteria | 1111 |
| 394 | Ga0207711_10695412 | 3300025941 | Bacteria | 948 |
| 395 | Ga0207689_10044841 | 3300025942 | Bacteria | 3657 |
| 396 | Ga0207689_10071481 | 3300025942 | Bacteria | 2850 |
| 397 | Ga0207689_10172400 | 3300025942 | Bacteria | 1784 |
| 398 | Ga0207661_10416929 | 3300025944 | Bacteria | 1219 |
| 399 | Ga0207661_10732522 | 3300025944 | Bacteria | 910 |
| 400 | Ga0207667_10322990 | 3300025949 | Bacteria | 1576 |
| 401 | Ga0207667_10702318 | 3300025949 | Bacteria | 1014 |
| 402 | Ga0207667_10739936 | 3300025949 | Bacteria | 983 |
| 403 | Ga0207651_10014597 | 3300025960 | Bacteria | 4542 |
| 404 | Ga0207651_10251259 | 3300025960 | Bacteria | 1447 |
| 405 | Ga0207651_10293512 | 3300025960 | Bacteria | 1349 |
| 406 | Ga0207651_10553425 | 3300025960 | Bacteria | 1001 |
| 407 | Ga0207712_10127977 | 3300025961 | Bacteria | 1931 |
| 408 | Ga0207668_10014378 | 3300025972 | Bacteria | 4896 |
| 409 | Ga0207640_10164918 | 3300025981 | Bacteria | 1644 |
| 410 | Ga0207658_10301893 | 3300025986 | Unclassified | 1380 |
| 411 | Ga0207658_10527618 | 3300025986 | Bacteria | 1054 |
| 412 | Ga0207658_10552494 | 3300025986 | Bacteria | 1030 |
| 413 | Ga0207677_10573240 | 3300026023 | Bacteria | 987 |
| 414 | Ga0207703_10000923 | 3300026035 | Bacteria | 28611 |
| 415 | Ga0207703_10057967 | 3300026035 | Bacteria | 3159 |
| 416 | Ga0207703_10409211 | 3300026035 | Bacteria | 1260 |
| 417 | Ga0207703_10435526 | 3300026035 | Bacteria | 1222 |
| 418 | Ga0207639_10040025 | 3300026041 | Bacteria | 3496 |
| 419 | Ga0207639_10354933 | 3300026041 | Bacteria | 1310 |
| 420 | Ga0207639_10751778 | 3300026041 | Bacteria | 906 |
| 421 | Ga0207639_11039247 | 3300026041 | Bacteria | 768 |
| 422 | Ga0207678_10058697 | 3300026067 | Bacteria | 3311 |
| 423 | Ga0207708_10163999 | 3300026075 | Bacteria | 1756 |
| 424 | Ga0207702_10228829 | 3300026078 | Bacteria | 1736 |
| 425 | Ga0207641_10011353 | 3300026088 | Bacteria | 7310 |
| 426 | Ga0207648_10061324 | 3300026089 | Bacteria | 3279 |
| 427 | Ga0207648_10070090 | 3300026089 | Bacteria | 3056 |
| 428 | Ga0207648_10875518 | 3300026089 | Bacteria | 838 |
| 429 | Ga0207648_11272618 | 3300026089 | Bacteria | 691 |
| 430 | Ga0207676_10128952 | 3300026095 | Bacteria | 2147 |
| 431 | Ga0207676_10289901 | 3300026095 | Bacteria | 1490 |
| 432 | Ga0207674_10137422 | 3300026116 | Bacteria | 2405 |
| 433 | Ga0207674_10430759 | 3300026116 | Bacteria | 1275 |
| 434 | Ga0207674_10719827 | 3300026116 | Bacteria | 963 |
| 435 | Ga0207675_100068646 | 3300026118 | Bacteria | 3312 |
| 436 | Ga0207675_100315204 | 3300026118 | Bacteria | 1526 |
| 437 | Ga0207675_100393820 | 3300026118 | Bacteria | 1364 |
| 438 | Ga0207675_101434422 | 3300026118 | Bacteria | 711 |
| 439 | Ga0207683_10037457 | 3300026121 | Bacteria | 4223 |
| 440 | Ga0207683_10159141 | 3300026121 | Bacteria | 2041 |
| 441 | Ga0207698_10092750 | 3300026142 | Bacteria | 2477 |
| 442 | Ga0207698_10454367 | 3300026142 | Bacteria | 1237 |
| 443 | Ga0207698_10972919 | 3300026142 | Bacteria | 858 |
| 444 | Ga0209179_1002231 | 3300027512 | Bacteria | 2578 |
| 445 | Ga0209813_10234593 | 3300027866 | Bacteria | 692 |
| 446 | Ga0209813_10246645 | 3300027866 | Bacteria | 677 |
| 447 | Ga0207428_10382796 | 3300027907 | Bacteria | 1032 |
| 448 | Ga0268266_10004725 | 3300028379 | Bacteria | 12957 |
| 449 | Ga0268266_10005936 | 3300028379 | Bacteria | 11292 |
| 450 | Ga0268266_10134027 | 3300028379 | Bacteria | 2217 |
| 451 | Ga0268266_10214112 | 3300028379 | Bacteria | 1768 |
| 452 | Ga0268265_10041239 | 3300028380 | Bacteria | 3414 |
| 453 | Ga0268265_10150353 | 3300028380 | Bacteria | 1963 |
| 454 | Ga0268265_10175657 | 3300028380 | Bacteria | 1835 |
| 455 | Ga0268265_10352668 | 3300028380 | Bacteria | 1344 |
| 456 | Ga0268265_10596417 | 3300028380 | Unclassified | 1055 |
| 457 | Ga0268264_10000151 | 3300028381 | Bacteria | 158241 |
| 458 | Ga0268264_10265545 | 3300028381 | Bacteria | 1601 |
| 459 | Ga0268264_10351764 | 3300028381 | Bacteria | 1403 |
| 460 | Ga0265334_10026004 | 3300028573 | Bacteria | 2366 |
| 461 | Ga0307517_10000235 | 3300028786 | Bacteria | 93944 |
| 462 | Ga0307517_10144167 | 3300028786 | Bacteria | 1659 |
| 463 | Ga0307515_10000014 | 3300028794 | Bacteria | 562358 |
| 464 | Ga0307515_10000424 | 3300028794 | Bacteria | 101910 |
| 465 | Ga0307515_10027689 | 3300028794 | Bacteria | 9672 |
| 466 | Ga0307515_10038046 | 3300028794 | Bacteria | 7712 |
| 467 | Ga0307515_10150180 | 3300028794 | Bacteria | 2440 |
| 468 | Ga0307515_10153597 | 3300028794 | Bacteria | 2391 |
| 469 | Ga0307515_10243825 | 3300028794 | Bacteria | 1562 |
| 470 | Ga0265338_10079204 | 3300028800 | Bacteria | 2766 |
| 471 | Ga0307511_10001160 | 3300030521 | Bacteria | 28060 |
| 472 | Ga0307512_10196542 | 3300030522 | Bacteria | 1101 |
| 473 | Ga0265760_10085776 | 3300031090 | Bacteria | 980 |
| 474 | Ga0265340_10182459 | 3300031247 | Bacteria | 948 |
| 475 | Ga0265316_10784000 | 3300031344 | Bacteria | 669 |
| 476 | Ga0307513_10012664 | 3300031456 | Bacteria | 10389 |
| 477 | Ga0307513_10041680 | 3300031456 | Bacteria | 5064 |
| 478 | Ga0307513_10572658 | 3300031456 | Bacteria | 840 |
| 479 | Ga0307513_10663977 | 3300031456 | Bacteria | 749 |
| 480 | Ga0307509_10000056 | 3300031507 | Bacteria | 157836 |
| 481 | Ga0307509_10017926 | 3300031507 | Bacteria | 8130 |
| 482 | Ga0307509_10035087 | 3300031507 | Bacteria | 5508 |
| 483 | Ga0307408_100745301 | 3300031548 | Bacteria | 884 |
| 484 | Ga0307508_10000003 | 3300031616 | Bacteria | 321602 |
| 485 | Ga0307508_10003404 | 3300031616 | Bacteria | 16091 |
| 486 | Ga0307508_10007698 | 3300031616 | Bacteria | 10014 |
| 487 | Ga0307508_10088121 | 3300031616 | Bacteria | 2687 |
| 488 | Ga0307508_10220855 | 3300031616 | Bacteria | 1495 |
| 489 | Ga0307516_10004419 | 3300031730 | Bacteria | 17372 |
| 490 | Ga0307516_10156207 | 3300031730 | Bacteria | 2036 |
| 491 | Ga0307516_10261844 | 3300031730 | Bacteria | 1419 |
| 492 | Ga0307516_10297417 | 3300031730 | Bacteria | 1291 |
| 493 | Ga0307413_10006806 | 3300031824 | Bacteria | 5254 |
| 494 | Ga0326468_10018756 | 3300031889 | Bacteria | 803 |
| 495 | Ga0307412_11036920 | 3300031911 | Bacteria | 727 |
| 496 | Ga0307409_100335528 | 3300031995 | Bacteria | 1420 |
| 497 | Ga0307414_11214478 | 3300032004 | Bacteria | 698 |
| 498 | Ga0307415_100628539 | 3300032126 | Bacteria | 959 |
| 499 | Ga0307507_10169357 | 3300033179 | Bacteria | 1591 |
| 500 | Ga0307507_10343597 | 3300033179 | Unclassified | 882 |
| 501 | Ga0307510_10000003 | 3300033180 | Bacteria | 756654 |
| 502 | Ga0307510_10002062 | 3300033180 | Bacteria | 22705 |
| 503 | Ga0307510_10038663 | 3300033180 | Bacteria | 5272 |
| 504 | Ga0307510_10059573 | 3300033180 | Bacteria | 3940 |
| 505 | Ga0373930_0041994 | 3300034816 | Bacteria | 977 |
| 506 | Ga0373949_0029168 | 3300035090 | Bacteria | 1306 |
| 507 | Ga0373923_0032315 | 3300035111 | Bacteria | 2114 |
| 508 | Ga0373954_0005967 | 3300035118 | Bacteria | 5300 |
| 509 | Ga0373954_0029469 | 3300035118 | Bacteria | 2527 |
| 510 | Ga0373954_0077649 | 3300035118 | Bacteria | 1584 |
| 511 | Ga0373954_0276955 | 3300035118 | Bacteria | 827 |
| 512 | Ga0373956_0007402 | 3300035119 | Bacteria | 4420 |
| 513 | Ga0373957_0035416 | 3300035120 | Bacteria | 1855 |
| 514 | Ga0373943_0018460 | 3300035170 | Bacteria | 3206 |
| 515 | Ga0373943_0054840 | 3300035170 | Bacteria | 1973 |
| 516 | Ga0373943_0124506 | 3300035170 | Bacteria | 1373 |
| 517 | Ga0373943_0136430 | 3300035170 | Bacteria | 1318 |
| 518 | Ga0373943_0828679 | 3300035170 | Unclassified | 551 |
| 519 | Ga0373955_0022961 | 3300035172 | Bacteria | 3172 |
| 520 | Ga0373942_0120412 | 3300035207 | Bacteria | 820 |
| 521 | Ga0373924_0118299 | 3300035410 | Bacteria | 1149 |
| 522 | Ga0373931_0010516 | 3300035691 | Bacteria | 4448 |
| 523 | Ga0373935_0079563 | 3300035692 | Bacteria | 2128 |
| 524 | Ga0373935_1376275 | 3300035692 | Bacteria | 527 |
| 525 | Ga0373927_0138115 | 3300035695 | Bacteria | 1593 |
| 526 | Ga0373927_0176992 | 3300035695 | Unclassified | 1399 |
| 527 | Ga0373933_0000981 | 3300035724 | Bacteria | 17438 |
| 528 | Ga0373933_0480392 | 3300035724 | Bacteria | 814 |
| 529 | Ga0373947_0239049 | 3300035725 | Bacteria | 1198 |
| 530 | Ga0373947_0565100 | 3300035725 | Bacteria | 775 |
| 531 | Ga0373937_0000294 | 3300036401 | Bacteria | 47485 |
| 532 | Ga0373937_0118994 | 3300036401 | Bacteria | 2461 |
| 533 | Ga0373937_0458255 | 3300036401 | Bacteria | 1211 |
| 534 | Ga0373937_1071635 | 3300036401 | Bacteria | 755 |
| 535 | Ga0373925_0487973 | 3300037068 | Bacteria | 1011 |
| 536 | Ga0395900_0010476 | 3300037418 | Bacteria | 9483 |
| 537 | Ga0395900_0266461 | 3300037418 | Bacteria | 1709 |
| 538 | Ga0395905_0207985 | 3300037471 | Bacteria | 1834 |
| 539 | Ga0395905_0854414 | 3300037471 | Bacteria | 813 |
| 540 | Ga0395901_0585422 | 3300038443 | Bacteria | 1127 |
| 541 | Ga0436365_0258411 | 3300039437 | Bacteria | 993 |
| 542 | Ga0436365_0562314 | 3300039437 | Bacteria | 1003 |
| 543 | Ga0436360_0244199 | 3300039438 | Bacteria | 843 |
| 544 | Ga0436363_0288115 | 3300039450 | Bacteria | 2355 |
| 545 | Ga0436363_0601769 | 3300039450 | Bacteria | 1053 |
| 546 | Ga0436363_1695463 | 3300039450 | Bacteria | 1094 |
| 547 | Ga0439461_0024173 | 3300041410 | Bacteria | 1227 |
| 548 | Ga0439461_0048664 | 3300041410 | Bacteria | 935 |
| 549 | Ga0451797_1010531 | 3300041453 | Bacteria | 606 |
| 550 | Ga0451795_1197467 | 3300041456 | Bacteria | 897 |
| 551 | Ga0451800_0219623 | 3300041459 | Bacteria | 1009 |
| 552 | Ga0451807_0330699 | 3300041486 | Bacteria | 1623 |
| 553 | Ga0439431_0038905 | 3300041997 | Bacteria | 1205 |
| 554 | Ga0439445_0092407 | 3300042004 | Bacteria | 853 |
| 555 | Ga0439432_167931 | 3300042006 | Bacteria | 641 |
| 556 | Ga0450898_023487 | 3300042134 | Bacteria | 1097 |
| 557 | Ga0439446_0064655 | 3300042156 | Bacteria | 1111 |
| 558 | Ga0439459_0052039 | 3300042438 | Bacteria | 902 |
| 559 | Ga0466972_0329827 | 3300044658 | Unclassified | 713 |
| 560 | Ga0466966_0197918 | 3300044684 | Bacteria | 1216 |
| 561 | Ga0466961_0004263 | 3300044693 | Bacteria | 8949 |
| 562 | Ga0466971_0362446 | 3300044719 | Bacteria | 703 |
| 563 | Ga0466959_0012524 | 3300045049 | Bacteria | 6131 |
| 564 | Ga0466959_0071056 | 3300045049 | Bacteria | 2521 |
| 565 | Ga0466959_0116423 | 3300045049 | Bacteria | 1903 |
| 566 | Ga0495592_0105607 | 3300046454 | Bacteria | 2000 |
| 567 | Ga0495603_0057356 | 3300046455 | Bacteria | 2304 |
| 568 | Ga0495603_0149867 | 3300046455 | Bacteria | 1355 |
| 569 | Ga0495603_0206073 | 3300046455 | Bacteria | 1136 |
| 570 | Ga0495603_0338158 | 3300046455 | Bacteria | 864 |
| 571 | Ga0495603_0382481 | 3300046455 | Bacteria | 807 |
| 572 | Ga0495629_0001072 | 3300046459 | Bacteria | 21851 |
| 573 | Ga0495638_0194879 | 3300046460 | Bacteria | 1147 |
| 574 | Ga0495641_0055933 | 3300046461 | Bacteria | 1790 |
| 575 | Ga0495651_0001380 | 3300046462 | Bacteria | 18836 |
| 576 | Ga0495651_0270877 | 3300046462 | Bacteria | 1151 |
| 577 | Ga0495651_0584173 | 3300046462 | Bacteria | 706 |
| 578 | Ga0495653_0000774 | 3300046463 | Bacteria | 24565 |
| 579 | Ga0495650_0049494 | 3300046471 | Bacteria | 1745 |
| 580 | Ga0495580_0000310 | 3300046472 | Bacteria | 39754 |
| 581 | Ga0495580_0005440 | 3300046472 | Bacteria | 10523 |
| 582 | Ga0495580_0181892 | 3300046472 | Bacteria | 1452 |
| 583 | Ga0495580_0398148 | 3300046472 | Unclassified | 929 |
| 584 | Ga0495582_0089667 | 3300046473 | Bacteria | 1714 |
| 585 | Ga0495605_0342048 | 3300046474 | Bacteria | 628 |
| 586 | Ga0495662_0054837 | 3300046476 | Bacteria | 1926 |
| 587 | Ga0495662_0067258 | 3300046476 | Bacteria | 1734 |
| 588 | Ga0495664_0037948 | 3300046477 | Bacteria | 2844 |
| 589 | Ga0495664_0105246 | 3300046477 | Bacteria | 1701 |
| 590 | Ga0495664_0188950 | 3300046477 | Bacteria | 1249 |
| 591 | Ga0495585_0089509 | 3300046492 | Bacteria | 1659 |
| 592 | Ga0495585_0407523 | 3300046492 | Bacteria | 654 |
| 593 | Ga0495594_0349966 | 3300046499 | Bacteria | 841 |
| 594 | Ga0495606_0119103 | 3300046507 | Bacteria | 1582 |
| 595 | Ga0495606_0170831 | 3300046507 | Unclassified | 1261 |
| 596 | Ga0495608_0000148 | 3300046511 | Bacteria | 50904 |
| 597 | Ga0495608_0237573 | 3300046511 | Bacteria | 1139 |
| 598 | Ga0495608_0658578 | 3300046511 | Bacteria | 625 |
| 599 | Ga0495610_0089866 | 3300046512 | Bacteria | 1394 |
| 600 | Ga0495618_0008092 | 3300046514 | Bacteria | 6367 |
| 601 | Ga0495618_0159314 | 3300046514 | Bacteria | 1439 |
| 602 | Ga0495618_0569981 | 3300046514 | Bacteria | 676 |
| 603 | Ga0495620_0065393 | 3300046515 | Bacteria | 1501 |
| 604 | Ga0495620_0079264 | 3300046515 | Bacteria | 1331 |
| 605 | Ga0495628_0003843 | 3300046516 | Bacteria | 13392 |
| 606 | Ga0495628_0125761 | 3300046516 | Bacteria | 1964 |
| 607 | Ga0495628_0600701 | 3300046516 | Bacteria | 786 |
| 608 | Ga0495630_0237991 | 3300046517 | Bacteria | 1391 |
| 609 | Ga0495631_0120517 | 3300046518 | Bacteria | 1128 |
| 610 | Ga0495632_0056594 | 3300046519 | Bacteria | 1917 |
| 611 | Ga0495632_0066436 | 3300046519 | Bacteria | 1740 |
| 612 | Ga0495632_0083260 | 3300046519 | Bacteria | 1524 |
| 613 | Ga0495643_0114100 | 3300046522 | Bacteria | 1371 |
| 614 | Ga0495643_0177050 | 3300046522 | Bacteria | 1039 |
| 615 | Ga0495643_0248259 | 3300046522 | Bacteria | 832 |
| 616 | Ga0495648_0241717 | 3300046524 | Bacteria | 877 |
| 617 | Ga0495652_0003165 | 3300046529 | Bacteria | 16410 |
| 618 | Ga0495652_0228413 | 3300046529 | Bacteria | 1394 |
| 619 | Ga0495652_0697414 | 3300046529 | Bacteria | 683 |
| 620 | Ga0495665_0283066 | 3300046531 | Bacteria | 850 |
| 621 | Ga0495640_0002047 | 3300046533 | Bacteria | 16081 |
| 622 | Ga0495640_0236437 | 3300046533 | Bacteria | 1148 |
| 623 | Ga0495587_0000957 | 3300046536 | Bacteria | 18905 |
| 624 | Ga0495587_0036109 | 3300046536 | Bacteria | 2974 |
| 625 | Ga0495587_0183344 | 3300046536 | Bacteria | 1186 |
| 626 | Ga0495587_0410989 | 3300046536 | Bacteria | 752 |
| 627 | Ga0495598_0002017 | 3300046537 | Bacteria | 4129 |
| 628 | Ga0495609_0077793 | 3300046538 | Bacteria | 1452 |
| 629 | Ga0495609_0174371 | 3300046538 | Bacteria | 907 |
| 630 | Ga0495609_0319410 | 3300046538 | Unclassified | 630 |
| 631 | Ga0495621_0039962 | 3300046539 | Bacteria | 1642 |
| 632 | Ga0495597_0021603 | 3300046542 | Bacteria | 2991 |
| 633 | Ga0495597_0098366 | 3300046542 | Bacteria | 1236 |
| 634 | Ga0495645_0052774 | 3300046543 | Bacteria | 2957 |
| 635 | Ga0495645_0402719 | 3300046543 | Bacteria | 872 |
| 636 | Ga0495645_0430473 | 3300046543 | Bacteria | 836 |
| 637 | Ga0495622_0110759 | 3300046557 | Bacteria | 1257 |
| 638 | Ga0495633_0143606 | 3300046558 | Bacteria | 1103 |
| 639 | Ga0495667_0000352 | 3300046559 | Bacteria | 29153 |
| 640 | Ga0495667_0228736 | 3300046559 | Bacteria | 1186 |
| 641 | Ga0495656_0002096 | 3300046615 | Bacteria | 6586 |
| 642 | Ga0495656_0060290 | 3300046615 | Bacteria | 1653 |
| 643 | Ga0495656_0103070 | 3300046615 | Bacteria | 1322 |
| 644 | Ga0495656_0231680 | 3300046615 | Bacteria | 927 |
| 645 | Ga0495668_0435561 | 3300046616 | Bacteria | 721 |
| 646 | Ga0495668_0526728 | 3300046616 | Bacteria | 652 |
| 647 | Ga0495668_0648802 | 3300046616 | Bacteria | 583 |
| 648 | Ga0495634_0001972 | 3300046642 | Bacteria | 17500 |
| 649 | Ga0495634_0177131 | 3300046642 | Bacteria | 1337 |
| 650 | Ga0495625_0072288 | 3300046660 | Bacteria | 2419 |
| 651 | Ga0495625_0220220 | 3300046660 | Bacteria | 1244 |
| 652 | Ga0495625_0296894 | 3300046660 | Bacteria | 1035 |
| 653 | Ga0495625_0428369 | 3300046660 | Bacteria | 821 |
| 654 | Ga0495625_0564310 | 3300046660 | Bacteria | 688 |
| 655 | Ga0495635_0003599 | 3300046663 | Bacteria | 10731 |
| 656 | Ga0495635_0251607 | 3300046663 | Bacteria | 1191 |
| 657 | Ga0495659_0029624 | 3300046664 | Bacteria | 1901 |
| 658 | Ga0495657_0014161 | 3300046675 | Bacteria | 5860 |
| 659 | Ga0495599_0014458 | 3300046678 | Bacteria | 4888 |
| 660 | Ga0495599_0043222 | 3300046678 | Bacteria | 2827 |
| 661 | Ga0495623_0003091 | 3300046679 | Bacteria | 10975 |
| 662 | Ga0495623_0025285 | 3300046679 | Bacteria | 3824 |
| 663 | Ga0495646_0000221 | 3300046680 | Bacteria | 28238 |
| 664 | Ga0495646_0183669 | 3300046680 | Bacteria | 1146 |
| 665 | Ga0495658_0516258 | 3300046683 | Bacteria | 765 |
| 666 | Ga0495669_0179917 | 3300046684 | Bacteria | 1008 |
| 667 | Ga0495613_0053231 | 3300046689 | Bacteria | 2979 |
| 668 | Ga0495613_0054875 | 3300046689 | Bacteria | 2929 |
| 669 | Ga0495613_0120870 | 3300046689 | Bacteria | 1881 |
| 670 | Ga0495613_0651372 | 3300046689 | Bacteria | 697 |
| 671 | Ga0495624_0524390 | 3300046690 | Bacteria | 708 |
| 672 | Ga0495670_0002945 | 3300046691 | Bacteria | 8396 |
| 673 | Ga0495670_0104633 | 3300046691 | Bacteria | 1461 |
| 674 | Ga0495670_0137835 | 3300046691 | Bacteria | 1274 |
| 675 | Ga0495649_0021854 | 3300046694 | Bacteria | 3584 |
| 676 | Ga0495649_0064443 | 3300046694 | Bacteria | 1968 |
| 677 | Ga0495600_0042849 | 3300046809 | Bacteria | 2951 |
| 678 | Ga0495660_0052421 | 3300046810 | Bacteria | 2216 |
| 679 | Ga0495581_0043039 | 3300047315 | Bacteria | 2613 |
| 680 | Ga0495581_0106993 | 3300047315 | Bacteria | 1626 |
| 681 | Ga0495581_0272631 | 3300047315 | Bacteria | 989 |
| 682 | Ga0495581_0602949 | 3300047315 | Bacteria | 636 |
| 683 | Ga0495604_0000883 | 3300047317 | Bacteria | 24920 |
| 684 | Ga0495604_0083057 | 3300047317 | Bacteria | 2394 |
| 685 | Ga0495604_0738257 | 3300047317 | Bacteria | 623 |
| 686 | Ga0495674_0015688 | 3300047319 | Bacteria | 7072 |
| 687 | Ga0495674_0072233 | 3300047319 | Bacteria | 2976 |
| 688 | Ga0495674_0233774 | 3300047319 | Bacteria | 1516 |
| 689 | Ga0495674_0360495 | 3300047319 | Bacteria | 1179 |
| 690 | Ga0495674_0381509 | 3300047319 | Bacteria | 1140 |
| 691 | Ga0495674_0891833 | 3300047319 | Bacteria | 687 |
| 692 | Ga0495672_0271050 | 3300047320 | Bacteria | 815 |
| 693 | Ga0495676_0122755 | 3300047321 | Bacteria | 1887 |
| 694 | Ga0495676_0150867 | 3300047321 | Bacteria | 1654 |
| 695 | Ga0495676_0483850 | 3300047321 | Bacteria | 814 |
| 696 | Ga0495680_0004008 | 3300047322 | Bacteria | 14219 |
| 697 | Ga0495680_0088225 | 3300047322 | Bacteria | 2331 |
| 698 | Ga0495680_0461106 | 3300047322 | Unclassified | 868 |
| 699 | Ga0495683_0193836 | 3300047323 | Bacteria | 920 |
| 700 | Ga0495687_000787 | 3300047443 | Bacteria | 34084 |
| 701 | Ga0495687_002913 | 3300047443 | Bacteria | 13020 |
| 702 | Ga0495687_014700 | 3300047443 | Bacteria | 4013 |
| 703 | Ga0495675_0003139 | 3300047444 | Bacteria | 9915 |
| 704 | Ga0495675_0107941 | 3300047444 | Bacteria | 1739 |
| 705 | Ga0495684_0047345 | 3300047471 | Bacteria | 3289 |
| 706 | Ga0495686_0349426 | 3300047472 | Bacteria | 804 |
| 707 | Ga0495593_0039275 | 3300047673 | Bacteria | 2552 |
| 708 | Ga0495602_0006391 | 3300048088 | Bacteria | 12362 |
| 709 | Ga0495602_0022093 | 3300048088 | Bacteria | 6234 |
| 710 | Ga0495602_0210177 | 3300048088 | Bacteria | 1478 |
| 711 | Ga0495602_0394890 | 3300048088 | Bacteria | 988 |
| 712 | Ga0495626_0082131 | 3300048091 | Bacteria | 1430 |
| 713 | Ga0496100_0089514 | 3300048903 | Bacteria | 2097 |
| 714 | Ga0496100_0178386 | 3300048903 | Bacteria | 1535 |
| 715 | Ga0496100_0198911 | 3300048903 | Bacteria | 1459 |
| 716 | Ga0496101_0144458 | 3300048904 | Bacteria | 1816 |
| 717 | Ga0496101_0290316 | 3300048904 | Bacteria | 1279 |
| 718 | Ga0496102_0048082 | 3300048905 | Bacteria | 3879 |
| 719 | Ga0496102_0160314 | 3300048905 | Bacteria | 2116 |
| 720 | Ga0496102_0402210 | 3300048905 | Bacteria | 1287 |
| 721 | Ga0496102_0742536 | 3300048905 | Bacteria | 904 |
| 722 | Ga0496103_0133126 | 3300048906 | Bacteria | 1588 |
| 723 | Ga0496103_0137922 | 3300048906 | Bacteria | 1559 |
| 724 | Ga0496103_0194323 | 3300048906 | Bacteria | 1305 |
| 725 | Ga0496104_0000242 | 3300048907 | Bacteria | 48242 |
| 726 | Ga0496104_0045018 | 3300048907 | Bacteria | 4148 |
| 727 | Ga0496104_0339154 | 3300048907 | Bacteria | 1416 |
| 728 | Ga0496104_0414522 | 3300048907 | Bacteria | 1259 |
| 729 | Ga0496104_0546804 | 3300048907 | Bacteria | 1069 |
| 730 | Ga0496105_0126326 | 3300048908 | Bacteria | 2108 |
| 731 | Ga0496105_0343744 | 3300048908 | Bacteria | 1193 |
| 732 | Ga0496105_0596468 | 3300048908 | Bacteria | 858 |
| 733 | Ga0496106_0006609 | 3300048909 | Bacteria | 8584 |
| 734 | Ga0496106_0230040 | 3300048909 | Bacteria | 1480 |
| 735 | Ga0496106_0281423 | 3300048909 | Bacteria | 1333 |
| 736 | Ga0496106_0724440 | 3300048909 | Bacteria | 792 |
| 737 | Ga0496106_1249382 | 3300048909 | Bacteria | 578 |
| 738 | Ga0496107_0055122 | 3300048910 | Bacteria | 2871 |
| 739 | Ga0496107_0080079 | 3300048910 | Bacteria | 2382 |
| 740 | Ga0496107_0131567 | 3300048910 | Bacteria | 1847 |
| 741 | Ga0496108_0009399 | 3300048911 | Bacteria | 7916 |
| 742 | Ga0496108_0017102 | 3300048911 | Bacteria | 5931 |
| 743 | Ga0496108_0148343 | 3300048911 | Bacteria | 2023 |
| 744 | Ga0496108_0175652 | 3300048911 | Bacteria | 1854 |
| 745 | Ga0496108_1135088 | 3300048911 | Bacteria | 663 |
| 746 | Ga0496109_0031556 | 3300048912 | Bacteria | 4755 |
| 747 | Ga0496109_0162388 | 3300048912 | Bacteria | 2093 |
| 748 | Ga0496109_0280888 | 3300048912 | Bacteria | 1569 |
| 749 | Ga0496109_0474755 | 3300048912 | Bacteria | 1181 |
| 750 | Ga0496110_0000700 | 3300048913 | Bacteria | 23141 |
| 751 | Ga0496110_0033398 | 3300048913 | Bacteria | 4451 |
| 752 | Ga0496110_0173488 | 3300048913 | Bacteria | 1957 |
| 753 | Ga0496110_0273977 | 3300048913 | Bacteria | 1536 |
| 754 | Ga0496110_0694557 | 3300048913 | Bacteria | 919 |
| 755 | Ga0496111_0010116 | 3300048914 | Bacteria | 6315 |
| 756 | Ga0496111_0201005 | 3300048914 | Bacteria | 1481 |
| 757 | Ga0496112_0012574 | 3300048915 | Bacteria | 7778 |
| 758 | Ga0496112_0032559 | 3300048915 | Bacteria | 5063 |
| 759 | Ga0496112_0033089 | 3300048915 | Bacteria | 5022 |
| 760 | Ga0496112_0119561 | 3300048915 | Bacteria | 2605 |
| 761 | Ga0496112_0196679 | 3300048915 | Bacteria | 1976 |
| 762 | Ga0496112_0293648 | 3300048915 | Bacteria | 1571 |
| 763 | Ga0496112_0437528 | 3300048915 | Bacteria | 1246 |
| 764 | Ga0496112_0510480 | 3300048915 | Bacteria | 1137 |
| 765 | Ga0496113_0001677 | 3300048916 | Bacteria | 12535 |
| 766 | Ga0496113_0014609 | 3300048916 | Bacteria | 5364 |
| 767 | Ga0496113_0036214 | 3300048916 | Bacteria | 3614 |
| 768 | Ga0496113_0278322 | 3300048916 | Bacteria | 1338 |
| 769 | Ga0496113_0631412 | 3300048916 | Bacteria | 857 |
| 770 | Ga0496114_0006074 | 3300048917 | Bacteria | 9505 |
| 771 | Ga0496114_0063193 | 3300048917 | Bacteria | 3099 |
| 772 | Ga0496114_0246233 | 3300048917 | Bacteria | 1573 |
| 773 | Ga0496114_0785938 | 3300048917 | Unclassified | 830 |
| 774 | Ga0496115_0067900 | 3300048918 | Bacteria | 2885 |
| 775 | Ga0496115_0080528 | 3300048918 | Bacteria | 2651 |
| 776 | Ga0496115_0220123 | 3300048918 | Bacteria | 1567 |
| 777 | Ga0496115_0259445 | 3300048918 | Bacteria | 1429 |
| 778 | Ga0496115_0308475 | 3300048918 | Bacteria | 1296 |
| 779 | Ga0496115_0434819 | 3300048918 | Bacteria | 1062 |
| 780 | Ga0496115_0549334 | 3300048918 | Bacteria | 923 |
| 781 | Ga0496115_0791586 | 3300048918 | Bacteria | 739 |
| 782 | Ga0496115_1167341 | 3300048918 | Unclassified | 580 |
| 783 | Ga0496116_0017044 | 3300048919 | Bacteria | 5658 |
| 784 | Ga0496116_0137758 | 3300048919 | Bacteria | 1379 |
| 785 | Ga0496117_0000316 | 3300048920 | Bacteria | 84475 |
| 786 | Ga0496118_0000003 | 3300048921 | Bacteria | 773148 |
| 787 | Ga0496118_0003186 | 3300048921 | Bacteria | 20962 |
| 788 | Ga0496118_0357855 | 3300048921 | Bacteria | 775 |
| 789 | Ga0496119_0000260 | 3300048922 | Bacteria | 74908 |
| 790 | Ga0496119_0033656 | 3300048922 | Bacteria | 3392 |
| 791 | Ga0496119_0082141 | 3300048922 | Bacteria | 1853 |
| 792 | Ga0496119_0329628 | 3300048922 | Bacteria | 745 |
| 793 | Ga0496119_0365653 | 3300048922 | Bacteria | 695 |
| 794 | Ga0496120_0000061 | 3300048923 | Bacteria | 172817 |
| 795 | Ga0496120_0117345 | 3300048923 | Bacteria | 1381 |
| 796 | Ga0496121_0000353 | 3300048924 | Bacteria | 95678 |
| 797 | Ga0496121_0025392 | 3300048924 | Bacteria | 5622 |
| 798 | Ga0496121_0167912 | 3300048924 | Bacteria | 1597 |
| 799 | Ga0496124_0037821 | 3300048927 | Bacteria | 4194 |
| 800 | Ga0496124_0054870 | 3300048927 | Unclassified | 3370 |
| 801 | Ga0496125_0000205 | 3300048928 | Bacteria | 124391 |
| 802 | Ga0496125_0019023 | 3300048928 | Bacteria | 6498 |
| 803 | Ga0496125_0023500 | 3300048928 | Bacteria | 5688 |
| 804 | Ga0496125_0216477 | 3300048928 | Bacteria | 1238 |
| 805 | Ga0496125_0406331 | 3300048928 | Bacteria | 794 |
| 806 | Ga0496126_0006587 | 3300048929 | Bacteria | 12941 |
| 807 | Ga0496126_0007152 | 3300048929 | Bacteria | 12291 |
| 808 | Ga0496126_0127107 | 3300048929 | Bacteria | 2205 |
| 809 | Ga0496126_0203085 | 3300048929 | Bacteria | 1672 |
| 810 | Ga0496126_0350453 | 3300048929 | Bacteria | 1207 |
| 811 | Ga0496126_0734596 | 3300048929 | Bacteria | 764 |
| 812 | Ga0496126_0777589 | 3300048929 | Bacteria | 737 |
| 813 | Ga0495678_116526 | 3300049459 | Bacteria | 903 |
| 814 | Ga0495682_0086726 | 3300049460 | Bacteria | 1125 |
| 815 | Ga0501033_0045646 | 3300049570 | Bacteria | 3260 |
| 816 | Ga0501036_0207748 | 3300049572 | Bacteria | 1646 |
| 817 | Ga0501037_0800846 | 3300049573 | Bacteria | 622 |
| 818 | Ga0501038_0036894 | 3300049574 | Bacteria | 4289 |
| 819 | Ga0501039_0054512 | 3300049575 | Bacteria | 3095 |
| 820 | Ga0501047_0237558 | 3300049581 | Bacteria | 1674 |
| 821 | Ga0501067_0563776 | 3300049583 | Bacteria | 638 |
| 822 | Ga0501069_0201607 | 3300049585 | Bacteria | 1153 |
| 823 | Ga0501044_0004315 | 3300049823 | Bacteria | 15940 |
| 824 | nmdc:mga03683_125171_c1 | 3300050489 | Bacteria | 1146 |
| 825 | nmdc:mga03683_190892_c1 | 3300050489 | Bacteria | 937 |
| 826 | nmdc:mga03683_276580_c1 | 3300050489 | Bacteria | 784 |
| 827 | nmdc:mga03683_388_c2 | 3300050489 | Bacteria | 10737 |
| 828 | nmdc:mga03683_41718_c1 | 3300050489 | Bacteria | 1886 |
| 829 | nmdc:mga03n38_218922_c1 | 3300050490 | Bacteria | 993 |
| 830 | nmdc:mga03n38_539_c1 | 3300050490 | Bacteria | 9619 |
| 831 | nmdc:mga03n38_828_c1 | 3300050490 | Bacteria | 8271 |
| 832 | nmdc:mga03n38_99315_c1 | 3300050490 | Bacteria | 1401 |
| 833 | nmdc:mga00v17_384175_c1 | 3300050491 | Bacteria | 913 |
| 834 | nmdc:mga00v17_736219_c1 | 3300050491 | Bacteria | 631 |
| 835 | nmdc:mga00v17_7580_c1 | 3300050491 | Bacteria | 5797 |
| 836 | nmdc:mga0yw44_102005_c1 | 3300050492 | Bacteria | 1829 |
| 837 | nmdc:mga0yw44_198931_c1 | 3300050492 | Bacteria | 1323 |
| 838 | nmdc:mga0yw44_300815_c1 | 3300050492 | Bacteria | 1075 |
| 839 | nmdc:mga0k408_136820_c1 | 3300050493 | Bacteria | 1456 |
| 840 | nmdc:mga0k408_14577_c1 | 3300050493 | Bacteria | 4335 |
| 841 | nmdc:mga0k408_15243_c1 | 3300050493 | Bacteria | 4248 |
| 842 | nmdc:mga0k408_171345_c1 | 3300050493 | Bacteria | 1294 |
| 843 | nmdc:mga0k408_472143_c1 | 3300050493 | Bacteria | 744 |
| 844 | nmdc:mga0k408_55072_c1 | 3300050493 | Bacteria | 2306 |
| 845 | nmdc:mga0k408_7032_c2 | 3300050493 | Bacteria | 2981 |
| 846 | nmdc:mga06z11_119096_c1 | 3300050494 | Bacteria | 1471 |
| 847 | nmdc:mga06z11_132068_c1 | 3300050494 | Bacteria | 1403 |
| 848 | nmdc:mga06z11_208051_c1 | 3300050494 | Bacteria | 1139 |
| 849 | nmdc:mga06z11_242252_c1 | 3300050494 | Bacteria | 1059 |
| 850 | nmdc:mga06z11_258306_c1 | 3300050494 | Bacteria | 1027 |
| 851 | nmdc:mga06z11_367692_c1 | 3300050494 | Bacteria | 863 |
| 852 | nmdc:mga06z11_7925_c1 | 3300050494 | Bacteria | 4399 |
| 853 | nmdc:mga04h51_114510_c1 | 3300050495 | Bacteria | 998 |
| 854 | nmdc:mga04h51_70935_c1 | 3300050495 | Bacteria | 1216 |
| 855 | nmdc:mga07m45_114654_c1 | 3300050496 | Bacteria | 1554 |
| 856 | nmdc:mga07m45_157081_c1 | 3300050496 | Bacteria | 1320 |
| 857 | nmdc:mga07m45_21357_c1 | 3300050496 | Bacteria | 1460 |
| 858 | nmdc:mga07m45_39579_c1 | 3300050496 | Bacteria | 1802 |
| 859 | nmdc:mga07m45_54_c1 | 3300050496 | Bacteria | 49018 |
| 860 | nmdc:mga07m45_96996_c1 | 3300050496 | Bacteria | 1692 |
| 861 | nmdc:mga05p37_120055_c1 | 3300050507 | Bacteria | 3229 |
| 862 | nmdc:mga0qj67_686162_c1 | 3300050509 | Bacteria | 815 |
| 863 | nmdc:mga08y16_527715_c1 | 3300050511 | Bacteria | 1197 |
| 864 | nmdc:mga0rr50_208933_c1 | 3300050513 | Bacteria | 1607 |
| 865 | nmdc:mga0a205_375369_c1 | 3300050515 | Bacteria | 1287 |
| 866 | nmdc:mga0sz30_167638_c1 | 3300050516 | Bacteria | 974 |
| 867 | nmdc:mga0sz30_186040_c1 | 3300050516 | Bacteria | 922 |
| 868 | nmdc:mga0sz30_235_c1 | 3300050516 | Bacteria | 21178 |
| 869 | Ga0495601_0002174 | 3300053077 | Bacteria | 11036 |
| 870 | Ga0495601_0013992 | 3300053077 | Bacteria | 4831 |
| 871 | Ga0495601_0540594 | 3300053077 | Bacteria | 750 |
| 872 | Ga0495612_0008623 | 3300053078 | Bacteria | 4134 |
| 873 | Ga0495612_0021184 | 3300053078 | Bacteria | 2608 |
| 874 | Ga0500610_0108645 | 3300053079 | Bacteria | 1429 |
| 875 | Ga0500635_0092805 | 3300053080 | Bacteria | 1101 |
| 876 | Ga0495595_0000257 | 3300053084 | Bacteria | 21149 |
| 877 | Ga0495595_0040557 | 3300053084 | Bacteria | 2128 |
| 878 | Ga0495595_0141229 | 3300053084 | Bacteria | 1181 |
| 879 | Ga0495619_0000089 | 3300053085 | Bacteria | 69604 |
| 880 | Ga0495619_0072158 | 3300053085 | Bacteria | 2312 |
| 881 | Ga0495619_0086861 | 3300053085 | Bacteria | 2114 |
| 882 | Ga0495619_0405984 | 3300053085 | Unclassified | 941 |
| 883 | Ga0495619_0443993 | 3300053085 | Bacteria | 894 |
| 884 | Ga0495619_0587514 | 3300053085 | Bacteria | 762 |
| 885 | Ga0500578_0149986 | 3300053086 | Bacteria | 1453 |
| 886 | Ga0500644_0008229 | 3300053088 | Bacteria | 2747 |
| 887 | Ga0500644_0055085 | 3300053088 | Unclassified | 1379 |
| 888 | Ga0500646_0140391 | 3300053090 | Bacteria | 792 |
| 889 | Ga0500647_0106643 | 3300053091 | Bacteria | 1335 |
| 890 | Ga0500566_0327937 | 3300053094 | Bacteria | 710 |
| 891 | Ga0500641_0084109 | 3300053096 | Bacteria | 1353 |
| 892 | Ga0500556_0033556 | 3300053104 | Bacteria | 1761 |
| 893 | Ga0500562_018606 | 3300053108 | Bacteria | 1794 |
| 894 | Ga0500562_033923 | 3300053108 | Bacteria | 1349 |
| 895 | Ga0500569_052576 | 3300053109 | Bacteria | 1234 |
| 896 | Ga0500595_001326 | 3300053119 | Bacteria | 13410 |
| 897 | Ga0500595_015953 | 3300053119 | Bacteria | 2807 |
| 898 | Ga0500642_0261224 | 3300053130 | Bacteria | 792 |
| 899 | Ga0500652_262644 | 3300053131 | Bacteria | 680 |
| 900 | Ga0500655_009437 | 3300053133 | Bacteria | 1760 |
| 901 | Ga0500658_0094165 | 3300053134 | Bacteria | 1299 |
| 902 | Ga0500658_0249757 | 3300053134 | Bacteria | 815 |
| 903 | Ga0500559_0033345 | 3300053136 | Bacteria | 2216 |
| 904 | Ga0500561_0078312 | 3300053137 | Bacteria | 959 |
| 905 | Ga0500573_0023818 | 3300053140 | Bacteria | 3516 |
| 906 | Ga0500577_0065495 | 3300053142 | Bacteria | 1410 |
| 907 | Ga0500589_100817 | 3300053147 | Bacteria | 1254 |
| 908 | Ga0500589_114445 | 3300053147 | Bacteria | 1152 |
| 909 | Ga0500590_048708 | 3300053148 | Bacteria | 2160 |
| 910 | Ga0500590_126524 | 3300053148 | Bacteria | 1189 |
| 911 | Ga0500616_0034848 | 3300053153 | Bacteria | 2741 |
| 912 | Ga0500616_0318052 | 3300053153 | Bacteria | 642 |
| 913 | Ga0500622_0046683 | 3300053156 | Bacteria | 2238 |
| 914 | Ga0500622_0122608 | 3300053156 | Bacteria | 1259 |
| 915 | Ga0500627_0108683 | 3300053158 | Bacteria | 1248 |
| 916 | Ga0500633_0148869 | 3300053160 | Bacteria | 877 |
| 917 | Ga0500636_0037456 | 3300053177 | Bacteria | 2869 |
| 918 | Ga0500636_0043970 | 3300053177 | Bacteria | 2635 |
| 919 | Ga0500637_0003656 | 3300053178 | Bacteria | 7152 |
| 920 | Ga0500637_0117095 | 3300053178 | Bacteria | 1545 |
| 921 | Ga0500637_0221548 | 3300053178 | Bacteria | 1069 |
| 922 | Ga0500637_0386188 | 3300053178 | Bacteria | 732 |
| 923 | Ga0500609_006296 | 3300053731 | Bacteria | 1617 |
| 924 | Ga0500609_011269 | 3300053731 | Bacteria | 1207 |
| 925 | Ga0500596_003856 | 3300053735 | Bacteria | 2807 |
| 926 | 2513698251 | 2513237101 | Bacteria | 7952346 |
| 927 | 2599748542 | 2599185240 | Bacteria | 7968121 |
| 928 | 2600210470 | 2599185355 | Bacteria | 7968906 |
| 929 | 2676746633 | 2675903129 | Bacteria | 7964495 |
| 930 | 2723848581 | 2721755755 | Bacteria | 8322773 |
| 931 | 2728755233 | 2728368998 | Bacteria | 8720350 |
| 932 | 2874606244 | 2874604998 | Bacteria | 7834745 |
| 933 | 2887376557 | 2887375801 | Bacteria | 5334027 |
| 934 | 2889036836 | 2889033259 | Bacteria | 9099371 |
| 935 | 8002392390 | 8002392321 | Bacteria | 4159911 |
| 936 | 8006988312 | 8006984368 | Bacteria | 9651211 |
| 937 | 8006999550 | 8006994254 | Bacteria | 8309700 |
| 938 | 8020948649 | 8020945358 | Bacteria | 8467355 |
| 939 | 8056679727 | 8056673599 | Bacteria | 7871253 |
| 940 | 8056692511 | 8056689827 | Bacteria | 6712655 |
| 941 | Ga0307508_10572961 | |||
| 942 | RicEn_C2288 | |||
| 943 | JGI25406J46586_10007733 | |||
| 944 | JGI25153J46596_10009937 | |||
| 945 | rootH1_10062104 | |||
| 946 | rootH2_10082343 | |||
| 947 | rootL2_10037120 | |||
| 948 | rootH1_10258310 | |||
| 949 | Ga0055527_1000417 | |||
| 950 | Ga0055535_1001078 | |||
| 951 | Ga0055542_1001702 | |||
| 952 | Ga0065704_10040826 | |||
| 953 | Ga0065715_10157121 | |||
| 954 | Ga0070683_100254921 | |||
| 955 | Ga0070690_100172410 | |||
| 956 | Ga0070670_100005241 | |||
| 957 | Ga0070670_100082724 | |||
| 958 | Ga0070670_100949216 | |||
| 959 | Ga0070670_100968008 | |||
| 960 | Ga0068869_100022912 | |||
| 961 | Ga0068869_100156195 | |||
| 962 | Ga0068869_100351677 | |||
| 963 | Ga0068869_100596600 | |||
| 964 | Ga0070666_10190029 | |||
| 965 | Ga0070666_10472266 | |||
| 966 | Ga0070680_100032614 | |||
| 967 | Ga0068868_100056725 | |||
| 968 | Ga0068868_100511069 | |||
| 969 | Ga0070660_100755196 | |||
| 970 | Ga0070689_100335981 | |||
| 971 | Ga0070691_10286968 | |||
| 972 | Ga0070668_100237900 | |||
| 973 | Ga0070675_100635482 | |||
| 974 | Ga0070671_100002026 | |||
| 975 | Ga0070671_100718138 | |||
| 976 | Ga0070673_100019816 | |||
| 977 | Ga0070673_100440968 | |||
| 978 | Ga0070673_100569106 | |||
| 979 | Ga0070673_100822652 | |||
| 980 | Ga0070688_100334649 | |||
| 981 | Ga0070659_100219456 | |||
| 982 | Ga0070659_100421717 | |||
| 983 | Ga0070667_100187596 | |||
| 984 | Ga0070667_100348847 | |||
| 985 | Ga0070709_10331292 | |||
| 986 | Ga0070709_11065472 | |||
| 987 | Ga0070714_100842963 | |||
| 988 | Ga0070714_101175572 | |||
| 989 | Ga0070713_100224686 | |||
| 990 | Ga0070710_10157192 | |||
| 991 | Ga0070710_10250650 | |||
| 992 | Ga0070710_10309714 | |||
| 993 | Ga0070711_100067451 | |||
| 994 | Ga0070711_100188427 | |||
| 995 | Ga0070711_100772862 | |||
| 996 | Ga0070708_100158225 | |||
| 997 | Ga0070663_100128284 | |||
| 998 | Ga0070663_100431573 | |||
| 999 | Ga0070663_100434055 | |||
| 1000 | Ga0070678_100133624 | |||
| 1001 | Ga0070678_100230648 | |||
| 1002 | Ga0070678_100720836 | |||
| 1003 | Ga0070662_100231213 | |||
| 1004 | Ga0070681_10045611 | |||
| 1005 | Ga0070681_10507742 | |||
| 1006 | Ga0070681_11316166 | |||
| 1007 | Ga0068867_100354905 | |||
| 1008 | Ga0068867_101171219 | |||
| 1009 | Ga0070685_10116171 | |||
| 1010 | Ga0070685_10186206 | |||
| 1011 | Ga0070685_10727194 | |||
| 1012 | Ga0070706_100001519 | |||
| 1013 | Ga0070707_100146568 | |||
| 1014 | Ga0070698_100103788 | |||
| 1015 | Ga0070699_100077162 | |||
| 1016 | Ga0070699_100700329 | |||
| 1017 | Ga0070697_100761345 | |||
| 1018 | Ga0068853_100909078 | |||
| 1019 | Ga0068853_101066506 | |||
| 1020 | Ga0068853_101084321 | |||
| 1021 | Ga0068853_101539578 | |||
| 1022 | Ga0070672_100031959 | |||
| 1023 | Ga0070672_100116243 | |||
| 1024 | Ga0070672_100132603 | |||
| 1025 | Ga0070696_100001126 | |||
| 1026 | Ga0070696_100089868 | |||
| 1027 | Ga0070665_100001168 | |||
| 1028 | Ga0070665_100008760 | |||
| 1029 | Ga0070665_100023272 | |||
| 1030 | Ga0070665_100104923 | |||
| 1031 | Ga0070665_100165569 | |||
| 1032 | Ga0070665_100253187 | |||
| 1033 | Ga0070665_100331126 | |||
| 1034 | Ga0070665_100533509 | |||
| 1035 | Ga0070704_100081030 | |||
| 1036 | Ga0070704_100826874 | |||
| 1037 | Ga0068855_100144386 | |||
| 1038 | Ga0070664_100733496 | |||
| 1039 | Ga0068857_100046837 | |||
| 1040 | Ga0068856_100194292 | |||
| 1041 | Ga0068856_100554000 | |||
| 1042 | Ga0070702_100047519 | |||
| 1043 | Ga0068852_100300256 | |||
| 1044 | Ga0068852_101180518 | |||
| 1045 | Ga0068859_100031093 | |||
| 1046 | Ga0068859_100553177 | |||
| 1047 | Ga0068859_100957838 | |||
| 1048 | Ga0068859_102026297 | |||
| 1049 | Ga0068866_10131614 | |||
| 1050 | Ga0068866_10333242 | |||
| 1051 | Ga0068866_10762980 | |||
| 1052 | Ga0068861_100318109 | |||
| 1053 | Ga0068861_101225968 | |||
| 1054 | Ga0068863_100047665 | |||
| 1055 | Ga0068863_101123701 | |||
| 1056 | Ga0068863_101815324 | |||
| 1057 | Ga0068858_100009170 | |||
| 1058 | Ga0068858_100030212 | |||
| 1059 | Ga0068858_100106653 | |||
| 1060 | Ga0068858_100358649 | |||
| 1061 | Ga0068860_100000371 | |||
| 1062 | Ga0068860_100429365 | |||
| 1063 | Ga0068860_101261294 | |||
| 1064 | Ga0068862_100072305 | |||
| 1065 | Ga0068862_100115909 | |||
| 1066 | Ga0068862_100178233 | |||
| 1067 | Ga0068862_100315474 | |||
| 1068 | Ga0068862_100394225 | |||
| 1069 | Ga0068862_100418134 | |||
| 1070 | Ga0068862_101276107 | |||
| 1071 | Ga0068862_101446805 | |||
| 1072 | Ga0081455_10024630 | |||
| 1073 | Ga0081455_10274437 | |||
| 1074 | Ga0081538_10087765 | |||
| 1075 | Ga0081539_10002040 | |||
| 1076 | Ga0081539_10053494 | |||
| 1077 | Ga0070717_10073245 | |||
| 1078 | Ga0075365_10077896 | |||
| 1079 | Ga0075365_10204544 | |||
| 1080 | Ga0075365_10272920 | |||
| 1081 | Ga0075365_10290379 | |||
| 1082 | Ga0075365_10537715 | |||
| 1083 | Ga0075365_10584898 | |||
| 1084 | Ga0075368_10012344 | |||
| 1085 | Ga0075368_10111160 | |||
| 1086 | Ga0075368_10221625 | |||
| 1087 | Ga0075368_10301229 | |||
| 1088 | Ga0075363_100010922 | |||
| 1089 | Ga0075363_100013697 | |||
| 1090 | Ga0075363_100377422 | |||
| 1091 | Ga0075363_100482629 | |||
| 1092 | Ga0075363_100653730 | |||
| 1093 | Ga0075364_10003559 | |||
| 1094 | Ga0075364_10381333 | |||
| 1095 | Ga0075432_10128445 | |||
| 1096 | Ga0070715_10085500 | |||
| 1097 | Ga0070715_10109493 | |||
| 1098 | Ga0070716_100055570 | |||
| 1099 | Ga0070716_100141053 | |||
| 1100 | Ga0070716_100218864 | |||
| 1101 | Ga0070716_100602234 | |||
| 1102 | Ga0070712_100457231 | |||
| 1103 | Ga0070712_100484306 | |||
| 1104 | Ga0070712_100558073 | |||
| 1105 | Ga0075362_10001867 | |||
| 1106 | Ga0075362_10003987 | |||
| 1107 | Ga0075362_10005810 | |||
| 1108 | Ga0075362_10012898 | |||
| 1109 | Ga0075362_10045963 | |||
| 1110 | Ga0075362_10133581 | |||
| 1111 | Ga0075367_10004238 | |||
| 1112 | Ga0075367_10024609 | |||
| 1113 | Ga0075367_10051802 | |||
| 1114 | Ga0075367_10059138 | |||
| 1115 | Ga0075367_10149611 | |||
| 1116 | Ga0075367_10184420 | |||
| 1117 | Ga0075367_10192494 | |||
| 1118 | Ga0075367_10596757 | |||
| 1119 | Ga0075367_10810066 | |||
| 1120 | Ga0075369_10031610 | |||
| 1121 | Ga0075369_10131079 | |||
| 1122 | Ga0075366_10004721 | |||
| 1123 | Ga0075366_10010783 | |||
| 1124 | Ga0075366_10013639 | |||
| 1125 | Ga0075366_10060089 | |||
| 1126 | Ga0075366_10079235 | |||
| 1127 | Ga0075366_10082715 | |||
| 1128 | Ga0075366_10095409 | |||
| 1129 | Ga0075366_10136270 | |||
| 1130 | Ga0075366_10219425 | |||
| 1131 | Ga0097621_100074080 | |||
| 1132 | Ga0097621_100237354 | |||
| 1133 | Ga0075370_10000711 | |||
| 1134 | Ga0075370_10002157 | |||
| 1135 | Ga0075370_10006505 | |||
| 1136 | Ga0075370_10020638 | |||
| 1137 | Ga0075370_10027738 | |||
| 1138 | Ga0075370_10049171 | |||
| 1139 | Ga0075370_10110607 | |||
| 1140 | Ga0075370_10403291 | |||
| 1141 | Ga0068871_100295741 | |||
| 1142 | Ga0075428_100025261 | |||
| 1143 | Ga0075430_100741538 | |||
| 1144 | Ga0075431_100004883 | |||
| 1145 | Ga0068865_100092989 | |||
| 1146 | Ga0068865_101027572 | |||
| 1147 | Ga0075436_100671810 | |||
| 1148 | Ga0097620_100031093 | |||
| 1149 | Ga0097620_100553294 | |||
| 1150 | Ga0097620_100957977 | |||
| 1151 | Ga0097620_102026270 | |||
| 1152 | Ga0075435_100701492 | |||
| 1153 | Ga0099794_10000442 | |||
| 1154 | Ga0099795_10000966 | |||
| 1155 | Ga0105244_10500930 | |||
| 1156 | Ga0105250_10018498 | |||
| 1157 | Ga0105240_10006809 | |||
| 1158 | Ga0105240_10026644 | |||
| 1159 | Ga0105240_10043543 | |||
| 1160 | Ga0105240_10118414 | |||
| 1161 | Ga0105240_10270002 | |||
| 1162 | Ga0105240_10391995 | |||
| 1163 | Ga0105240_10414441 | |||
| 1164 | Ga0105240_10471381 | |||
| 1165 | Ga0105240_10652328 | |||
| 1166 | Ga0105245_10048817 | |||
| 1167 | Ga0105245_10188396 | |||
| 1168 | Ga0105245_10332764 | |||
| 1169 | Ga0105247_10055529 | |||
| 1170 | Ga0105247_10559129 | |||
| 1171 | Ga0114129_10090122 | |||
| 1172 | Ga0105243_10230554 | |||
| 1173 | Ga0105243_10418523 | |||
| 1174 | Ga0105243_11323712 | |||
| 1175 | Ga0105241_10085696 | |||
| 1176 | Ga0105241_10120621 | |||
| 1177 | Ga0105241_10349754 | |||
| 1178 | Ga0105242_10546036 | |||
| 1179 | Ga0105248_10146332 | |||
| 1180 | Ga0105248_10357819 | |||
| 1181 | Ga0105248_10589821 | |||
| 1182 | Ga0105248_11843389 | |||
| 1183 | Ga0105237_10091285 | |||
| 1184 | Ga0105237_10157191 | |||
| 1185 | Ga0105237_10169986 | |||
| 1186 | Ga0105237_10191072 | |||
| 1187 | Ga0105237_10262331 | |||
| 1188 | Ga0105237_10623308 | |||
| 1189 | Ga0105237_10767295 | |||
| 1190 | Ga0105238_10302473 | |||
| 1191 | Ga0105238_10398409 | |||
| 1192 | Ga0105238_10509903 | |||
| 1193 | Ga0105238_10572997 | |||
| 1194 | Ga0105238_11081248 | |||
| 1195 | Ga0105249_10040039 | |||
| 1196 | Ga0105249_10087193 | |||
| 1197 | Ga0105249_10629004 | |||
| 1198 | Ga0105249_10975300 | |||
| 1199 | Ga0105249_11130230 | |||
| 1200 | Ga0099796_10070719 | |||
| 1201 | Ga0099796_10195595 | |||
| 1202 | Ga0105239_10150693 | |||
| 1203 | Ga0105239_10154231 | |||
| 1204 | Ga0105239_10278682 | |||
| 1205 | Ga0105239_10753307 | |||
| 1206 | Ga0105239_11037005 | |||
| 1207 | Ga0105239_11841851 | |||
| 1208 | Ga0105246_10685185 | |||
| 1209 | Ga0157335_1004574 | |||
| 1210 | Ga0157347_1022954 | |||
| 1211 | Ga0157369_10459770 | |||
| 1212 | Ga0157369_10757423 | |||
| 1213 | Ga0157374_10171374 | |||
| 1214 | Ga0157374_10532719 | |||
| 1215 | Ga0157374_10831984 | |||
| 1216 | Ga0157378_10217349 | |||
| 1217 | Ga0157378_10321917 | |||
| 1218 | Ga0163162_10022525 | |||
| 1219 | Ga0163162_10845071 | |||
| 1220 | Ga0163162_10883254 | |||
| 1221 | Ga0157375_10134352 | |||
| 1222 | Ga0157375_10407926 | |||
| 1223 | Ga0157375_10596691 | |||
| 1224 | Ga0157375_11325440 | |||
| 1225 | Ga0163163_10118326 | |||
| 1226 | Ga0163163_10360541 | |||
| 1227 | Ga0163163_10398266 | |||
| 1228 | Ga0163163_11388170 | |||
| 1229 | Ga0157380_10263585 | |||
| 1230 | Ga0157380_11094041 | |||
| 1231 | Ga0182008_10135092 | |||
| 1232 | Ga0157379_10161974 | |||
| 1233 | Ga0157379_10266766 | |||
| 1234 | Ga0157379_10314154 | |||
| 1235 | Ga0157379_10344676 | |||
| 1236 | Ga0157379_10396549 | |||
| 1237 | Ga0157379_10606760 | |||
| 1238 | Ga0157376_10458591 | |||
| 1239 | Ga0157376_10472995 | |||
| 1240 | Ga0157376_11843223 | |||
| 1241 | Ga0182006_1026974 | |||
| 1242 | Ga0163161_10184373 | |||
| 1243 | Ga0163161_10626849 | |||
| 1244 | Ga0213872_10186324 | |||
| 1245 | Ga0228598_1000670 | |||
| 1246 | Ga0209672_100015 | |||
| 1247 | Ga0209147_100016 | |||
| 1248 | Ga0209258_100026 | |||
| 1249 | Ga0209148_1001962 | |||
| 1250 | Ga0209759_1003001 | |||
| 1251 | Ga0209455_1000812 | |||
| 1252 | Ga0209758_1000240 | |||
| 1253 | Ga0209758_1005019 | |||
| 1254 | Ga0209758_1077614 | |||
| 1255 | Ga0207697_10075807 | |||
| 1256 | Ga0207656_10495171 | |||
| 1257 | Ga0207653_10011428 | |||
| 1258 | Ga0207682_10146749 | |||
| 1259 | Ga0207692_10139078 | |||
| 1260 | Ga0207692_10551702 | |||
| 1261 | Ga0207710_10091521 | |||
| 1262 | Ga0207710_10121598 | |||
| 1263 | Ga0207710_10155667 | |||
| 1264 | Ga0207688_10071903 | |||
| 1265 | Ga0207680_10367061 | |||
| 1266 | Ga0207680_10436702 | |||
| 1267 | Ga0207647_10137293 | |||
| 1268 | Ga0207685_10208835 | |||
| 1269 | Ga0207699_10162592 | |||
| 1270 | Ga0207699_10536609 | |||
| 1271 | Ga0207645_10115816 | |||
| 1272 | Ga0207684_10013902 | |||
| 1273 | Ga0207684_10522164 | |||
| 1274 | Ga0207654_10005798 | |||
| 1275 | Ga0207654_10175894 | |||
| 1276 | Ga0207654_10182135 | |||
| 1277 | Ga0207707_10724874 | |||
| 1278 | Ga0207695_10002871 | |||
| 1279 | Ga0207695_10111961 | |||
| 1280 | Ga0207695_10197006 | |||
| 1281 | Ga0207695_10378063 | |||
| 1282 | Ga0207695_10491880 | |||
| 1283 | Ga0207695_10571542 | |||
| 1284 | Ga0207695_11285764 | |||
| 1285 | Ga0207671_10040030 | |||
| 1286 | Ga0207671_10117291 | |||
| 1287 | Ga0207671_10177589 | |||
| 1288 | Ga0207671_10764028 | |||
| 1289 | Ga0207693_10035791 | |||
| 1290 | Ga0207693_10135688 | |||
| 1291 | Ga0207693_10175802 | |||
| 1292 | Ga0207693_10252415 | |||
| 1293 | Ga0207663_10171798 | |||
| 1294 | Ga0207663_10221250 | |||
| 1295 | Ga0207662_10178711 | |||
| 1296 | Ga0207649_10070154 | |||
| 1297 | Ga0207652_10070870 | |||
| 1298 | Ga0207646_10187194 | |||
| 1299 | Ga0207681_10799822 | |||
| 1300 | Ga0207694_10518297 | |||
| 1301 | Ga0207694_10742309 | |||
| 1302 | Ga0207694_10817967 | |||
| 1303 | Ga0207650_10273758 | |||
| 1304 | Ga0207650_10860355 | |||
| 1305 | Ga0207650_11233842 | |||
| 1306 | Ga0207659_10532425 | |||
| 1307 | Ga0207687_10011613 | |||
| 1308 | Ga0207687_10150722 | |||
| 1309 | Ga0207687_11503913 | |||
| 1310 | Ga0207700_10065555 | |||
| 1311 | Ga0207700_10386812 | |||
| 1312 | Ga0207664_10905942 | |||
| 1313 | Ga0207644_10014094 | |||
| 1314 | Ga0207644_11071500 | |||
| 1315 | Ga0207706_10034459 | |||
| 1316 | Ga0207706_10102321 | |||
| 1317 | Ga0207706_10262770 | |||
| 1318 | Ga0207709_10258641 | |||
| 1319 | Ga0207670_10130274 | |||
| 1320 | Ga0207670_10542674 | |||
| 1321 | Ga0207669_10579214 | |||
| 1322 | Ga0207704_10301008 | |||
| 1323 | Ga0207704_10610249 | |||
| 1324 | Ga0207665_10334722 | |||
| 1325 | Ga0207665_10476951 | |||
| 1326 | Ga0207665_10880545 | |||
| 1327 | Ga0207691_10114806 | |||
| 1328 | Ga0207691_10183967 | |||
| 1329 | Ga0207691_10234680 | |||
| 1330 | Ga0207691_10306156 | |||
| 1331 | Ga0207711_10127440 | |||
| 1332 | Ga0207711_10372632 | |||
| 1333 | Ga0207711_10518414 | |||
| 1334 | Ga0207711_10695412 | |||
| 1335 | Ga0207689_10044841 | |||
| 1336 | Ga0207689_10071481 | |||
| 1337 | Ga0207689_10172400 | |||
| 1338 | Ga0207661_10416929 | |||
| 1339 | Ga0207661_10732522 | |||
| 1340 | Ga0207667_10322990 | |||
| 1341 | Ga0207667_10702318 | |||
| 1342 | Ga0207667_10739936 | |||
| 1343 | Ga0207651_10014597 | |||
| 1344 | Ga0207651_10251259 | |||
| 1345 | Ga0207651_10293512 | |||
| 1346 | Ga0207651_10553425 | |||
| 1347 | Ga0207712_10127977 | |||
| 1348 | Ga0207668_10014378 | |||
| 1349 | Ga0207640_10164918 | |||
| 1350 | Ga0207658_10301893 | |||
| 1351 | Ga0207658_10527618 | |||
| 1352 | Ga0207658_10552494 | |||
| 1353 | Ga0207677_10573240 | |||
| 1354 | Ga0207703_10000923 | |||
| 1355 | Ga0207703_10057967 | |||
| 1356 | Ga0207703_10409211 | |||
| 1357 | Ga0207703_10435526 | |||
| 1358 | Ga0207639_10040025 | |||
| 1359 | Ga0207639_10354933 | |||
| 1360 | Ga0207639_10751778 | |||
| 1361 | Ga0207639_11039247 | |||
| 1362 | Ga0207678_10058697 | |||
| 1363 | Ga0207708_10163999 | |||
| 1364 | Ga0207702_10228829 | |||
| 1365 | Ga0207641_10011353 | |||
| 1366 | Ga0207648_10061324 | |||
| 1367 | Ga0207648_10070090 | |||
| 1368 | Ga0207648_10875518 | |||
| 1369 | Ga0207648_11272618 | |||
| 1370 | Ga0207676_10128952 | |||
| 1371 | Ga0207676_10289901 | |||
| 1372 | Ga0207674_10137422 | |||
| 1373 | Ga0207674_10430759 | |||
| 1374 | Ga0207674_10719827 | |||
| 1375 | Ga0207675_100068646 | |||
| 1376 | Ga0207675_100315204 | |||
| 1377 | Ga0207675_100393820 | |||
| 1378 | Ga0207675_101434422 | |||
| 1379 | Ga0207683_10037457 | |||
| 1380 | Ga0207683_10159141 | |||
| 1381 | Ga0207698_10092750 | |||
| 1382 | Ga0207698_10454367 | |||
| 1383 | Ga0207698_10972919 | |||
| 1384 | Ga0209179_1002231 | |||
| 1385 | Ga0209813_10234593 | |||
| 1386 | Ga0209813_10246645 | |||
| 1387 | Ga0207428_10382796 | |||
| 1388 | Ga0268266_10004725 | |||
| 1389 | Ga0268266_10005936 | |||
| 1390 | Ga0268266_10134027 | |||
| 1391 | Ga0268266_10214112 | |||
| 1392 | Ga0268265_10041239 | |||
| 1393 | Ga0268265_10150353 | |||
| 1394 | Ga0268265_10175657 | |||
| 1395 | Ga0268265_10352668 | |||
| 1396 | Ga0268265_10596417 | |||
| 1397 | Ga0268264_10000151 | |||
| 1398 | Ga0268264_10265545 | |||
| 1399 | Ga0268264_10351764 | |||
| 1400 | Ga0265334_10026004 | |||
| 1401 | Ga0307517_10000235 | |||
| 1402 | Ga0307517_10144167 | |||
| 1403 | Ga0307515_10000014 | |||
| 1404 | Ga0307515_10000424 | |||
| 1405 | Ga0307515_10027689 | |||
| 1406 | Ga0307515_10038046 | |||
| 1407 | Ga0307515_10150180 | |||
| 1408 | Ga0307515_10153597 | |||
| 1409 | Ga0307515_10243825 | |||
| 1410 | Ga0265338_10079204 | |||
| 1411 | Ga0307511_10001160 | |||
| 1412 | Ga0307512_10196542 | |||
| 1413 | Ga0265760_10085776 | |||
| 1414 | Ga0265340_10182459 | |||
| 1415 | Ga0265316_10784000 | |||
| 1416 | Ga0307513_10012664 | |||
| 1417 | Ga0307513_10041680 | |||
| 1418 | Ga0307513_10572658 | |||
| 1419 | Ga0307513_10663977 | |||
| 1420 | Ga0307509_10000056 | |||
| 1421 | Ga0307509_10017926 | |||
| 1422 | Ga0307509_10035087 | |||
| 1423 | Ga0307408_100745301 | |||
| 1424 | Ga0307508_10000003 | |||
| 1425 | Ga0307508_10003404 | |||
| 1426 | Ga0307508_10007698 | |||
| 1427 | Ga0307508_10088121 | |||
| 1428 | Ga0307508_10220855 | |||
| 1429 | Ga0307516_10004419 | |||
| 1430 | Ga0307516_10156207 | |||
| 1431 | Ga0307516_10261844 | |||
| 1432 | Ga0307516_10297417 | |||
| 1433 | Ga0307413_10006806 | |||
| 1434 | Ga0326468_10018756 | |||
| 1435 | Ga0307412_11036920 | |||
| 1436 | Ga0307409_100335528 | |||
| 1437 | Ga0307414_11214478 | |||
| 1438 | Ga0307415_100628539 | |||
| 1439 | Ga0307507_10169357 | |||
| 1440 | Ga0307507_10343597 | |||
| 1441 | Ga0307510_10000003 | |||
| 1442 | Ga0307510_10002062 | |||
| 1443 | Ga0307510_10038663 | |||
| 1444 | Ga0307510_10059573 | |||
| 1445 | Ga0373930_0041994 | |||
| 1446 | Ga0373949_0029168 | |||
| 1447 | Ga0373923_0032315 | |||
| 1448 | Ga0373954_0005967 | |||
| 1449 | Ga0373954_0029469 | |||
| 1450 | Ga0373954_0077649 | |||
| 1451 | Ga0373954_0276955 | |||
| 1452 | Ga0373956_0007402 | |||
| 1453 | Ga0373957_0035416 | |||
| 1454 | Ga0373943_0018460 | |||
| 1455 | Ga0373943_0054840 | |||
| 1456 | Ga0373943_0124506 | |||
| 1457 | Ga0373943_0136430 | |||
| 1458 | Ga0373943_0828679 | |||
| 1459 | Ga0373955_0022961 | |||
| 1460 | Ga0373942_0120412 | |||
| 1461 | Ga0373924_0118299 | |||
| 1462 | Ga0373931_0010516 | |||
| 1463 | Ga0373935_0079563 | |||
| 1464 | Ga0373935_1376275 | |||
| 1465 | Ga0373927_0138115 | |||
| 1466 | Ga0373927_0176992 | |||
| 1467 | Ga0373933_0000981 | |||
| 1468 | Ga0373933_0480392 | |||
| 1469 | Ga0373947_0239049 | |||
| 1470 | Ga0373947_0565100 | |||
| 1471 | Ga0373937_0000294 | |||
| 1472 | Ga0373937_0118994 | |||
| 1473 | Ga0373937_0458255 | |||
| 1474 | Ga0373937_1071635 | |||
| 1475 | Ga0373925_0487973 | |||
| 1476 | Ga0395900_0010476 | |||
| 1477 | Ga0395900_0266461 | |||
| 1478 | Ga0395905_0207985 | |||
| 1479 | Ga0395905_0854414 | |||
| 1480 | Ga0395901_0585422 | |||
| 1481 | Ga0436365_0258411 | |||
| 1482 | Ga0436365_0562314 | |||
| 1483 | Ga0436360_0244199 | |||
| 1484 | Ga0436363_0288115 | |||
| 1485 | Ga0436363_0601769 | |||
| 1486 | Ga0436363_1695463 | |||
| 1487 | Ga0439461_0024173 | |||
| 1488 | Ga0439461_0048664 | |||
| 1489 | Ga0451797_1010531 | |||
| 1490 | Ga0451795_1197467 | |||
| 1491 | Ga0451800_0219623 | |||
| 1492 | Ga0451807_0330699 | |||
| 1493 | Ga0439431_0038905 | |||
| 1494 | Ga0439445_0092407 | |||
| 1495 | Ga0439432_167931 | |||
| 1496 | Ga0450898_023487 | |||
| 1497 | Ga0439446_0064655 | |||
| 1498 | Ga0439459_0052039 | |||
| 1499 | Ga0466972_0329827 | |||
| 1500 | Ga0466966_0197918 | |||
| 1501 | Ga0466961_0004263 | |||
| 1502 | Ga0466971_0362446 | |||
| 1503 | Ga0466959_0012524 | |||
| 1504 | Ga0466959_0071056 | |||
| 1505 | Ga0466959_0116423 | |||
| 1506 | Ga0495592_0105607 | |||
| 1507 | Ga0495603_0057356 | |||
| 1508 | Ga0495603_0149867 | |||
| 1509 | Ga0495603_0206073 | |||
| 1510 | Ga0495603_0338158 | |||
| 1511 | Ga0495603_0382481 | |||
| 1512 | Ga0495629_0001072 | |||
| 1513 | Ga0495638_0194879 | |||
| 1514 | Ga0495641_0055933 | |||
| 1515 | Ga0495651_0001380 | |||
| 1516 | Ga0495651_0270877 | |||
| 1517 | Ga0495651_0584173 | |||
| 1518 | Ga0495653_0000774 | |||
| 1519 | Ga0495650_0049494 | |||
| 1520 | Ga0495580_0000310 | |||
| 1521 | Ga0495580_0005440 | |||
| 1522 | Ga0495580_0181892 | |||
| 1523 | Ga0495580_0398148 | |||
| 1524 | Ga0495582_0089667 | |||
| 1525 | Ga0495605_0342048 | |||
| 1526 | Ga0495662_0054837 | |||
| 1527 | Ga0495662_0067258 | |||
| 1528 | Ga0495664_0037948 | |||
| 1529 | Ga0495664_0105246 | |||
| 1530 | Ga0495664_0188950 | |||
| 1531 | Ga0495585_0089509 | |||
| 1532 | Ga0495585_0407523 | |||
| 1533 | Ga0495594_0349966 | |||
| 1534 | Ga0495606_0119103 | |||
| 1535 | Ga0495606_0170831 | |||
| 1536 | Ga0495608_0000148 | |||
| 1537 | Ga0495608_0237573 | |||
| 1538 | Ga0495608_0658578 | |||
| 1539 | Ga0495610_0089866 | |||
| 1540 | Ga0495618_0008092 | |||
| 1541 | Ga0495618_0159314 | |||
| 1542 | Ga0495618_0569981 | |||
| 1543 | Ga0495620_0065393 | |||
| 1544 | Ga0495620_0079264 | |||
| 1545 | Ga0495628_0003843 | |||
| 1546 | Ga0495628_0125761 | |||
| 1547 | Ga0495628_0600701 | |||
| 1548 | Ga0495630_0237991 | |||
| 1549 | Ga0495631_0120517 | |||
| 1550 | Ga0495632_0056594 | |||
| 1551 | Ga0495632_0066436 | |||
| 1552 | Ga0495632_0083260 | |||
| 1553 | Ga0495643_0114100 | |||
| 1554 | Ga0495643_0177050 | |||
| 1555 | Ga0495643_0248259 | |||
| 1556 | Ga0495648_0241717 | |||
| 1557 | Ga0495652_0003165 | |||
| 1558 | Ga0495652_0228413 | |||
| 1559 | Ga0495652_0697414 | |||
| 1560 | Ga0495665_0283066 | |||
| 1561 | Ga0495640_0002047 | |||
| 1562 | Ga0495640_0236437 | |||
| 1563 | Ga0495587_0000957 | |||
| 1564 | Ga0495587_0036109 | |||
| 1565 | Ga0495587_0183344 | |||
| 1566 | Ga0495587_0410989 | |||
| 1567 | Ga0495598_0002017 | |||
| 1568 | Ga0495609_0077793 | |||
| 1569 | Ga0495609_0174371 | |||
| 1570 | Ga0495609_0319410 | |||
| 1571 | Ga0495621_0039962 | |||
| 1572 | Ga0495597_0021603 | |||
| 1573 | Ga0495597_0098366 | |||
| 1574 | Ga0495645_0052774 | |||
| 1575 | Ga0495645_0402719 | |||
| 1576 | Ga0495645_0430473 | |||
| 1577 | Ga0495622_0110759 | |||
| 1578 | Ga0495633_0143606 | |||
| 1579 | Ga0495667_0000352 | |||
| 1580 | Ga0495667_0228736 | |||
| 1581 | Ga0495656_0002096 | |||
| 1582 | Ga0495656_0060290 | |||
| 1583 | Ga0495656_0103070 | |||
| 1584 | Ga0495656_0231680 | |||
| 1585 | Ga0495668_0435561 | |||
| 1586 | Ga0495668_0526728 | |||
| 1587 | Ga0495668_0648802 | |||
| 1588 | Ga0495634_0001972 | |||
| 1589 | Ga0495634_0177131 | |||
| 1590 | Ga0495625_0072288 | |||
| 1591 | Ga0495625_0220220 | |||
| 1592 | Ga0495625_0296894 | |||
| 1593 | Ga0495625_0428369 | |||
| 1594 | Ga0495625_0564310 | |||
| 1595 | Ga0495635_0003599 | |||
| 1596 | Ga0495635_0251607 | |||
| 1597 | Ga0495659_0029624 | |||
| 1598 | Ga0495657_0014161 | |||
| 1599 | Ga0495599_0014458 | |||
| 1600 | Ga0495599_0043222 | |||
| 1601 | Ga0495623_0003091 | |||
| 1602 | Ga0495623_0025285 | |||
| 1603 | Ga0495646_0000221 | |||
| 1604 | Ga0495646_0183669 | |||
| 1605 | Ga0495658_0516258 | |||
| 1606 | Ga0495669_0179917 | |||
| 1607 | Ga0495613_0053231 | |||
| 1608 | Ga0495613_0054875 | |||
| 1609 | Ga0495613_0120870 | |||
| 1610 | Ga0495613_0651372 | |||
| 1611 | Ga0495624_0524390 | |||
| 1612 | Ga0495670_0002945 | |||
| 1613 | Ga0495670_0104633 | |||
| 1614 | Ga0495670_0137835 | |||
| 1615 | Ga0495649_0021854 | |||
| 1616 | Ga0495649_0064443 | |||
| 1617 | Ga0495600_0042849 | |||
| 1618 | Ga0495660_0052421 | |||
| 1619 | Ga0495581_0043039 | |||
| 1620 | Ga0495581_0106993 | |||
| 1621 | Ga0495581_0272631 | |||
| 1622 | Ga0495581_0602949 | |||
| 1623 | Ga0495604_0000883 | |||
| 1624 | Ga0495604_0083057 | |||
| 1625 | Ga0495604_0738257 | |||
| 1626 | Ga0495674_0015688 | |||
| 1627 | Ga0495674_0072233 | |||
| 1628 | Ga0495674_0233774 | |||
| 1629 | Ga0495674_0360495 | |||
| 1630 | Ga0495674_0381509 | |||
| 1631 | Ga0495674_0891833 | |||
| 1632 | Ga0495672_0271050 | |||
| 1633 | Ga0495676_0122755 | |||
| 1634 | Ga0495676_0150867 | |||
| 1635 | Ga0495676_0483850 | |||
| 1636 | Ga0495680_0004008 | |||
| 1637 | Ga0495680_0088225 | |||
| 1638 | Ga0495680_0461106 | |||
| 1639 | Ga0495683_0193836 | |||
| 1640 | Ga0495687_000787 | |||
| 1641 | Ga0495687_002913 | |||
| 1642 | Ga0495687_014700 | |||
| 1643 | Ga0495675_0003139 | |||
| 1644 | Ga0495675_0107941 | |||
| 1645 | Ga0495684_0047345 | |||
| 1646 | Ga0495686_0349426 | |||
| 1647 | Ga0495593_0039275 | |||
| 1648 | Ga0495602_0006391 | |||
| 1649 | Ga0495602_0022093 | |||
| 1650 | Ga0495602_0210177 | |||
| 1651 | Ga0495602_0394890 | |||
| 1652 | Ga0495626_0082131 | |||
| 1653 | Ga0496100_0089514 | |||
| 1654 | Ga0496100_0178386 | |||
| 1655 | Ga0496100_0198911 | |||
| 1656 | Ga0496101_0144458 | |||
| 1657 | Ga0496101_0290316 | |||
| 1658 | Ga0496102_0048082 | |||
| 1659 | Ga0496102_0160314 | |||
| 1660 | Ga0496102_0402210 | |||
| 1661 | Ga0496102_0742536 | |||
| 1662 | Ga0496103_0133126 | |||
| 1663 | Ga0496103_0137922 | |||
| 1664 | Ga0496103_0194323 | |||
| 1665 | Ga0496104_0000242 | |||
| 1666 | Ga0496104_0045018 | |||
| 1667 | Ga0496104_0339154 | |||
| 1668 | Ga0496104_0414522 | |||
| 1669 | Ga0496104_0546804 | |||
| 1670 | Ga0496105_0126326 | |||
| 1671 | Ga0496105_0343744 | |||
| 1672 | Ga0496105_0596468 | |||
| 1673 | Ga0496106_0006609 | |||
| 1674 | Ga0496106_0230040 | |||
| 1675 | Ga0496106_0281423 | |||
| 1676 | Ga0496106_0724440 | |||
| 1677 | Ga0496106_1249382 | |||
| 1678 | Ga0496107_0055122 | |||
| 1679 | Ga0496107_0080079 | |||
| 1680 | Ga0496107_0131567 | |||
| 1681 | Ga0496108_0009399 | |||
| 1682 | Ga0496108_0017102 | |||
| 1683 | Ga0496108_0148343 | |||
| 1684 | Ga0496108_0175652 | |||
| 1685 | Ga0496108_1135088 | |||
| 1686 | Ga0496109_0031556 | |||
| 1687 | Ga0496109_0162388 | |||
| 1688 | Ga0496109_0280888 | |||
| 1689 | Ga0496109_0474755 | |||
| 1690 | Ga0496110_0000700 | |||
| 1691 | Ga0496110_0033398 | |||
| 1692 | Ga0496110_0173488 | |||
| 1693 | Ga0496110_0273977 | |||
| 1694 | Ga0496110_0694557 | |||
| 1695 | Ga0496111_0010116 | |||
| 1696 | Ga0496111_0201005 | |||
| 1697 | Ga0496112_0012574 | |||
| 1698 | Ga0496112_0032559 | |||
| 1699 | Ga0496112_0033089 | |||
| 1700 | Ga0496112_0119561 | |||
| 1701 | Ga0496112_0196679 | |||
| 1702 | Ga0496112_0293648 | |||
| 1703 | Ga0496112_0437528 | |||
| 1704 | Ga0496112_0510480 | |||
| 1705 | Ga0496113_0001677 | |||
| 1706 | Ga0496113_0014609 | |||
| 1707 | Ga0496113_0036214 | |||
| 1708 | Ga0496113_0278322 | |||
| 1709 | Ga0496113_0631412 | |||
| 1710 | Ga0496114_0006074 | |||
| 1711 | Ga0496114_0063193 | |||
| 1712 | Ga0496114_0246233 | |||
| 1713 | Ga0496114_0785938 | |||
| 1714 | Ga0496115_0067900 | |||
| 1715 | Ga0496115_0080528 | |||
| 1716 | Ga0496115_0220123 | |||
| 1717 | Ga0496115_0259445 | |||
| 1718 | Ga0496115_0308475 | |||
| 1719 | Ga0496115_0434819 | |||
| 1720 | Ga0496115_0549334 | |||
| 1721 | Ga0496115_0791586 | |||
| 1722 | Ga0496115_1167341 | |||
| 1723 | Ga0496116_0017044 | |||
| 1724 | Ga0496116_0137758 | |||
| 1725 | Ga0496117_0000316 | |||
| 1726 | Ga0496118_0000003 | |||
| 1727 | Ga0496118_0003186 | |||
| 1728 | Ga0496118_0357855 | |||
| 1729 | Ga0496119_0000260 | |||
| 1730 | Ga0496119_0033656 | |||
| 1731 | Ga0496119_0082141 | |||
| 1732 | Ga0496119_0329628 | |||
| 1733 | Ga0496119_0365653 | |||
| 1734 | Ga0496120_0000061 | |||
| 1735 | Ga0496120_0117345 | |||
| 1736 | Ga0496121_0000353 | |||
| 1737 | Ga0496121_0025392 | |||
| 1738 | Ga0496121_0167912 | |||
| 1739 | Ga0496124_0037821 | |||
| 1740 | Ga0496124_0054870 | |||
| 1741 | Ga0496125_0000205 | |||
| 1742 | Ga0496125_0019023 | |||
| 1743 | Ga0496125_0023500 | |||
| 1744 | Ga0496125_0216477 | |||
| 1745 | Ga0496125_0406331 | |||
| 1746 | Ga0496126_0006587 | |||
| 1747 | Ga0496126_0007152 | |||
| 1748 | Ga0496126_0127107 | |||
| 1749 | Ga0496126_0203085 | |||
| 1750 | Ga0496126_0350453 | |||
| 1751 | Ga0496126_0734596 | |||
| 1752 | Ga0496126_0777589 | |||
| 1753 | Ga0495678_116526 | |||
| 1754 | Ga0495682_0086726 | |||
| 1755 | Ga0501033_0045646 | |||
| 1756 | Ga0501036_0207748 | |||
| 1757 | Ga0501037_0800846 | |||
| 1758 | Ga0501038_0036894 | |||
| 1759 | Ga0501039_0054512 | |||
| 1760 | Ga0501047_0237558 | |||
| 1761 | Ga0501067_0563776 | |||
| 1762 | Ga0501069_0201607 | |||
| 1763 | Ga0501044_0004315 | |||
| 1764 | nmdc:mga03683_125171_c1 | |||
| 1765 | nmdc:mga03683_190892_c1 | |||
| 1766 | nmdc:mga03683_276580_c1 | |||
| 1767 | nmdc:mga03683_388_c2 | |||
| 1768 | nmdc:mga03683_41718_c1 | |||
| 1769 | nmdc:mga03n38_218922_c1 | |||
| 1770 | nmdc:mga03n38_539_c1 | |||
| 1771 | nmdc:mga03n38_828_c1 | |||
| 1772 | nmdc:mga03n38_99315_c1 | |||
| 1773 | nmdc:mga00v17_384175_c1 | |||
| 1774 | nmdc:mga00v17_736219_c1 | |||
| 1775 | nmdc:mga00v17_7580_c1 | |||
| 1776 | nmdc:mga0yw44_102005_c1 | |||
| 1777 | nmdc:mga0yw44_198931_c1 | |||
| 1778 | nmdc:mga0yw44_300815_c1 | |||
| 1779 | nmdc:mga0k408_136820_c1 | |||
| 1780 | nmdc:mga0k408_14577_c1 | |||
| 1781 | nmdc:mga0k408_15243_c1 | |||
| 1782 | nmdc:mga0k408_171345_c1 | |||
| 1783 | nmdc:mga0k408_472143_c1 | |||
| 1784 | nmdc:mga0k408_55072_c1 | |||
| 1785 | nmdc:mga0k408_7032_c2 | |||
| 1786 | nmdc:mga06z11_119096_c1 | |||
| 1787 | nmdc:mga06z11_132068_c1 | |||
| 1788 | nmdc:mga06z11_208051_c1 | |||
| 1789 | nmdc:mga06z11_242252_c1 | |||
| 1790 | nmdc:mga06z11_258306_c1 | |||
| 1791 | nmdc:mga06z11_367692_c1 | |||
| 1792 | nmdc:mga06z11_7925_c1 | |||
| 1793 | nmdc:mga04h51_114510_c1 | |||
| 1794 | nmdc:mga04h51_70935_c1 | |||
| 1795 | nmdc:mga07m45_114654_c1 | |||
| 1796 | nmdc:mga07m45_157081_c1 | |||
| 1797 | nmdc:mga07m45_21357_c1 | |||
| 1798 | nmdc:mga07m45_39579_c1 | |||
| 1799 | nmdc:mga07m45_54_c1 | |||
| 1800 | nmdc:mga07m45_96996_c1 | |||
| 1801 | nmdc:mga05p37_120055_c1 | |||
| 1802 | nmdc:mga0qj67_686162_c1 | |||
| 1803 | nmdc:mga08y16_527715_c1 | |||
| 1804 | nmdc:mga0rr50_208933_c1 | |||
| 1805 | nmdc:mga0a205_375369_c1 | |||
| 1806 | nmdc:mga0sz30_167638_c1 | |||
| 1807 | nmdc:mga0sz30_186040_c1 | |||
| 1808 | nmdc:mga0sz30_235_c1 | |||
| 1809 | Ga0495601_0002174 | |||
| 1810 | Ga0495601_0013992 | |||
| 1811 | Ga0495601_0540594 | |||
| 1812 | Ga0495612_0008623 | |||
| 1813 | Ga0495612_0021184 | |||
| 1814 | Ga0500610_0108645 | |||
| 1815 | Ga0500635_0092805 | |||
| 1816 | Ga0495595_0000257 | |||
| 1817 | Ga0495595_0040557 | |||
| 1818 | Ga0495595_0141229 | |||
| 1819 | Ga0495619_0000089 | |||
| 1820 | Ga0495619_0072158 | |||
| 1821 | Ga0495619_0086861 | |||
| 1822 | Ga0495619_0405984 | |||
| 1823 | Ga0495619_0443993 | |||
| 1824 | Ga0495619_0587514 | |||
| 1825 | Ga0500578_0149986 | |||
| 1826 | Ga0500644_0008229 | |||
| 1827 | Ga0500644_0055085 | |||
| 1828 | Ga0500646_0140391 | |||
| 1829 | Ga0500647_0106643 | |||
| 1830 | Ga0500566_0327937 | |||
| 1831 | Ga0500641_0084109 | |||
| 1832 | Ga0500556_0033556 | |||
| 1833 | Ga0500562_018606 | |||
| 1834 | Ga0500562_033923 | |||
| 1835 | Ga0500569_052576 | |||
| 1836 | Ga0500595_001326 | |||
| 1837 | Ga0500595_015953 | |||
| 1838 | Ga0500642_0261224 | |||
| 1839 | Ga0500652_262644 | |||
| 1840 | Ga0500655_009437 | |||
| 1841 | Ga0500658_0094165 | |||
| 1842 | Ga0500658_0249757 | |||
| 1843 | Ga0500559_0033345 | |||
| 1844 | Ga0500561_0078312 | |||
| 1845 | Ga0500573_0023818 | |||
| 1846 | Ga0500577_0065495 | |||
| 1847 | Ga0500589_100817 | |||
| 1848 | Ga0500589_114445 | |||
| 1849 | Ga0500590_048708 | |||
| 1850 | Ga0500590_126524 | |||
| 1851 | Ga0500616_0034848 | |||
| 1852 | Ga0500616_0318052 | |||
| 1853 | Ga0500622_0046683 | |||
| 1854 | Ga0500622_0122608 | |||
| 1855 | Ga0500627_0108683 | |||
| 1856 | Ga0500633_0148869 | |||
| 1857 | Ga0500636_0037456 | |||
| 1858 | Ga0500636_0043970 | |||
| 1859 | Ga0500637_0003656 | |||
| 1860 | Ga0500637_0117095 | |||
| 1861 | Ga0500637_0221548 | |||
| 1862 | Ga0500637_0386188 | |||
| 1863 | Ga0500609_006296 | |||
| 1864 | Ga0500609_011269 | |||
| 1865 | Ga0500596_003856 | |||
| 1866 | 2513698251 | |||
| 1867 | 2599748542 | |||
| 1868 | 2600210470 | |||
| 1869 | 2676746633 | |||
| 1870 | 2723848581 | |||
| 1871 | 2728755233 | |||
| 1872 | 2874606244 | |||
| 1873 | 2887376557 | |||
| 1874 | 2889036836 | |||
| 1875 | 8002392390 | |||
| 1876 | 8006988312 | |||
| 1877 | 8006999550 | |||
| 1878 | 8020948649 | |||
| 1879 | 8056679727 | |||
| 1880 | 8056692511 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8h2t-assembly1.cif.gz_H | cryo-em structure of iadd/e dioxygenase bound with iaa | 0.9275 | 4 | 160 |
| 8h2t-assembly1.cif.gz_H | cryo-em structure of iadd/e dioxygenase bound with iaa | 0.922 | 4 | 160 |
| 7o21-assembly1.cif.gz_B | structure of bdellovibrio bacteriovorus bd1075 | 0.8216 | 7 | 144 |
| 7o21-assembly1.cif.gz_A | structure of bdellovibrio bacteriovorus bd1075 | 0.8169 | 7 | 144 |
| 6ihj-assembly1.cif.gz_B | crystal structure of drosophila nxf1 ntf2 domain in complex with nxt1/p15 | 0.8124 | 11 | 146 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q47140_1_172_3.10.450.50 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.8088 | 2 | 160 | 3.10.450.50 |
| 2b1xB00 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.8069 | 4 | 160 | 3.10.450.50 |
| 2r4iB00 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.8019 | 5 | 147 | 3.10.450.50 |
| af_Q47140_1_172_3.10.450.50 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.7994 | 2 | 160 | 3.10.450.50 |
| 2bmoB00 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.7991 | 7 | 149 | 3.10.450.50 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4V1QZ72-F1-model_v4 | deleted | 0.9397 | 2 | 138 |
|
| AF-A0A3M6R7Y1-F1-model_v4 | Phenylpropionate dioxygenase | 0.9388 | 2 | 160 |
GO:0019380
GO:0051213 |
| AF-A0A071MLB5-F1-model_v4 | Phenylpropionate dioxygenase | 0.9378 | 1 | 160 |
GO:0019380
GO:0051213 |
| AF-A0A515DA17-F1-model_v4 | Phenylpropionate dioxygenase | 0.9368 | 4 | 160 |
GO:0019380
GO:0051213 |
| AF-A0A3M6R7Y1-F1-model_v4 | Phenylpropionate dioxygenase | 0.9331 | 2 | 160 |
GO:0019380
GO:0051213 |