F486313

General Info

Members Datasets Scaffolds Average Seq Length
940 427 1880 163

Family's Representative Sequence

Representative Sequence 3300031616|Ga0307508_10572961|Ga0307508_105729611
Length 187
Sequence MADAQPVPCLVEIHDDVDVMSGSMNALPNIPTDQQLIDFVIRETRLIDQHRFEEWLELFADDGYYWMPLEWGQTDPRLTTSLMYEDKLLLKIRVERLKGNRTFSQKPKSRCHHVLQTPQVDSRNNTANEYVTWTPMHYLETRLDQQTLYAAWATHTLAVVDGVLKIKLKRVDIVNCDAAFSNIQLFM

Samples

Sample ID Description Type Environment
1 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
2 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
10 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
11 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
12 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
13 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
67 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
68 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
69 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
70 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
71 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
72 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
73 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
74 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
75 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
76 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
77 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
78 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
79 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
80 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
81 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
84 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
85 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
86 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
87 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
88 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
89 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
90 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
92 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
93 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
94 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
95 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
96 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
97 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
98 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
99 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
101 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
102 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
103 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
104 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
105 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
106 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
107 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
108 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
109 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
110 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
111 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
112 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
113 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
114 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
115 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
116 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
117 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
118 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
119 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
120 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
121 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
122 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
123 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
124 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
125 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
126 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
131 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
133 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
195 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
196 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
200 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
201 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
202 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
203 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
204 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
205 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
206 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
207 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
208 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
209 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
210 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
211 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
212 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
213 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
214 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
215 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
216 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
217 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
218 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
219 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
220 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
221 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
222 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
223 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
224 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
225 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
226 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
227 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
228 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
229 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
230 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
231 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
232 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
233 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
234 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
235 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
236 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
237 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
238 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
239 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
240 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
241 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
242 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
243 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
244 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
245 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
246 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
247 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
248 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
249 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
250 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
251 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
252 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
253 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
254 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
255 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
256 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
257 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
258 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
259 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
260 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
261 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
262 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
263 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
264 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
265 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
266 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
267 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
268 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
269 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
270 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
271 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
272 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
273 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
274 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
275 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
276 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
277 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
278 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
279 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
280 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
281 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
282 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
283 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
284 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
285 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
286 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
287 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
288 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
289 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
290 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
291 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
292 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
293 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
294 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
295 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
296 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
297 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
298 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
299 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
300 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
301 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
302 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
303 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
304 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
305 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
306 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
307 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
308 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
309 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
310 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
311 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
312 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
313 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
314 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
315 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
316 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
317 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
318 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
319 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
320 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
321 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
322 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
323 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
324 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
325 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
326 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
327 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
328 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
329 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
330 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
331 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
332 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
333 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
334 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
335 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
336 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
337 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
338 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
339 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
340 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
341 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
342 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
343 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
344 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
345 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
346 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
347 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
348 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
349 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
350 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
351 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
352 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
353 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
354 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
355 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
356 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
357 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
358 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
359 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
360 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
361 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
362 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
363 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
364 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
365 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
366 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
367 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
368 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
369 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
370 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
371 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
372 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
373 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
374 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
375 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
376 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
377 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
378 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
379 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
380 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
381 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
382 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
383 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
384 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
385 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
386 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
387 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
388 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
389 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
390 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
391 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
392 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
393 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
394 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
395 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
396 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
397 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
398 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
399 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
400 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
401 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
402 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
403 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
404 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
405 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
406 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
407 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
408 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
409 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
410 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
411 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
412 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
413 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
414 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
415 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
416 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
417 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
418 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
419 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
420 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
421 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
422 8002392321 Alcaligenes faecalis Mc250 Isolate Rhizosphere
423 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
424 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
425 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
426 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
427 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.3
Metatranscriptomes 0.11
Isolates 1.6

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.85
Nodule 0.74
Rhizoplane 8.19
Rhizosphere 67.13
Stem 0
Stem Tuber 0
Unclassified 3.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307508_10572961 3300031616 Bacteria 728
2 RicEn_C2288 2010549000 Bacteria 1394
3 JGI25406J46586_10007733 3300003203 Bacteria 4889
4 JGI25153J46596_10009937 3300003215 Bacteria 4355
5 rootH1_10062104 3300003316 Bacteria 1386
6 rootH2_10082343 3300003320 Bacteria 4135
7 rootL2_10037120 3300003322 Bacteria 5597
8 rootH1_10258310 3300003323 Bacteria 1332
9 Ga0055527_1000417 3300003760 Bacteria 17581
10 Ga0055535_1001078 3300003761 Bacteria 16794
11 Ga0055542_1001702 3300003762 Bacteria 9544
12 Ga0065704_10040826 3300005289 Bacteria 1019
13 Ga0065715_10157121 3300005293 Bacteria 1664
14 Ga0070683_100254921 3300005329 Bacteria 1669
15 Ga0070690_100172410 3300005330 Bacteria 1490
16 Ga0070670_100005241 3300005331 Bacteria 10914
17 Ga0070670_100082724 3300005331 Bacteria 2759
18 Ga0070670_100949216 3300005331 Bacteria 781
19 Ga0070670_100968008 3300005331 Unclassified 773
20 Ga0068869_100022912 3300005334 Bacteria 4307
21 Ga0068869_100156195 3300005334 Bacteria 1773
22 Ga0068869_100351677 3300005334 Unclassified 1201
23 Ga0068869_100596600 3300005334 Bacteria 932
24 Ga0070666_10190029 3300005335 Bacteria 1443
25 Ga0070666_10472266 3300005335 Bacteria 907
26 Ga0070680_100032614 3300005336 Bacteria 4193
27 Ga0068868_100056725 3300005338 Bacteria 3093
28 Ga0068868_100511069 3300005338 Bacteria 1053
29 Ga0070660_100755196 3300005339 Bacteria 817
30 Ga0070689_100335981 3300005340 Bacteria 1265
31 Ga0070691_10286968 3300005341 Bacteria 895
32 Ga0070668_100237900 3300005347 Bacteria 1507
33 Ga0070675_100635482 3300005354 Bacteria 970
34 Ga0070671_100002026 3300005355 Bacteria 15597
35 Ga0070671_100718138 3300005355 Bacteria 867
36 Ga0070673_100019816 3300005364 Bacteria 4837
37 Ga0070673_100440968 3300005364 Bacteria 1170
38 Ga0070673_100569106 3300005364 Bacteria 1031
39 Ga0070673_100822652 3300005364 Bacteria 858
40 Ga0070688_100334649 3300005365 Bacteria 1104
41 Ga0070659_100219456 3300005366 Bacteria 1569
42 Ga0070659_100421717 3300005366 Bacteria 1128
43 Ga0070667_100187596 3300005367 Bacteria 1830
44 Ga0070667_100348847 3300005367 Bacteria 1339
45 Ga0070709_10331292 3300005434 Unclassified 1120
46 Ga0070709_11065472 3300005434 Bacteria 645
47 Ga0070714_100842963 3300005435 Unclassified 889
48 Ga0070714_101175572 3300005435 Bacteria 748
49 Ga0070713_100224686 3300005436 Bacteria 1704
50 Ga0070710_10157192 3300005437 Bacteria 1407
51 Ga0070710_10250650 3300005437 Bacteria 1138
52 Ga0070710_10309714 3300005437 Bacteria 1033
53 Ga0070711_100067451 3300005439 Bacteria 2510
54 Ga0070711_100188427 3300005439 Bacteria 1584
55 Ga0070711_100772862 3300005439 Bacteria 813
56 Ga0070708_100158225 3300005445 Bacteria 2110
57 Ga0070663_100128284 3300005455 Bacteria 1923
58 Ga0070663_100431573 3300005455 Unclassified 1083
59 Ga0070663_100434055 3300005455 Bacteria 1080
60 Ga0070678_100133624 3300005456 Bacteria 1975
61 Ga0070678_100230648 3300005456 Bacteria 1543
62 Ga0070678_100720836 3300005456 Bacteria 900
63 Ga0070662_100231213 3300005457 Bacteria 1479
64 Ga0070681_10045611 3300005458 Bacteria 4385
65 Ga0070681_10507742 3300005458 Bacteria 1119
66 Ga0070681_11316166 3300005458 Bacteria 645
67 Ga0068867_100354905 3300005459 Bacteria 1225
68 Ga0068867_101171219 3300005459 Bacteria 705
69 Ga0070685_10116171 3300005466 Bacteria 1656
70 Ga0070685_10186206 3300005466 Bacteria 1340
71 Ga0070685_10727194 3300005466 Bacteria 726
72 Ga0070706_100001519 3300005467 Bacteria 24333
73 Ga0070707_100146568 3300005468 Bacteria 2298
74 Ga0070698_100103788 3300005471 Bacteria 2813
75 Ga0070699_100077162 3300005518 Bacteria 2900
76 Ga0070699_100700329 3300005518 Bacteria 925
77 Ga0070697_100761345 3300005536 Bacteria 856
78 Ga0068853_100909078 3300005539 Bacteria 846
79 Ga0068853_101066506 3300005539 Bacteria 779
80 Ga0068853_101084321 3300005539 Bacteria 772
81 Ga0068853_101539578 3300005539 Bacteria 644
82 Ga0070672_100031959 3300005543 Bacteria 3968
83 Ga0070672_100116243 3300005543 Bacteria 2185
84 Ga0070672_100132603 3300005543 Bacteria 2049
85 Ga0070696_100001126 3300005546 Bacteria 17300
86 Ga0070696_100089868 3300005546 Bacteria 2184
87 Ga0070665_100001168 3300005548 Bacteria 32297
88 Ga0070665_100008760 3300005548 Bacteria 10241
89 Ga0070665_100023272 3300005548 Bacteria 6239
90 Ga0070665_100104923 3300005548 Bacteria 2828
91 Ga0070665_100165569 3300005548 Bacteria 2213
92 Ga0070665_100253187 3300005548 Bacteria 1762
93 Ga0070665_100331126 3300005548 Bacteria 1527
94 Ga0070665_100533509 3300005548 Bacteria 1185
95 Ga0070704_100081030 3300005549 Bacteria 2389
96 Ga0070704_100826874 3300005549 Bacteria 829
97 Ga0068855_100144386 3300005563 Bacteria 2711
98 Ga0070664_100733496 3300005564 Bacteria 922
99 Ga0068857_100046837 3300005577 Bacteria 3838
100 Ga0068856_100194292 3300005614 Bacteria 2043
101 Ga0068856_100554000 3300005614 Bacteria 1171
102 Ga0070702_100047519 3300005615 Bacteria 2438
103 Ga0068852_100300256 3300005616 Bacteria 1554
104 Ga0068852_101180518 3300005616 Unclassified 786
105 Ga0068859_100031093 3300005617 Bacteria 5360
106 Ga0068859_100553177 3300005617 Bacteria 1245
107 Ga0068859_100957838 3300005617 Bacteria 939
108 Ga0068859_102026297 3300005617 Bacteria 635
109 Ga0068866_10131614 3300005718 Bacteria 1423
110 Ga0068866_10333242 3300005718 Bacteria 958
111 Ga0068866_10762980 3300005718 Bacteria 669
112 Ga0068861_100318109 3300005719 Bacteria 1354
113 Ga0068861_101225968 3300005719 Bacteria 726
114 Ga0068863_100047665 3300005841 Bacteria 4064
115 Ga0068863_101123701 3300005841 Bacteria 791
116 Ga0068863_101815324 3300005841 Bacteria 619
117 Ga0068858_100009170 3300005842 Bacteria 9458
118 Ga0068858_100030212 3300005842 Bacteria 5032
119 Ga0068858_100106653 3300005842 Bacteria 2615
120 Ga0068858_100358649 3300005842 Bacteria 1397
121 Ga0068860_100000371 3300005843 Bacteria 59118
122 Ga0068860_100429365 3300005843 Bacteria 1311
123 Ga0068860_101261294 3300005843 Bacteria 760
124 Ga0068862_100072305 3300005844 Bacteria 2979
125 Ga0068862_100115909 3300005844 Bacteria 2356
126 Ga0068862_100178233 3300005844 Bacteria 1906
127 Ga0068862_100315474 3300005844 Bacteria 1442
128 Ga0068862_100394225 3300005844 Bacteria 1294
129 Ga0068862_100418134 3300005844 Bacteria 1257
130 Ga0068862_101276107 3300005844 Unclassified 735
131 Ga0068862_101446805 3300005844 Bacteria 691
132 Ga0081455_10024630 3300005937 Bacteria 5568
133 Ga0081455_10274437 3300005937 Bacteria 1221
134 Ga0081538_10087765 3300005981 Bacteria 1622
135 Ga0081539_10002040 3300005985 Bacteria 30429
136 Ga0081539_10053494 3300005985 Bacteria 2260
137 Ga0070717_10073245 3300006028 Bacteria 2862
138 Ga0075365_10077896 3300006038 Bacteria 2240
139 Ga0075365_10204544 3300006038 Bacteria 1383
140 Ga0075365_10272920 3300006038 Bacteria 1189
141 Ga0075365_10290379 3300006038 Bacteria 1150
142 Ga0075365_10537715 3300006038 Bacteria 826
143 Ga0075365_10584898 3300006038 Bacteria 789
144 Ga0075368_10012344 3300006042 Bacteria 3120
145 Ga0075368_10111160 3300006042 Bacteria 1130
146 Ga0075368_10221625 3300006042 Bacteria 804
147 Ga0075368_10301229 3300006042 Bacteria 692
148 Ga0075363_100010922 3300006048 Bacteria 4333
149 Ga0075363_100013697 3300006048 Bacteria 3942
150 Ga0075363_100377422 3300006048 Bacteria 831
151 Ga0075363_100482629 3300006048 Bacteria 735
152 Ga0075363_100653730 3300006048 Bacteria 633
153 Ga0075364_10003559 3300006051 Bacteria 8869
154 Ga0075364_10381333 3300006051 Bacteria 962
155 Ga0075432_10128445 3300006058 Bacteria 958
156 Ga0070715_10085500 3300006163 Bacteria 1441
157 Ga0070715_10109493 3300006163 Bacteria 1301
158 Ga0070716_100055570 3300006173 Bacteria 2266
159 Ga0070716_100141053 3300006173 Bacteria 1537
160 Ga0070716_100218864 3300006173 Bacteria 1278
161 Ga0070716_100602234 3300006173 Bacteria 827
162 Ga0070712_100457231 3300006175 Bacteria 1064
163 Ga0070712_100484306 3300006175 Bacteria 1035
164 Ga0070712_100558073 3300006175 Bacteria 966
165 Ga0075362_10001867 3300006177 Bacteria 6897
166 Ga0075362_10003987 3300006177 Bacteria 5250
167 Ga0075362_10005810 3300006177 Bacteria 4549
168 Ga0075362_10012898 3300006177 Bacteria 3332
169 Ga0075362_10045963 3300006177 Bacteria 1940
170 Ga0075362_10133581 3300006177 Bacteria 1182
171 Ga0075367_10004238 3300006178 Bacteria 6965
172 Ga0075367_10024609 3300006178 Bacteria 3397
173 Ga0075367_10051802 3300006178 Bacteria 2427
174 Ga0075367_10059138 3300006178 Bacteria 2281
175 Ga0075367_10149611 3300006178 Bacteria 1448
176 Ga0075367_10184420 3300006178 Bacteria 1301
177 Ga0075367_10192494 3300006178 Bacteria 1273
178 Ga0075367_10596757 3300006178 Bacteria 702
179 Ga0075367_10810066 3300006178 Bacteria 597
180 Ga0075369_10031610 3300006186 Bacteria 2236
181 Ga0075369_10131079 3300006186 Bacteria 1139
182 Ga0075366_10004721 3300006195 Bacteria 7338
183 Ga0075366_10010783 3300006195 Bacteria 5139
184 Ga0075366_10013639 3300006195 Bacteria 4632
185 Ga0075366_10060089 3300006195 Bacteria 2258
186 Ga0075366_10079235 3300006195 Bacteria 1960
187 Ga0075366_10082715 3300006195 Bacteria 1918
188 Ga0075366_10095409 3300006195 Bacteria 1783
189 Ga0075366_10136270 3300006195 Bacteria 1483
190 Ga0075366_10219425 3300006195 Bacteria 1158
191 Ga0097621_100074080 3300006237 Bacteria 2819
192 Ga0097621_100237354 3300006237 Bacteria 1593
193 Ga0075370_10000711 3300006353 Bacteria 13157
194 Ga0075370_10002157 3300006353 Bacteria 9010
195 Ga0075370_10006505 3300006353 Bacteria 5883
196 Ga0075370_10020638 3300006353 Bacteria 3604
197 Ga0075370_10027738 3300006353 Bacteria 3144
198 Ga0075370_10049171 3300006353 Bacteria 2390
199 Ga0075370_10110607 3300006353 Bacteria 1596
200 Ga0075370_10403291 3300006353 Bacteria 820
201 Ga0068871_100295741 3300006358 Bacteria 1420
202 Ga0075428_100025261 3300006844 Bacteria 6574
203 Ga0075430_100741538 3300006846 Bacteria 810
204 Ga0075431_100004883 3300006847 Bacteria 13205
205 Ga0068865_100092989 3300006881 Bacteria 2192
206 Ga0068865_101027572 3300006881 Bacteria 723
207 Ga0075436_100671810 3300006914 Bacteria 766
208 Ga0097620_100031093 3300006931 Bacteria 5360
209 Ga0097620_100553294 3300006931 Bacteria 1245
210 Ga0097620_100957977 3300006931 Bacteria 939
211 Ga0097620_102026270 3300006931 Bacteria 635
212 Ga0075435_100701492 3300007076 Bacteria 880
213 Ga0099794_10000442 3300007265 Bacteria 13852
214 Ga0099795_10000966 3300007788 Bacteria 5846
215 Ga0105244_10500930 3300009036 Bacteria 559
216 Ga0105250_10018498 3300009092 Bacteria 2821
217 Ga0105240_10006809 3300009093 Bacteria 16710
218 Ga0105240_10026644 3300009093 Bacteria 7586
219 Ga0105240_10043543 3300009093 Bacteria 5711
220 Ga0105240_10118414 3300009093 Bacteria 3191
221 Ga0105240_10270002 3300009093 Bacteria 1959
222 Ga0105240_10391995 3300009093 Bacteria 1566
223 Ga0105240_10414441 3300009093 Bacteria 1515
224 Ga0105240_10471381 3300009093 Bacteria 1401
225 Ga0105240_10652328 3300009093 Unclassified 1153
226 Ga0105245_10048817 3300009098 Bacteria 3787
227 Ga0105245_10188396 3300009098 Bacteria 1975
228 Ga0105245_10332764 3300009098 Bacteria 1499
229 Ga0105247_10055529 3300009101 Bacteria 2444
230 Ga0105247_10559129 3300009101 Bacteria 842
231 Ga0114129_10090122 3300009147 Bacteria 4251
232 Ga0105243_10230554 3300009148 Bacteria 1643
233 Ga0105243_10418523 3300009148 Bacteria 1249
234 Ga0105243_11323712 3300009148 Bacteria 738
235 Ga0105241_10085696 3300009174 Bacteria 2476
236 Ga0105241_10120621 3300009174 Bacteria 2111
237 Ga0105241_10349754 3300009174 Unclassified 1283
238 Ga0105242_10546036 3300009176 Bacteria 1110
239 Ga0105248_10146332 3300009177 Bacteria 2666
240 Ga0105248_10357819 3300009177 Bacteria 1643
241 Ga0105248_10589821 3300009177 Bacteria 1254
242 Ga0105248_11843389 3300009177 Bacteria 686
243 Ga0105237_10091285 3300009545 Bacteria 3035
244 Ga0105237_10157191 3300009545 Bacteria 2271
245 Ga0105237_10169986 3300009545 Bacteria 2179
246 Ga0105237_10191072 3300009545 Bacteria 2048
247 Ga0105237_10262331 3300009545 Bacteria 1730
248 Ga0105237_10623308 3300009545 Bacteria 1086
249 Ga0105237_10767295 3300009545 Bacteria 971
250 Ga0105238_10302473 3300009551 Bacteria 1583
251 Ga0105238_10398409 3300009551 Bacteria 1369
252 Ga0105238_10509903 3300009551 Bacteria 1204
253 Ga0105238_10572997 3300009551 Bacteria 1135
254 Ga0105238_11081248 3300009551 Bacteria 824
255 Ga0105249_10040039 3300009553 Bacteria 4256
256 Ga0105249_10087193 3300009553 Bacteria 2912
257 Ga0105249_10629004 3300009553 Bacteria 1130
258 Ga0105249_10975300 3300009553 Bacteria 916
259 Ga0105249_11130230 3300009553 Bacteria 854
260 Ga0099796_10070719 3300010159 Bacteria 1259
261 Ga0099796_10195595 3300010159 Bacteria 818
262 Ga0105239_10150693 3300010375 Bacteria 2596
263 Ga0105239_10154231 3300010375 Bacteria 2564
264 Ga0105239_10278682 3300010375 Bacteria 1882
265 Ga0105239_10753307 3300010375 Bacteria 1115
266 Ga0105239_11037005 3300010375 Bacteria 943
267 Ga0105239_11841851 3300010375 Bacteria 701
268 Ga0105246_10685185 3300011119 Bacteria 896
269 Ga0157335_1004574 3300012492 Bacteria 936
270 Ga0157347_1022954 3300012502 Bacteria 741
271 Ga0157369_10459770 3300013105 Bacteria 1318
272 Ga0157369_10757423 3300013105 Bacteria 999
273 Ga0157374_10171374 3300013296 Bacteria 2117
274 Ga0157374_10532719 3300013296 Bacteria 1181
275 Ga0157374_10831984 3300013296 Bacteria 940
276 Ga0157378_10217349 3300013297 Bacteria 1815
277 Ga0157378_10321917 3300013297 Bacteria 1502
278 Ga0163162_10022525 3300013306 Bacteria 6208
279 Ga0163162_10845071 3300013306 Bacteria 1031
280 Ga0163162_10883254 3300013306 Bacteria 1008
281 Ga0157375_10134352 3300013308 Bacteria 2596
282 Ga0157375_10407926 3300013308 Bacteria 1525
283 Ga0157375_10596691 3300013308 Bacteria 1264
284 Ga0157375_11325440 3300013308 Unclassified 847
285 Ga0163163_10118326 3300014325 Bacteria 2682
286 Ga0163163_10360541 3300014325 Bacteria 1510
287 Ga0163163_10398266 3300014325 Bacteria 1435
288 Ga0163163_11388170 3300014325 Bacteria 764
289 Ga0157380_10263585 3300014326 Bacteria 1567
290 Ga0157380_11094041 3300014326 Bacteria 836
291 Ga0182008_10135092 3300014497 Bacteria 1231
292 Ga0157379_10161974 3300014968 Bacteria 2019
293 Ga0157379_10266766 3300014968 Bacteria 1556
294 Ga0157379_10314154 3300014968 Unclassified 1430
295 Ga0157379_10344676 3300014968 Bacteria 1363
296 Ga0157379_10396549 3300014968 Bacteria 1268
297 Ga0157379_10606760 3300014968 Bacteria 1022
298 Ga0157376_10458591 3300014969 Bacteria 1245
299 Ga0157376_10472995 3300014969 Bacteria 1227
300 Ga0157376_11843223 3300014969 Bacteria 641
301 Ga0182006_1026974 3300015261 Bacteria 2348
302 Ga0163161_10184373 3300017792 Bacteria 1602
303 Ga0163161_10626849 3300017792 Bacteria 889
304 Ga0213872_10186324 3300021361 Bacteria 895
305 Ga0228598_1000670 3300024227 Bacteria 7214
306 Ga0209672_100015 3300025228 Bacteria 529352
307 Ga0209147_100016 3300025229 Bacteria 527606
308 Ga0209258_100026 3300025242 Bacteria 527606
309 Ga0209148_1001962 3300025254 Bacteria 8265
310 Ga0209759_1003001 3300025256 Bacteria 6987
311 Ga0209455_1000812 3300025272 Bacteria 17050
312 Ga0209758_1000240 3300025297 Bacteria 114169
313 Ga0209758_1005019 3300025297 Bacteria 10546
314 Ga0209758_1077614 3300025297 Bacteria 1017
315 Ga0207697_10075807 3300025315 Bacteria 1413
316 Ga0207656_10495171 3300025321 Bacteria 620
317 Ga0207653_10011428 3300025885 Bacteria 2771
318 Ga0207682_10146749 3300025893 Bacteria 1062
319 Ga0207692_10139078 3300025898 Bacteria 1380
320 Ga0207692_10551702 3300025898 Bacteria 736
321 Ga0207710_10091521 3300025900 Bacteria 1424
322 Ga0207710_10121598 3300025900 Bacteria 1247
323 Ga0207710_10155667 3300025900 Bacteria 1111
324 Ga0207688_10071903 3300025901 Bacteria 1965
325 Ga0207680_10367061 3300025903 Bacteria 1013
326 Ga0207680_10436702 3300025903 Bacteria 928
327 Ga0207647_10137293 3300025904 Bacteria 1434
328 Ga0207685_10208835 3300025905 Bacteria 922
329 Ga0207699_10162592 3300025906 Bacteria 1487
330 Ga0207699_10536609 3300025906 Bacteria 847
331 Ga0207645_10115816 3300025907 Bacteria 1738
332 Ga0207684_10013902 3300025910 Bacteria 6953
333 Ga0207684_10522164 3300025910 Bacteria 1017
334 Ga0207654_10005798 3300025911 Bacteria 6232
335 Ga0207654_10175894 3300025911 Bacteria 1393
336 Ga0207654_10182135 3300025911 Bacteria 1371
337 Ga0207707_10724874 3300025912 Bacteria 833
338 Ga0207695_10002871 3300025913 Bacteria 25012
339 Ga0207695_10111961 3300025913 Bacteria 2708
340 Ga0207695_10197006 3300025913 Bacteria 1930
341 Ga0207695_10378063 3300025913 Bacteria 1302
342 Ga0207695_10491880 3300025913 Bacteria 1109
343 Ga0207695_10571542 3300025913 Unclassified 1012
344 Ga0207695_11285764 3300025913 Bacteria 612
345 Ga0207671_10040030 3300025914 Bacteria 3470
346 Ga0207671_10117291 3300025914 Bacteria 2032
347 Ga0207671_10177589 3300025914 Bacteria 1656
348 Ga0207671_10764028 3300025914 Unclassified 767
349 Ga0207693_10035791 3300025915 Bacteria 3914
350 Ga0207693_10135688 3300025915 Bacteria 1935
351 Ga0207693_10175802 3300025915 Bacteria 1685
352 Ga0207693_10252415 3300025915 Bacteria 1384
353 Ga0207663_10171798 3300025916 Bacteria 1540
354 Ga0207663_10221250 3300025916 Bacteria 1377
355 Ga0207662_10178711 3300025918 Bacteria 1365
356 Ga0207649_10070154 3300025920 Bacteria 2234
357 Ga0207652_10070870 3300025921 Bacteria 3028
358 Ga0207646_10187194 3300025922 Bacteria 1870
359 Ga0207681_10799822 3300025923 Unclassified 788
360 Ga0207694_10518297 3300025924 Bacteria 999
361 Ga0207694_10742309 3300025924 Unclassified 828
362 Ga0207694_10817967 3300025924 Bacteria 787
363 Ga0207650_10273758 3300025925 Bacteria 1373
364 Ga0207650_10860355 3300025925 Unclassified 769
365 Ga0207650_11233842 3300025925 Unclassified 636
366 Ga0207659_10532425 3300025926 Bacteria 997
367 Ga0207687_10011613 3300025927 Bacteria 5755
368 Ga0207687_10150722 3300025927 Bacteria 1774
369 Ga0207687_11503913 3300025927 Bacteria 578
370 Ga0207700_10065555 3300025928 Bacteria 2772
371 Ga0207700_10386812 3300025928 Bacteria 1224
372 Ga0207664_10905942 3300025929 Bacteria 792
373 Ga0207644_10014094 3300025931 Bacteria 5346
374 Ga0207644_11071500 3300025931 Bacteria 677
375 Ga0207706_10034459 3300025933 Bacteria 4504
376 Ga0207706_10102321 3300025933 Bacteria 2520
377 Ga0207706_10262770 3300025933 Bacteria 1507
378 Ga0207709_10258641 3300025935 Bacteria 1275
379 Ga0207670_10130274 3300025936 Bacteria 1842
380 Ga0207670_10542674 3300025936 Bacteria 949
381 Ga0207669_10579214 3300025937 Bacteria 909
382 Ga0207704_10301008 3300025938 Bacteria 1228
383 Ga0207704_10610249 3300025938 Bacteria 894
384 Ga0207665_10334722 3300025939 Bacteria 1139
385 Ga0207665_10476951 3300025939 Bacteria 961
386 Ga0207665_10880545 3300025939 Bacteria 710
387 Ga0207691_10114806 3300025940 Bacteria 2392
388 Ga0207691_10183967 3300025940 Bacteria 1825
389 Ga0207691_10234680 3300025940 Bacteria 1587
390 Ga0207691_10306156 3300025940 Bacteria 1364
391 Ga0207711_10127440 3300025941 Bacteria 2279
392 Ga0207711_10372632 3300025941 Bacteria 1324
393 Ga0207711_10518414 3300025941 Bacteria 1111
394 Ga0207711_10695412 3300025941 Bacteria 948
395 Ga0207689_10044841 3300025942 Bacteria 3657
396 Ga0207689_10071481 3300025942 Bacteria 2850
397 Ga0207689_10172400 3300025942 Bacteria 1784
398 Ga0207661_10416929 3300025944 Bacteria 1219
399 Ga0207661_10732522 3300025944 Bacteria 910
400 Ga0207667_10322990 3300025949 Bacteria 1576
401 Ga0207667_10702318 3300025949 Bacteria 1014
402 Ga0207667_10739936 3300025949 Bacteria 983
403 Ga0207651_10014597 3300025960 Bacteria 4542
404 Ga0207651_10251259 3300025960 Bacteria 1447
405 Ga0207651_10293512 3300025960 Bacteria 1349
406 Ga0207651_10553425 3300025960 Bacteria 1001
407 Ga0207712_10127977 3300025961 Bacteria 1931
408 Ga0207668_10014378 3300025972 Bacteria 4896
409 Ga0207640_10164918 3300025981 Bacteria 1644
410 Ga0207658_10301893 3300025986 Unclassified 1380
411 Ga0207658_10527618 3300025986 Bacteria 1054
412 Ga0207658_10552494 3300025986 Bacteria 1030
413 Ga0207677_10573240 3300026023 Bacteria 987
414 Ga0207703_10000923 3300026035 Bacteria 28611
415 Ga0207703_10057967 3300026035 Bacteria 3159
416 Ga0207703_10409211 3300026035 Bacteria 1260
417 Ga0207703_10435526 3300026035 Bacteria 1222
418 Ga0207639_10040025 3300026041 Bacteria 3496
419 Ga0207639_10354933 3300026041 Bacteria 1310
420 Ga0207639_10751778 3300026041 Bacteria 906
421 Ga0207639_11039247 3300026041 Bacteria 768
422 Ga0207678_10058697 3300026067 Bacteria 3311
423 Ga0207708_10163999 3300026075 Bacteria 1756
424 Ga0207702_10228829 3300026078 Bacteria 1736
425 Ga0207641_10011353 3300026088 Bacteria 7310
426 Ga0207648_10061324 3300026089 Bacteria 3279
427 Ga0207648_10070090 3300026089 Bacteria 3056
428 Ga0207648_10875518 3300026089 Bacteria 838
429 Ga0207648_11272618 3300026089 Bacteria 691
430 Ga0207676_10128952 3300026095 Bacteria 2147
431 Ga0207676_10289901 3300026095 Bacteria 1490
432 Ga0207674_10137422 3300026116 Bacteria 2405
433 Ga0207674_10430759 3300026116 Bacteria 1275
434 Ga0207674_10719827 3300026116 Bacteria 963
435 Ga0207675_100068646 3300026118 Bacteria 3312
436 Ga0207675_100315204 3300026118 Bacteria 1526
437 Ga0207675_100393820 3300026118 Bacteria 1364
438 Ga0207675_101434422 3300026118 Bacteria 711
439 Ga0207683_10037457 3300026121 Bacteria 4223
440 Ga0207683_10159141 3300026121 Bacteria 2041
441 Ga0207698_10092750 3300026142 Bacteria 2477
442 Ga0207698_10454367 3300026142 Bacteria 1237
443 Ga0207698_10972919 3300026142 Bacteria 858
444 Ga0209179_1002231 3300027512 Bacteria 2578
445 Ga0209813_10234593 3300027866 Bacteria 692
446 Ga0209813_10246645 3300027866 Bacteria 677
447 Ga0207428_10382796 3300027907 Bacteria 1032
448 Ga0268266_10004725 3300028379 Bacteria 12957
449 Ga0268266_10005936 3300028379 Bacteria 11292
450 Ga0268266_10134027 3300028379 Bacteria 2217
451 Ga0268266_10214112 3300028379 Bacteria 1768
452 Ga0268265_10041239 3300028380 Bacteria 3414
453 Ga0268265_10150353 3300028380 Bacteria 1963
454 Ga0268265_10175657 3300028380 Bacteria 1835
455 Ga0268265_10352668 3300028380 Bacteria 1344
456 Ga0268265_10596417 3300028380 Unclassified 1055
457 Ga0268264_10000151 3300028381 Bacteria 158241
458 Ga0268264_10265545 3300028381 Bacteria 1601
459 Ga0268264_10351764 3300028381 Bacteria 1403
460 Ga0265334_10026004 3300028573 Bacteria 2366
461 Ga0307517_10000235 3300028786 Bacteria 93944
462 Ga0307517_10144167 3300028786 Bacteria 1659
463 Ga0307515_10000014 3300028794 Bacteria 562358
464 Ga0307515_10000424 3300028794 Bacteria 101910
465 Ga0307515_10027689 3300028794 Bacteria 9672
466 Ga0307515_10038046 3300028794 Bacteria 7712
467 Ga0307515_10150180 3300028794 Bacteria 2440
468 Ga0307515_10153597 3300028794 Bacteria 2391
469 Ga0307515_10243825 3300028794 Bacteria 1562
470 Ga0265338_10079204 3300028800 Bacteria 2766
471 Ga0307511_10001160 3300030521 Bacteria 28060
472 Ga0307512_10196542 3300030522 Bacteria 1101
473 Ga0265760_10085776 3300031090 Bacteria 980
474 Ga0265340_10182459 3300031247 Bacteria 948
475 Ga0265316_10784000 3300031344 Bacteria 669
476 Ga0307513_10012664 3300031456 Bacteria 10389
477 Ga0307513_10041680 3300031456 Bacteria 5064
478 Ga0307513_10572658 3300031456 Bacteria 840
479 Ga0307513_10663977 3300031456 Bacteria 749
480 Ga0307509_10000056 3300031507 Bacteria 157836
481 Ga0307509_10017926 3300031507 Bacteria 8130
482 Ga0307509_10035087 3300031507 Bacteria 5508
483 Ga0307408_100745301 3300031548 Bacteria 884
484 Ga0307508_10000003 3300031616 Bacteria 321602
485 Ga0307508_10003404 3300031616 Bacteria 16091
486 Ga0307508_10007698 3300031616 Bacteria 10014
487 Ga0307508_10088121 3300031616 Bacteria 2687
488 Ga0307508_10220855 3300031616 Bacteria 1495
489 Ga0307516_10004419 3300031730 Bacteria 17372
490 Ga0307516_10156207 3300031730 Bacteria 2036
491 Ga0307516_10261844 3300031730 Bacteria 1419
492 Ga0307516_10297417 3300031730 Bacteria 1291
493 Ga0307413_10006806 3300031824 Bacteria 5254
494 Ga0326468_10018756 3300031889 Bacteria 803
495 Ga0307412_11036920 3300031911 Bacteria 727
496 Ga0307409_100335528 3300031995 Bacteria 1420
497 Ga0307414_11214478 3300032004 Bacteria 698
498 Ga0307415_100628539 3300032126 Bacteria 959
499 Ga0307507_10169357 3300033179 Bacteria 1591
500 Ga0307507_10343597 3300033179 Unclassified 882
501 Ga0307510_10000003 3300033180 Bacteria 756654
502 Ga0307510_10002062 3300033180 Bacteria 22705
503 Ga0307510_10038663 3300033180 Bacteria 5272
504 Ga0307510_10059573 3300033180 Bacteria 3940
505 Ga0373930_0041994 3300034816 Bacteria 977
506 Ga0373949_0029168 3300035090 Bacteria 1306
507 Ga0373923_0032315 3300035111 Bacteria 2114
508 Ga0373954_0005967 3300035118 Bacteria 5300
509 Ga0373954_0029469 3300035118 Bacteria 2527
510 Ga0373954_0077649 3300035118 Bacteria 1584
511 Ga0373954_0276955 3300035118 Bacteria 827
512 Ga0373956_0007402 3300035119 Bacteria 4420
513 Ga0373957_0035416 3300035120 Bacteria 1855
514 Ga0373943_0018460 3300035170 Bacteria 3206
515 Ga0373943_0054840 3300035170 Bacteria 1973
516 Ga0373943_0124506 3300035170 Bacteria 1373
517 Ga0373943_0136430 3300035170 Bacteria 1318
518 Ga0373943_0828679 3300035170 Unclassified 551
519 Ga0373955_0022961 3300035172 Bacteria 3172
520 Ga0373942_0120412 3300035207 Bacteria 820
521 Ga0373924_0118299 3300035410 Bacteria 1149
522 Ga0373931_0010516 3300035691 Bacteria 4448
523 Ga0373935_0079563 3300035692 Bacteria 2128
524 Ga0373935_1376275 3300035692 Bacteria 527
525 Ga0373927_0138115 3300035695 Bacteria 1593
526 Ga0373927_0176992 3300035695 Unclassified 1399
527 Ga0373933_0000981 3300035724 Bacteria 17438
528 Ga0373933_0480392 3300035724 Bacteria 814
529 Ga0373947_0239049 3300035725 Bacteria 1198
530 Ga0373947_0565100 3300035725 Bacteria 775
531 Ga0373937_0000294 3300036401 Bacteria 47485
532 Ga0373937_0118994 3300036401 Bacteria 2461
533 Ga0373937_0458255 3300036401 Bacteria 1211
534 Ga0373937_1071635 3300036401 Bacteria 755
535 Ga0373925_0487973 3300037068 Bacteria 1011
536 Ga0395900_0010476 3300037418 Bacteria 9483
537 Ga0395900_0266461 3300037418 Bacteria 1709
538 Ga0395905_0207985 3300037471 Bacteria 1834
539 Ga0395905_0854414 3300037471 Bacteria 813
540 Ga0395901_0585422 3300038443 Bacteria 1127
541 Ga0436365_0258411 3300039437 Bacteria 993
542 Ga0436365_0562314 3300039437 Bacteria 1003
543 Ga0436360_0244199 3300039438 Bacteria 843
544 Ga0436363_0288115 3300039450 Bacteria 2355
545 Ga0436363_0601769 3300039450 Bacteria 1053
546 Ga0436363_1695463 3300039450 Bacteria 1094
547 Ga0439461_0024173 3300041410 Bacteria 1227
548 Ga0439461_0048664 3300041410 Bacteria 935
549 Ga0451797_1010531 3300041453 Bacteria 606
550 Ga0451795_1197467 3300041456 Bacteria 897
551 Ga0451800_0219623 3300041459 Bacteria 1009
552 Ga0451807_0330699 3300041486 Bacteria 1623
553 Ga0439431_0038905 3300041997 Bacteria 1205
554 Ga0439445_0092407 3300042004 Bacteria 853
555 Ga0439432_167931 3300042006 Bacteria 641
556 Ga0450898_023487 3300042134 Bacteria 1097
557 Ga0439446_0064655 3300042156 Bacteria 1111
558 Ga0439459_0052039 3300042438 Bacteria 902
559 Ga0466972_0329827 3300044658 Unclassified 713
560 Ga0466966_0197918 3300044684 Bacteria 1216
561 Ga0466961_0004263 3300044693 Bacteria 8949
562 Ga0466971_0362446 3300044719 Bacteria 703
563 Ga0466959_0012524 3300045049 Bacteria 6131
564 Ga0466959_0071056 3300045049 Bacteria 2521
565 Ga0466959_0116423 3300045049 Bacteria 1903
566 Ga0495592_0105607 3300046454 Bacteria 2000
567 Ga0495603_0057356 3300046455 Bacteria 2304
568 Ga0495603_0149867 3300046455 Bacteria 1355
569 Ga0495603_0206073 3300046455 Bacteria 1136
570 Ga0495603_0338158 3300046455 Bacteria 864
571 Ga0495603_0382481 3300046455 Bacteria 807
572 Ga0495629_0001072 3300046459 Bacteria 21851
573 Ga0495638_0194879 3300046460 Bacteria 1147
574 Ga0495641_0055933 3300046461 Bacteria 1790
575 Ga0495651_0001380 3300046462 Bacteria 18836
576 Ga0495651_0270877 3300046462 Bacteria 1151
577 Ga0495651_0584173 3300046462 Bacteria 706
578 Ga0495653_0000774 3300046463 Bacteria 24565
579 Ga0495650_0049494 3300046471 Bacteria 1745
580 Ga0495580_0000310 3300046472 Bacteria 39754
581 Ga0495580_0005440 3300046472 Bacteria 10523
582 Ga0495580_0181892 3300046472 Bacteria 1452
583 Ga0495580_0398148 3300046472 Unclassified 929
584 Ga0495582_0089667 3300046473 Bacteria 1714
585 Ga0495605_0342048 3300046474 Bacteria 628
586 Ga0495662_0054837 3300046476 Bacteria 1926
587 Ga0495662_0067258 3300046476 Bacteria 1734
588 Ga0495664_0037948 3300046477 Bacteria 2844
589 Ga0495664_0105246 3300046477 Bacteria 1701
590 Ga0495664_0188950 3300046477 Bacteria 1249
591 Ga0495585_0089509 3300046492 Bacteria 1659
592 Ga0495585_0407523 3300046492 Bacteria 654
593 Ga0495594_0349966 3300046499 Bacteria 841
594 Ga0495606_0119103 3300046507 Bacteria 1582
595 Ga0495606_0170831 3300046507 Unclassified 1261
596 Ga0495608_0000148 3300046511 Bacteria 50904
597 Ga0495608_0237573 3300046511 Bacteria 1139
598 Ga0495608_0658578 3300046511 Bacteria 625
599 Ga0495610_0089866 3300046512 Bacteria 1394
600 Ga0495618_0008092 3300046514 Bacteria 6367
601 Ga0495618_0159314 3300046514 Bacteria 1439
602 Ga0495618_0569981 3300046514 Bacteria 676
603 Ga0495620_0065393 3300046515 Bacteria 1501
604 Ga0495620_0079264 3300046515 Bacteria 1331
605 Ga0495628_0003843 3300046516 Bacteria 13392
606 Ga0495628_0125761 3300046516 Bacteria 1964
607 Ga0495628_0600701 3300046516 Bacteria 786
608 Ga0495630_0237991 3300046517 Bacteria 1391
609 Ga0495631_0120517 3300046518 Bacteria 1128
610 Ga0495632_0056594 3300046519 Bacteria 1917
611 Ga0495632_0066436 3300046519 Bacteria 1740
612 Ga0495632_0083260 3300046519 Bacteria 1524
613 Ga0495643_0114100 3300046522 Bacteria 1371
614 Ga0495643_0177050 3300046522 Bacteria 1039
615 Ga0495643_0248259 3300046522 Bacteria 832
616 Ga0495648_0241717 3300046524 Bacteria 877
617 Ga0495652_0003165 3300046529 Bacteria 16410
618 Ga0495652_0228413 3300046529 Bacteria 1394
619 Ga0495652_0697414 3300046529 Bacteria 683
620 Ga0495665_0283066 3300046531 Bacteria 850
621 Ga0495640_0002047 3300046533 Bacteria 16081
622 Ga0495640_0236437 3300046533 Bacteria 1148
623 Ga0495587_0000957 3300046536 Bacteria 18905
624 Ga0495587_0036109 3300046536 Bacteria 2974
625 Ga0495587_0183344 3300046536 Bacteria 1186
626 Ga0495587_0410989 3300046536 Bacteria 752
627 Ga0495598_0002017 3300046537 Bacteria 4129
628 Ga0495609_0077793 3300046538 Bacteria 1452
629 Ga0495609_0174371 3300046538 Bacteria 907
630 Ga0495609_0319410 3300046538 Unclassified 630
631 Ga0495621_0039962 3300046539 Bacteria 1642
632 Ga0495597_0021603 3300046542 Bacteria 2991
633 Ga0495597_0098366 3300046542 Bacteria 1236
634 Ga0495645_0052774 3300046543 Bacteria 2957
635 Ga0495645_0402719 3300046543 Bacteria 872
636 Ga0495645_0430473 3300046543 Bacteria 836
637 Ga0495622_0110759 3300046557 Bacteria 1257
638 Ga0495633_0143606 3300046558 Bacteria 1103
639 Ga0495667_0000352 3300046559 Bacteria 29153
640 Ga0495667_0228736 3300046559 Bacteria 1186
641 Ga0495656_0002096 3300046615 Bacteria 6586
642 Ga0495656_0060290 3300046615 Bacteria 1653
643 Ga0495656_0103070 3300046615 Bacteria 1322
644 Ga0495656_0231680 3300046615 Bacteria 927
645 Ga0495668_0435561 3300046616 Bacteria 721
646 Ga0495668_0526728 3300046616 Bacteria 652
647 Ga0495668_0648802 3300046616 Bacteria 583
648 Ga0495634_0001972 3300046642 Bacteria 17500
649 Ga0495634_0177131 3300046642 Bacteria 1337
650 Ga0495625_0072288 3300046660 Bacteria 2419
651 Ga0495625_0220220 3300046660 Bacteria 1244
652 Ga0495625_0296894 3300046660 Bacteria 1035
653 Ga0495625_0428369 3300046660 Bacteria 821
654 Ga0495625_0564310 3300046660 Bacteria 688
655 Ga0495635_0003599 3300046663 Bacteria 10731
656 Ga0495635_0251607 3300046663 Bacteria 1191
657 Ga0495659_0029624 3300046664 Bacteria 1901
658 Ga0495657_0014161 3300046675 Bacteria 5860
659 Ga0495599_0014458 3300046678 Bacteria 4888
660 Ga0495599_0043222 3300046678 Bacteria 2827
661 Ga0495623_0003091 3300046679 Bacteria 10975
662 Ga0495623_0025285 3300046679 Bacteria 3824
663 Ga0495646_0000221 3300046680 Bacteria 28238
664 Ga0495646_0183669 3300046680 Bacteria 1146
665 Ga0495658_0516258 3300046683 Bacteria 765
666 Ga0495669_0179917 3300046684 Bacteria 1008
667 Ga0495613_0053231 3300046689 Bacteria 2979
668 Ga0495613_0054875 3300046689 Bacteria 2929
669 Ga0495613_0120870 3300046689 Bacteria 1881
670 Ga0495613_0651372 3300046689 Bacteria 697
671 Ga0495624_0524390 3300046690 Bacteria 708
672 Ga0495670_0002945 3300046691 Bacteria 8396
673 Ga0495670_0104633 3300046691 Bacteria 1461
674 Ga0495670_0137835 3300046691 Bacteria 1274
675 Ga0495649_0021854 3300046694 Bacteria 3584
676 Ga0495649_0064443 3300046694 Bacteria 1968
677 Ga0495600_0042849 3300046809 Bacteria 2951
678 Ga0495660_0052421 3300046810 Bacteria 2216
679 Ga0495581_0043039 3300047315 Bacteria 2613
680 Ga0495581_0106993 3300047315 Bacteria 1626
681 Ga0495581_0272631 3300047315 Bacteria 989
682 Ga0495581_0602949 3300047315 Bacteria 636
683 Ga0495604_0000883 3300047317 Bacteria 24920
684 Ga0495604_0083057 3300047317 Bacteria 2394
685 Ga0495604_0738257 3300047317 Bacteria 623
686 Ga0495674_0015688 3300047319 Bacteria 7072
687 Ga0495674_0072233 3300047319 Bacteria 2976
688 Ga0495674_0233774 3300047319 Bacteria 1516
689 Ga0495674_0360495 3300047319 Bacteria 1179
690 Ga0495674_0381509 3300047319 Bacteria 1140
691 Ga0495674_0891833 3300047319 Bacteria 687
692 Ga0495672_0271050 3300047320 Bacteria 815
693 Ga0495676_0122755 3300047321 Bacteria 1887
694 Ga0495676_0150867 3300047321 Bacteria 1654
695 Ga0495676_0483850 3300047321 Bacteria 814
696 Ga0495680_0004008 3300047322 Bacteria 14219
697 Ga0495680_0088225 3300047322 Bacteria 2331
698 Ga0495680_0461106 3300047322 Unclassified 868
699 Ga0495683_0193836 3300047323 Bacteria 920
700 Ga0495687_000787 3300047443 Bacteria 34084
701 Ga0495687_002913 3300047443 Bacteria 13020
702 Ga0495687_014700 3300047443 Bacteria 4013
703 Ga0495675_0003139 3300047444 Bacteria 9915
704 Ga0495675_0107941 3300047444 Bacteria 1739
705 Ga0495684_0047345 3300047471 Bacteria 3289
706 Ga0495686_0349426 3300047472 Bacteria 804
707 Ga0495593_0039275 3300047673 Bacteria 2552
708 Ga0495602_0006391 3300048088 Bacteria 12362
709 Ga0495602_0022093 3300048088 Bacteria 6234
710 Ga0495602_0210177 3300048088 Bacteria 1478
711 Ga0495602_0394890 3300048088 Bacteria 988
712 Ga0495626_0082131 3300048091 Bacteria 1430
713 Ga0496100_0089514 3300048903 Bacteria 2097
714 Ga0496100_0178386 3300048903 Bacteria 1535
715 Ga0496100_0198911 3300048903 Bacteria 1459
716 Ga0496101_0144458 3300048904 Bacteria 1816
717 Ga0496101_0290316 3300048904 Bacteria 1279
718 Ga0496102_0048082 3300048905 Bacteria 3879
719 Ga0496102_0160314 3300048905 Bacteria 2116
720 Ga0496102_0402210 3300048905 Bacteria 1287
721 Ga0496102_0742536 3300048905 Bacteria 904
722 Ga0496103_0133126 3300048906 Bacteria 1588
723 Ga0496103_0137922 3300048906 Bacteria 1559
724 Ga0496103_0194323 3300048906 Bacteria 1305
725 Ga0496104_0000242 3300048907 Bacteria 48242
726 Ga0496104_0045018 3300048907 Bacteria 4148
727 Ga0496104_0339154 3300048907 Bacteria 1416
728 Ga0496104_0414522 3300048907 Bacteria 1259
729 Ga0496104_0546804 3300048907 Bacteria 1069
730 Ga0496105_0126326 3300048908 Bacteria 2108
731 Ga0496105_0343744 3300048908 Bacteria 1193
732 Ga0496105_0596468 3300048908 Bacteria 858
733 Ga0496106_0006609 3300048909 Bacteria 8584
734 Ga0496106_0230040 3300048909 Bacteria 1480
735 Ga0496106_0281423 3300048909 Bacteria 1333
736 Ga0496106_0724440 3300048909 Bacteria 792
737 Ga0496106_1249382 3300048909 Bacteria 578
738 Ga0496107_0055122 3300048910 Bacteria 2871
739 Ga0496107_0080079 3300048910 Bacteria 2382
740 Ga0496107_0131567 3300048910 Bacteria 1847
741 Ga0496108_0009399 3300048911 Bacteria 7916
742 Ga0496108_0017102 3300048911 Bacteria 5931
743 Ga0496108_0148343 3300048911 Bacteria 2023
744 Ga0496108_0175652 3300048911 Bacteria 1854
745 Ga0496108_1135088 3300048911 Bacteria 663
746 Ga0496109_0031556 3300048912 Bacteria 4755
747 Ga0496109_0162388 3300048912 Bacteria 2093
748 Ga0496109_0280888 3300048912 Bacteria 1569
749 Ga0496109_0474755 3300048912 Bacteria 1181
750 Ga0496110_0000700 3300048913 Bacteria 23141
751 Ga0496110_0033398 3300048913 Bacteria 4451
752 Ga0496110_0173488 3300048913 Bacteria 1957
753 Ga0496110_0273977 3300048913 Bacteria 1536
754 Ga0496110_0694557 3300048913 Bacteria 919
755 Ga0496111_0010116 3300048914 Bacteria 6315
756 Ga0496111_0201005 3300048914 Bacteria 1481
757 Ga0496112_0012574 3300048915 Bacteria 7778
758 Ga0496112_0032559 3300048915 Bacteria 5063
759 Ga0496112_0033089 3300048915 Bacteria 5022
760 Ga0496112_0119561 3300048915 Bacteria 2605
761 Ga0496112_0196679 3300048915 Bacteria 1976
762 Ga0496112_0293648 3300048915 Bacteria 1571
763 Ga0496112_0437528 3300048915 Bacteria 1246
764 Ga0496112_0510480 3300048915 Bacteria 1137
765 Ga0496113_0001677 3300048916 Bacteria 12535
766 Ga0496113_0014609 3300048916 Bacteria 5364
767 Ga0496113_0036214 3300048916 Bacteria 3614
768 Ga0496113_0278322 3300048916 Bacteria 1338
769 Ga0496113_0631412 3300048916 Bacteria 857
770 Ga0496114_0006074 3300048917 Bacteria 9505
771 Ga0496114_0063193 3300048917 Bacteria 3099
772 Ga0496114_0246233 3300048917 Bacteria 1573
773 Ga0496114_0785938 3300048917 Unclassified 830
774 Ga0496115_0067900 3300048918 Bacteria 2885
775 Ga0496115_0080528 3300048918 Bacteria 2651
776 Ga0496115_0220123 3300048918 Bacteria 1567
777 Ga0496115_0259445 3300048918 Bacteria 1429
778 Ga0496115_0308475 3300048918 Bacteria 1296
779 Ga0496115_0434819 3300048918 Bacteria 1062
780 Ga0496115_0549334 3300048918 Bacteria 923
781 Ga0496115_0791586 3300048918 Bacteria 739
782 Ga0496115_1167341 3300048918 Unclassified 580
783 Ga0496116_0017044 3300048919 Bacteria 5658
784 Ga0496116_0137758 3300048919 Bacteria 1379
785 Ga0496117_0000316 3300048920 Bacteria 84475
786 Ga0496118_0000003 3300048921 Bacteria 773148
787 Ga0496118_0003186 3300048921 Bacteria 20962
788 Ga0496118_0357855 3300048921 Bacteria 775
789 Ga0496119_0000260 3300048922 Bacteria 74908
790 Ga0496119_0033656 3300048922 Bacteria 3392
791 Ga0496119_0082141 3300048922 Bacteria 1853
792 Ga0496119_0329628 3300048922 Bacteria 745
793 Ga0496119_0365653 3300048922 Bacteria 695
794 Ga0496120_0000061 3300048923 Bacteria 172817
795 Ga0496120_0117345 3300048923 Bacteria 1381
796 Ga0496121_0000353 3300048924 Bacteria 95678
797 Ga0496121_0025392 3300048924 Bacteria 5622
798 Ga0496121_0167912 3300048924 Bacteria 1597
799 Ga0496124_0037821 3300048927 Bacteria 4194
800 Ga0496124_0054870 3300048927 Unclassified 3370
801 Ga0496125_0000205 3300048928 Bacteria 124391
802 Ga0496125_0019023 3300048928 Bacteria 6498
803 Ga0496125_0023500 3300048928 Bacteria 5688
804 Ga0496125_0216477 3300048928 Bacteria 1238
805 Ga0496125_0406331 3300048928 Bacteria 794
806 Ga0496126_0006587 3300048929 Bacteria 12941
807 Ga0496126_0007152 3300048929 Bacteria 12291
808 Ga0496126_0127107 3300048929 Bacteria 2205
809 Ga0496126_0203085 3300048929 Bacteria 1672
810 Ga0496126_0350453 3300048929 Bacteria 1207
811 Ga0496126_0734596 3300048929 Bacteria 764
812 Ga0496126_0777589 3300048929 Bacteria 737
813 Ga0495678_116526 3300049459 Bacteria 903
814 Ga0495682_0086726 3300049460 Bacteria 1125
815 Ga0501033_0045646 3300049570 Bacteria 3260
816 Ga0501036_0207748 3300049572 Bacteria 1646
817 Ga0501037_0800846 3300049573 Bacteria 622
818 Ga0501038_0036894 3300049574 Bacteria 4289
819 Ga0501039_0054512 3300049575 Bacteria 3095
820 Ga0501047_0237558 3300049581 Bacteria 1674
821 Ga0501067_0563776 3300049583 Bacteria 638
822 Ga0501069_0201607 3300049585 Bacteria 1153
823 Ga0501044_0004315 3300049823 Bacteria 15940
824 nmdc:mga03683_125171_c1 3300050489 Bacteria 1146
825 nmdc:mga03683_190892_c1 3300050489 Bacteria 937
826 nmdc:mga03683_276580_c1 3300050489 Bacteria 784
827 nmdc:mga03683_388_c2 3300050489 Bacteria 10737
828 nmdc:mga03683_41718_c1 3300050489 Bacteria 1886
829 nmdc:mga03n38_218922_c1 3300050490 Bacteria 993
830 nmdc:mga03n38_539_c1 3300050490 Bacteria 9619
831 nmdc:mga03n38_828_c1 3300050490 Bacteria 8271
832 nmdc:mga03n38_99315_c1 3300050490 Bacteria 1401
833 nmdc:mga00v17_384175_c1 3300050491 Bacteria 913
834 nmdc:mga00v17_736219_c1 3300050491 Bacteria 631
835 nmdc:mga00v17_7580_c1 3300050491 Bacteria 5797
836 nmdc:mga0yw44_102005_c1 3300050492 Bacteria 1829
837 nmdc:mga0yw44_198931_c1 3300050492 Bacteria 1323
838 nmdc:mga0yw44_300815_c1 3300050492 Bacteria 1075
839 nmdc:mga0k408_136820_c1 3300050493 Bacteria 1456
840 nmdc:mga0k408_14577_c1 3300050493 Bacteria 4335
841 nmdc:mga0k408_15243_c1 3300050493 Bacteria 4248
842 nmdc:mga0k408_171345_c1 3300050493 Bacteria 1294
843 nmdc:mga0k408_472143_c1 3300050493 Bacteria 744
844 nmdc:mga0k408_55072_c1 3300050493 Bacteria 2306
845 nmdc:mga0k408_7032_c2 3300050493 Bacteria 2981
846 nmdc:mga06z11_119096_c1 3300050494 Bacteria 1471
847 nmdc:mga06z11_132068_c1 3300050494 Bacteria 1403
848 nmdc:mga06z11_208051_c1 3300050494 Bacteria 1139
849 nmdc:mga06z11_242252_c1 3300050494 Bacteria 1059
850 nmdc:mga06z11_258306_c1 3300050494 Bacteria 1027
851 nmdc:mga06z11_367692_c1 3300050494 Bacteria 863
852 nmdc:mga06z11_7925_c1 3300050494 Bacteria 4399
853 nmdc:mga04h51_114510_c1 3300050495 Bacteria 998
854 nmdc:mga04h51_70935_c1 3300050495 Bacteria 1216
855 nmdc:mga07m45_114654_c1 3300050496 Bacteria 1554
856 nmdc:mga07m45_157081_c1 3300050496 Bacteria 1320
857 nmdc:mga07m45_21357_c1 3300050496 Bacteria 1460
858 nmdc:mga07m45_39579_c1 3300050496 Bacteria 1802
859 nmdc:mga07m45_54_c1 3300050496 Bacteria 49018
860 nmdc:mga07m45_96996_c1 3300050496 Bacteria 1692
861 nmdc:mga05p37_120055_c1 3300050507 Bacteria 3229
862 nmdc:mga0qj67_686162_c1 3300050509 Bacteria 815
863 nmdc:mga08y16_527715_c1 3300050511 Bacteria 1197
864 nmdc:mga0rr50_208933_c1 3300050513 Bacteria 1607
865 nmdc:mga0a205_375369_c1 3300050515 Bacteria 1287
866 nmdc:mga0sz30_167638_c1 3300050516 Bacteria 974
867 nmdc:mga0sz30_186040_c1 3300050516 Bacteria 922
868 nmdc:mga0sz30_235_c1 3300050516 Bacteria 21178
869 Ga0495601_0002174 3300053077 Bacteria 11036
870 Ga0495601_0013992 3300053077 Bacteria 4831
871 Ga0495601_0540594 3300053077 Bacteria 750
872 Ga0495612_0008623 3300053078 Bacteria 4134
873 Ga0495612_0021184 3300053078 Bacteria 2608
874 Ga0500610_0108645 3300053079 Bacteria 1429
875 Ga0500635_0092805 3300053080 Bacteria 1101
876 Ga0495595_0000257 3300053084 Bacteria 21149
877 Ga0495595_0040557 3300053084 Bacteria 2128
878 Ga0495595_0141229 3300053084 Bacteria 1181
879 Ga0495619_0000089 3300053085 Bacteria 69604
880 Ga0495619_0072158 3300053085 Bacteria 2312
881 Ga0495619_0086861 3300053085 Bacteria 2114
882 Ga0495619_0405984 3300053085 Unclassified 941
883 Ga0495619_0443993 3300053085 Bacteria 894
884 Ga0495619_0587514 3300053085 Bacteria 762
885 Ga0500578_0149986 3300053086 Bacteria 1453
886 Ga0500644_0008229 3300053088 Bacteria 2747
887 Ga0500644_0055085 3300053088 Unclassified 1379
888 Ga0500646_0140391 3300053090 Bacteria 792
889 Ga0500647_0106643 3300053091 Bacteria 1335
890 Ga0500566_0327937 3300053094 Bacteria 710
891 Ga0500641_0084109 3300053096 Bacteria 1353
892 Ga0500556_0033556 3300053104 Bacteria 1761
893 Ga0500562_018606 3300053108 Bacteria 1794
894 Ga0500562_033923 3300053108 Bacteria 1349
895 Ga0500569_052576 3300053109 Bacteria 1234
896 Ga0500595_001326 3300053119 Bacteria 13410
897 Ga0500595_015953 3300053119 Bacteria 2807
898 Ga0500642_0261224 3300053130 Bacteria 792
899 Ga0500652_262644 3300053131 Bacteria 680
900 Ga0500655_009437 3300053133 Bacteria 1760
901 Ga0500658_0094165 3300053134 Bacteria 1299
902 Ga0500658_0249757 3300053134 Bacteria 815
903 Ga0500559_0033345 3300053136 Bacteria 2216
904 Ga0500561_0078312 3300053137 Bacteria 959
905 Ga0500573_0023818 3300053140 Bacteria 3516
906 Ga0500577_0065495 3300053142 Bacteria 1410
907 Ga0500589_100817 3300053147 Bacteria 1254
908 Ga0500589_114445 3300053147 Bacteria 1152
909 Ga0500590_048708 3300053148 Bacteria 2160
910 Ga0500590_126524 3300053148 Bacteria 1189
911 Ga0500616_0034848 3300053153 Bacteria 2741
912 Ga0500616_0318052 3300053153 Bacteria 642
913 Ga0500622_0046683 3300053156 Bacteria 2238
914 Ga0500622_0122608 3300053156 Bacteria 1259
915 Ga0500627_0108683 3300053158 Bacteria 1248
916 Ga0500633_0148869 3300053160 Bacteria 877
917 Ga0500636_0037456 3300053177 Bacteria 2869
918 Ga0500636_0043970 3300053177 Bacteria 2635
919 Ga0500637_0003656 3300053178 Bacteria 7152
920 Ga0500637_0117095 3300053178 Bacteria 1545
921 Ga0500637_0221548 3300053178 Bacteria 1069
922 Ga0500637_0386188 3300053178 Bacteria 732
923 Ga0500609_006296 3300053731 Bacteria 1617
924 Ga0500609_011269 3300053731 Bacteria 1207
925 Ga0500596_003856 3300053735 Bacteria 2807
926 2513698251 2513237101 Bacteria 7952346
927 2599748542 2599185240 Bacteria 7968121
928 2600210470 2599185355 Bacteria 7968906
929 2676746633 2675903129 Bacteria 7964495
930 2723848581 2721755755 Bacteria 8322773
931 2728755233 2728368998 Bacteria 8720350
932 2874606244 2874604998 Bacteria 7834745
933 2887376557 2887375801 Bacteria 5334027
934 2889036836 2889033259 Bacteria 9099371
935 8002392390 8002392321 Bacteria 4159911
936 8006988312 8006984368 Bacteria 9651211
937 8006999550 8006994254 Bacteria 8309700
938 8020948649 8020945358 Bacteria 8467355
939 8056679727 8056673599 Bacteria 7871253
940 8056692511 8056689827 Bacteria 6712655
941 Ga0307508_10572961
942 RicEn_C2288
943 JGI25406J46586_10007733
944 JGI25153J46596_10009937
945 rootH1_10062104
946 rootH2_10082343
947 rootL2_10037120
948 rootH1_10258310
949 Ga0055527_1000417
950 Ga0055535_1001078
951 Ga0055542_1001702
952 Ga0065704_10040826
953 Ga0065715_10157121
954 Ga0070683_100254921
955 Ga0070690_100172410
956 Ga0070670_100005241
957 Ga0070670_100082724
958 Ga0070670_100949216
959 Ga0070670_100968008
960 Ga0068869_100022912
961 Ga0068869_100156195
962 Ga0068869_100351677
963 Ga0068869_100596600
964 Ga0070666_10190029
965 Ga0070666_10472266
966 Ga0070680_100032614
967 Ga0068868_100056725
968 Ga0068868_100511069
969 Ga0070660_100755196
970 Ga0070689_100335981
971 Ga0070691_10286968
972 Ga0070668_100237900
973 Ga0070675_100635482
974 Ga0070671_100002026
975 Ga0070671_100718138
976 Ga0070673_100019816
977 Ga0070673_100440968
978 Ga0070673_100569106
979 Ga0070673_100822652
980 Ga0070688_100334649
981 Ga0070659_100219456
982 Ga0070659_100421717
983 Ga0070667_100187596
984 Ga0070667_100348847
985 Ga0070709_10331292
986 Ga0070709_11065472
987 Ga0070714_100842963
988 Ga0070714_101175572
989 Ga0070713_100224686
990 Ga0070710_10157192
991 Ga0070710_10250650
992 Ga0070710_10309714
993 Ga0070711_100067451
994 Ga0070711_100188427
995 Ga0070711_100772862
996 Ga0070708_100158225
997 Ga0070663_100128284
998 Ga0070663_100431573
999 Ga0070663_100434055
1000 Ga0070678_100133624
1001 Ga0070678_100230648
1002 Ga0070678_100720836
1003 Ga0070662_100231213
1004 Ga0070681_10045611
1005 Ga0070681_10507742
1006 Ga0070681_11316166
1007 Ga0068867_100354905
1008 Ga0068867_101171219
1009 Ga0070685_10116171
1010 Ga0070685_10186206
1011 Ga0070685_10727194
1012 Ga0070706_100001519
1013 Ga0070707_100146568
1014 Ga0070698_100103788
1015 Ga0070699_100077162
1016 Ga0070699_100700329
1017 Ga0070697_100761345
1018 Ga0068853_100909078
1019 Ga0068853_101066506
1020 Ga0068853_101084321
1021 Ga0068853_101539578
1022 Ga0070672_100031959
1023 Ga0070672_100116243
1024 Ga0070672_100132603
1025 Ga0070696_100001126
1026 Ga0070696_100089868
1027 Ga0070665_100001168
1028 Ga0070665_100008760
1029 Ga0070665_100023272
1030 Ga0070665_100104923
1031 Ga0070665_100165569
1032 Ga0070665_100253187
1033 Ga0070665_100331126
1034 Ga0070665_100533509
1035 Ga0070704_100081030
1036 Ga0070704_100826874
1037 Ga0068855_100144386
1038 Ga0070664_100733496
1039 Ga0068857_100046837
1040 Ga0068856_100194292
1041 Ga0068856_100554000
1042 Ga0070702_100047519
1043 Ga0068852_100300256
1044 Ga0068852_101180518
1045 Ga0068859_100031093
1046 Ga0068859_100553177
1047 Ga0068859_100957838
1048 Ga0068859_102026297
1049 Ga0068866_10131614
1050 Ga0068866_10333242
1051 Ga0068866_10762980
1052 Ga0068861_100318109
1053 Ga0068861_101225968
1054 Ga0068863_100047665
1055 Ga0068863_101123701
1056 Ga0068863_101815324
1057 Ga0068858_100009170
1058 Ga0068858_100030212
1059 Ga0068858_100106653
1060 Ga0068858_100358649
1061 Ga0068860_100000371
1062 Ga0068860_100429365
1063 Ga0068860_101261294
1064 Ga0068862_100072305
1065 Ga0068862_100115909
1066 Ga0068862_100178233
1067 Ga0068862_100315474
1068 Ga0068862_100394225
1069 Ga0068862_100418134
1070 Ga0068862_101276107
1071 Ga0068862_101446805
1072 Ga0081455_10024630
1073 Ga0081455_10274437
1074 Ga0081538_10087765
1075 Ga0081539_10002040
1076 Ga0081539_10053494
1077 Ga0070717_10073245
1078 Ga0075365_10077896
1079 Ga0075365_10204544
1080 Ga0075365_10272920
1081 Ga0075365_10290379
1082 Ga0075365_10537715
1083 Ga0075365_10584898
1084 Ga0075368_10012344
1085 Ga0075368_10111160
1086 Ga0075368_10221625
1087 Ga0075368_10301229
1088 Ga0075363_100010922
1089 Ga0075363_100013697
1090 Ga0075363_100377422
1091 Ga0075363_100482629
1092 Ga0075363_100653730
1093 Ga0075364_10003559
1094 Ga0075364_10381333
1095 Ga0075432_10128445
1096 Ga0070715_10085500
1097 Ga0070715_10109493
1098 Ga0070716_100055570
1099 Ga0070716_100141053
1100 Ga0070716_100218864
1101 Ga0070716_100602234
1102 Ga0070712_100457231
1103 Ga0070712_100484306
1104 Ga0070712_100558073
1105 Ga0075362_10001867
1106 Ga0075362_10003987
1107 Ga0075362_10005810
1108 Ga0075362_10012898
1109 Ga0075362_10045963
1110 Ga0075362_10133581
1111 Ga0075367_10004238
1112 Ga0075367_10024609
1113 Ga0075367_10051802
1114 Ga0075367_10059138
1115 Ga0075367_10149611
1116 Ga0075367_10184420
1117 Ga0075367_10192494
1118 Ga0075367_10596757
1119 Ga0075367_10810066
1120 Ga0075369_10031610
1121 Ga0075369_10131079
1122 Ga0075366_10004721
1123 Ga0075366_10010783
1124 Ga0075366_10013639
1125 Ga0075366_10060089
1126 Ga0075366_10079235
1127 Ga0075366_10082715
1128 Ga0075366_10095409
1129 Ga0075366_10136270
1130 Ga0075366_10219425
1131 Ga0097621_100074080
1132 Ga0097621_100237354
1133 Ga0075370_10000711
1134 Ga0075370_10002157
1135 Ga0075370_10006505
1136 Ga0075370_10020638
1137 Ga0075370_10027738
1138 Ga0075370_10049171
1139 Ga0075370_10110607
1140 Ga0075370_10403291
1141 Ga0068871_100295741
1142 Ga0075428_100025261
1143 Ga0075430_100741538
1144 Ga0075431_100004883
1145 Ga0068865_100092989
1146 Ga0068865_101027572
1147 Ga0075436_100671810
1148 Ga0097620_100031093
1149 Ga0097620_100553294
1150 Ga0097620_100957977
1151 Ga0097620_102026270
1152 Ga0075435_100701492
1153 Ga0099794_10000442
1154 Ga0099795_10000966
1155 Ga0105244_10500930
1156 Ga0105250_10018498
1157 Ga0105240_10006809
1158 Ga0105240_10026644
1159 Ga0105240_10043543
1160 Ga0105240_10118414
1161 Ga0105240_10270002
1162 Ga0105240_10391995
1163 Ga0105240_10414441
1164 Ga0105240_10471381
1165 Ga0105240_10652328
1166 Ga0105245_10048817
1167 Ga0105245_10188396
1168 Ga0105245_10332764
1169 Ga0105247_10055529
1170 Ga0105247_10559129
1171 Ga0114129_10090122
1172 Ga0105243_10230554
1173 Ga0105243_10418523
1174 Ga0105243_11323712
1175 Ga0105241_10085696
1176 Ga0105241_10120621
1177 Ga0105241_10349754
1178 Ga0105242_10546036
1179 Ga0105248_10146332
1180 Ga0105248_10357819
1181 Ga0105248_10589821
1182 Ga0105248_11843389
1183 Ga0105237_10091285
1184 Ga0105237_10157191
1185 Ga0105237_10169986
1186 Ga0105237_10191072
1187 Ga0105237_10262331
1188 Ga0105237_10623308
1189 Ga0105237_10767295
1190 Ga0105238_10302473
1191 Ga0105238_10398409
1192 Ga0105238_10509903
1193 Ga0105238_10572997
1194 Ga0105238_11081248
1195 Ga0105249_10040039
1196 Ga0105249_10087193
1197 Ga0105249_10629004
1198 Ga0105249_10975300
1199 Ga0105249_11130230
1200 Ga0099796_10070719
1201 Ga0099796_10195595
1202 Ga0105239_10150693
1203 Ga0105239_10154231
1204 Ga0105239_10278682
1205 Ga0105239_10753307
1206 Ga0105239_11037005
1207 Ga0105239_11841851
1208 Ga0105246_10685185
1209 Ga0157335_1004574
1210 Ga0157347_1022954
1211 Ga0157369_10459770
1212 Ga0157369_10757423
1213 Ga0157374_10171374
1214 Ga0157374_10532719
1215 Ga0157374_10831984
1216 Ga0157378_10217349
1217 Ga0157378_10321917
1218 Ga0163162_10022525
1219 Ga0163162_10845071
1220 Ga0163162_10883254
1221 Ga0157375_10134352
1222 Ga0157375_10407926
1223 Ga0157375_10596691
1224 Ga0157375_11325440
1225 Ga0163163_10118326
1226 Ga0163163_10360541
1227 Ga0163163_10398266
1228 Ga0163163_11388170
1229 Ga0157380_10263585
1230 Ga0157380_11094041
1231 Ga0182008_10135092
1232 Ga0157379_10161974
1233 Ga0157379_10266766
1234 Ga0157379_10314154
1235 Ga0157379_10344676
1236 Ga0157379_10396549
1237 Ga0157379_10606760
1238 Ga0157376_10458591
1239 Ga0157376_10472995
1240 Ga0157376_11843223
1241 Ga0182006_1026974
1242 Ga0163161_10184373
1243 Ga0163161_10626849
1244 Ga0213872_10186324
1245 Ga0228598_1000670
1246 Ga0209672_100015
1247 Ga0209147_100016
1248 Ga0209258_100026
1249 Ga0209148_1001962
1250 Ga0209759_1003001
1251 Ga0209455_1000812
1252 Ga0209758_1000240
1253 Ga0209758_1005019
1254 Ga0209758_1077614
1255 Ga0207697_10075807
1256 Ga0207656_10495171
1257 Ga0207653_10011428
1258 Ga0207682_10146749
1259 Ga0207692_10139078
1260 Ga0207692_10551702
1261 Ga0207710_10091521
1262 Ga0207710_10121598
1263 Ga0207710_10155667
1264 Ga0207688_10071903
1265 Ga0207680_10367061
1266 Ga0207680_10436702
1267 Ga0207647_10137293
1268 Ga0207685_10208835
1269 Ga0207699_10162592
1270 Ga0207699_10536609
1271 Ga0207645_10115816
1272 Ga0207684_10013902
1273 Ga0207684_10522164
1274 Ga0207654_10005798
1275 Ga0207654_10175894
1276 Ga0207654_10182135
1277 Ga0207707_10724874
1278 Ga0207695_10002871
1279 Ga0207695_10111961
1280 Ga0207695_10197006
1281 Ga0207695_10378063
1282 Ga0207695_10491880
1283 Ga0207695_10571542
1284 Ga0207695_11285764
1285 Ga0207671_10040030
1286 Ga0207671_10117291
1287 Ga0207671_10177589
1288 Ga0207671_10764028
1289 Ga0207693_10035791
1290 Ga0207693_10135688
1291 Ga0207693_10175802
1292 Ga0207693_10252415
1293 Ga0207663_10171798
1294 Ga0207663_10221250
1295 Ga0207662_10178711
1296 Ga0207649_10070154
1297 Ga0207652_10070870
1298 Ga0207646_10187194
1299 Ga0207681_10799822
1300 Ga0207694_10518297
1301 Ga0207694_10742309
1302 Ga0207694_10817967
1303 Ga0207650_10273758
1304 Ga0207650_10860355
1305 Ga0207650_11233842
1306 Ga0207659_10532425
1307 Ga0207687_10011613
1308 Ga0207687_10150722
1309 Ga0207687_11503913
1310 Ga0207700_10065555
1311 Ga0207700_10386812
1312 Ga0207664_10905942
1313 Ga0207644_10014094
1314 Ga0207644_11071500
1315 Ga0207706_10034459
1316 Ga0207706_10102321
1317 Ga0207706_10262770
1318 Ga0207709_10258641
1319 Ga0207670_10130274
1320 Ga0207670_10542674
1321 Ga0207669_10579214
1322 Ga0207704_10301008
1323 Ga0207704_10610249
1324 Ga0207665_10334722
1325 Ga0207665_10476951
1326 Ga0207665_10880545
1327 Ga0207691_10114806
1328 Ga0207691_10183967
1329 Ga0207691_10234680
1330 Ga0207691_10306156
1331 Ga0207711_10127440
1332 Ga0207711_10372632
1333 Ga0207711_10518414
1334 Ga0207711_10695412
1335 Ga0207689_10044841
1336 Ga0207689_10071481
1337 Ga0207689_10172400
1338 Ga0207661_10416929
1339 Ga0207661_10732522
1340 Ga0207667_10322990
1341 Ga0207667_10702318
1342 Ga0207667_10739936
1343 Ga0207651_10014597
1344 Ga0207651_10251259
1345 Ga0207651_10293512
1346 Ga0207651_10553425
1347 Ga0207712_10127977
1348 Ga0207668_10014378
1349 Ga0207640_10164918
1350 Ga0207658_10301893
1351 Ga0207658_10527618
1352 Ga0207658_10552494
1353 Ga0207677_10573240
1354 Ga0207703_10000923
1355 Ga0207703_10057967
1356 Ga0207703_10409211
1357 Ga0207703_10435526
1358 Ga0207639_10040025
1359 Ga0207639_10354933
1360 Ga0207639_10751778
1361 Ga0207639_11039247
1362 Ga0207678_10058697
1363 Ga0207708_10163999
1364 Ga0207702_10228829
1365 Ga0207641_10011353
1366 Ga0207648_10061324
1367 Ga0207648_10070090
1368 Ga0207648_10875518
1369 Ga0207648_11272618
1370 Ga0207676_10128952
1371 Ga0207676_10289901
1372 Ga0207674_10137422
1373 Ga0207674_10430759
1374 Ga0207674_10719827
1375 Ga0207675_100068646
1376 Ga0207675_100315204
1377 Ga0207675_100393820
1378 Ga0207675_101434422
1379 Ga0207683_10037457
1380 Ga0207683_10159141
1381 Ga0207698_10092750
1382 Ga0207698_10454367
1383 Ga0207698_10972919
1384 Ga0209179_1002231
1385 Ga0209813_10234593
1386 Ga0209813_10246645
1387 Ga0207428_10382796
1388 Ga0268266_10004725
1389 Ga0268266_10005936
1390 Ga0268266_10134027
1391 Ga0268266_10214112
1392 Ga0268265_10041239
1393 Ga0268265_10150353
1394 Ga0268265_10175657
1395 Ga0268265_10352668
1396 Ga0268265_10596417
1397 Ga0268264_10000151
1398 Ga0268264_10265545
1399 Ga0268264_10351764
1400 Ga0265334_10026004
1401 Ga0307517_10000235
1402 Ga0307517_10144167
1403 Ga0307515_10000014
1404 Ga0307515_10000424
1405 Ga0307515_10027689
1406 Ga0307515_10038046
1407 Ga0307515_10150180
1408 Ga0307515_10153597
1409 Ga0307515_10243825
1410 Ga0265338_10079204
1411 Ga0307511_10001160
1412 Ga0307512_10196542
1413 Ga0265760_10085776
1414 Ga0265340_10182459
1415 Ga0265316_10784000
1416 Ga0307513_10012664
1417 Ga0307513_10041680
1418 Ga0307513_10572658
1419 Ga0307513_10663977
1420 Ga0307509_10000056
1421 Ga0307509_10017926
1422 Ga0307509_10035087
1423 Ga0307408_100745301
1424 Ga0307508_10000003
1425 Ga0307508_10003404
1426 Ga0307508_10007698
1427 Ga0307508_10088121
1428 Ga0307508_10220855
1429 Ga0307516_10004419
1430 Ga0307516_10156207
1431 Ga0307516_10261844
1432 Ga0307516_10297417
1433 Ga0307413_10006806
1434 Ga0326468_10018756
1435 Ga0307412_11036920
1436 Ga0307409_100335528
1437 Ga0307414_11214478
1438 Ga0307415_100628539
1439 Ga0307507_10169357
1440 Ga0307507_10343597
1441 Ga0307510_10000003
1442 Ga0307510_10002062
1443 Ga0307510_10038663
1444 Ga0307510_10059573
1445 Ga0373930_0041994
1446 Ga0373949_0029168
1447 Ga0373923_0032315
1448 Ga0373954_0005967
1449 Ga0373954_0029469
1450 Ga0373954_0077649
1451 Ga0373954_0276955
1452 Ga0373956_0007402
1453 Ga0373957_0035416
1454 Ga0373943_0018460
1455 Ga0373943_0054840
1456 Ga0373943_0124506
1457 Ga0373943_0136430
1458 Ga0373943_0828679
1459 Ga0373955_0022961
1460 Ga0373942_0120412
1461 Ga0373924_0118299
1462 Ga0373931_0010516
1463 Ga0373935_0079563
1464 Ga0373935_1376275
1465 Ga0373927_0138115
1466 Ga0373927_0176992
1467 Ga0373933_0000981
1468 Ga0373933_0480392
1469 Ga0373947_0239049
1470 Ga0373947_0565100
1471 Ga0373937_0000294
1472 Ga0373937_0118994
1473 Ga0373937_0458255
1474 Ga0373937_1071635
1475 Ga0373925_0487973
1476 Ga0395900_0010476
1477 Ga0395900_0266461
1478 Ga0395905_0207985
1479 Ga0395905_0854414
1480 Ga0395901_0585422
1481 Ga0436365_0258411
1482 Ga0436365_0562314
1483 Ga0436360_0244199
1484 Ga0436363_0288115
1485 Ga0436363_0601769
1486 Ga0436363_1695463
1487 Ga0439461_0024173
1488 Ga0439461_0048664
1489 Ga0451797_1010531
1490 Ga0451795_1197467
1491 Ga0451800_0219623
1492 Ga0451807_0330699
1493 Ga0439431_0038905
1494 Ga0439445_0092407
1495 Ga0439432_167931
1496 Ga0450898_023487
1497 Ga0439446_0064655
1498 Ga0439459_0052039
1499 Ga0466972_0329827
1500 Ga0466966_0197918
1501 Ga0466961_0004263
1502 Ga0466971_0362446
1503 Ga0466959_0012524
1504 Ga0466959_0071056
1505 Ga0466959_0116423
1506 Ga0495592_0105607
1507 Ga0495603_0057356
1508 Ga0495603_0149867
1509 Ga0495603_0206073
1510 Ga0495603_0338158
1511 Ga0495603_0382481
1512 Ga0495629_0001072
1513 Ga0495638_0194879
1514 Ga0495641_0055933
1515 Ga0495651_0001380
1516 Ga0495651_0270877
1517 Ga0495651_0584173
1518 Ga0495653_0000774
1519 Ga0495650_0049494
1520 Ga0495580_0000310
1521 Ga0495580_0005440
1522 Ga0495580_0181892
1523 Ga0495580_0398148
1524 Ga0495582_0089667
1525 Ga0495605_0342048
1526 Ga0495662_0054837
1527 Ga0495662_0067258
1528 Ga0495664_0037948
1529 Ga0495664_0105246
1530 Ga0495664_0188950
1531 Ga0495585_0089509
1532 Ga0495585_0407523
1533 Ga0495594_0349966
1534 Ga0495606_0119103
1535 Ga0495606_0170831
1536 Ga0495608_0000148
1537 Ga0495608_0237573
1538 Ga0495608_0658578
1539 Ga0495610_0089866
1540 Ga0495618_0008092
1541 Ga0495618_0159314
1542 Ga0495618_0569981
1543 Ga0495620_0065393
1544 Ga0495620_0079264
1545 Ga0495628_0003843
1546 Ga0495628_0125761
1547 Ga0495628_0600701
1548 Ga0495630_0237991
1549 Ga0495631_0120517
1550 Ga0495632_0056594
1551 Ga0495632_0066436
1552 Ga0495632_0083260
1553 Ga0495643_0114100
1554 Ga0495643_0177050
1555 Ga0495643_0248259
1556 Ga0495648_0241717
1557 Ga0495652_0003165
1558 Ga0495652_0228413
1559 Ga0495652_0697414
1560 Ga0495665_0283066
1561 Ga0495640_0002047
1562 Ga0495640_0236437
1563 Ga0495587_0000957
1564 Ga0495587_0036109
1565 Ga0495587_0183344
1566 Ga0495587_0410989
1567 Ga0495598_0002017
1568 Ga0495609_0077793
1569 Ga0495609_0174371
1570 Ga0495609_0319410
1571 Ga0495621_0039962
1572 Ga0495597_0021603
1573 Ga0495597_0098366
1574 Ga0495645_0052774
1575 Ga0495645_0402719
1576 Ga0495645_0430473
1577 Ga0495622_0110759
1578 Ga0495633_0143606
1579 Ga0495667_0000352
1580 Ga0495667_0228736
1581 Ga0495656_0002096
1582 Ga0495656_0060290
1583 Ga0495656_0103070
1584 Ga0495656_0231680
1585 Ga0495668_0435561
1586 Ga0495668_0526728
1587 Ga0495668_0648802
1588 Ga0495634_0001972
1589 Ga0495634_0177131
1590 Ga0495625_0072288
1591 Ga0495625_0220220
1592 Ga0495625_0296894
1593 Ga0495625_0428369
1594 Ga0495625_0564310
1595 Ga0495635_0003599
1596 Ga0495635_0251607
1597 Ga0495659_0029624
1598 Ga0495657_0014161
1599 Ga0495599_0014458
1600 Ga0495599_0043222
1601 Ga0495623_0003091
1602 Ga0495623_0025285
1603 Ga0495646_0000221
1604 Ga0495646_0183669
1605 Ga0495658_0516258
1606 Ga0495669_0179917
1607 Ga0495613_0053231
1608 Ga0495613_0054875
1609 Ga0495613_0120870
1610 Ga0495613_0651372
1611 Ga0495624_0524390
1612 Ga0495670_0002945
1613 Ga0495670_0104633
1614 Ga0495670_0137835
1615 Ga0495649_0021854
1616 Ga0495649_0064443
1617 Ga0495600_0042849
1618 Ga0495660_0052421
1619 Ga0495581_0043039
1620 Ga0495581_0106993
1621 Ga0495581_0272631
1622 Ga0495581_0602949
1623 Ga0495604_0000883
1624 Ga0495604_0083057
1625 Ga0495604_0738257
1626 Ga0495674_0015688
1627 Ga0495674_0072233
1628 Ga0495674_0233774
1629 Ga0495674_0360495
1630 Ga0495674_0381509
1631 Ga0495674_0891833
1632 Ga0495672_0271050
1633 Ga0495676_0122755
1634 Ga0495676_0150867
1635 Ga0495676_0483850
1636 Ga0495680_0004008
1637 Ga0495680_0088225
1638 Ga0495680_0461106
1639 Ga0495683_0193836
1640 Ga0495687_000787
1641 Ga0495687_002913
1642 Ga0495687_014700
1643 Ga0495675_0003139
1644 Ga0495675_0107941
1645 Ga0495684_0047345
1646 Ga0495686_0349426
1647 Ga0495593_0039275
1648 Ga0495602_0006391
1649 Ga0495602_0022093
1650 Ga0495602_0210177
1651 Ga0495602_0394890
1652 Ga0495626_0082131
1653 Ga0496100_0089514
1654 Ga0496100_0178386
1655 Ga0496100_0198911
1656 Ga0496101_0144458
1657 Ga0496101_0290316
1658 Ga0496102_0048082
1659 Ga0496102_0160314
1660 Ga0496102_0402210
1661 Ga0496102_0742536
1662 Ga0496103_0133126
1663 Ga0496103_0137922
1664 Ga0496103_0194323
1665 Ga0496104_0000242
1666 Ga0496104_0045018
1667 Ga0496104_0339154
1668 Ga0496104_0414522
1669 Ga0496104_0546804
1670 Ga0496105_0126326
1671 Ga0496105_0343744
1672 Ga0496105_0596468
1673 Ga0496106_0006609
1674 Ga0496106_0230040
1675 Ga0496106_0281423
1676 Ga0496106_0724440
1677 Ga0496106_1249382
1678 Ga0496107_0055122
1679 Ga0496107_0080079
1680 Ga0496107_0131567
1681 Ga0496108_0009399
1682 Ga0496108_0017102
1683 Ga0496108_0148343
1684 Ga0496108_0175652
1685 Ga0496108_1135088
1686 Ga0496109_0031556
1687 Ga0496109_0162388
1688 Ga0496109_0280888
1689 Ga0496109_0474755
1690 Ga0496110_0000700
1691 Ga0496110_0033398
1692 Ga0496110_0173488
1693 Ga0496110_0273977
1694 Ga0496110_0694557
1695 Ga0496111_0010116
1696 Ga0496111_0201005
1697 Ga0496112_0012574
1698 Ga0496112_0032559
1699 Ga0496112_0033089
1700 Ga0496112_0119561
1701 Ga0496112_0196679
1702 Ga0496112_0293648
1703 Ga0496112_0437528
1704 Ga0496112_0510480
1705 Ga0496113_0001677
1706 Ga0496113_0014609
1707 Ga0496113_0036214
1708 Ga0496113_0278322
1709 Ga0496113_0631412
1710 Ga0496114_0006074
1711 Ga0496114_0063193
1712 Ga0496114_0246233
1713 Ga0496114_0785938
1714 Ga0496115_0067900
1715 Ga0496115_0080528
1716 Ga0496115_0220123
1717 Ga0496115_0259445
1718 Ga0496115_0308475
1719 Ga0496115_0434819
1720 Ga0496115_0549334
1721 Ga0496115_0791586
1722 Ga0496115_1167341
1723 Ga0496116_0017044
1724 Ga0496116_0137758
1725 Ga0496117_0000316
1726 Ga0496118_0000003
1727 Ga0496118_0003186
1728 Ga0496118_0357855
1729 Ga0496119_0000260
1730 Ga0496119_0033656
1731 Ga0496119_0082141
1732 Ga0496119_0329628
1733 Ga0496119_0365653
1734 Ga0496120_0000061
1735 Ga0496120_0117345
1736 Ga0496121_0000353
1737 Ga0496121_0025392
1738 Ga0496121_0167912
1739 Ga0496124_0037821
1740 Ga0496124_0054870
1741 Ga0496125_0000205
1742 Ga0496125_0019023
1743 Ga0496125_0023500
1744 Ga0496125_0216477
1745 Ga0496125_0406331
1746 Ga0496126_0006587
1747 Ga0496126_0007152
1748 Ga0496126_0127107
1749 Ga0496126_0203085
1750 Ga0496126_0350453
1751 Ga0496126_0734596
1752 Ga0496126_0777589
1753 Ga0495678_116526
1754 Ga0495682_0086726
1755 Ga0501033_0045646
1756 Ga0501036_0207748
1757 Ga0501037_0800846
1758 Ga0501038_0036894
1759 Ga0501039_0054512
1760 Ga0501047_0237558
1761 Ga0501067_0563776
1762 Ga0501069_0201607
1763 Ga0501044_0004315
1764 nmdc:mga03683_125171_c1
1765 nmdc:mga03683_190892_c1
1766 nmdc:mga03683_276580_c1
1767 nmdc:mga03683_388_c2
1768 nmdc:mga03683_41718_c1
1769 nmdc:mga03n38_218922_c1
1770 nmdc:mga03n38_539_c1
1771 nmdc:mga03n38_828_c1
1772 nmdc:mga03n38_99315_c1
1773 nmdc:mga00v17_384175_c1
1774 nmdc:mga00v17_736219_c1
1775 nmdc:mga00v17_7580_c1
1776 nmdc:mga0yw44_102005_c1
1777 nmdc:mga0yw44_198931_c1
1778 nmdc:mga0yw44_300815_c1
1779 nmdc:mga0k408_136820_c1
1780 nmdc:mga0k408_14577_c1
1781 nmdc:mga0k408_15243_c1
1782 nmdc:mga0k408_171345_c1
1783 nmdc:mga0k408_472143_c1
1784 nmdc:mga0k408_55072_c1
1785 nmdc:mga0k408_7032_c2
1786 nmdc:mga06z11_119096_c1
1787 nmdc:mga06z11_132068_c1
1788 nmdc:mga06z11_208051_c1
1789 nmdc:mga06z11_242252_c1
1790 nmdc:mga06z11_258306_c1
1791 nmdc:mga06z11_367692_c1
1792 nmdc:mga06z11_7925_c1
1793 nmdc:mga04h51_114510_c1
1794 nmdc:mga04h51_70935_c1
1795 nmdc:mga07m45_114654_c1
1796 nmdc:mga07m45_157081_c1
1797 nmdc:mga07m45_21357_c1
1798 nmdc:mga07m45_39579_c1
1799 nmdc:mga07m45_54_c1
1800 nmdc:mga07m45_96996_c1
1801 nmdc:mga05p37_120055_c1
1802 nmdc:mga0qj67_686162_c1
1803 nmdc:mga08y16_527715_c1
1804 nmdc:mga0rr50_208933_c1
1805 nmdc:mga0a205_375369_c1
1806 nmdc:mga0sz30_167638_c1
1807 nmdc:mga0sz30_186040_c1
1808 nmdc:mga0sz30_235_c1
1809 Ga0495601_0002174
1810 Ga0495601_0013992
1811 Ga0495601_0540594
1812 Ga0495612_0008623
1813 Ga0495612_0021184
1814 Ga0500610_0108645
1815 Ga0500635_0092805
1816 Ga0495595_0000257
1817 Ga0495595_0040557
1818 Ga0495595_0141229
1819 Ga0495619_0000089
1820 Ga0495619_0072158
1821 Ga0495619_0086861
1822 Ga0495619_0405984
1823 Ga0495619_0443993
1824 Ga0495619_0587514
1825 Ga0500578_0149986
1826 Ga0500644_0008229
1827 Ga0500644_0055085
1828 Ga0500646_0140391
1829 Ga0500647_0106643
1830 Ga0500566_0327937
1831 Ga0500641_0084109
1832 Ga0500556_0033556
1833 Ga0500562_018606
1834 Ga0500562_033923
1835 Ga0500569_052576
1836 Ga0500595_001326
1837 Ga0500595_015953
1838 Ga0500642_0261224
1839 Ga0500652_262644
1840 Ga0500655_009437
1841 Ga0500658_0094165
1842 Ga0500658_0249757
1843 Ga0500559_0033345
1844 Ga0500561_0078312
1845 Ga0500573_0023818
1846 Ga0500577_0065495
1847 Ga0500589_100817
1848 Ga0500589_114445
1849 Ga0500590_048708
1850 Ga0500590_126524
1851 Ga0500616_0034848
1852 Ga0500616_0318052
1853 Ga0500622_0046683
1854 Ga0500622_0122608
1855 Ga0500627_0108683
1856 Ga0500633_0148869
1857 Ga0500636_0037456
1858 Ga0500636_0043970
1859 Ga0500637_0003656
1860 Ga0500637_0117095
1861 Ga0500637_0221548
1862 Ga0500637_0386188
1863 Ga0500609_006296
1864 Ga0500609_011269
1865 Ga0500596_003856
1866 2513698251
1867 2599748542
1868 2600210470
1869 2676746633
1870 2723848581
1871 2728755233
1872 2874606244
1873 2887376557
1874 2889036836
1875 8002392390
1876 8006988312
1877 8006999550
1878 8020948649
1879 8056679727
1880 8056692511

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00866

Ring_hydroxyl_B

Ring hydroxylating beta subunit

42

178

0.91

PF13577

SnoaL_4

SnoaL-like domain

30

170

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
8h2t-assembly1.cif.gz_H cryo-em structure of iadd/e dioxygenase bound with iaa 0.9275 4 160
8h2t-assembly1.cif.gz_H cryo-em structure of iadd/e dioxygenase bound with iaa 0.922 4 160
7o21-assembly1.cif.gz_B structure of bdellovibrio bacteriovorus bd1075 0.8216 7 144
7o21-assembly1.cif.gz_A structure of bdellovibrio bacteriovorus bd1075 0.8169 7 144
6ihj-assembly1.cif.gz_B crystal structure of drosophila nxf1 ntf2 domain in complex with nxt1/p15 0.8124 11 146
ID Description Score Start End Superfamily
af_Q47140_1_172_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8088 2 160 3.10.450.50
2b1xB00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8069 4 160 3.10.450.50
2r4iB00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8019 5 147 3.10.450.50
af_Q47140_1_172_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.7994 2 160 3.10.450.50
2bmoB00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.7991 7 149 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A4V1QZ72-F1-model_v4 deleted 0.9397 2 138
AF-A0A3M6R7Y1-F1-model_v4 Phenylpropionate dioxygenase 0.9388 2 160 GO:0019380
GO:0051213
AF-A0A071MLB5-F1-model_v4 Phenylpropionate dioxygenase 0.9378 1 160 GO:0019380
GO:0051213
AF-A0A515DA17-F1-model_v4 Phenylpropionate dioxygenase 0.9368 4 160 GO:0019380
GO:0051213
AF-A0A3M6R7Y1-F1-model_v4 Phenylpropionate dioxygenase 0.9331 2 160 GO:0019380
GO:0051213

Map