F486252
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 938 | 524 | 883 | 479 |
Family's Representative Sequence
| Representative Sequence | 3300025901|Ga0207688_10042921|Ga0207688_100429212 |
| Length | 523 |
| Sequence | MLLWFVIIYWIISVGIGLWAAMRVKNTADYAVAGRSLPLYIVTATVFATWFGSETVLGIPATFLREGLGGVIADPFGSSMCLILVGLFFARPLYRMQLLTIGDFYRNKYGRTVETLTTLCIVLSYLGWVAAQISALGLVFHVVSEGAMSQSTGMIVGASTVLIYTMWGGMWAVAITDFLQMIIIVIGMLYIGWDVSQLAGGVTAVVSHAADAGKFATFLPEASLAGILGFTAAAITMMLGSIPQQDVFQRVASSKDERTAGRASILGGCLYFCFAFIPMFLAYSATLIDPQLVQKLIDGDKQSQLILPNMILNHAPLFAQVMFFGALLSAIKSCASATLLAPSVTFTENILRPAFKHLGDQQLLRLMRIVVLCFTVLVTLFALNSQLSIYKMVENAYKVTLVSAFVPLAFGLYWKRANTQGALAAIVLGLATWIWLEILAPTAVCPPQLAGFLAALFGMIAGSLAPLVIRHQPASHAGLMTSSVRIRSASVTVASWSSSFEPKCAYRPLLLMPMAAARLPACV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231003 | Herbaspirillum sp. CF444 | Isolate | Rhizosphere |
| 2 | 2511231026 | Herbaspirillum sp. YR522 | Isolate | Rhizosphere |
| 3 | 2513237150 | Cupriavidus taiwanensis STM6018 | Isolate | Nodule |
| 4 | 2513237165 | Cupriavidus neocaledonicus STM6070 | Isolate | Nodule |
| 5 | 2521172590 | Herbaspirillum sp. GW103 | Isolate | Rhizosphere |
| 6 | 2547132512 | Azospira oryzae 6a3 | Isolate | Unclassified |
| 7 | 2548876994 | Herbaspirillum lusitanum P6-12 | Isolate | Nodule |
| 8 | 2551306416 | Herbaspirillum seropedicae Os34 | Isolate | Unclassified |
| 9 | 2574179768 | Azoarcus communis DSM 12120 | Isolate | Unclassified |
| 10 | 2596583598 | Ralstonia sp. UNCCL144 | Isolate | Unclassified |
| 11 | 2599185178 | Ralstonia sp. NFACC01 | Isolate | Rhizoplane |
| 12 | 2643221544 | Pelomonas sp. Root1444 | Isolate | Unclassified |
| 13 | 2643221556 | Massilia sp. Root1485 | Isolate | Unclassified |
| 14 | 2643221585 | Pelomonas sp. Root662 | Isolate | Unclassified |
| 15 | 2643221603 | Noviherbaspirillum sp. Root189 | Isolate | Unclassified |
| 16 | 2643221656 | Pelomonas sp. Root405 | Isolate | Unclassified |
| 17 | 2643221684 | Massilia sp. Root133 | Isolate | Unclassified |
| 18 | 2687453341 | Pirellula sp. SH-Sr6A | Isolate | Unclassified |
| 19 | 2738541337 | Pelomonas sp. BT06 | Isolate | Unclassified |
| 20 | 2765235838 | Herbaspirillum robiniae AA6 | Isolate | Unclassified |
| 21 | 2808606386 | Herbaspirillum sp. SJZ099 | Isolate | Rhizosphere |
| 22 | 2808606415 | Herbaspirillum sp. SJZ130 | Isolate | Rhizosphere |
| 23 | 2808606418 | Herbaspirillum sp. SJZ107 | Isolate | Rhizosphere |
| 24 | 2808606419 | Herbaspirillum sp. SJZ106 | Isolate | Rhizosphere |
| 25 | 2818991445 | Herbaspirillum hiltneri 3195 | Isolate | Unclassified |
| 26 | 2818991449 | Herbaspirillum huttiense 1147 | Isolate | Unclassified |
| 27 | 2834641062 | Cupriavidus gilardii JZ4 | Isolate | Unclassified |
| 28 | 2839094727 | Herbaspirillum robiniae HZ10 | Isolate | Nodule |
| 29 | 2843690924 | Chromobacterium rhizoryzae JP2-74 | Isolate | Rhizosphere |
| 30 | 2852618963 | Herbaspirillum sp. SJZ102 | Isolate | Rhizosphere |
| 31 | 2857576091 | Pigmentiphaga sp. R-72090 | Isolate | Unclassified |
| 32 | 2884811622 | Herbaspirillum sp. 3C11 | Isolate | Unclassified |
| 33 | 2884836552 | Herbaspirillum sp. 3R-11 | Isolate | Unclassified |
| 34 | 2884852848 | Herbaspirillum sp. 3R11 | Isolate | Unclassified |
| 35 | 2885266251 | Ralstonia sp. SET104 | Isolate | Nodule |
| 36 | 2891633521 | Azoarcus rhizosphaerae CC-YHH848 | Isolate | Rhizosphere |
| 37 | 2896154374 | Herbaspirillum sp. 3R-3a1 | Isolate | Nodule |
| 38 | 2900577576 | Ralstonia sp. TCR112 | Isolate | Rhizosphere |
| 39 | 2901300506 | Cupriavidus sp. UYMSc13B | Isolate | Unclassified |
| 40 | 2904439833 | Herbaspirillum sp. 1589 | Isolate | Rhizosphere |
| 41 | 2904530477 | Herbaspirillum huttiense 611 | Isolate | Unclassified |
| 42 | 2904584206 | Herbaspirillum sp. 1050 | Isolate | Unclassified |
| 43 | 2904589729 | Herbaspirillum sp. 1130 | Isolate | Unclassified |
| 44 | 2904601388 | Herbaspirillum sp. 1273 | Isolate | Rhizosphere |
| 45 | 2910245624 | Adhaeribacter radiodurans KUDC8001 | Isolate | Rhizosphere |
| 46 | 2919046199 | Herbaspirillum frisingense 596 | Isolate | Unclassified |
| 47 | 2919079590 | Herbaspirillum sp. 1173 | Isolate | Unclassified |
| 48 | 2923510766 | Herbaspirillum rubrisubalbicans SLBN-127 | Isolate | Rhizosphere |
| 49 | 2928058823 | Ralstonia sp. 1138 | Isolate | Unclassified |
| 50 | 2928130867 | Herbaspirillum seropedicae 1977 | Isolate | Unclassified |
| 51 | 2939631187 | Ottowia thiooxydans 2709 | Isolate | Rhizosphere |
| 52 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 53 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 54 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 55 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 56 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 57 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 58 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 59 | 3300003371 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM | Metagenome | Rhizosphere |
| 60 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 61 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 62 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 63 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 64 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 65 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 66 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 67 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 68 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 69 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 70 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 71 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 72 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 73 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 74 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 75 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 76 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 77 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 78 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 79 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 80 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 82 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 83 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 86 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 88 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 89 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 91 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 92 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 93 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 101 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 104 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 105 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 106 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 107 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 108 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 109 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 110 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 111 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 112 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 113 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 114 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 115 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 116 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 117 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 118 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 119 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 120 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 121 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 122 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 123 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 124 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 125 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 126 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 127 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 128 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 129 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 130 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 131 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 132 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 133 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 134 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 135 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 136 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 137 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 138 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 139 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 140 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 141 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 142 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 143 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 144 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 146 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 147 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 148 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 149 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 150 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 151 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 152 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 154 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 155 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 156 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 157 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 158 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 160 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 161 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 163 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 164 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 165 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 166 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 167 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 168 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 169 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 170 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 171 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 172 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 173 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 174 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 175 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 176 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 177 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 178 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 179 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 180 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 181 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 182 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 183 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 184 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 185 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 186 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 187 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 188 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 189 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 190 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 191 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 192 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 193 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 194 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 195 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 196 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 197 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 198 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 199 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 200 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 201 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 202 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 203 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 204 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 205 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 206 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 207 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 208 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 209 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 210 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 211 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 212 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 213 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 214 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 268 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 278 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 280 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 281 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 283 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 284 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 285 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 286 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 287 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 288 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 289 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 290 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 291 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 292 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 293 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 294 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 295 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 296 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 297 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 298 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 299 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 300 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 301 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 302 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 303 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 304 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 305 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 306 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 307 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 308 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 309 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 310 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 311 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 312 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 313 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 314 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 315 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 316 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 317 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 318 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 319 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 320 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 321 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 322 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 323 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 324 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 325 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 326 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 327 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 328 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 329 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 330 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 331 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 332 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 333 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 334 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 335 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 336 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 337 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 338 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 339 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 340 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 341 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 342 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 343 | 3300044666 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E | Metagenome | Unclassified |
| 344 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 345 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 346 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 347 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 348 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 349 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 350 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 351 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 352 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 353 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 354 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 355 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 356 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 410 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 411 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 412 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 413 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 414 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 415 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 416 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 417 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 418 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 419 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 420 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 421 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 422 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 423 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 424 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 426 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 427 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 428 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 429 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 430 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 431 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 432 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 433 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 434 | 3300049524 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control | Metagenome | Rhizosphere |
| 435 | 3300049526 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control | Metagenome | Rhizosphere |
| 436 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 437 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 438 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 439 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 440 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 441 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 442 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 443 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 444 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 445 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 446 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 447 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 448 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 449 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 450 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 451 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 452 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 453 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 454 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 455 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 456 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 457 | 3300049650 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought | Metagenome | Rhizosphere |
| 458 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 459 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 460 | 3300049655 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought | Metagenome | Rhizosphere |
| 461 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 462 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 463 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 464 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 465 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 466 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 467 | 3300049672 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought | Metagenome | Rhizosphere |
| 468 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 469 | 3300049676 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control | Metagenome | Rhizosphere |
| 470 | 3300049677 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control | Metagenome | Rhizosphere |
| 471 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 472 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 473 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 474 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 475 | 3300049689 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought | Metagenome | Rhizosphere |
| 476 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 477 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 478 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 479 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 480 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 481 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 482 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 483 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 484 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 485 | 3300049757 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control | Metagenome | Rhizosphere |
| 486 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 487 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 488 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 489 | 3300049768 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought | Metagenome | Rhizosphere |
| 490 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 491 | 3300049774 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought | Metagenome | Rhizosphere |
| 492 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 493 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 494 | 3300049777 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control | Metagenome | Rhizosphere |
| 495 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 496 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 497 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 498 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 499 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 500 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 501 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 502 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 503 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 504 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 505 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 506 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 507 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 508 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 509 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 510 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 511 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 512 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 513 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 514 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 515 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 516 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 517 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 518 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 519 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 520 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 521 | 639633007 | Azoarcus olearius BH72 | Isolate | Unclassified |
| 522 | 644736347 | Cupriavidus taiwanensis LMG 19424 | Isolate | Nodule |
| 523 | 8003400568 | Cupriavidus gilardii USM5 | Isolate | Rhizosphere |
| 524 | 8047673197 | Telluria mixta LMG 11547 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.92 |
| Metatranscriptomes | 0.21 |
| Isolates | 5.86 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.28 |
| Nodule | 1.17 |
| Rhizoplane | 1.6 |
| Rhizosphere | 80.6 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.36 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24741J21665_1000120 | 3300001915 | Bacteria | 21131 |
| 2 | JGI25155J39150_1000205 | 3300002704 | Bacteria | 23971 |
| 3 | JGI25155J39150_1000224 | 3300002704 | Bacteria | 22214 |
| 4 | JGI25155J39150_1000386 | 3300002704 | Bacteria | 12552 |
| 5 | JGI25156J39149_1000357 | 3300002705 | Bacteria | 29554 |
| 6 | JGI25156J39149_1002757 | 3300002705 | Bacteria | 6103 |
| 7 | JGI25156J39149_1003165 | 3300002705 | Bacteria | 5528 |
| 8 | JGI25154J39366_1000298 | 3300002738 | Bacteria | 29516 |
| 9 | JGI25154J39366_1000314 | 3300002738 | Bacteria | 28089 |
| 10 | JGI25154J39366_1001626 | 3300002738 | Bacteria | 7580 |
| 11 | JGI25157J39369_1000262 | 3300002741 | Bacteria | 38795 |
| 12 | JGI25157J39369_1000702 | 3300002741 | Bacteria | 18049 |
| 13 | JGI25151J46595_10002295 | 3300003187 | Bacteria | 11698 |
| 14 | rootH2_10038054 | 3300003320 | Bacteria | 8042 |
| 15 | JGI26145J50221_1000448 | 3300003371 | Bacteria | 3576 |
| 16 | Ga0006562J51391_1127957 | 3300003578 | Bacteria | 2566 |
| 17 | Ga0055538_1000110 | 3300003751 | Bacteria | 64583 |
| 18 | Ga0055539_1000094 | 3300003752 | Bacteria | 103196 |
| 19 | Ga0055539_1000159 | 3300003752 | Bacteria | 64583 |
| 20 | Ga0055533_1000161 | 3300003756 | Bacteria | 64583 |
| 21 | Ga0055532_1000006 | 3300003758 | Bacteria | 451244 |
| 22 | Ga0055532_1000059 | 3300003758 | Bacteria | 152948 |
| 23 | Ga0055525_1000081 | 3300003759 | Bacteria | 161329 |
| 24 | Ga0055525_1000214 | 3300003759 | Bacteria | 64583 |
| 25 | Ga0055525_1000323 | 3300003759 | Bacteria | 37297 |
| 26 | Ga0055527_1003007 | 3300003760 | Bacteria | 2632 |
| 27 | Ga0055535_1000004 | 3300003761 | Bacteria | 451244 |
| 28 | Ga0055542_1000940 | 3300003762 | Bacteria | 19156 |
| 29 | Ga0055529_1000022 | 3300003763 | Bacteria | 320108 |
| 30 | Ga0055526_1000651 | 3300003771 | Bacteria | 26844 |
| 31 | Ga0055526_1003073 | 3300003771 | Bacteria | 10849 |
| 32 | Ga0055526_1004090 | 3300003771 | Bacteria | 8916 |
| 33 | Ga0055526_1006100 | 3300003771 | Bacteria | 6656 |
| 34 | Ga0055537_1001420 | 3300003773 | Bacteria | 9394 |
| 35 | Ga0055524_1000642 | 3300003775 | Bacteria | 24850 |
| 36 | Ga0055524_1006682 | 3300003775 | Bacteria | 4983 |
| 37 | Ga0055536_1000094 | 3300003781 | Bacteria | 76734 |
| 38 | Ga0055536_1000110 | 3300003781 | Bacteria | 72378 |
| 39 | Ga0055534_1000656 | 3300003784 | Bacteria | 17498 |
| 40 | Ga0055534_1001751 | 3300003784 | Bacteria | 8196 |
| 41 | Ga0055531_10000007 | 3300003794 | Bacteria | 225289 |
| 42 | Ga0055541_1000105 | 3300003841 | Bacteria | 64583 |
| 43 | Ga0055541_1000464 | 3300003841 | Bacteria | 11612 |
| 44 | Ga0065704_10077577 | 3300005289 | Bacteria | 4689 |
| 45 | Ga0065712_10096373 | 3300005290 | Bacteria | 2185 |
| 46 | Ga0065707_10082548 | 3300005295 | Bacteria | 13907 |
| 47 | Ga0070676_10008985 | 3300005328 | Bacteria | 5405 |
| 48 | Ga0070683_100015466 | 3300005329 | Bacteria | 6704 |
| 49 | Ga0070690_100001012 | 3300005330 | Bacteria | 14375 |
| 50 | Ga0070690_100012031 | 3300005330 | Bacteria | 5079 |
| 51 | Ga0070670_100000054 | 3300005331 | Bacteria | 127396 |
| 52 | Ga0070670_100007425 | 3300005331 | Bacteria | 9309 |
| 53 | Ga0070670_100024257 | 3300005331 | Bacteria | 5217 |
| 54 | Ga0070677_10001872 | 3300005333 | Bacteria | 6654 |
| 55 | Ga0068869_100124717 | 3300005334 | Unclassified | 1974 |
| 56 | Ga0070666_10008897 | 3300005335 | Bacteria | 6245 |
| 57 | Ga0070666_10015909 | 3300005335 | Bacteria | 4806 |
| 58 | Ga0070682_100039419 | 3300005337 | Bacteria | 2903 |
| 59 | Ga0070682_100078636 | 3300005337 | Bacteria | 2128 |
| 60 | Ga0070682_100096002 | 3300005337 | Bacteria | 1948 |
| 61 | Ga0068868_100045184 | 3300005338 | Bacteria | 3445 |
| 62 | Ga0068868_100086366 | 3300005338 | Bacteria | 2522 |
| 63 | Ga0068868_100160142 | 3300005338 | Bacteria | 1858 |
| 64 | Ga0070660_100003556 | 3300005339 | Bacteria | 10762 |
| 65 | Ga0070660_100004636 | 3300005339 | Bacteria | 9517 |
| 66 | Ga0070660_100100823 | 3300005339 | Bacteria | 2287 |
| 67 | Ga0070689_100000070 | 3300005340 | Bacteria | 61448 |
| 68 | Ga0070689_100040742 | 3300005340 | Bacteria | 3562 |
| 69 | Ga0070689_100042986 | 3300005340 | Bacteria | 3471 |
| 70 | Ga0070691_10000598 | 3300005341 | Bacteria | 13822 |
| 71 | Ga0070687_100013134 | 3300005343 | Bacteria | 3680 |
| 72 | Ga0070661_100000012 | 3300005344 | Bacteria | 167998 |
| 73 | Ga0070661_100005481 | 3300005344 | Bacteria | 8749 |
| 74 | Ga0070668_100005970 | 3300005347 | Bacteria | 9034 |
| 75 | Ga0070669_100000779 | 3300005353 | Bacteria | 23159 |
| 76 | Ga0070669_100002303 | 3300005353 | Bacteria | 13840 |
| 77 | Ga0070675_100013140 | 3300005354 | Bacteria | 6506 |
| 78 | Ga0070671_100000037 | 3300005355 | Bacteria | 95248 |
| 79 | Ga0070671_100053012 | 3300005355 | Unclassified | 3372 |
| 80 | Ga0070674_100001339 | 3300005356 | Bacteria | 12993 |
| 81 | Ga0070674_100006470 | 3300005356 | Bacteria | 6837 |
| 82 | Ga0070673_100000190 | 3300005364 | Bacteria | 30180 |
| 83 | Ga0070673_100001171 | 3300005364 | Bacteria | 15046 |
| 84 | Ga0070673_100153218 | 3300005364 | Bacteria | 1954 |
| 85 | Ga0070688_100000006 | 3300005365 | Bacteria | 92017 |
| 86 | Ga0070659_100001082 | 3300005366 | Bacteria | 19884 |
| 87 | Ga0070659_100001965 | 3300005366 | Bacteria | 14678 |
| 88 | Ga0070659_100006729 | 3300005366 | Bacteria | 8311 |
| 89 | Ga0070659_100053140 | 3300005366 | Bacteria | 3188 |
| 90 | Ga0070667_100000002 | 3300005367 | Bacteria | 504831 |
| 91 | Ga0070667_100121803 | 3300005367 | Unclassified | 2269 |
| 92 | Ga0070701_10000161 | 3300005438 | Bacteria | 20802 |
| 93 | Ga0070700_100000390 | 3300005441 | Bacteria | 22595 |
| 94 | Ga0070700_100053233 | 3300005441 | Bacteria | 2525 |
| 95 | Ga0070694_100029065 | 3300005444 | Unclassified | 3604 |
| 96 | Ga0070694_100075087 | 3300005444 | Bacteria | 2338 |
| 97 | Ga0070663_100000003 | 3300005455 | Bacteria | 260492 |
| 98 | Ga0070663_100014804 | 3300005455 | Bacteria | 5014 |
| 99 | Ga0070678_100075262 | 3300005456 | Bacteria | 2539 |
| 100 | Ga0070662_100000059 | 3300005457 | Bacteria | 59672 |
| 101 | Ga0070662_100018115 | 3300005457 | Bacteria | 4760 |
| 102 | Ga0070662_100091708 | 3300005457 | Bacteria | 2282 |
| 103 | Ga0070681_10032587 | 3300005458 | Bacteria | 5231 |
| 104 | Ga0068867_100000588 | 3300005459 | Bacteria | 24065 |
| 105 | Ga0070685_10000014 | 3300005466 | Bacteria | 120530 |
| 106 | Ga0070685_10000693 | 3300005466 | Bacteria | 18235 |
| 107 | Ga0070706_100035202 | 3300005467 | Bacteria | 4624 |
| 108 | Ga0070707_100000032 | 3300005468 | Bacteria | 118776 |
| 109 | Ga0070707_100082597 | 3300005468 | Bacteria | 3103 |
| 110 | Ga0070707_100193040 | 3300005468 | Bacteria | 1986 |
| 111 | Ga0070698_100097369 | 3300005471 | Unclassified | 2918 |
| 112 | Ga0070699_100005467 | 3300005518 | Bacteria | 11135 |
| 113 | Ga0070699_100049858 | 3300005518 | Bacteria | 3623 |
| 114 | Ga0070684_100149560 | 3300005535 | Unclassified | 2115 |
| 115 | Ga0070697_100035617 | 3300005536 | Bacteria | 4016 |
| 116 | Ga0070697_100055367 | 3300005536 | Bacteria | 3225 |
| 117 | Ga0070672_100000116 | 3300005543 | Bacteria | 40577 |
| 118 | Ga0070672_100000683 | 3300005543 | Bacteria | 19990 |
| 119 | Ga0070672_100173255 | 3300005543 | Bacteria | 1795 |
| 120 | Ga0070686_100000897 | 3300005544 | Bacteria | 17311 |
| 121 | Ga0070686_100002011 | 3300005544 | Bacteria | 11273 |
| 122 | Ga0070695_100027086 | 3300005545 | Bacteria | 3548 |
| 123 | Ga0070695_100077990 | 3300005545 | Bacteria | 2183 |
| 124 | Ga0070696_100000917 | 3300005546 | Bacteria | 19177 |
| 125 | Ga0070696_100002873 | 3300005546 | Bacteria | 11454 |
| 126 | Ga0070665_100079228 | 3300005548 | Bacteria | 3291 |
| 127 | Ga0070665_100252100 | 3300005548 | Bacteria | 1766 |
| 128 | Ga0070704_100025964 | 3300005549 | Bacteria | 3863 |
| 129 | Ga0070704_100131554 | 3300005549 | Unclassified | 1940 |
| 130 | Ga0068855_100002313 | 3300005563 | Bacteria | 23555 |
| 131 | Ga0068855_100296172 | 3300005563 | Unclassified | 1792 |
| 132 | Ga0070664_100000003 | 3300005564 | Bacteria | 325604 |
| 133 | Ga0070664_100002039 | 3300005564 | Bacteria | 16186 |
| 134 | Ga0070664_100018224 | 3300005564 | Bacteria | 5762 |
| 135 | Ga0068857_100004739 | 3300005577 | Bacteria | 11524 |
| 136 | Ga0068857_100130134 | 3300005577 | Bacteria | 2270 |
| 137 | Ga0068854_100000063 | 3300005578 | Bacteria | 77198 |
| 138 | Ga0068854_100014150 | 3300005578 | Bacteria | 5253 |
| 139 | Ga0068854_100028452 | 3300005578 | Bacteria | 3862 |
| 140 | Ga0068856_100000256 | 3300005614 | Bacteria | 58184 |
| 141 | Ga0068856_100150656 | 3300005614 | Bacteria | 2335 |
| 142 | Ga0070702_100047359 | 3300005615 | Bacteria | 2442 |
| 143 | Ga0068852_100002180 | 3300005616 | Bacteria | 13425 |
| 144 | Ga0068852_100022134 | 3300005616 | Bacteria | 5092 |
| 145 | Ga0068859_100046115 | 3300005617 | Bacteria | 4378 |
| 146 | Ga0068859_100187125 | 3300005617 | Bacteria | 2154 |
| 147 | Ga0068864_100000002 | 3300005618 | Bacteria | 658857 |
| 148 | Ga0068866_10019056 | 3300005718 | Bacteria | 3116 |
| 149 | Ga0068861_100050758 | 3300005719 | Bacteria | 3146 |
| 150 | Ga0068861_100057108 | 3300005719 | Unclassified | 2981 |
| 151 | Ga0068851_10056120 | 3300005834 | Bacteria | 2008 |
| 152 | Ga0068858_100001596 | 3300005842 | Bacteria | 23124 |
| 153 | Ga0068858_100003164 | 3300005842 | Bacteria | 16479 |
| 154 | Ga0068858_100026292 | 3300005842 | Bacteria | 5410 |
| 155 | Ga0068858_100084998 | 3300005842 | Bacteria | 2943 |
| 156 | Ga0068860_100000844 | 3300005843 | Bacteria | 34309 |
| 157 | Ga0068860_100014459 | 3300005843 | Bacteria | 7728 |
| 158 | Ga0081455_10000900 | 3300005937 | Bacteria | 38337 |
| 159 | Ga0081539_10042221 | 3300005985 | Bacteria | 2658 |
| 160 | Ga0075363_100034682 | 3300006048 | Bacteria | 2635 |
| 161 | Ga0075364_10051700 | 3300006051 | Bacteria | 2684 |
| 162 | Ga0075432_10000012 | 3300006058 | Bacteria | 34480 |
| 163 | Ga0075366_10008423 | 3300006195 | Bacteria | 5733 |
| 164 | Ga0075366_10020793 | 3300006195 | Bacteria | 3809 |
| 165 | Ga0075366_10036985 | 3300006195 | Bacteria | 2880 |
| 166 | Ga0097621_100021171 | 3300006237 | Bacteria | 5024 |
| 167 | Ga0097621_100021799 | 3300006237 | Bacteria | 4964 |
| 168 | Ga0097621_100041534 | 3300006237 | Bacteria | 3702 |
| 169 | Ga0097621_100173286 | 3300006237 | Bacteria | 1861 |
| 170 | Ga0068871_100012101 | 3300006358 | Bacteria | 6350 |
| 171 | Ga0068871_100019039 | 3300006358 | Bacteria | 5234 |
| 172 | Ga0068871_100075038 | 3300006358 | Bacteria | 2791 |
| 173 | Ga0075428_100051320 | 3300006844 | Bacteria | 4523 |
| 174 | Ga0075430_100002760 | 3300006846 | Bacteria | 14668 |
| 175 | Ga0075430_100005824 | 3300006846 | Bacteria | 10398 |
| 176 | Ga0075431_100004053 | 3300006847 | Bacteria | 14278 |
| 177 | Ga0075431_100021196 | 3300006847 | Bacteria | 6641 |
| 178 | Ga0075431_100090819 | 3300006847 | Bacteria | 3152 |
| 179 | Ga0075431_100092175 | 3300006847 | Bacteria | 3127 |
| 180 | Ga0075433_10006279 | 3300006852 | Bacteria | 9383 |
| 181 | Ga0075429_100028503 | 3300006880 | Bacteria | 4848 |
| 182 | Ga0075429_100041774 | 3300006880 | Bacteria | 3993 |
| 183 | Ga0068865_100003182 | 3300006881 | Bacteria | 9837 |
| 184 | Ga0097620_100046114 | 3300006931 | Bacteria | 4378 |
| 185 | Ga0097620_100187119 | 3300006931 | Bacteria | 2154 |
| 186 | Ga0079104_1002487 | 3300006946 | Bacteria | 9833 |
| 187 | Ga0099826_10000014 | 3300006948 | Bacteria | 258520 |
| 188 | Ga0075435_100022656 | 3300007076 | Bacteria | 4847 |
| 189 | Ga0075435_100054284 | 3300007076 | Bacteria | 3233 |
| 190 | Ga0105244_10036312 | 3300009036 | Bacteria | 2582 |
| 191 | Ga0105244_10063047 | 3300009036 | Bacteria | 1862 |
| 192 | Ga0105240_10002549 | 3300009093 | Bacteria | 29203 |
| 193 | Ga0105240_10006370 | 3300009093 | Bacteria | 17381 |
| 194 | Ga0105240_10052544 | 3300009093 | Bacteria | 5121 |
| 195 | Ga0105240_10067174 | 3300009093 | Bacteria | 4445 |
| 196 | Ga0111539_10000106 | 3300009094 | Bacteria | 90149 |
| 197 | Ga0111539_10006915 | 3300009094 | Bacteria | 14568 |
| 198 | Ga0111539_10013844 | 3300009094 | Bacteria | 10084 |
| 199 | Ga0111539_10125488 | 3300009094 | Bacteria | 3007 |
| 200 | Ga0105245_10016534 | 3300009098 | Bacteria | 6437 |
| 201 | Ga0105245_10067537 | 3300009098 | Bacteria | 3238 |
| 202 | Ga0105247_10042854 | 3300009101 | Bacteria | 2772 |
| 203 | Ga0114129_10003723 | 3300009147 | Bacteria | 21500 |
| 204 | Ga0114129_10016942 | 3300009147 | Bacteria | 10375 |
| 205 | Ga0114129_10020244 | 3300009147 | Bacteria | 9469 |
| 206 | Ga0114129_10041544 | 3300009147 | Bacteria | 6479 |
| 207 | Ga0114129_10081280 | 3300009147 | Bacteria | 4504 |
| 208 | Ga0114129_10395888 | 3300009147 | Bacteria | 1821 |
| 209 | Ga0105243_10001690 | 3300009148 | Bacteria | 19014 |
| 210 | Ga0105243_10029824 | 3300009148 | Bacteria | 4197 |
| 211 | Ga0105243_10034506 | 3300009148 | Bacteria | 3917 |
| 212 | Ga0105243_10083206 | 3300009148 | Bacteria | 2618 |
| 213 | Ga0105241_10021227 | 3300009174 | Bacteria | 4798 |
| 214 | Ga0105242_10000115 | 3300009176 | Bacteria | 57986 |
| 215 | Ga0105242_10000834 | 3300009176 | Bacteria | 23976 |
| 216 | Ga0105242_10033981 | 3300009176 | Bacteria | 4087 |
| 217 | Ga0105242_10156871 | 3300009176 | Bacteria | 1989 |
| 218 | Ga0105248_10004494 | 3300009177 | Bacteria | 15438 |
| 219 | Ga0105248_10020966 | 3300009177 | Bacteria | 7244 |
| 220 | Ga0105248_10042075 | 3300009177 | Bacteria | 5124 |
| 221 | Ga0105237_10014545 | 3300009545 | Bacteria | 8222 |
| 222 | Ga0105237_10040376 | 3300009545 | Bacteria | 4706 |
| 223 | Ga0105238_10000258 | 3300009551 | Bacteria | 59300 |
| 224 | Ga0105238_10000537 | 3300009551 | Bacteria | 39712 |
| 225 | Ga0105249_10107901 | 3300009553 | Bacteria | 2628 |
| 226 | Ga0105239_10003482 | 3300010375 | Bacteria | 19261 |
| 227 | Ga0105239_10012398 | 3300010375 | Bacteria | 9492 |
| 228 | Ga0105246_10000428 | 3300011119 | Bacteria | 22446 |
| 229 | Ga0157373_10037002 | 3300013100 | Bacteria | 3501 |
| 230 | Ga0157373_10042627 | 3300013100 | Bacteria | 3243 |
| 231 | Ga0157371_10000755 | 3300013102 | Bacteria | 37443 |
| 232 | Ga0157370_10000921 | 3300013104 | Bacteria | 37306 |
| 233 | Ga0157369_10026862 | 3300013105 | Bacteria | 6384 |
| 234 | Ga0157369_10111531 | 3300013105 | Bacteria | 2907 |
| 235 | Ga0157374_10003255 | 3300013296 | Bacteria | 13642 |
| 236 | Ga0157374_10005053 | 3300013296 | Bacteria | 11065 |
| 237 | Ga0157374_10110758 | 3300013296 | Bacteria | 2640 |
| 238 | Ga0157374_10201938 | 3300013296 | Bacteria | 1947 |
| 239 | Ga0157378_10005614 | 3300013297 | Bacteria | 10990 |
| 240 | Ga0157378_10056594 | 3300013297 | Bacteria | 3495 |
| 241 | Ga0163162_10013512 | 3300013306 | Bacteria | 7972 |
| 242 | Ga0157372_10002524 | 3300013307 | Bacteria | 19852 |
| 243 | Ga0157375_10072169 | 3300013308 | Bacteria | 3468 |
| 244 | Ga0157375_10096306 | 3300013308 | Bacteria | 3032 |
| 245 | Ga0163163_10004619 | 3300014325 | Bacteria | 11758 |
| 246 | Ga0157380_10003948 | 3300014326 | Bacteria | 10238 |
| 247 | Ga0157380_10033827 | 3300014326 | Unclassified | 3938 |
| 248 | Ga0157380_10090109 | 3300014326 | Bacteria | 2529 |
| 249 | Ga0182008_10013237 | 3300014497 | Bacteria | 4337 |
| 250 | Ga0157377_10055886 | 3300014745 | Bacteria | 2240 |
| 251 | Ga0157376_10005228 | 3300014969 | Bacteria | 9063 |
| 252 | Ga0157376_10024880 | 3300014969 | Bacteria | 4708 |
| 253 | Ga0182006_1002915 | 3300015261 | Bacteria | 9073 |
| 254 | Ga0182007_10009681 | 3300015262 | Bacteria | 3865 |
| 255 | Ga0154015_1057316 | 3300020610 | Bacteria | 23087 |
| 256 | Ga0213872_10000093 | 3300021361 | Bacteria | 83513 |
| 257 | Ga0213872_10002967 | 3300021361 | Bacteria | 9599 |
| 258 | Ga0213872_10003726 | 3300021361 | Bacteria | 8334 |
| 259 | Ga0213872_10027058 | 3300021361 | Bacteria | 2633 |
| 260 | Ga0209435_100032 | 3300025206 | Bacteria | 153068 |
| 261 | Ga0209435_100146 | 3300025206 | Bacteria | 23627 |
| 262 | Ga0209784_100035 | 3300025224 | Bacteria | 299760 |
| 263 | Ga0209784_100223 | 3300025224 | Bacteria | 38244 |
| 264 | Ga0209784_100389 | 3300025224 | Bacteria | 20132 |
| 265 | Ga0209566_100002 | 3300025225 | Bacteria | 2614868 |
| 266 | Ga0209566_100040 | 3300025225 | Bacteria | 299760 |
| 267 | Ga0209566_100597 | 3300025225 | Bacteria | 22638 |
| 268 | Ga0209566_102325 | 3300025225 | Bacteria | 3632 |
| 269 | Ga0209674_100010 | 3300025226 | Bacteria | 1038638 |
| 270 | Ga0209674_100050 | 3300025226 | Bacteria | 341738 |
| 271 | Ga0209674_100057 | 3300025226 | Bacteria | 299760 |
| 272 | Ga0209674_100262 | 3300025226 | Bacteria | 42282 |
| 273 | Ga0209672_100111 | 3300025228 | Bacteria | 94440 |
| 274 | Ga0209147_100015 | 3300025229 | Bacteria | 565073 |
| 275 | Ga0209147_100109 | 3300025229 | Bacteria | 153068 |
| 276 | Ga0209563_100004 | 3300025230 | Bacteria | 1814108 |
| 277 | Ga0209563_100015 | 3300025230 | Bacteria | 879901 |
| 278 | Ga0209563_100026 | 3300025230 | Bacteria | 559453 |
| 279 | Ga0209563_100059 | 3300025230 | Bacteria | 299760 |
| 280 | Ga0209437_100512 | 3300025233 | Bacteria | 27460 |
| 281 | Ga0209258_100021 | 3300025242 | Bacteria | 565073 |
| 282 | Ga0209258_100190 | 3300025242 | Bacteria | 126878 |
| 283 | Ga0209646_1000055 | 3300025246 | Bacteria | 271793 |
| 284 | Ga0209646_1000113 | 3300025246 | Bacteria | 153068 |
| 285 | Ga0209646_1000327 | 3300025246 | Bacteria | 36378 |
| 286 | Ga0209026_1000102 | 3300025250 | Bacteria | 153068 |
| 287 | Ga0209026_1003686 | 3300025250 | Bacteria | 4903 |
| 288 | Ga0209677_100007 | 3300025253 | Bacteria | 1021332 |
| 289 | Ga0209677_100036 | 3300025253 | Bacteria | 299760 |
| 290 | Ga0209677_102096 | 3300025253 | Bacteria | 7876 |
| 291 | Ga0209677_104484 | 3300025253 | Bacteria | 4003 |
| 292 | Ga0209148_1000109 | 3300025254 | Bacteria | 204266 |
| 293 | Ga0209759_1000104 | 3300025256 | Bacteria | 153068 |
| 294 | Ga0209759_1001940 | 3300025256 | Bacteria | 10056 |
| 295 | Ga0209759_1001952 | 3300025256 | Bacteria | 9947 |
| 296 | Ga0209565_1000045 | 3300025263 | Bacteria | 226864 |
| 297 | Ga0209565_1010345 | 3300025263 | Bacteria | 2315 |
| 298 | Ga0209455_1000028 | 3300025272 | Bacteria | 565073 |
| 299 | Ga0209455_1005292 | 3300025272 | Bacteria | 4021 |
| 300 | Ga0209675_1000661 | 3300025291 | Bacteria | 24235 |
| 301 | Ga0209676_1000064 | 3300025292 | Bacteria | 321700 |
| 302 | Ga0209025_1000371 | 3300025294 | Bacteria | 94612 |
| 303 | Ga0209025_1001907 | 3300025294 | Bacteria | 24289 |
| 304 | Ga0209025_1004682 | 3300025294 | Bacteria | 11678 |
| 305 | Ga0209025_1008213 | 3300025294 | Bacteria | 7550 |
| 306 | Ga0209564_1001969 | 3300025295 | Bacteria | 18087 |
| 307 | Ga0209564_1003010 | 3300025295 | Bacteria | 12070 |
| 308 | Ga0209564_1003370 | 3300025295 | Bacteria | 11056 |
| 309 | Ga0209758_1016413 | 3300025297 | Bacteria | 3763 |
| 310 | Ga0209050_1010447 | 3300025298 | Bacteria | 4576 |
| 311 | Ga0209256_1000287 | 3300025299 | Bacteria | 88526 |
| 312 | Ga0209256_1000835 | 3300025299 | Bacteria | 38753 |
| 313 | Ga0209051_1016564 | 3300025303 | Bacteria | 3328 |
| 314 | Ga0209051_1020107 | 3300025303 | Bacteria | 2889 |
| 315 | Ga0209257_1000021 | 3300025304 | Bacteria | 771986 |
| 316 | Ga0207656_10002178 | 3300025321 | Bacteria | 6554 |
| 317 | Ga0207682_10002916 | 3300025893 | Bacteria | 7543 |
| 318 | Ga0207642_10011312 | 3300025899 | Bacteria | 3178 |
| 319 | Ga0207642_10038230 | 3300025899 | Bacteria | 2075 |
| 320 | Ga0207710_10029853 | 3300025900 | Bacteria | 2376 |
| 321 | Ga0207688_10007275 | 3300025901 | Bacteria | 6025 |
| 322 | Ga0207688_10042921 | 3300025901 | Bacteria | 2518 |
| 323 | Ga0207680_10008088 | 3300025903 | Bacteria | 5153 |
| 324 | Ga0207680_10017073 | 3300025903 | Bacteria | 3826 |
| 325 | Ga0207680_10021987 | 3300025903 | Bacteria | 3462 |
| 326 | Ga0207645_10000009 | 3300025907 | Bacteria | 142449 |
| 327 | Ga0207645_10009334 | 3300025907 | Bacteria | 6790 |
| 328 | Ga0207645_10016845 | 3300025907 | Bacteria | 4831 |
| 329 | Ga0207643_10018377 | 3300025908 | Bacteria | 3829 |
| 330 | Ga0207684_10041172 | 3300025910 | Bacteria | 3918 |
| 331 | Ga0207707_10106442 | 3300025912 | Bacteria | 2452 |
| 332 | Ga0207695_10001571 | 3300025913 | Bacteria | 37209 |
| 333 | Ga0207695_10003997 | 3300025913 | Bacteria | 20338 |
| 334 | Ga0207695_10021978 | 3300025913 | Bacteria | 7260 |
| 335 | Ga0207695_10241708 | 3300025913 | Bacteria | 1706 |
| 336 | Ga0207671_10006562 | 3300025914 | Bacteria | 10334 |
| 337 | Ga0207660_10005324 | 3300025917 | Bacteria | 8361 |
| 338 | Ga0207660_10032198 | 3300025917 | Bacteria | 3618 |
| 339 | Ga0207662_10015073 | 3300025918 | Bacteria | 4344 |
| 340 | Ga0207662_10020619 | 3300025918 | Bacteria | 3761 |
| 341 | Ga0207657_10005067 | 3300025919 | Bacteria | 13820 |
| 342 | Ga0207657_10102751 | 3300025919 | Unclassified | 2370 |
| 343 | Ga0207649_10000408 | 3300025920 | Bacteria | 31917 |
| 344 | Ga0207649_10009607 | 3300025920 | Bacteria | 5296 |
| 345 | Ga0207649_10013648 | 3300025920 | Bacteria | 4540 |
| 346 | Ga0207646_10000032 | 3300025922 | Bacteria | 216397 |
| 347 | Ga0207646_10063723 | 3300025922 | Bacteria | 3290 |
| 348 | Ga0207646_10081509 | 3300025922 | Bacteria | 2893 |
| 349 | Ga0207681_10001771 | 3300025923 | Bacteria | 13871 |
| 350 | Ga0207681_10001840 | 3300025923 | Bacteria | 13592 |
| 351 | Ga0207694_10000384 | 3300025924 | Bacteria | 41184 |
| 352 | Ga0207650_10000002 | 3300025925 | Bacteria | 1439222 |
| 353 | Ga0207650_10001415 | 3300025925 | Bacteria | 17295 |
| 354 | Ga0207650_10011570 | 3300025925 | Bacteria | 6076 |
| 355 | Ga0207650_10026204 | 3300025925 | Bacteria | 4156 |
| 356 | Ga0207650_10034544 | 3300025925 | Bacteria | 3667 |
| 357 | Ga0207659_10001981 | 3300025926 | Bacteria | 12117 |
| 358 | Ga0207659_10002634 | 3300025926 | Bacteria | 10689 |
| 359 | Ga0207687_10063307 | 3300025927 | Bacteria | 2618 |
| 360 | Ga0207644_10000114 | 3300025931 | Bacteria | 59996 |
| 361 | Ga0207644_10054530 | 3300025931 | Bacteria | 2880 |
| 362 | Ga0207690_10001518 | 3300025932 | Bacteria | 14519 |
| 363 | Ga0207690_10006028 | 3300025932 | Bacteria | 7184 |
| 364 | Ga0207706_10000134 | 3300025933 | Bacteria | 80573 |
| 365 | Ga0207706_10024959 | 3300025933 | Bacteria | 5359 |
| 366 | Ga0207706_10026965 | 3300025933 | Bacteria | 5140 |
| 367 | Ga0207706_10052507 | 3300025933 | Bacteria | 3599 |
| 368 | Ga0207706_10067903 | 3300025933 | Bacteria | 3138 |
| 369 | Ga0207686_10006468 | 3300025934 | Bacteria | 6307 |
| 370 | Ga0207686_10033668 | 3300025934 | Bacteria | 3060 |
| 371 | Ga0207709_10028889 | 3300025935 | Bacteria | 3210 |
| 372 | Ga0207709_10095548 | 3300025935 | Bacteria | 1953 |
| 373 | Ga0207709_10123125 | 3300025935 | Bacteria | 1754 |
| 374 | Ga0207670_10000160 | 3300025936 | Bacteria | 44356 |
| 375 | Ga0207670_10011882 | 3300025936 | Bacteria | 5071 |
| 376 | Ga0207670_10019416 | 3300025936 | Bacteria | 4152 |
| 377 | Ga0207669_10042504 | 3300025937 | Bacteria | 2653 |
| 378 | Ga0207704_10009221 | 3300025938 | Bacteria | 4750 |
| 379 | Ga0207665_10095622 | 3300025939 | Bacteria | 2065 |
| 380 | Ga0207691_10000015 | 3300025940 | Bacteria | 142014 |
| 381 | Ga0207691_10000066 | 3300025940 | Bacteria | 84662 |
| 382 | Ga0207691_10047442 | 3300025940 | Bacteria | 3941 |
| 383 | Ga0207691_10151284 | 3300025940 | Bacteria | 2040 |
| 384 | Ga0207711_10005430 | 3300025941 | Bacteria | 10780 |
| 385 | Ga0207711_10192370 | 3300025941 | Bacteria | 1860 |
| 386 | Ga0207689_10004460 | 3300025942 | Bacteria | 12692 |
| 387 | Ga0207661_10085137 | 3300025944 | Unclassified | 2620 |
| 388 | Ga0207679_10000007 | 3300025945 | Bacteria | 460140 |
| 389 | Ga0207679_10000931 | 3300025945 | Bacteria | 18690 |
| 390 | Ga0207679_10010190 | 3300025945 | Bacteria | 6047 |
| 391 | Ga0207679_10015279 | 3300025945 | Bacteria | 5067 |
| 392 | Ga0207679_10037901 | 3300025945 | Bacteria | 3431 |
| 393 | Ga0207667_10002083 | 3300025949 | Bacteria | 25061 |
| 394 | Ga0207667_10023865 | 3300025949 | Bacteria | 6730 |
| 395 | Ga0207651_10000209 | 3300025960 | Bacteria | 25205 |
| 396 | Ga0207651_10013780 | 3300025960 | Bacteria | 4641 |
| 397 | Ga0207712_10118138 | 3300025961 | Bacteria | 2001 |
| 398 | Ga0207668_10067417 | 3300025972 | Bacteria | 2541 |
| 399 | Ga0207640_10000132 | 3300025981 | Bacteria | 55549 |
| 400 | Ga0207640_10029086 | 3300025981 | Bacteria | 3387 |
| 401 | Ga0207640_10062780 | 3300025981 | Bacteria | 2466 |
| 402 | Ga0207658_10000001 | 3300025986 | Bacteria | 1439333 |
| 403 | Ga0207658_10017783 | 3300025986 | Bacteria | 4898 |
| 404 | Ga0207677_10027785 | 3300026023 | Bacteria | 3569 |
| 405 | Ga0207703_10007101 | 3300026035 | Bacteria | 8909 |
| 406 | Ga0207703_10036652 | 3300026035 | Bacteria | 3904 |
| 407 | Ga0207678_10000011 | 3300026067 | Bacteria | 147685 |
| 408 | Ga0207678_10004674 | 3300026067 | Bacteria | 12296 |
| 409 | Ga0207678_10059322 | 3300026067 | Bacteria | 3292 |
| 410 | Ga0207678_10135373 | 3300026067 | Bacteria | 2102 |
| 411 | Ga0207708_10000336 | 3300026075 | Bacteria | 36973 |
| 412 | Ga0207708_10001429 | 3300026075 | Bacteria | 17906 |
| 413 | Ga0207708_10015389 | 3300026075 | Bacteria | 5738 |
| 414 | Ga0207708_10063040 | 3300026075 | Bacteria | 2832 |
| 415 | Ga0207708_10071162 | 3300026075 | Bacteria | 2664 |
| 416 | Ga0207702_10000018 | 3300026078 | Bacteria | 212617 |
| 417 | Ga0207702_10116246 | 3300026078 | Bacteria | 2387 |
| 418 | Ga0207641_10010053 | 3300026088 | Bacteria | 7781 |
| 419 | Ga0207641_10010055 | 3300026088 | Bacteria | 7779 |
| 420 | Ga0207648_10000049 | 3300026089 | Bacteria | 108876 |
| 421 | Ga0207648_10003565 | 3300026089 | Bacteria | 16280 |
| 422 | Ga0207648_10007583 | 3300026089 | Bacteria | 10641 |
| 423 | Ga0207676_10000001 | 3300026095 | Bacteria | 1439222 |
| 424 | Ga0207676_10008539 | 3300026095 | Bacteria | 7281 |
| 425 | Ga0207674_10001844 | 3300026116 | Bacteria | 27005 |
| 426 | Ga0207674_10031517 | 3300026116 | Bacteria | 5569 |
| 427 | Ga0207674_10037920 | 3300026116 | Bacteria | 5007 |
| 428 | Ga0207674_10086447 | 3300026116 | Bacteria | 3130 |
| 429 | Ga0207674_10095295 | 3300026116 | Bacteria | 2962 |
| 430 | Ga0207674_10148254 | 3300026116 | Bacteria | 2304 |
| 431 | Ga0207683_10000023 | 3300026121 | Bacteria | 114463 |
| 432 | Ga0207683_10000501 | 3300026121 | Bacteria | 36209 |
| 433 | Ga0207698_10000462 | 3300026142 | Bacteria | 23583 |
| 434 | Ga0207698_10000553 | 3300026142 | Bacteria | 21782 |
| 435 | Ga0207698_10081542 | 3300026142 | Bacteria | 2612 |
| 436 | Ga0207698_10110019 | 3300026142 | Bacteria | 2307 |
| 437 | Ga0209281_1003184 | 3300027111 | Bacteria | 5643 |
| 438 | Ga0209969_1000683 | 3300027360 | Bacteria | 4544 |
| 439 | Ga0209969_1001115 | 3300027360 | Bacteria | 3682 |
| 440 | Ga0209967_1000047 | 3300027364 | Bacteria | 15443 |
| 441 | Ga0209981_1000336 | 3300027378 | Bacteria | 6067 |
| 442 | Ga0209996_1000225 | 3300027395 | Bacteria | 7304 |
| 443 | Ga0209984_1000396 | 3300027424 | Bacteria | 4750 |
| 444 | Ga0210000_1000180 | 3300027462 | Bacteria | 9138 |
| 445 | Ga0209995_1000150 | 3300027471 | Bacteria | 11181 |
| 446 | Ga0209968_1000036 | 3300027526 | Bacteria | 24144 |
| 447 | Ga0209970_1000719 | 3300027614 | Bacteria | 5745 |
| 448 | Ga0209282_1000048 | 3300027666 | Bacteria | 111312 |
| 449 | Ga0209971_1000062 | 3300027682 | Bacteria | 34062 |
| 450 | Ga0209966_1000210 | 3300027695 | Bacteria | 23707 |
| 451 | Ga0209998_10000030 | 3300027717 | Bacteria | 60299 |
| 452 | Ga0209974_10000386 | 3300027876 | Bacteria | 14621 |
| 453 | Ga0209974_10000506 | 3300027876 | Bacteria | 13008 |
| 454 | Ga0207428_10001516 | 3300027907 | Bacteria | 24234 |
| 455 | Ga0207428_10006322 | 3300027907 | Bacteria | 10951 |
| 456 | Ga0207428_10007796 | 3300027907 | Bacteria | 9747 |
| 457 | Ga0268266_10023623 | 3300028379 | Bacteria | 5233 |
| 458 | Ga0268266_10056565 | 3300028379 | Bacteria | 3374 |
| 459 | Ga0268266_10085640 | 3300028379 | Bacteria | 2754 |
| 460 | Ga0268265_10009824 | 3300028380 | Bacteria | 6458 |
| 461 | Ga0268264_10000004 | 3300028381 | Bacteria | 1116842 |
| 462 | Ga0265318_10001430 | 3300028577 | Bacteria | 14112 |
| 463 | Ga0265336_10000511 | 3300028666 | Bacteria | 22483 |
| 464 | Ga0307515_10009616 | 3300028794 | Bacteria | 18663 |
| 465 | Ga0265338_10093773 | 3300028800 | Bacteria | 2472 |
| 466 | Ga0265324_10000011 | 3300029957 | Bacteria | 218521 |
| 467 | Ga0265324_10000340 | 3300029957 | Bacteria | 34285 |
| 468 | Ga0265324_10024393 | 3300029957 | Bacteria | 2147 |
| 469 | Ga0307511_10000022 | 3300030521 | Bacteria | 116875 |
| 470 | Ga0265328_10000447 | 3300031239 | Bacteria | 19190 |
| 471 | Ga0265328_10002460 | 3300031239 | Bacteria | 8309 |
| 472 | Ga0265328_10005254 | 3300031239 | Bacteria | 5562 |
| 473 | Ga0265328_10006977 | 3300031239 | Bacteria | 4740 |
| 474 | Ga0265325_10000125 | 3300031241 | Bacteria | 52592 |
| 475 | Ga0265325_10007301 | 3300031241 | Bacteria | 6632 |
| 476 | Ga0265329_10004482 | 3300031242 | Bacteria | 5795 |
| 477 | Ga0265331_10000070 | 3300031250 | Bacteria | 152331 |
| 478 | Ga0265331_10003188 | 3300031250 | Bacteria | 10707 |
| 479 | Ga0265331_10022219 | 3300031250 | Bacteria | 3238 |
| 480 | Ga0265327_10000068 | 3300031251 | Bacteria | 219962 |
| 481 | Ga0265327_10000156 | 3300031251 | Bacteria | 146362 |
| 482 | Ga0265327_10000205 | 3300031251 | Bacteria | 123596 |
| 483 | Ga0265327_10000706 | 3300031251 | Bacteria | 52819 |
| 484 | Ga0265327_10000719 | 3300031251 | Bacteria | 52024 |
| 485 | Ga0265327_10001333 | 3300031251 | Bacteria | 31995 |
| 486 | Ga0265327_10003120 | 3300031251 | Bacteria | 16304 |
| 487 | Ga0265327_10003549 | 3300031251 | Bacteria | 14790 |
| 488 | Ga0265327_10006214 | 3300031251 | Bacteria | 9629 |
| 489 | Ga0265327_10006520 | 3300031251 | Bacteria | 9293 |
| 490 | Ga0265327_10008435 | 3300031251 | Bacteria | 7671 |
| 491 | Ga0265327_10020927 | 3300031251 | Bacteria | 3966 |
| 492 | Ga0265327_10044401 | 3300031251 | Bacteria | 2370 |
| 493 | Ga0265327_10073494 | 3300031251 | Bacteria | 1705 |
| 494 | Ga0265316_10000005 | 3300031344 | Bacteria | 304442 |
| 495 | Ga0265316_10059298 | 3300031344 | Bacteria | 2977 |
| 496 | Ga0307408_100000023 | 3300031548 | Bacteria | 295931 |
| 497 | Ga0307408_100023759 | 3300031548 | Bacteria | 4179 |
| 498 | Ga0316575_10005752 | 3300031665 | Bacteria | 4428 |
| 499 | Ga0316579_10000015 | 3300031691 | Bacteria | 39681 |
| 500 | Ga0265314_10000134 | 3300031711 | Bacteria | 111395 |
| 501 | Ga0265314_10007756 | 3300031711 | Bacteria | 9281 |
| 502 | Ga0265314_10020023 | 3300031711 | Bacteria | 5172 |
| 503 | Ga0307516_10002741 | 3300031730 | Bacteria | 23228 |
| 504 | Ga0307405_10018136 | 3300031731 | Bacteria | 3877 |
| 505 | Ga0307413_10002623 | 3300031824 | Bacteria | 7356 |
| 506 | Ga0307407_10030521 | 3300031903 | Bacteria | 2909 |
| 507 | Ga0307412_10030943 | 3300031911 | Bacteria | 3375 |
| 508 | Ga0307412_10057247 | 3300031911 | Bacteria | 2601 |
| 509 | Ga0307416_100006355 | 3300032002 | Bacteria | 7388 |
| 510 | Ga0307416_100050238 | 3300032002 | Bacteria | 3323 |
| 511 | Ga0307416_100126947 | 3300032002 | Bacteria | 2286 |
| 512 | Ga0307411_10090392 | 3300032005 | Bacteria | 2135 |
| 513 | Ga0307415_100000756 | 3300032126 | Bacteria | 14568 |
| 514 | Ga0316583_10000483 | 3300032133 | Bacteria | 11841 |
| 515 | Ga0316583_10004823 | 3300032133 | Bacteria | 4817 |
| 516 | Ga0307507_10047428 | 3300033179 | Bacteria | 4196 |
| 517 | Ga0373952_0000324 | 3300035092 | Bacteria | 8028 |
| 518 | Ga0373923_0094106 | 3300035111 | Bacteria | 1314 |
| 519 | Ga0373956_0036076 | 3300035119 | Bacteria | 2182 |
| 520 | Ga0373957_0045731 | 3300035120 | Bacteria | 1660 |
| 521 | Ga0373960_0019946 | 3300035121 | Bacteria | 1767 |
| 522 | Ga0373955_0013547 | 3300035172 | Bacteria | 3947 |
| 523 | Ga0373955_0078224 | 3300035172 | Bacteria | 1864 |
| 524 | Ga0373924_0007992 | 3300035410 | Bacteria | 3829 |
| 525 | Ga0373935_0086873 | 3300035692 | Bacteria | 2041 |
| 526 | Ga0373933_0002452 | 3300035724 | Bacteria | 10435 |
| 527 | Ga0373937_0028631 | 3300036401 | Bacteria | 5043 |
| 528 | Ga0373937_0045752 | 3300036401 | Bacteria | 4000 |
| 529 | Ga0316582_0003674 | 3300036647 | Bacteria | 7582 |
| 530 | Ga0373925_0114893 | 3300037068 | Bacteria | 2083 |
| 531 | Ga0395899_0002272 | 3300037312 | Bacteria | 15706 |
| 532 | Ga0395899_0023327 | 3300037312 | Bacteria | 4688 |
| 533 | Ga0395899_0024592 | 3300037312 | Bacteria | 4552 |
| 534 | Ga0395899_0042010 | 3300037312 | Bacteria | 3414 |
| 535 | Ga0395899_0097786 | 3300037312 | Bacteria | 2121 |
| 536 | Ga0395899_0108211 | 3300037312 | Bacteria | 2000 |
| 537 | Ga0395900_0001906 | 3300037418 | Bacteria | 23725 |
| 538 | Ga0395900_0004368 | 3300037418 | Bacteria | 14997 |
| 539 | Ga0395900_0040940 | 3300037418 | Bacteria | 4776 |
| 540 | Ga0395900_0058716 | 3300037418 | Bacteria | 3960 |
| 541 | Ga0395900_0167746 | 3300037418 | Bacteria | 2236 |
| 542 | Ga0395905_0000043 | 3300037471 | Bacteria | 247469 |
| 543 | Ga0395905_0000242 | 3300037471 | Bacteria | 82835 |
| 544 | Ga0395905_0008311 | 3300037471 | Bacteria | 10241 |
| 545 | Ga0395905_0014548 | 3300037471 | Bacteria | 7507 |
| 546 | Ga0395905_0016517 | 3300037471 | Bacteria | 7016 |
| 547 | Ga0395905_0056374 | 3300037471 | Bacteria | 3676 |
| 548 | Ga0395905_0087784 | 3300037471 | Bacteria | 2915 |
| 549 | Ga0395905_0242384 | 3300037471 | Bacteria | 1684 |
| 550 | Ga0395901_0000307 | 3300038443 | Bacteria | 60012 |
| 551 | Ga0395901_0002559 | 3300038443 | Bacteria | 18423 |
| 552 | Ga0395901_0005833 | 3300038443 | Bacteria | 12465 |
| 553 | Ga0395901_0060610 | 3300038443 | Bacteria | 3937 |
| 554 | Ga0395901_0077433 | 3300038443 | Bacteria | 3471 |
| 555 | Ga0395901_0169831 | 3300038443 | Bacteria | 2288 |
| 556 | Ga0400490_21110 | 3300038726 | Bacteria | 5837 |
| 557 | Ga0436361_0100960 | 3300039447 | Bacteria | 8932 |
| 558 | Ga0436361_0257895 | 3300039447 | Bacteria | 4702 |
| 559 | Ga0436361_0545153 | 3300039447 | Bacteria | 4298 |
| 560 | Ga0436361_0773293 | 3300039447 | Bacteria | 38992 |
| 561 | Ga0436361_1049300 | 3300039447 | Bacteria | 3677 |
| 562 | Ga0439436_0024218 | 3300041404 | Bacteria | 1793 |
| 563 | Ga0439438_010003 | 3300041405 | Bacteria | 3033 |
| 564 | Ga0450911_004719 | 3300042115 | Bacteria | 2200 |
| 565 | Ga0450888_000035 | 3300042126 | Bacteria | 9574 |
| 566 | Ga0450890_000572 | 3300042127 | Bacteria | 5368 |
| 567 | Ga0450891_000065 | 3300042129 | Bacteria | 8426 |
| 568 | Ga0450889_000145 | 3300042144 | Bacteria | 7163 |
| 569 | Ga0439458_0003049 | 3300042157 | Bacteria | 3994 |
| 570 | Ga0450909_002848 | 3300042185 | Bacteria | 2458 |
| 571 | Ga0450893_0001962 | 3300042532 | Bacteria | 3197 |
| 572 | Ga0451577_0000085 | 3300042876 | Bacteria | 211141 |
| 573 | Ga0451577_0008429 | 3300042876 | Bacteria | 10034 |
| 574 | Ga0451577_0008841 | 3300042876 | Bacteria | 9752 |
| 575 | Ga0451577_0018842 | 3300042876 | Bacteria | 6353 |
| 576 | Ga0451577_0019578 | 3300042876 | Bacteria | 6221 |
| 577 | Ga0466969_0019979 | 3300044656 | Bacteria | 3472 |
| 578 | Ga0466969_0039336 | 3300044656 | Bacteria | 2375 |
| 579 | Ga0466972_0000359 | 3300044658 | Bacteria | 24761 |
| 580 | Ga0466972_0017061 | 3300044658 | Bacteria | 3632 |
| 581 | Ga0466977_0013105 | 3300044666 | Bacteria | 4867 |
| 582 | Ga0453683_0000047 | 3300044673 | Bacteria | 207763 |
| 583 | Ga0453683_0006123 | 3300044673 | Bacteria | 8290 |
| 584 | Ga0466966_0015691 | 3300044684 | Bacteria | 5008 |
| 585 | Ga0466966_0018170 | 3300044684 | Bacteria | 4639 |
| 586 | Ga0466966_0026512 | 3300044684 | Bacteria | 3783 |
| 587 | Ga0466966_0036339 | 3300044684 | Bacteria | 3180 |
| 588 | Ga0466961_0001701 | 3300044693 | Bacteria | 13704 |
| 589 | Ga0466961_0019077 | 3300044693 | Bacteria | 4412 |
| 590 | Ga0466961_0020792 | 3300044693 | Bacteria | 4224 |
| 591 | Ga0466964_0000097 | 3300044706 | Bacteria | 21037 |
| 592 | Ga0466964_0011111 | 3300044706 | Bacteria | 3400 |
| 593 | Ga0453684_0000273 | 3300044712 | Bacteria | 222658 |
| 594 | Ga0453684_0000276 | 3300044712 | Bacteria | 222326 |
| 595 | Ga0453684_0000302 | 3300044712 | Bacteria | 207763 |
| 596 | Ga0453684_0004162 | 3300044712 | Bacteria | 31248 |
| 597 | Ga0453684_0034104 | 3300044712 | Bacteria | 7074 |
| 598 | Ga0453684_0036639 | 3300044712 | Bacteria | 6755 |
| 599 | Ga0453684_0038837 | 3300044712 | Bacteria | 6496 |
| 600 | Ga0466968_0000838 | 3300044735 | Bacteria | 10735 |
| 601 | Ga0466968_0045031 | 3300044735 | Bacteria | 1871 |
| 602 | Ga0466970_0002355 | 3300044765 | Bacteria | 9130 |
| 603 | Ga0466957_0001772 | 3300044842 | Bacteria | 11366 |
| 604 | Ga0466957_0006017 | 3300044842 | Bacteria | 6844 |
| 605 | Ga0466957_0047230 | 3300044842 | Bacteria | 2615 |
| 606 | Ga0466957_0098808 | 3300044842 | Bacteria | 1837 |
| 607 | Ga0466959_0016980 | 3300045049 | Bacteria | 5327 |
| 608 | Ga0466959_0038347 | 3300045049 | Bacteria | 3540 |
| 609 | Ga0451576_0000003 | 3300045051 | Bacteria | 1550573 |
| 610 | Ga0451576_0000006 | 3300045051 | Bacteria | 949698 |
| 611 | Ga0451576_0000096 | 3300045051 | Bacteria | 221078 |
| 612 | Ga0451576_0000116 | 3300045051 | Bacteria | 207763 |
| 613 | Ga0451576_0000147 | 3300045051 | Bacteria | 179223 |
| 614 | Ga0451576_0001472 | 3300045051 | Bacteria | 39908 |
| 615 | Ga0451576_0002503 | 3300045051 | Bacteria | 27266 |
| 616 | Ga0451576_0002526 | 3300045051 | Bacteria | 27094 |
| 617 | Ga0451576_0004790 | 3300045051 | Bacteria | 17343 |
| 618 | Ga0451576_0008254 | 3300045051 | Bacteria | 12246 |
| 619 | Ga0451576_0019294 | 3300045051 | Bacteria | 7444 |
| 620 | Ga0451576_0019765 | 3300045051 | Bacteria | 7350 |
| 621 | Ga0451576_0021263 | 3300045051 | Bacteria | 7054 |
| 622 | Ga0451576_0025801 | 3300045051 | Bacteria | 6330 |
| 623 | Ga0451576_0071239 | 3300045051 | Bacteria | 3617 |
| 624 | Ga0451576_0103230 | 3300045051 | Bacteria | 2966 |
| 625 | Ga0451576_0204093 | 3300045051 | Bacteria | 2064 |
| 626 | Ga0451576_0237968 | 3300045051 | Unclassified | 1901 |
| 627 | Ga0466958_0052313 | 3300045836 | Bacteria | 2475 |
| 628 | Ga0466967_0005183 | 3300045976 | Bacteria | 8975 |
| 629 | Ga0466967_0011484 | 3300045976 | Bacteria | 6712 |
| 630 | Ga0466967_0057073 | 3300045976 | Bacteria | 3445 |
| 631 | Ga0495617_000125 | 3300046452 | Bacteria | 50630 |
| 632 | Ga0495592_0020784 | 3300046454 | Bacteria | 4994 |
| 633 | Ga0495590_0002849 | 3300046457 | Bacteria | 7124 |
| 634 | Ga0495651_0084410 | 3300046462 | Bacteria | 2393 |
| 635 | Ga0495653_0041728 | 3300046463 | Bacteria | 3579 |
| 636 | Ga0495653_0116134 | 3300046463 | Bacteria | 1914 |
| 637 | Ga0495580_0036217 | 3300046472 | Bacteria | 3543 |
| 638 | Ga0495582_0000662 | 3300046473 | Bacteria | 18974 |
| 639 | Ga0495605_0000725 | 3300046474 | Bacteria | 24295 |
| 640 | Ga0495605_0000845 | 3300046474 | Bacteria | 21424 |
| 641 | Ga0495584_0000417 | 3300046491 | Bacteria | 29344 |
| 642 | Ga0495584_0032982 | 3300046491 | Bacteria | 2619 |
| 643 | Ga0495585_0003922 | 3300046492 | Bacteria | 9850 |
| 644 | Ga0495585_0004000 | 3300046492 | Bacteria | 9711 |
| 645 | Ga0495585_0020428 | 3300046492 | Bacteria | 3809 |
| 646 | Ga0495594_0006120 | 3300046499 | Bacteria | 6188 |
| 647 | Ga0495594_0038603 | 3300046499 | Bacteria | 2608 |
| 648 | Ga0495594_0060699 | 3300046499 | Bacteria | 2091 |
| 649 | Ga0495596_0001761 | 3300046500 | Bacteria | 12120 |
| 650 | Ga0495596_0004535 | 3300046500 | Bacteria | 6748 |
| 651 | Ga0495596_0005727 | 3300046500 | Bacteria | 5832 |
| 652 | Ga0495607_0000004 | 3300046501 | Bacteria | 317271 |
| 653 | Ga0495607_0001408 | 3300046501 | Bacteria | 21405 |
| 654 | Ga0495607_0003124 | 3300046501 | Bacteria | 12858 |
| 655 | Ga0495607_0036047 | 3300046501 | Bacteria | 2985 |
| 656 | Ga0495583_0000222 | 3300046506 | Bacteria | 95964 |
| 657 | Ga0495583_0006001 | 3300046506 | Bacteria | 8055 |
| 658 | Ga0495606_0018114 | 3300046507 | Bacteria | 5294 |
| 659 | Ga0495606_0019130 | 3300046507 | Bacteria | 5106 |
| 660 | Ga0495608_0023686 | 3300046511 | Bacteria | 4205 |
| 661 | Ga0495631_0001168 | 3300046518 | Bacteria | 16231 |
| 662 | Ga0495643_0002098 | 3300046522 | Bacteria | 16504 |
| 663 | Ga0495643_0002952 | 3300046522 | Bacteria | 12877 |
| 664 | Ga0495644_0019602 | 3300046523 | Bacteria | 2582 |
| 665 | Ga0495644_0022177 | 3300046523 | Bacteria | 2420 |
| 666 | Ga0495648_0000612 | 3300046524 | Bacteria | 38167 |
| 667 | Ga0495648_0002837 | 3300046524 | Bacteria | 15598 |
| 668 | Ga0495666_0000791 | 3300046526 | Bacteria | 14659 |
| 669 | Ga0495666_0006131 | 3300046526 | Bacteria | 6047 |
| 670 | Ga0495642_0000515 | 3300046528 | Bacteria | 19938 |
| 671 | Ga0495642_0013263 | 3300046528 | Bacteria | 3185 |
| 672 | Ga0495652_0064084 | 3300046529 | Bacteria | 3092 |
| 673 | Ga0495665_0003210 | 3300046531 | Bacteria | 8842 |
| 674 | Ga0495586_0028232 | 3300046535 | Bacteria | 3003 |
| 675 | Ga0495587_0062895 | 3300046536 | Bacteria | 2172 |
| 676 | Ga0495587_0072105 | 3300046536 | Bacteria | 2008 |
| 677 | Ga0495587_0087071 | 3300046536 | Bacteria | 1807 |
| 678 | Ga0495622_0010883 | 3300046557 | Bacteria | 4196 |
| 679 | Ga0495633_0006611 | 3300046558 | Bacteria | 6844 |
| 680 | Ga0495667_0091051 | 3300046559 | Bacteria | 1976 |
| 681 | Ga0495656_0004470 | 3300046615 | Bacteria | 4793 |
| 682 | Ga0495634_0106344 | 3300046642 | Bacteria | 1808 |
| 683 | Ga0495611_0002853 | 3300046648 | Bacteria | 7726 |
| 684 | Ga0495661_0000805 | 3300046665 | Bacteria | 29621 |
| 685 | Ga0495661_0004703 | 3300046665 | Bacteria | 9801 |
| 686 | Ga0495661_0005396 | 3300046665 | Bacteria | 9088 |
| 687 | Ga0495661_0007618 | 3300046665 | Bacteria | 7543 |
| 688 | Ga0495661_0053002 | 3300046665 | Bacteria | 2441 |
| 689 | Ga0495588_0002016 | 3300046674 | Bacteria | 8685 |
| 690 | Ga0495588_0013718 | 3300046674 | Bacteria | 3864 |
| 691 | Ga0495657_0060037 | 3300046675 | Bacteria | 2521 |
| 692 | Ga0495623_0018146 | 3300046679 | Bacteria | 4543 |
| 693 | Ga0495670_0005460 | 3300046691 | Bacteria | 6240 |
| 694 | Ga0495670_0019346 | 3300046691 | Bacteria | 3354 |
| 695 | Ga0495649_0020690 | 3300046694 | Bacteria | 3688 |
| 696 | Ga0495589_0000309 | 3300046794 | Bacteria | 38979 |
| 697 | Ga0495589_0001297 | 3300046794 | Bacteria | 14743 |
| 698 | Ga0495600_0021920 | 3300046809 | Bacteria | 4097 |
| 699 | Ga0495660_0000734 | 3300046810 | Bacteria | 24893 |
| 700 | Ga0495581_0001061 | 3300047315 | Bacteria | 14904 |
| 701 | Ga0495581_0005818 | 3300047315 | Bacteria | 7149 |
| 702 | Ga0495604_0040469 | 3300047317 | Bacteria | 3659 |
| 703 | Ga0495636_0023321 | 3300047318 | Bacteria | 2504 |
| 704 | Ga0495672_0000865 | 3300047320 | Bacteria | 31951 |
| 705 | Ga0495680_0061285 | 3300047322 | Bacteria | 2895 |
| 706 | Ga0495687_000656 | 3300047443 | Bacteria | 39649 |
| 707 | Ga0495687_000829 | 3300047443 | Bacteria | 33057 |
| 708 | Ga0495687_000866 | 3300047443 | Bacteria | 32045 |
| 709 | Ga0495687_007801 | 3300047443 | Bacteria | 6230 |
| 710 | Ga0495677_0003090 | 3300047445 | Bacteria | 6481 |
| 711 | Ga0495677_0004391 | 3300047445 | Bacteria | 5421 |
| 712 | Ga0495677_0007440 | 3300047445 | Bacteria | 4093 |
| 713 | Ga0495681_0000511 | 3300047470 | Bacteria | 29544 |
| 714 | Ga0495681_0003757 | 3300047470 | Bacteria | 10528 |
| 715 | Ga0495686_0000285 | 3300047472 | Bacteria | 88880 |
| 716 | Ga0495686_0002310 | 3300047472 | Bacteria | 18237 |
| 717 | Ga0495602_0001988 | 3300048088 | Bacteria | 20511 |
| 718 | Ga0495614_0008722 | 3300048089 | Bacteria | 4505 |
| 719 | Ga0495626_0000292 | 3300048091 | Bacteria | 53923 |
| 720 | Ga0495626_0000613 | 3300048091 | Bacteria | 34843 |
| 721 | Ga0496100_0074995 | 3300048903 | Bacteria | 2267 |
| 722 | Ga0496102_0000544 | 3300048905 | Bacteria | 40620 |
| 723 | Ga0496103_0006831 | 3300048906 | Bacteria | 6810 |
| 724 | Ga0496104_0019038 | 3300048907 | Bacteria | 6272 |
| 725 | Ga0496104_0085381 | 3300048907 | Bacteria | 3013 |
| 726 | Ga0496105_0152772 | 3300048908 | Bacteria | 1897 |
| 727 | Ga0496109_0006786 | 3300048912 | Bacteria | 9645 |
| 728 | Ga0496109_0057917 | 3300048912 | Bacteria | 3539 |
| 729 | Ga0496109_0113160 | 3300048912 | Bacteria | 2524 |
| 730 | Ga0496110_0047848 | 3300048913 | Bacteria | 3747 |
| 731 | Ga0496110_0070412 | 3300048913 | Bacteria | 3099 |
| 732 | Ga0496111_0004898 | 3300048914 | Bacteria | 8505 |
| 733 | Ga0496112_0069132 | 3300048915 | Bacteria | 3489 |
| 734 | Ga0496113_0009852 | 3300048916 | Bacteria | 6291 |
| 735 | Ga0496116_0007586 | 3300048919 | Bacteria | 9588 |
| 736 | Ga0496116_0030764 | 3300048919 | Bacteria | 3852 |
| 737 | Ga0496121_0044676 | 3300048924 | Bacteria | 3817 |
| 738 | Ga0496121_0099040 | 3300048924 | Bacteria | 2254 |
| 739 | Ga0496121_0123323 | 3300048924 | Bacteria | 1953 |
| 740 | Ga0496122_0001645 | 3300048925 | Bacteria | 34677 |
| 741 | Ga0496122_0006420 | 3300048925 | Bacteria | 13505 |
| 742 | Ga0496123_0002540 | 3300048926 | Bacteria | 22349 |
| 743 | Ga0496123_0005186 | 3300048926 | Bacteria | 13249 |
| 744 | Ga0496125_0001339 | 3300048928 | Bacteria | 36299 |
| 745 | Ga0496125_0083060 | 3300048928 | Bacteria | 2438 |
| 746 | Ga0495678_007426 | 3300049459 | Bacteria | 5680 |
| 747 | Ga0501290_000202 | 3300049513 | Bacteria | 9807 |
| 748 | Ga0501291_000129 | 3300049514 | Bacteria | 9241 |
| 749 | Ga0501292_000544 | 3300049515 | Bacteria | 4667 |
| 750 | Ga0501294_000270 | 3300049517 | Bacteria | 6383 |
| 751 | Ga0501296_000163 | 3300049519 | Bacteria | 7078 |
| 752 | Ga0501297_000961 | 3300049520 | Bacteria | 2607 |
| 753 | Ga0501298_000125 | 3300049521 | Bacteria | 9223 |
| 754 | Ga0501299_000033 | 3300049522 | Bacteria | 16414 |
| 755 | Ga0501300_000111 | 3300049523 | Bacteria | 11859 |
| 756 | Ga0501300_005855 | 3300049523 | Bacteria | 1809 |
| 757 | Ga0501301_000402 | 3300049524 | Bacteria | 2576 |
| 758 | Ga0501303_000044 | 3300049526 | Bacteria | 9779 |
| 759 | Ga0501031_0009138 | 3300049568 | Bacteria | 6445 |
| 760 | Ga0501031_0045375 | 3300049568 | Bacteria | 2868 |
| 761 | Ga0501032_0100497 | 3300049569 | Unclassified | 1916 |
| 762 | Ga0501034_0008163 | 3300049571 | Bacteria | 11100 |
| 763 | Ga0501034_0050002 | 3300049571 | Bacteria | 4217 |
| 764 | Ga0501034_0105734 | 3300049571 | Bacteria | 2807 |
| 765 | Ga0501036_0019186 | 3300049572 | Bacteria | 5737 |
| 766 | Ga0501037_0020623 | 3300049573 | Bacteria | 4866 |
| 767 | Ga0501037_0061841 | 3300049573 | Unclassified | 2731 |
| 768 | Ga0501038_0000129 | 3300049574 | Bacteria | 64365 |
| 769 | Ga0501038_0084344 | 3300049574 | Unclassified | 2673 |
| 770 | Ga0501039_0005040 | 3300049575 | Bacteria | 10015 |
| 771 | Ga0501039_0036031 | 3300049575 | Bacteria | 3817 |
| 772 | Ga0501039_0052723 | 3300049575 | Bacteria | 3146 |
| 773 | Ga0501039_0056686 | 3300049575 | Bacteria | 3035 |
| 774 | Ga0501039_0075842 | 3300049575 | Bacteria | 2614 |
| 775 | Ga0501039_0141383 | 3300049575 | Unclassified | 1890 |
| 776 | Ga0501041_0018228 | 3300049577 | Unclassified | 4181 |
| 777 | Ga0501041_0032501 | 3300049577 | Bacteria | 3153 |
| 778 | Ga0501042_0045024 | 3300049578 | Bacteria | 3144 |
| 779 | Ga0501042_0053358 | 3300049578 | Unclassified | 2884 |
| 780 | Ga0501043_0069412 | 3300049579 | Bacteria | 2768 |
| 781 | Ga0501043_0224578 | 3300049579 | Bacteria | 1452 |
| 782 | Ga0501046_0001975 | 3300049580 | Bacteria | 19485 |
| 783 | Ga0501046_0020030 | 3300049580 | Bacteria | 5539 |
| 784 | Ga0501046_0065302 | 3300049580 | Bacteria | 2839 |
| 785 | Ga0501047_0109279 | 3300049581 | Bacteria | 2648 |
| 786 | Ga0501047_0160923 | 3300049581 | Bacteria | 2117 |
| 787 | Ga0501048_0045866 | 3300049582 | Unclassified | 3120 |
| 788 | Ga0501048_0068156 | 3300049582 | Bacteria | 2514 |
| 789 | Ga0501048_0117174 | 3300049582 | Bacteria | 1881 |
| 790 | Ga0501068_0029264 | 3300049584 | Bacteria | 3261 |
| 791 | Ga0501068_0056185 | 3300049584 | Bacteria | 2386 |
| 792 | Ga0501069_0055790 | 3300049585 | Unclassified | 2201 |
| 793 | Ga0501071_0045472 | 3300049587 | Bacteria | 3152 |
| 794 | Ga0501072_0083304 | 3300049588 | Bacteria | 2535 |
| 795 | Ga0501074_0033222 | 3300049590 | Bacteria | 3738 |
| 796 | Ga0501075_0037193 | 3300049591 | Bacteria | 3635 |
| 797 | Ga0501076_0002131 | 3300049592 | Bacteria | 13585 |
| 798 | Ga0501076_0082045 | 3300049592 | Bacteria | 2588 |
| 799 | Ga0501077_0019179 | 3300049593 | Bacteria | 4325 |
| 800 | Ga0501199_000202 | 3300049650 | Bacteria | 5090 |
| 801 | Ga0501201_000008 | 3300049651 | Bacteria | 11752 |
| 802 | Ga0501206_001086 | 3300049653 | Bacteria | 3382 |
| 803 | Ga0501208_000079 | 3300049655 | Bacteria | 5609 |
| 804 | Ga0501209_001129 | 3300049656 | Bacteria | 3629 |
| 805 | Ga0501209_002581 | 3300049656 | Bacteria | 2823 |
| 806 | Ga0501211_003374 | 3300049658 | Bacteria | 1649 |
| 807 | Ga0501216_000568 | 3300049660 | Bacteria | 4450 |
| 808 | Ga0501217_000716 | 3300049661 | Bacteria | 5715 |
| 809 | Ga0501227_005905 | 3300049665 | Bacteria | 2626 |
| 810 | Ga0501233_001847 | 3300049668 | Bacteria | 3673 |
| 811 | Ga0501239_000151 | 3300049672 | Bacteria | 4835 |
| 812 | Ga0501243_001478 | 3300049675 | Bacteria | 3364 |
| 813 | Ga0501246_000473 | 3300049676 | Bacteria | 2919 |
| 814 | Ga0501247_003826 | 3300049677 | Bacteria | 1628 |
| 815 | Ga0501249_000311 | 3300049679 | Bacteria | 13576 |
| 816 | Ga0501252_001635 | 3300049682 | Bacteria | 2110 |
| 817 | Ga0501253_000151 | 3300049683 | Bacteria | 5070 |
| 818 | Ga0501257_000887 | 3300049686 | Bacteria | 6039 |
| 819 | Ga0501260_000071 | 3300049689 | Bacteria | 6904 |
| 820 | Ga0501261_000153 | 3300049690 | Bacteria | 9883 |
| 821 | Ga0501219_001509 | 3300049703 | Bacteria | 2180 |
| 822 | Ga0501221_000243 | 3300049704 | Bacteria | 7907 |
| 823 | Ga0501225_0001799 | 3300049705 | Bacteria | 6709 |
| 824 | Ga0501229_000181 | 3300049706 | Bacteria | 6695 |
| 825 | Ga0501229_000367 | 3300049706 | Bacteria | 5103 |
| 826 | Ga0501245_001642 | 3300049708 | Bacteria | 2916 |
| 827 | Ga0501079_0032234 | 3300049741 | Bacteria | 4028 |
| 828 | Ga0501080_0060090 | 3300049742 | Bacteria | 3537 |
| 829 | Ga0501081_0000696 | 3300049743 | Bacteria | 19414 |
| 830 | Ga0501232_001562 | 3300049757 | Bacteria | 1849 |
| 831 | Ga0501241_003767 | 3300049758 | Bacteria | 2856 |
| 832 | Ga0501266_000300 | 3300049763 | Bacteria | 6560 |
| 833 | Ga0501270_000102 | 3300049767 | Bacteria | 6639 |
| 834 | Ga0501271_000064 | 3300049768 | Bacteria | 8080 |
| 835 | Ga0501272_000006 | 3300049769 | Bacteria | 14613 |
| 836 | Ga0501278_000064 | 3300049774 | Bacteria | 7151 |
| 837 | Ga0501279_000060 | 3300049775 | Bacteria | 19728 |
| 838 | Ga0501280_003287 | 3300049776 | Bacteria | 2510 |
| 839 | Ga0501281_00372 | 3300049777 | Bacteria | 4506 |
| 840 | Ga0501282_002430 | 3300049778 | Bacteria | 2026 |
| 841 | Ga0501283_000255 | 3300049779 | Bacteria | 7004 |
| 842 | Ga0501035_0005765 | 3300049822 | Bacteria | 11675 |
| 843 | Ga0501035_0008524 | 3300049822 | Bacteria | 9543 |
| 844 | Ga0501035_0032289 | 3300049822 | Bacteria | 4764 |
| 845 | Ga0501035_0075320 | 3300049822 | Unclassified | 2985 |
| 846 | Ga0501035_0160598 | 3300049822 | Unclassified | 1945 |
| 847 | Ga0501044_0111665 | 3300049823 | Bacteria | 2741 |
| 848 | Ga0501045_0138021 | 3300049824 | Bacteria | 1813 |
| 849 | Ga0501226_000463 | 3300049853 | Bacteria | 5709 |
| 850 | nmdc:mga00v17_26544_c1 | 3300050491 | Bacteria | 3376 |
| 851 | nmdc:mga0k408_12676_c1 | 3300050493 | Bacteria | 4611 |
| 852 | nmdc:mga0k408_33506_c1 | 3300050493 | Bacteria | 2938 |
| 853 | nmdc:mga0k408_3408_c1 | 3300050493 | Bacteria | 8421 |
| 854 | nmdc:mga05p37_11314_c1 | 3300050507 | Bacteria | 10614 |
| 855 | nmdc:mga05p37_21279_c1 | 3300050507 | Bacteria | 7852 |
| 856 | nmdc:mga05p37_28711_c1 | 3300050507 | Bacteria | 6787 |
| 857 | nmdc:mga05p37_55990_c1 | 3300050507 | Bacteria | 4854 |
| 858 | nmdc:mga09592_1679_c1 | 3300050508 | Bacteria | 17838 |
| 859 | nmdc:mga09592_84091_c1 | 3300050508 | Bacteria | 2713 |
| 860 | nmdc:mga0qj67_4478_c1 | 3300050509 | Bacteria | 10121 |
| 861 | nmdc:mga0qj67_4787_c1 | 3300050509 | Bacteria | 9842 |
| 862 | nmdc:mga0qj67_56868_c1 | 3300050509 | Bacteria | 3102 |
| 863 | nmdc:mga06r32_111951_c1 | 3300050510 | Bacteria | 2686 |
| 864 | nmdc:mga06r32_82324_c1 | 3300050510 | Bacteria | 3135 |
| 865 | nmdc:mga08y16_2953_c1 | 3300050511 | Bacteria | 17518 |
| 866 | nmdc:mga08y16_5521_c1 | 3300050511 | Bacteria | 13236 |
| 867 | nmdc:mga0n895_42530_c1 | 3300050512 | Bacteria | 4421 |
| 868 | nmdc:mga0rr50_14167_c1 | 3300050513 | Bacteria | 5221 |
| 869 | nmdc:mga0rr50_215891_c1 | 3300050513 | Bacteria | 1582 |
| 870 | nmdc:mga08x19_8249_c1 | 3300050514 | Bacteria | 6193 |
| 871 | nmdc:mga0a205_10309_c1 | 3300050515 | Bacteria | 8589 |
| 872 | nmdc:mga0a205_119880_c1 | 3300050515 | Bacteria | 2530 |
| 873 | nmdc:mga0sz30_14682_c1 | 3300050516 | Bacteria | 3087 |
| 874 | Ga0495619_0047189 | 3300053085 | Bacteria | 2836 |
| 875 | Ga0495619_0108036 | 3300053085 | Unclassified | 1898 |
| 876 | Ga0500646_0000154 | 3300053090 | Bacteria | 20271 |
| 877 | Ga0500641_0054808 | 3300053096 | Bacteria | 1649 |
| 878 | Ga0500636_0000250 | 3300053177 | Bacteria | 29581 |
| 879 | Ga0501084_0011541 | 3300054114 | Bacteria | 7315 |
| 880 | Ga0590077_008026 | 3300059426 | Bacteria | 2162 |
| 881 | Ga0501082_0000754 | 3300060353 | Bacteria | 28420 |
| 882 | Ga0466962_0002290 | 3300061719 | Bacteria | 9078 |
| 883 | Ga0466962_0005722 | 3300061719 | Bacteria | 5973 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300014326 | Ga0157380_10090109 | Ga0157380_100901091 | 393 |
| 2 | 3300035111 | Ga0373923_0094106 | Ga0373923_0094106_17_1222 | 394 |
| 3 | 3300049579 | Ga0501043_0224578 | Ga0501043_0224578_16_1263 | 400 |
| 4 | iso_pu_bacteria | 2884811622 | 2884816143 | 402 |
| 5 | 3300042185 | Ga0450909_002848 | Ga0450909_002848_1167_2420 | 408 |
| 6 | 3300049822 | Ga0501035_0160598 | Ga0501035_0160598_680_1933 | 411 |
| 7 | 3300038443 | Ga0395901_0169831 | Ga0395901_0169831_996_2276 | 413 |
| 8 | 3300045051 | Ga0451576_0204093 | Ga0451576_0204093_765_2051 | 416 |
| 9 | 3300049705 | Ga0501225_0001799 | Ga0501225_0001799_5408_6694 | 422 |
| 10 | 3300037471 | Ga0395905_0008311 | Ga0395905_0008311_8184_9638 | 424 |
| 11 | 3300035172 | Ga0373955_0078224 | Ga0373955_0078224_34_1338 | 427 |
| 12 | 3300046665 | Ga0495661_0053002 | Ga0495661_0053002_1100_2428 | 429 |
| 13 | 3300048928 | Ga0496125_0083060 | Ga0496125_0083060_39_1466 | 434 |
| 14 | 3300005457 | Ga0070662_100018115 | Ga0070662_1000181153 | 437 |
| 15 | 3300025933 | Ga0207706_10026965 | Ga0207706_100269653 | 437 |
| 16 | 3300026142 | Ga0207698_10110019 | Ga0207698_101100191 | 437 |
| 17 | 3300049523 | Ga0501300_005855 | Ga0501300_005855_116_1579 | 439 |
| 18 | 3300049665 | Ga0501227_005905 | Ga0501227_005905_814_2277 | 439 |
| 19 | 3300049704 | Ga0501221_000243 | Ga0501221_000243_1519_2982 | 439 |
| 20 | 3300049706 | Ga0501229_000367 | Ga0501229_000367_179_1642 | 439 |
| 21 | 3300049757 | Ga0501232_001562 | Ga0501232_001562_256_1719 | 439 |
| 22 | 3300031731 | Ga0307405_10018136 | Ga0307405_100181361 | 444 |
| 23 | 3300031824 | Ga0307413_10002623 | Ga0307413_100026236 | 444 |
| 24 | 3300031903 | Ga0307407_10030521 | Ga0307407_100305211 | 444 |
| 25 | 3300031911 | Ga0307412_10030943 | Ga0307412_100309431 | 444 |
| 26 | 3300032002 | Ga0307416_100006355 | Ga0307416_1000063553 | 444 |
| 27 | 3300032005 | Ga0307411_10090392 | Ga0307411_100903921 | 444 |
| 28 | 3300032126 | Ga0307415_100000756 | Ga0307415_1000007561 | 444 |
| 29 | 3300044712 | Ga0453684_0004162 | Ga0453684_0004162_17481_18848 | 444 |
| 30 | 3300045051 | Ga0451576_0000003 | Ga0451576_0000003_250914_252314 | 447 |
| 31 | 3300028794 | Ga0307515_10009616 | Ga0307515_1000961614 | 448 |
| 32 | 3300042126 | Ga0450888_000035 | Ga0450888_000035_1738_3201 | 448 |
| 33 | 3300042127 | Ga0450890_000572 | Ga0450890_000572_1365_2828 | 448 |
| 34 | 3300042129 | Ga0450891_000065 | Ga0450891_000065_1634_3097 | 448 |
| 35 | 3300042144 | Ga0450889_000145 | Ga0450889_000145_3938_5401 | 448 |
| 36 | 3300042532 | Ga0450893_0001962 | Ga0450893_0001962_1590_3053 | 448 |
| 37 | 3300046524 | Ga0495648_0002837 | Ga0495648_0002837_6929_8386 | 448 |
| 38 | 3300047472 | Ga0495686_0002310 | Ga0495686_0002310_1986_3416 | 448 |
| 39 | 3300049575 | Ga0501039_0056686 | Ga0501039_0056686_1501_2925 | 448 |
| 40 | 3300049579 | Ga0501043_0069412 | Ga0501043_0069412_684_2108 | 448 |
| 41 | 3300049584 | Ga0501068_0029264 | Ga0501068_0029264_121_1545 | 448 |
| 42 | 3300049592 | Ga0501076_0002131 | Ga0501076_0002131_10915_12339 | 448 |
| 43 | 3300049676 | Ga0501246_000473 | Ga0501246_000473_17_1366 | 448 |
| 44 | 3300049743 | Ga0501081_0000696 | Ga0501081_0000696_12563_13987 | 448 |
| 45 | 3300049824 | Ga0501045_0138021 | Ga0501045_0138021_291_1715 | 448 |
| 46 | 3300054114 | Ga0501084_0011541 | Ga0501084_0011541_2422_3846 | 448 |
| 47 | 3300060353 | Ga0501082_0000754 | Ga0501082_0000754_12458_13882 | 448 |
| 48 | 3300044684 | Ga0466966_0015691 | Ga0466966_0015691_1886_3316 | 449 |
| 49 | 3300044842 | Ga0466957_0098808 | Ga0466957_0098808_69_1532 | 449 |
| 50 | 3300047443 | Ga0495687_000656 | Ga0495687_000656_9949_11379 | 449 |
| 51 | 3300042115 | Ga0450911_004719 | Ga0450911_004719_328_1785 | 450 |
| 52 | 3300044706 | Ga0466964_0011111 | Ga0466964_0011111_395_1852 | 450 |
| 53 | 3300044735 | Ga0466968_0000838 | Ga0466968_0000838_3925_5382 | 450 |
| 54 | 3300047445 | Ga0495677_0003090 | Ga0495677_0003090_1219_2670 | 450 |
| 55 | 3300048914 | Ga0496111_0004898 | Ga0496111_0004898_6967_8424 | 450 |
| 56 | 3300049775 | Ga0501279_000060 | Ga0501279_000060_17842_19209 | 450 |
| 57 | 3300009147 | Ga0114129_10395888 | Ga0114129_103958881 | 451 |
| 58 | 3300009174 | Ga0105241_10021227 | Ga0105241_100212271 | 451 |
| 59 | 3300026116 | Ga0207674_10148254 | Ga0207674_101482541 | 451 |
| 60 | 3300031239 | Ga0265328_10006977 | Ga0265328_100069774 | 451 |
| 61 | 3300046492 | Ga0495585_0004000 | Ga0495585_0004000_3606_5135 | 451 |
| 62 | 3300046528 | Ga0495642_0000515 | Ga0495642_0000515_7115_8572 | 451 |
| 63 | 3300046648 | Ga0495611_0002853 | Ga0495611_0002853_2661_4190 | 451 |
| 64 | 3300028666 | Ga0265336_10000511 | Ga0265336_1000051113 | 452 |
| 65 | 3300029957 | Ga0265324_10000011 | Ga0265324_10000011203 | 452 |
| 66 | 3300031241 | Ga0265325_10000125 | Ga0265325_1000012535 | 452 |
| 67 | 3300031711 | Ga0265314_10007756 | Ga0265314_100077562 | 452 |
| 68 | 3300046474 | Ga0495605_0000725 | Ga0495605_0000725_7315_8772 | 453 |
| 69 | 3300046501 | Ga0495607_0003124 | Ga0495607_0003124_5145_6602 | 453 |
| 70 | 3300046522 | Ga0495643_0002952 | Ga0495643_0002952_4103_5560 | 453 |
| 71 | 3300046694 | Ga0495649_0020690 | Ga0495649_0020690_1450_2907 | 453 |
| 72 | 3300046794 | Ga0495589_0000309 | Ga0495589_0000309_35254_36711 | 453 |
| 73 | 3300046810 | Ga0495660_0000734 | Ga0495660_0000734_9335_10792 | 453 |
| 74 | 3300047320 | Ga0495672_0000865 | Ga0495672_0000865_23576_25033 | 453 |
| 75 | 3300047443 | Ga0495687_000866 | Ga0495687_000866_23582_25039 | 453 |
| 76 | 3300047445 | Ga0495677_0004391 | Ga0495677_0004391_3864_5321 | 453 |
| 77 | 3300048091 | Ga0495626_0000292 | Ga0495626_0000292_34296_35753 | 453 |
| 78 | 3300005339 | Ga0070660_100100823 | Ga0070660_1001008232 | 454 |
| 79 | 3300005366 | Ga0070659_100053140 | Ga0070659_1000531402 | 454 |
| 80 | 3300005457 | Ga0070662_100091708 | Ga0070662_1000917081 | 454 |
| 81 | 3300009036 | Ga0105244_10063047 | Ga0105244_100630472 | 454 |
| 82 | 3300044842 | Ga0466957_0006017 | Ga0466957_0006017_2878_4329 | 454 |
| 83 | 3300046491 | Ga0495584_0000417 | Ga0495584_0000417_7199_8656 | 454 |
| 84 | 3300047443 | Ga0495687_000829 | Ga0495687_000829_7741_9198 | 454 |
| 85 | iso_pu_bacteria | 2910245624 | 2910250707 | 454 |
| 86 | 3300025922 | Ga0207646_10081509 | Ga0207646_100815092 | 455 |
| 87 | 3300037418 | Ga0395900_0001906 | Ga0395900_0001906_11710_13167 | 455 |
| 88 | 3300038443 | Ga0395901_0000307 | Ga0395901_0000307_7403_8860 | 455 |
| 89 | 3300046501 | Ga0495607_0036047 | Ga0495607_0036047_873_2330 | 455 |
| 90 | 3300046665 | Ga0495661_0000805 | Ga0495661_0000805_24698_26155 | 455 |
| 91 | 3300046665 | Ga0495661_0007618 | Ga0495661_0007618_2586_4043 | 455 |
| 92 | 3300049822 | Ga0501035_0005765 | Ga0501035_0005765_9002_10459 | 455 |
| 93 | 3300050513 | nmdc:mga0rr50_215891_c1 | nmdc:mga0rr50_215891_c1_191_1561 | 455 |
| 94 | 3300031239 | Ga0265328_10005254 | Ga0265328_100052543 | 456 |
| 95 | 3300031251 | Ga0265327_10000205 | Ga0265327_1000020529 | 456 |
| 96 | 3300044684 | Ga0466966_0026512 | Ga0466966_0026512_1587_3041 | 456 |
| 97 | 3300044693 | Ga0466961_0020792 | Ga0466961_0020792_1933_3387 | 456 |
| 98 | 3300046674 | Ga0495588_0002016 | Ga0495588_0002016_5088_6551 | 456 |
| 99 | 3300061719 | Ga0466962_0002290 | Ga0466962_0002290_1418_2872 | 456 |
| 100 | 3300006880 | Ga0075429_100028503 | Ga0075429_1000285034 | 457 |
| 101 | 3300046506 | Ga0495583_0006001 | Ga0495583_0006001_5478_6932 | 457 |
| 102 | 3300049574 | Ga0501038_0000129 | Ga0501038_0000129_38901_40466 | 457 |
| 103 | 3300050508 | nmdc:mga09592_1679_c1 | nmdc:mga09592_1679_c1_1784_3247 | 457 |
| 104 | 3300032002 | Ga0307416_100126947 | Ga0307416_1001269472 | 458 |
| 105 | 3300006195 | Ga0075366_10036985 | Ga0075366_100369852 | 459 |
| 106 | 3300025945 | Ga0207679_10037901 | Ga0207679_100379012 | 459 |
| 107 | 3300026067 | Ga0207678_10059322 | Ga0207678_100593222 | 459 |
| 108 | 3300037471 | Ga0395905_0000242 | Ga0395905_0000242_33717_35180 | 459 |
| 109 | 3300050493 | nmdc:mga0k408_33506_c1 | nmdc:mga0k408_33506_c1_436_1899 | 459 |
| 110 | 3300050514 | nmdc:mga08x19_8249_c1 | nmdc:mga08x19_8249_c1_2195_3619 | 459 |
| 111 | 3300005985 | Ga0081539_10042221 | Ga0081539_100422212 | 460 |
| 112 | 3300009147 | Ga0114129_10041544 | Ga0114129_100415444 | 460 |
| 113 | 3300009148 | Ga0105243_10029824 | Ga0105243_100298243 | 460 |
| 114 | 3300025935 | Ga0207709_10028889 | Ga0207709_100288892 | 460 |
| 115 | 3300031251 | Ga0265327_10003549 | Ga0265327_100035496 | 460 |
| 116 | 3300031344 | Ga0265316_10059298 | Ga0265316_100592983 | 460 |
| 117 | 3300031548 | Ga0307408_100023759 | Ga0307408_1000237593 | 460 |
| 118 | 3300042157 | Ga0439458_0003049 | Ga0439458_0003049_1302_2759 | 460 |
| 119 | 3300044684 | Ga0466966_0018170 | Ga0466966_0018170_1373_2830 | 460 |
| 120 | 3300044842 | Ga0466957_0001772 | Ga0466957_0001772_9483_10940 | 460 |
| 121 | 3300045976 | Ga0466967_0011484 | Ga0466967_0011484_1817_3274 | 460 |
| 122 | 3300048908 | Ga0496105_0152772 | Ga0496105_0152772_66_1523 | 460 |
| 123 | 3300050507 | nmdc:mga05p37_55990_c1 | nmdc:mga05p37_55990_c1_1209_2675 | 460 |
| 124 | 3300037418 | Ga0395900_0004368 | Ga0395900_0004368_6180_7637 | 461 |
| 125 | 3300038443 | Ga0395901_0002559 | Ga0395901_0002559_6983_8440 | 461 |
| 126 | 3300048912 | Ga0496109_0057917 | Ga0496109_0057917_1272_2729 | 461 |
| 127 | 3300049587 | Ga0501071_0045472 | Ga0501071_0045472_908_2326 | 461 |
| 128 | 3300005563 | Ga0068855_100296172 | Ga0068855_1002961721 | 463 |
| 129 | 3300006846 | Ga0075430_100002760 | Ga0075430_1000027602 | 463 |
| 130 | 3300006847 | Ga0075431_100021196 | Ga0075431_1000211965 | 463 |
| 131 | 3300027876 | Ga0209974_10000506 | Ga0209974_100005066 | 463 |
| 132 | 3300037471 | Ga0395905_0016517 | Ga0395905_0016517_3002_4456 | 463 |
| 133 | 3300037471 | Ga0395905_0242384 | Ga0395905_0242384_241_1671 | 463 |
| 134 | 3300050509 | nmdc:mga0qj67_4787_c1 | nmdc:mga0qj67_4787_c1_8301_9707 | 463 |
| 135 | 3300003794 | Ga0055531_10000007 | Ga0055531_1000000778 | 464 |
| 136 | 3300025298 | Ga0209050_1010447 | Ga0209050_10104472 | 464 |
| 137 | 3300025304 | Ga0209257_1000021 | Ga0209257_1000021150 | 464 |
| 138 | 3300031911 | Ga0307412_10057247 | Ga0307412_100572471 | 464 |
| 139 | 3300041405 | Ga0439438_010003 | Ga0439438_010003_17_1429 | 464 |
| 140 | 3300049513 | Ga0501290_000202 | Ga0501290_000202_3498_4910 | 464 |
| 141 | 3300049514 | Ga0501291_000129 | Ga0501291_000129_3786_5198 | 464 |
| 142 | 3300049515 | Ga0501292_000544 | Ga0501292_000544_3193_4605 | 464 |
| 143 | 3300049517 | Ga0501294_000270 | Ga0501294_000270_4642_6054 | 464 |
| 144 | 3300049519 | Ga0501296_000163 | Ga0501296_000163_5592_7004 | 464 |
| 145 | 3300049520 | Ga0501297_000961 | Ga0501297_000961_199_1611 | 464 |
| 146 | 3300049521 | Ga0501298_000125 | Ga0501298_000125_2650_4062 | 464 |
| 147 | 3300049522 | Ga0501299_000033 | Ga0501299_000033_5826_7238 | 464 |
| 148 | 3300049523 | Ga0501300_000111 | Ga0501300_000111_5391_6803 | 464 |
| 149 | 3300049524 | Ga0501301_000402 | Ga0501301_000402_535_1947 | 464 |
| 150 | 3300049526 | Ga0501303_000044 | Ga0501303_000044_240_1652 | 464 |
| 151 | 3300049650 | Ga0501199_000202 | Ga0501199_000202_273_1685 | 464 |
| 152 | 3300049651 | Ga0501201_000008 | Ga0501201_000008_4924_6336 | 464 |
| 153 | 3300049653 | Ga0501206_001086 | Ga0501206_001086_190_1602 | 464 |
| 154 | 3300049655 | Ga0501208_000079 | Ga0501208_000079_4167_5579 | 464 |
| 155 | 3300049656 | Ga0501209_002581 | Ga0501209_002581_709_2121 | 464 |
| 156 | 3300049658 | Ga0501211_003374 | Ga0501211_003374_156_1568 | 464 |
| 157 | 3300049660 | Ga0501216_000568 | Ga0501216_000568_688_2100 | 464 |
| 158 | 3300049661 | Ga0501217_000716 | Ga0501217_000716_4176_5588 | 464 |
| 159 | 3300049668 | Ga0501233_001847 | Ga0501233_001847_63_1475 | 464 |
| 160 | 3300049672 | Ga0501239_000151 | Ga0501239_000151_1009_2421 | 464 |
| 161 | 3300049675 | Ga0501243_001478 | Ga0501243_001478_1844_3256 | 464 |
| 162 | 3300049677 | Ga0501247_003826 | Ga0501247_003826_27_1439 | 464 |
| 163 | 3300049679 | Ga0501249_000311 | Ga0501249_000311_3787_5199 | 464 |
| 164 | 3300049682 | Ga0501252_001635 | Ga0501252_001635_104_1516 | 464 |
| 165 | 3300049683 | Ga0501253_000151 | Ga0501253_000151_600_2012 | 464 |
| 166 | 3300049686 | Ga0501257_000887 | Ga0501257_000887_3886_5298 | 464 |
| 167 | 3300049689 | Ga0501260_000071 | Ga0501260_000071_17_1429 | 464 |
| 168 | 3300049690 | Ga0501261_000153 | Ga0501261_000153_6962_8374 | 464 |
| 169 | 3300049703 | Ga0501219_001509 | Ga0501219_001509_367_1779 | 464 |
| 170 | 3300049706 | Ga0501229_000181 | Ga0501229_000181_3445_4857 | 464 |
| 171 | 3300049708 | Ga0501245_001642 | Ga0501245_001642_877_2289 | 464 |
| 172 | 3300049758 | Ga0501241_003767 | Ga0501241_003767_817_2229 | 464 |
| 173 | 3300049763 | Ga0501266_000300 | Ga0501266_000300_742_2154 | 464 |
| 174 | 3300049767 | Ga0501270_000102 | Ga0501270_000102_2580_3992 | 464 |
| 175 | 3300049768 | Ga0501271_000064 | Ga0501271_000064_5900_7312 | 464 |
| 176 | 3300049769 | Ga0501272_000006 | Ga0501272_000006_3605_5017 | 464 |
| 177 | 3300049774 | Ga0501278_000064 | Ga0501278_000064_4047_5459 | 464 |
| 178 | 3300049776 | Ga0501280_003287 | Ga0501280_003287_53_1465 | 464 |
| 179 | 3300049777 | Ga0501281_00372 | Ga0501281_00372_80_1492 | 464 |
| 180 | 3300049778 | Ga0501282_002430 | Ga0501282_002430_532_1944 | 464 |
| 181 | 3300049779 | Ga0501283_000255 | Ga0501283_000255_3512_4924 | 464 |
| 182 | 3300049853 | Ga0501226_000463 | Ga0501226_000463_891_2303 | 464 |
| 183 | iso_pu_bacteria | 2857576091 | 2857578848 | 465 |
| 184 | 3300003371 | JGI26145J50221_1000448 | JGI26145J50221_10004482 | 466 |
| 185 | 3300005289 | Ga0065704_10077577 | Ga0065704_100775772 | 466 |
| 186 | 3300005295 | Ga0065707_10082548 | Ga0065707_100825483 | 466 |
| 187 | 3300005328 | Ga0070676_10008985 | Ga0070676_100089853 | 466 |
| 188 | 3300005329 | Ga0070683_100015466 | Ga0070683_1000154662 | 466 |
| 189 | 3300005331 | Ga0070670_100024257 | Ga0070670_1000242573 | 466 |
| 190 | 3300005333 | Ga0070677_10001872 | Ga0070677_100018726 | 466 |
| 191 | 3300005335 | Ga0070666_10015909 | Ga0070666_100159092 | 466 |
| 192 | 3300005338 | Ga0068868_100086366 | Ga0068868_1000863662 | 466 |
| 193 | 3300005339 | Ga0070660_100003556 | Ga0070660_1000035566 | 466 |
| 194 | 3300005340 | Ga0070689_100040742 | Ga0070689_1000407422 | 466 |
| 195 | 3300005341 | Ga0070691_10000598 | Ga0070691_1000059812 | 466 |
| 196 | 3300005347 | Ga0070668_100005970 | Ga0070668_1000059705 | 466 |
| 197 | 3300005353 | Ga0070669_100000779 | Ga0070669_10000077922 | 466 |
| 198 | 3300005356 | Ga0070674_100001339 | Ga0070674_1000013391 | 466 |
| 199 | 3300005364 | Ga0070673_100001171 | Ga0070673_10000117114 | 466 |
| 200 | 3300005366 | Ga0070659_100001082 | Ga0070659_10000108222 | 466 |
| 201 | 3300005367 | Ga0070667_100121803 | Ga0070667_1001218032 | 466 |
| 202 | 3300005441 | Ga0070700_100053233 | Ga0070700_1000532333 | 466 |
| 203 | 3300005457 | Ga0070662_100000059 | Ga0070662_10000005924 | 466 |
| 204 | 3300005458 | Ga0070681_10032587 | Ga0070681_100325871 | 466 |
| 205 | 3300005459 | Ga0068867_100000588 | Ga0068867_10000058820 | 466 |
| 206 | 3300005535 | Ga0070684_100149560 | Ga0070684_1001495602 | 466 |
| 207 | 3300005543 | Ga0070672_100000683 | Ga0070672_1000006838 | 466 |
| 208 | 3300005546 | Ga0070696_100000917 | Ga0070696_1000009172 | 466 |
| 209 | 3300005549 | Ga0070704_100131554 | Ga0070704_1001315541 | 466 |
| 210 | 3300005578 | Ga0068854_100028452 | Ga0068854_1000284522 | 466 |
| 211 | 3300005718 | Ga0068866_10019056 | Ga0068866_100190562 | 466 |
| 212 | 3300005843 | Ga0068860_100014459 | Ga0068860_1000144596 | 466 |
| 213 | 3300006058 | Ga0075432_10000012 | Ga0075432_1000001217 | 466 |
| 214 | 3300006237 | Ga0097621_100021799 | Ga0097621_1000217994 | 466 |
| 215 | 3300006358 | Ga0068871_100019039 | Ga0068871_1000190394 | 466 |
| 216 | 3300006844 | Ga0075428_100051320 | Ga0075428_1000513202 | 466 |
| 217 | 3300006847 | Ga0075431_100004053 | Ga0075431_1000040531 | 466 |
| 218 | 3300006852 | Ga0075433_10006279 | Ga0075433_100062793 | 466 |
| 219 | 3300006880 | Ga0075429_100041774 | Ga0075429_1000417742 | 466 |
| 220 | 3300006881 | Ga0068865_100003182 | Ga0068865_1000031828 | 466 |
| 221 | 3300007076 | Ga0075435_100022656 | Ga0075435_1000226565 | 466 |
| 222 | 3300009093 | Ga0105240_10067174 | Ga0105240_100671742 | 466 |
| 223 | 3300009094 | Ga0111539_10013844 | Ga0111539_100138448 | 466 |
| 224 | 3300009098 | Ga0105245_10016534 | Ga0105245_100165346 | 466 |
| 225 | 3300009147 | Ga0114129_10020244 | Ga0114129_100202446 | 466 |
| 226 | 3300009148 | Ga0105243_10001690 | Ga0105243_100016906 | 466 |
| 227 | 3300009176 | Ga0105242_10000834 | Ga0105242_100008342 | 466 |
| 228 | 3300010375 | Ga0105239_10012398 | Ga0105239_100123985 | 466 |
| 229 | 3300011119 | Ga0105246_10000428 | Ga0105246_1000042821 | 466 |
| 230 | 3300013296 | Ga0157374_10005053 | Ga0157374_1000505310 | 466 |
| 231 | 3300013297 | Ga0157378_10056594 | Ga0157378_100565941 | 466 |
| 232 | 3300013306 | Ga0163162_10013512 | Ga0163162_100135126 | 466 |
| 233 | 3300013308 | Ga0157375_10072169 | Ga0157375_100721692 | 466 |
| 234 | 3300014969 | Ga0157376_10005228 | Ga0157376_100052286 | 466 |
| 235 | 3300025899 | Ga0207642_10011312 | Ga0207642_100113122 | 466 |
| 236 | 3300025901 | Ga0207688_10007275 | Ga0207688_100072752 | 466 |
| 237 | 3300025903 | Ga0207680_10008088 | Ga0207680_100080883 | 466 |
| 238 | 3300025907 | Ga0207645_10000009 | Ga0207645_1000000945 | 466 |
| 239 | 3300025918 | Ga0207662_10015073 | Ga0207662_100150733 | 466 |
| 240 | 3300025919 | Ga0207657_10005067 | Ga0207657_100050673 | 466 |
| 241 | 3300025920 | Ga0207649_10013648 | Ga0207649_100136484 | 466 |
| 242 | 3300025923 | Ga0207681_10001771 | Ga0207681_1000177114 | 466 |
| 243 | 3300025925 | Ga0207650_10026204 | Ga0207650_100262043 | 466 |
| 244 | 3300025926 | Ga0207659_10001981 | Ga0207659_100019819 | 466 |
| 245 | 3300025927 | Ga0207687_10063307 | Ga0207687_100633072 | 466 |
| 246 | 3300025931 | Ga0207644_10054530 | Ga0207644_100545302 | 466 |
| 247 | 3300025933 | Ga0207706_10000134 | Ga0207706_1000013454 | 466 |
| 248 | 3300025934 | Ga0207686_10006468 | Ga0207686_100064684 | 466 |
| 249 | 3300025936 | Ga0207670_10019416 | Ga0207670_100194162 | 466 |
| 250 | 3300025937 | Ga0207669_10042504 | Ga0207669_100425043 | 466 |
| 251 | 3300025938 | Ga0207704_10009221 | Ga0207704_100092213 | 466 |
| 252 | 3300025940 | Ga0207691_10000066 | Ga0207691_1000006642 | 466 |
| 253 | 3300025942 | Ga0207689_10004460 | Ga0207689_100044602 | 466 |
| 254 | 3300025944 | Ga0207661_10085137 | Ga0207661_100851372 | 466 |
| 255 | 3300025945 | Ga0207679_10000931 | Ga0207679_100009316 | 466 |
| 256 | 3300025960 | Ga0207651_10013780 | Ga0207651_100137803 | 466 |
| 257 | 3300025981 | Ga0207640_10029086 | Ga0207640_100290862 | 466 |
| 258 | 3300025986 | Ga0207658_10017783 | Ga0207658_100177833 | 466 |
| 259 | 3300026023 | Ga0207677_10027785 | Ga0207677_100277852 | 466 |
| 260 | 3300026067 | Ga0207678_10135373 | Ga0207678_101353732 | 466 |
| 261 | 3300026075 | Ga0207708_10000336 | Ga0207708_1000033628 | 466 |
| 262 | 3300026089 | Ga0207648_10000049 | Ga0207648_1000004982 | 466 |
| 263 | 3300026116 | Ga0207674_10031517 | Ga0207674_100315173 | 466 |
| 264 | 3300026121 | Ga0207683_10000023 | Ga0207683_1000002351 | 466 |
| 265 | 3300027360 | Ga0209969_1000683 | Ga0209969_10006832 | 466 |
| 266 | 3300027364 | Ga0209967_1000047 | Ga0209967_100004714 | 466 |
| 267 | 3300027378 | Ga0209981_1000336 | Ga0209981_10003364 | 466 |
| 268 | 3300027395 | Ga0209996_1000225 | Ga0209996_10002253 | 466 |
| 269 | 3300027424 | Ga0209984_1000396 | Ga0209984_10003962 | 466 |
| 270 | 3300027462 | Ga0210000_1000180 | Ga0210000_10001802 | 466 |
| 271 | 3300027471 | Ga0209995_1000150 | Ga0209995_10001507 | 466 |
| 272 | 3300027526 | Ga0209968_1000036 | Ga0209968_100003627 | 466 |
| 273 | 3300027614 | Ga0209970_1000719 | Ga0209970_10007192 | 466 |
| 274 | 3300027682 | Ga0209971_1000062 | Ga0209971_100006229 | 466 |
| 275 | 3300027695 | Ga0209966_1000210 | Ga0209966_100021023 | 466 |
| 276 | 3300027717 | Ga0209998_10000030 | Ga0209998_1000003046 | 466 |
| 277 | 3300027876 | Ga0209974_10000386 | Ga0209974_100003864 | 466 |
| 278 | 3300027907 | Ga0207428_10001516 | Ga0207428_100015166 | 466 |
| 279 | 3300031251 | Ga0265327_10000719 | Ga0265327_1000071915 | 466 |
| 280 | 3300045051 | Ga0451576_0237968 | Ga0451576_0237968_389_1807 | 466 |
| 281 | 3300050507 | nmdc:mga05p37_28711_c1 | nmdc:mga05p37_28711_c1_556_1974 | 466 |
| 282 | 3300050509 | nmdc:mga0qj67_56868_c1 | nmdc:mga0qj67_56868_c1_738_2156 | 466 |
| 283 | 3300050511 | nmdc:mga08y16_5521_c1 | nmdc:mga08y16_5521_c1_11062_12480 | 466 |
| 284 | 3300050512 | nmdc:mga0n895_42530_c1 | nmdc:mga0n895_42530_c1_1089_2507 | 466 |
| 285 | 3300050513 | nmdc:mga0rr50_14167_c1 | nmdc:mga0rr50_14167_c1_3458_4876 | 466 |
| 286 | 3300050515 | nmdc:mga0a205_10309_c1 | nmdc:mga0a205_10309_c1_6083_7501 | 466 |
| 287 | 3300035092 | Ga0373952_0000324 | Ga0373952_0000324_5728_7164 | 467 |
| 288 | 3300035121 | Ga0373960_0019946 | Ga0373960_0019946_56_1492 | 467 |
| 289 | 3300046506 | Ga0495583_0000222 | Ga0495583_0000222_71239_72678 | 467 |
| 290 | 3300049572 | Ga0501036_0019186 | Ga0501036_0019186_2762_4183 | 467 |
| 291 | 3300049575 | Ga0501039_0141383 | Ga0501039_0141383_62_1483 | 467 |
| 292 | 3300049577 | Ga0501041_0032501 | Ga0501041_0032501_345_1766 | 467 |
| 293 | 3300049582 | Ga0501048_0068156 | Ga0501048_0068156_991_2412 | 467 |
| 294 | 3300049584 | Ga0501068_0056185 | Ga0501068_0056185_901_2322 | 467 |
| 295 | 3300049585 | Ga0501069_0055790 | Ga0501069_0055790_446_1867 | 467 |
| 296 | 3300049588 | Ga0501072_0083304 | Ga0501072_0083304_414_1835 | 467 |
| 297 | 3300049590 | Ga0501074_0033222 | Ga0501074_0033222_2246_3667 | 467 |
| 298 | 3300049591 | Ga0501075_0037193 | Ga0501075_0037193_851_2272 | 467 |
| 299 | 3300049592 | Ga0501076_0082045 | Ga0501076_0082045_795_2216 | 467 |
| 300 | 3300049593 | Ga0501077_0019179 | Ga0501077_0019179_2580_4001 | 467 |
| 301 | 3300049741 | Ga0501079_0032234 | Ga0501079_0032234_406_1827 | 467 |
| 302 | 3300049742 | Ga0501080_0060090 | Ga0501080_0060090_1890_3311 | 467 |
| 303 | 3300005290 | Ga0065712_10096373 | Ga0065712_100963732 | 468 |
| 304 | 3300005330 | Ga0070690_100001012 | Ga0070690_10000101211 | 468 |
| 305 | 3300005330 | Ga0070690_100012031 | Ga0070690_1000120315 | 468 |
| 306 | 3300005334 | Ga0068869_100124717 | Ga0068869_1001247171 | 468 |
| 307 | 3300005340 | Ga0070689_100000070 | Ga0070689_10000007051 | 468 |
| 308 | 3300005340 | Ga0070689_100042986 | Ga0070689_1000429862 | 468 |
| 309 | 3300005343 | Ga0070687_100013134 | Ga0070687_1000131342 | 468 |
| 310 | 3300005365 | Ga0070688_100000006 | Ga0070688_10000000679 | 468 |
| 311 | 3300005438 | Ga0070701_10000161 | Ga0070701_1000016110 | 468 |
| 312 | 3300005441 | Ga0070700_100000390 | Ga0070700_10000039010 | 468 |
| 313 | 3300005444 | Ga0070694_100029065 | Ga0070694_1000290651 | 468 |
| 314 | 3300005444 | Ga0070694_100075087 | Ga0070694_1000750873 | 468 |
| 315 | 3300005466 | Ga0070685_10000693 | Ga0070685_1000069311 | 468 |
| 316 | 3300005467 | Ga0070706_100035202 | Ga0070706_1000352024 | 468 |
| 317 | 3300005468 | Ga0070707_100000032 | Ga0070707_10000003213 | 468 |
| 318 | 3300005468 | Ga0070707_100082597 | Ga0070707_1000825972 | 468 |
| 319 | 3300005468 | Ga0070707_100193040 | Ga0070707_1001930401 | 468 |
| 320 | 3300005471 | Ga0070698_100097369 | Ga0070698_1000973693 | 468 |
| 321 | 3300005518 | Ga0070699_100005467 | Ga0070699_1000054674 | 468 |
| 322 | 3300005518 | Ga0070699_100049858 | Ga0070699_1000498584 | 468 |
| 323 | 3300005536 | Ga0070697_100035617 | Ga0070697_1000356172 | 468 |
| 324 | 3300005536 | Ga0070697_100055367 | Ga0070697_1000553671 | 468 |
| 325 | 3300005544 | Ga0070686_100000897 | Ga0070686_1000008976 | 468 |
| 326 | 3300005544 | Ga0070686_100002011 | Ga0070686_1000020117 | 468 |
| 327 | 3300005545 | Ga0070695_100027086 | Ga0070695_1000270864 | 468 |
| 328 | 3300005564 | Ga0070664_100002039 | Ga0070664_1000020398 | 468 |
| 329 | 3300005615 | Ga0070702_100047359 | Ga0070702_1000473591 | 468 |
| 330 | 3300005719 | Ga0068861_100057108 | Ga0068861_1000571082 | 468 |
| 331 | 3300007076 | Ga0075435_100054284 | Ga0075435_1000542842 | 468 |
| 332 | 3300009098 | Ga0105245_10067537 | Ga0105245_100675372 | 468 |
| 333 | 3300009147 | Ga0114129_10003723 | Ga0114129_1000372310 | 468 |
| 334 | 3300009176 | Ga0105242_10033981 | Ga0105242_100339812 | 468 |
| 335 | 3300009176 | Ga0105242_10156871 | Ga0105242_101568711 | 468 |
| 336 | 3300009177 | Ga0105248_10004494 | Ga0105248_100044949 | 468 |
| 337 | 3300013296 | Ga0157374_10003255 | Ga0157374_1000325513 | 468 |
| 338 | 3300014326 | Ga0157380_10003948 | Ga0157380_100039485 | 468 |
| 339 | 3300014326 | Ga0157380_10033827 | Ga0157380_100338272 | 468 |
| 340 | 3300021361 | Ga0213872_10003726 | Ga0213872_100037264 | 468 |
| 341 | 3300021361 | Ga0213872_10027058 | Ga0213872_100270582 | 468 |
| 342 | 3300025903 | Ga0207680_10021987 | Ga0207680_100219871 | 468 |
| 343 | 3300025910 | Ga0207684_10041172 | Ga0207684_100411721 | 468 |
| 344 | 3300025912 | Ga0207707_10106442 | Ga0207707_101064422 | 468 |
| 345 | 3300025917 | Ga0207660_10005324 | Ga0207660_100053244 | 468 |
| 346 | 3300025918 | Ga0207662_10020619 | Ga0207662_100206192 | 468 |
| 347 | 3300025922 | Ga0207646_10000032 | Ga0207646_1000003255 | 468 |
| 348 | 3300025922 | Ga0207646_10063723 | Ga0207646_100637232 | 468 |
| 349 | 3300025936 | Ga0207670_10000160 | Ga0207670_1000016011 | 468 |
| 350 | 3300025940 | Ga0207691_10047442 | Ga0207691_100474422 | 468 |
| 351 | 3300025941 | Ga0207711_10005430 | Ga0207711_100054301 | 468 |
| 352 | 3300025945 | Ga0207679_10010190 | Ga0207679_100101906 | 468 |
| 353 | 3300026075 | Ga0207708_10001429 | Ga0207708_100014299 | 468 |
| 354 | 3300026075 | Ga0207708_10063040 | Ga0207708_100630401 | 468 |
| 355 | 3300026089 | Ga0207648_10003565 | Ga0207648_100035657 | 468 |
| 356 | 3300031251 | Ga0265327_10020927 | Ga0265327_100209272 | 468 |
| 357 | 3300031344 | Ga0265316_10000005 | Ga0265316_100000057 | 468 |
| 358 | 3300035120 | Ga0373957_0045731 | Ga0373957_0045731_143_1570 | 468 |
| 359 | 3300035692 | Ga0373935_0086873 | Ga0373935_0086873_165_1592 | 468 |
| 360 | 3300036401 | Ga0373937_0045752 | Ga0373937_0045752_567_1994 | 468 |
| 361 | 3300037068 | Ga0373925_0114893 | Ga0373925_0114893_628_2055 | 468 |
| 362 | 3300039447 | Ga0436361_0257895 | Ga0436361_0257895_2852_4285 | 468 |
| 363 | 3300039447 | Ga0436361_0545153 | Ga0436361_0545153_2851_4284 | 468 |
| 364 | 3300045051 | Ga0451576_0008254 | Ga0451576_0008254_6374_7792 | 468 |
| 365 | 3300046499 | Ga0495594_0006120 | Ga0495594_0006120_815_2242 | 468 |
| 366 | 3300046536 | Ga0495587_0062895 | Ga0495587_0062895_701_2128 | 468 |
| 367 | 3300050507 | nmdc:mga05p37_21279_c1 | nmdc:mga05p37_21279_c1_305_1714 | 468 |
| 368 | 3300050509 | nmdc:mga0qj67_4478_c1 | nmdc:mga0qj67_4478_c1_8194_9612 | 468 |
| 369 | 3300050515 | nmdc:mga0a205_119880_c1 | nmdc:mga0a205_119880_c1_1066_2475 | 468 |
| 370 | 3300053085 | Ga0495619_0047189 | Ga0495619_0047189_1384_2811 | 468 |
| 371 | 3300053085 | Ga0495619_0108036 | Ga0495619_0108036_422_1837 | 468 |
| 372 | 3300059426 | Ga0590077_008026 | Ga0590077_008026_61_1479 | 468 |
| 373 | iso_pu_bacteria | 2574179768 | 2574432118 | 468 |
| 374 | iso_pu_bacteria | 2643221556 | 2643800528 | 468 |
| 375 | iso_pu_bacteria | 2643221684 | 2644470437 | 468 |
| 376 | iso_pu_bacteria | 2808606418 | 2809144042 | 468 |
| 377 | iso_pu_bacteria | 2891633521 | 2891633621 | 468 |
| 378 | iso_pu_bacteria | 8047673197 | 8047678833 | 468 |
| 379 | 3300003759 | Ga0055525_1000081 | Ga0055525_1000081117 | 469 |
| 380 | 3300005549 | Ga0070704_100025964 | Ga0070704_1000259643 | 469 |
| 381 | 3300005937 | Ga0081455_10000900 | Ga0081455_1000090031 | 469 |
| 382 | 3300009147 | Ga0114129_10016942 | Ga0114129_100169427 | 469 |
| 383 | 3300009551 | Ga0105238_10000258 | Ga0105238_1000025848 | 469 |
| 384 | 3300013296 | Ga0157374_10201938 | Ga0157374_102019382 | 469 |
| 385 | 3300021361 | Ga0213872_10000093 | Ga0213872_1000009325 | 469 |
| 386 | 3300025230 | Ga0209563_100015 | Ga0209563_100015671 | 469 |
| 387 | 3300025253 | Ga0209677_104484 | Ga0209677_1044842 | 469 |
| 388 | 3300025917 | Ga0207660_10032198 | Ga0207660_100321982 | 469 |
| 389 | 3300031250 | Ga0265331_10022219 | Ga0265331_100222192 | 469 |
| 390 | 3300031251 | Ga0265327_10003120 | Ga0265327_100031208 | 469 |
| 391 | 3300037312 | Ga0395899_0024592 | Ga0395899_0024592_1489_2946 | 469 |
| 392 | 3300037312 | Ga0395899_0042010 | Ga0395899_0042010_343_1800 | 469 |
| 393 | 3300037312 | Ga0395899_0108211 | Ga0395899_0108211_489_1946 | 469 |
| 394 | 3300037418 | Ga0395900_0167746 | Ga0395900_0167746_238_1695 | 469 |
| 395 | 3300037471 | Ga0395905_0087784 | Ga0395905_0087784_773_2230 | 469 |
| 396 | 3300039447 | Ga0436361_0773293 | Ga0436361_0773293_9951_11423 | 469 |
| 397 | 3300039447 | Ga0436361_1049300 | Ga0436361_1049300_1527_2951 | 469 |
| 398 | 3300044656 | Ga0466969_0039336 | Ga0466969_0039336_368_1825 | 469 |
| 399 | 3300044693 | Ga0466961_0019077 | Ga0466961_0019077_1234_2691 | 469 |
| 400 | 3300044706 | Ga0466964_0000097 | Ga0466964_0000097_14209_15687 | 469 |
| 401 | 3300045049 | Ga0466959_0038347 | Ga0466959_0038347_1872_3329 | 469 |
| 402 | 3300045836 | Ga0466958_0052313 | Ga0466958_0052313_454_1911 | 469 |
| 403 | 3300046452 | Ga0495617_000125 | Ga0495617_000125_38252_39709 | 469 |
| 404 | 3300046457 | Ga0495590_0002849 | Ga0495590_0002849_2907_4358 | 469 |
| 405 | 3300046463 | Ga0495653_0041728 | Ga0495653_0041728_1176_2627 | 469 |
| 406 | 3300046463 | Ga0495653_0116134 | Ga0495653_0116134_43_1494 | 469 |
| 407 | 3300046472 | Ga0495580_0036217 | Ga0495580_0036217_399_1850 | 469 |
| 408 | 3300046473 | Ga0495582_0000662 | Ga0495582_0000662_1694_3145 | 469 |
| 409 | 3300046474 | Ga0495605_0000845 | Ga0495605_0000845_10551_12008 | 469 |
| 410 | 3300046491 | Ga0495584_0032982 | Ga0495584_0032982_539_2071 | 469 |
| 411 | 3300046492 | Ga0495585_0003922 | Ga0495585_0003922_1598_3061 | 469 |
| 412 | 3300046492 | Ga0495585_0020428 | Ga0495585_0020428_1076_2539 | 469 |
| 413 | 3300046499 | Ga0495594_0038603 | Ga0495594_0038603_798_2249 | 469 |
| 414 | 3300046499 | Ga0495594_0060699 | Ga0495594_0060699_317_1774 | 469 |
| 415 | 3300046500 | Ga0495596_0004535 | Ga0495596_0004535_1241_2698 | 469 |
| 416 | 3300046500 | Ga0495596_0005727 | Ga0495596_0005727_3296_4753 | 469 |
| 417 | 3300046501 | Ga0495607_0000004 | Ga0495607_0000004_95521_97011 | 469 |
| 418 | 3300046501 | Ga0495607_0001408 | Ga0495607_0001408_10551_12008 | 469 |
| 419 | 3300046507 | Ga0495606_0018114 | Ga0495606_0018114_226_1686 | 469 |
| 420 | 3300046518 | Ga0495631_0001168 | Ga0495631_0001168_6084_7541 | 469 |
| 421 | 3300046523 | Ga0495644_0019602 | Ga0495644_0019602_167_1624 | 469 |
| 422 | 3300046523 | Ga0495644_0022177 | Ga0495644_0022177_131_1588 | 469 |
| 423 | 3300046524 | Ga0495648_0000612 | Ga0495648_0000612_1768_3225 | 469 |
| 424 | 3300046526 | Ga0495666_0000791 | Ga0495666_0000791_7567_9027 | 469 |
| 425 | 3300046526 | Ga0495666_0006131 | Ga0495666_0006131_2916_4367 | 469 |
| 426 | 3300046528 | Ga0495642_0013263 | Ga0495642_0013263_35_1492 | 469 |
| 427 | 3300046529 | Ga0495652_0064084 | Ga0495652_0064084_747_2198 | 469 |
| 428 | 3300046531 | Ga0495665_0003210 | Ga0495665_0003210_5584_7035 | 469 |
| 429 | 3300046535 | Ga0495586_0028232 | Ga0495586_0028232_1212_2663 | 469 |
| 430 | 3300046536 | Ga0495587_0087071 | Ga0495587_0087071_125_1576 | 469 |
| 431 | 3300046557 | Ga0495622_0010883 | Ga0495622_0010883_1388_2848 | 469 |
| 432 | 3300046558 | Ga0495633_0006611 | Ga0495633_0006611_2462_3925 | 469 |
| 433 | 3300046615 | Ga0495656_0004470 | Ga0495656_0004470_2305_3762 | 469 |
| 434 | 3300046642 | Ga0495634_0106344 | Ga0495634_0106344_213_1664 | 469 |
| 435 | 3300046665 | Ga0495661_0005396 | Ga0495661_0005396_5033_6496 | 469 |
| 436 | 3300046674 | Ga0495588_0013718 | Ga0495588_0013718_1617_3068 | 469 |
| 437 | 3300046679 | Ga0495623_0018146 | Ga0495623_0018146_2464_3915 | 469 |
| 438 | 3300046691 | Ga0495670_0005460 | Ga0495670_0005460_3050_4513 | 469 |
| 439 | 3300046691 | Ga0495670_0019346 | Ga0495670_0019346_1100_2557 | 469 |
| 440 | 3300046794 | Ga0495589_0001297 | Ga0495589_0001297_907_2364 | 469 |
| 441 | 3300046809 | Ga0495600_0021920 | Ga0495600_0021920_483_1934 | 469 |
| 442 | 3300047315 | Ga0495581_0001061 | Ga0495581_0001061_8073_9533 | 469 |
| 443 | 3300047315 | Ga0495581_0005818 | Ga0495581_0005818_1665_3122 | 469 |
| 444 | 3300047317 | Ga0495604_0040469 | Ga0495604_0040469_798_2249 | 469 |
| 445 | 3300047445 | Ga0495677_0007440 | Ga0495677_0007440_1620_3077 | 469 |
| 446 | 3300047470 | Ga0495681_0000511 | Ga0495681_0000511_11681_13138 | 469 |
| 447 | 3300047470 | Ga0495681_0003757 | Ga0495681_0003757_7810_9267 | 469 |
| 448 | 3300047472 | Ga0495686_0000285 | Ga0495686_0000285_65089_66546 | 469 |
| 449 | 3300048088 | Ga0495602_0001988 | Ga0495602_0001988_9907_11358 | 469 |
| 450 | 3300048089 | Ga0495614_0008722 | Ga0495614_0008722_1615_3072 | 469 |
| 451 | 3300048091 | Ga0495626_0000613 | Ga0495626_0000613_10021_11472 | 469 |
| 452 | 3300048903 | Ga0496100_0074995 | Ga0496100_0074995_376_1833 | 469 |
| 453 | 3300048906 | Ga0496103_0006831 | Ga0496103_0006831_1853_3310 | 469 |
| 454 | 3300048912 | Ga0496109_0006786 | Ga0496109_0006786_5154_6611 | 469 |
| 455 | 3300048915 | Ga0496112_0069132 | Ga0496112_0069132_210_1667 | 469 |
| 456 | 3300048916 | Ga0496113_0009852 | Ga0496113_0009852_3743_5200 | 469 |
| 457 | 3300048919 | Ga0496116_0030764 | Ga0496116_0030764_1402_2811 | 469 |
| 458 | 3300048924 | Ga0496121_0123323 | Ga0496121_0123323_374_1831 | 469 |
| 459 | 3300048925 | Ga0496122_0001645 | Ga0496122_0001645_19303_20760 | 469 |
| 460 | 3300048926 | Ga0496123_0002540 | Ga0496123_0002540_19793_21250 | 469 |
| 461 | 3300048928 | Ga0496125_0001339 | Ga0496125_0001339_19066_20523 | 469 |
| 462 | 3300049459 | Ga0495678_007426 | Ga0495678_007426_957_2426 | 469 |
| 463 | 3300050507 | nmdc:mga05p37_11314_c1 | nmdc:mga05p37_11314_c1_7793_9226 | 469 |
| 464 | iso_pu_bacteria | 2939631187 | 2939634185 | 469 |
| 465 | 3300005545 | Ga0070695_100077990 | Ga0070695_1000779902 | 470 |
| 466 | 3300005546 | Ga0070696_100002873 | Ga0070696_1000028736 | 470 |
| 467 | 3300031251 | Ga0265327_10044401 | Ga0265327_100444012 | 470 |
| 468 | 3300031251 | Ga0265327_10073494 | Ga0265327_100734942 | 470 |
| 469 | 3300045051 | Ga0451576_0019765 | Ga0451576_0019765_4380_5867 | 470 |
| 470 | 3300046522 | Ga0495643_0002098 | Ga0495643_0002098_10700_12130 | 470 |
| 471 | 3300046665 | Ga0495661_0004703 | Ga0495661_0004703_4393_5823 | 470 |
| 472 | 3300047443 | Ga0495687_007801 | Ga0495687_007801_2181_3611 | 470 |
| 473 | 3300005355 | Ga0070671_100053012 | Ga0070671_1000530122 | 471 |
| 474 | 3300009094 | Ga0111539_10000106 | Ga0111539_1000010633 | 471 |
| 475 | 3300025919 | Ga0207657_10102751 | Ga0207657_101027512 | 471 |
| 476 | 3300027907 | Ga0207428_10007796 | Ga0207428_100077966 | 471 |
| 477 | 3300031251 | Ga0265327_10006214 | Ga0265327_100062143 | 471 |
| 478 | 3300031730 | Ga0307516_10002741 | Ga0307516_1000274119 | 471 |
| 479 | 3300037312 | Ga0395899_0023327 | Ga0395899_0023327_301_1797 | 471 |
| 480 | 3300037312 | Ga0395899_0097786 | Ga0395899_0097786_298_1794 | 471 |
| 481 | 3300037418 | Ga0395900_0040940 | Ga0395900_0040940_799_2295 | 471 |
| 482 | 3300037471 | Ga0395905_0014548 | Ga0395905_0014548_531_1985 | 471 |
| 483 | 3300038443 | Ga0395901_0060610 | Ga0395901_0060610_1541_3037 | 471 |
| 484 | 3300044656 | Ga0466969_0019979 | Ga0466969_0019979_1047_2486 | 471 |
| 485 | 3300044658 | Ga0466972_0000359 | Ga0466972_0000359_14913_16376 | 471 |
| 486 | 3300044666 | Ga0466977_0013105 | Ga0466977_0013105_1911_3350 | 471 |
| 487 | 3300047318 | Ga0495636_0023321 | Ga0495636_0023321_781_2235 | 471 |
| 488 | 3300048905 | Ga0496102_0000544 | Ga0496102_0000544_11292_12758 | 471 |
| 489 | 3300049571 | Ga0501034_0050002 | Ga0501034_0050002_1329_2768 | 471 |
| 490 | 3300049823 | Ga0501044_0111665 | Ga0501044_0111665_679_2175 | 471 |
| 491 | iso_pu_bacteria | 2511231026 | 2511384922 | 471 |
| 492 | iso_pu_bacteria | 2643221544 | 2643743826 | 471 |
| 493 | iso_pu_bacteria | 2643221585 | 2643937216 | 471 |
| 494 | iso_pu_bacteria | 2643221603 | 2644027150 | 471 |
| 495 | iso_pu_bacteria | 2643221656 | 2644318381 | 471 |
| 496 | iso_pu_bacteria | 2738541337 | 2739056453 | 471 |
| 497 | 3300003771 | Ga0055526_1000651 | Ga0055526_10006514 | 472 |
| 498 | 3300005337 | Ga0070682_100039419 | Ga0070682_1000394193 | 472 |
| 499 | 3300005337 | Ga0070682_100096002 | Ga0070682_1000960022 | 472 |
| 500 | 3300005339 | Ga0070660_100004636 | Ga0070660_1000046362 | 472 |
| 501 | 3300005344 | Ga0070661_100005481 | Ga0070661_1000054814 | 472 |
| 502 | 3300005364 | Ga0070673_100153218 | Ga0070673_1001532181 | 472 |
| 503 | 3300005366 | Ga0070659_100001965 | Ga0070659_10000196511 | 472 |
| 504 | 3300005455 | Ga0070663_100014804 | Ga0070663_1000148041 | 472 |
| 505 | 3300005456 | Ga0070678_100075262 | Ga0070678_1000752622 | 472 |
| 506 | 3300005564 | Ga0070664_100018224 | Ga0070664_1000182244 | 472 |
| 507 | 3300005577 | Ga0068857_100130134 | Ga0068857_1001301342 | 472 |
| 508 | 3300005617 | Ga0068859_100187125 | Ga0068859_1001871252 | 472 |
| 509 | 3300005842 | Ga0068858_100003164 | Ga0068858_1000031646 | 472 |
| 510 | 3300005842 | Ga0068858_100026292 | Ga0068858_1000262923 | 472 |
| 511 | 3300006051 | Ga0075364_10051700 | Ga0075364_100517002 | 472 |
| 512 | 3300006195 | Ga0075366_10008423 | Ga0075366_100084235 | 472 |
| 513 | 3300006195 | Ga0075366_10020793 | Ga0075366_100207934 | 472 |
| 514 | 3300006237 | Ga0097621_100173286 | Ga0097621_1001732862 | 472 |
| 515 | 3300006931 | Ga0097620_100187119 | Ga0097620_1001871192 | 472 |
| 516 | 3300009094 | Ga0111539_10006915 | Ga0111539_1000691513 | 472 |
| 517 | 3300009148 | Ga0105243_10083206 | Ga0105243_100832062 | 472 |
| 518 | 3300009176 | Ga0105242_10000115 | Ga0105242_1000011518 | 472 |
| 519 | 3300009177 | Ga0105248_10020966 | Ga0105248_100209662 | 472 |
| 520 | 3300009177 | Ga0105248_10042075 | Ga0105248_100420753 | 472 |
| 521 | 3300013105 | Ga0157369_10111531 | Ga0157369_101115312 | 472 |
| 522 | 3300013296 | Ga0157374_10110758 | Ga0157374_101107582 | 472 |
| 523 | 3300013308 | Ga0157375_10096306 | Ga0157375_100963062 | 472 |
| 524 | 3300025920 | Ga0207649_10009607 | Ga0207649_100096073 | 472 |
| 525 | 3300025932 | Ga0207690_10001518 | Ga0207690_100015184 | 472 |
| 526 | 3300025933 | Ga0207706_10052507 | Ga0207706_100525072 | 472 |
| 527 | 3300025934 | Ga0207686_10033668 | Ga0207686_100336682 | 472 |
| 528 | 3300025935 | Ga0207709_10095548 | Ga0207709_100955481 | 472 |
| 529 | 3300025935 | Ga0207709_10123125 | Ga0207709_101231251 | 472 |
| 530 | 3300025936 | Ga0207670_10011882 | Ga0207670_100118823 | 472 |
| 531 | 3300025940 | Ga0207691_10151284 | Ga0207691_101512842 | 472 |
| 532 | 3300025945 | Ga0207679_10015279 | Ga0207679_100152794 | 472 |
| 533 | 3300026035 | Ga0207703_10036652 | Ga0207703_100366523 | 472 |
| 534 | 3300026067 | Ga0207678_10004674 | Ga0207678_100046747 | 472 |
| 535 | 3300026075 | Ga0207708_10071162 | Ga0207708_100711622 | 472 |
| 536 | 3300026116 | Ga0207674_10037920 | Ga0207674_100379203 | 472 |
| 537 | 3300027907 | Ga0207428_10006322 | Ga0207428_1000632211 | 472 |
| 538 | 3300028379 | Ga0268266_10085640 | Ga0268266_100856402 | 472 |
| 539 | 3300031241 | Ga0265325_10007301 | Ga0265325_100073014 | 472 |
| 540 | 3300031548 | Ga0307408_100000023 | Ga0307408_10000002366 | 472 |
| 541 | 3300037312 | Ga0395899_0002272 | Ga0395899_0002272_13963_15432 | 472 |
| 542 | 3300042876 | Ga0451577_0000085 | Ga0451577_0000085_18897_20369 | 472 |
| 543 | 3300044658 | Ga0466972_0017061 | Ga0466972_0017061_621_2084 | 472 |
| 544 | 3300044673 | Ga0453683_0000047 | Ga0453683_0000047_15519_16991 | 472 |
| 545 | 3300044684 | Ga0466966_0036339 | Ga0466966_0036339_1420_2892 | 472 |
| 546 | 3300044712 | Ga0453684_0000273 | Ga0453684_0000273_205537_207012 | 472 |
| 547 | 3300044712 | Ga0453684_0000302 | Ga0453684_0000302_190773_192245 | 472 |
| 548 | 3300045051 | Ga0451576_0000116 | Ga0451576_0000116_15519_16991 | 472 |
| 549 | 3300045051 | Ga0451576_0103230 | Ga0451576_0103230_1234_2673 | 472 |
| 550 | 3300045976 | Ga0466967_0057073 | Ga0466967_0057073_141_1589 | 472 |
| 551 | 3300046454 | Ga0495592_0020784 | Ga0495592_0020784_3364_4794 | 472 |
| 552 | 3300046462 | Ga0495651_0084410 | Ga0495651_0084410_605_2035 | 472 |
| 553 | 3300046507 | Ga0495606_0019130 | Ga0495606_0019130_2102_3535 | 472 |
| 554 | 3300046511 | Ga0495608_0023686 | Ga0495608_0023686_1328_2758 | 472 |
| 555 | 3300046536 | Ga0495587_0072105 | Ga0495587_0072105_484_1914 | 472 |
| 556 | 3300046559 | Ga0495667_0091051 | Ga0495667_0091051_185_1615 | 472 |
| 557 | 3300046675 | Ga0495657_0060037 | Ga0495657_0060037_730_2160 | 472 |
| 558 | 3300048912 | Ga0496109_0113160 | Ga0496109_0113160_663_2132 | 472 |
| 559 | 3300049568 | Ga0501031_0045375 | Ga0501031_0045375_192_1637 | 472 |
| 560 | 3300049656 | Ga0501209_001129 | Ga0501209_001129_1811_3304 | 472 |
| 561 | 3300050491 | nmdc:mga00v17_26544_c1 | nmdc:mga00v17_26544_c1_1612_3042 | 472 |
| 562 | 3300050493 | nmdc:mga0k408_12676_c1 | nmdc:mga0k408_12676_c1_186_1616 | 472 |
| 563 | 3300050493 | nmdc:mga0k408_3408_c1 | nmdc:mga0k408_3408_c1_726_2189 | 472 |
| 564 | 3300050511 | nmdc:mga08y16_2953_c1 | nmdc:mga08y16_2953_c1_10086_11516 | 472 |
| 565 | 3300050516 | nmdc:mga0sz30_14682_c1 | nmdc:mga0sz30_14682_c1_946_2376 | 472 |
| 566 | 3300053096 | Ga0500641_0054808 | Ga0500641_0054808_65_1495 | 472 |
| 567 | 3300005337 | Ga0070682_100078636 | Ga0070682_1000786362 | 473 |
| 568 | 3300006946 | Ga0079104_1002487 | Ga0079104_10024877 | 473 |
| 569 | 3300027111 | Ga0209281_1003184 | Ga0209281_10031844 | 473 |
| 570 | 3300031665 | Ga0316575_10005752 | Ga0316575_100057522 | 473 |
| 571 | 3300031691 | Ga0316579_10000015 | Ga0316579_100000154 | 473 |
| 572 | 3300032133 | Ga0316583_10000483 | Ga0316583_100004832 | 473 |
| 573 | 3300032133 | Ga0316583_10004823 | Ga0316583_100048233 | 473 |
| 574 | 3300035119 | Ga0373956_0036076 | Ga0373956_0036076_585_2027 | 473 |
| 575 | 3300035172 | Ga0373955_0013547 | Ga0373955_0013547_93_1535 | 473 |
| 576 | 3300035410 | Ga0373924_0007992 | Ga0373924_0007992_1600_3042 | 473 |
| 577 | 3300035724 | Ga0373933_0002452 | Ga0373933_0002452_7250_8692 | 473 |
| 578 | 3300036647 | Ga0316582_0003674 | Ga0316582_0003674_4219_5664 | 473 |
| 579 | 3300037471 | Ga0395905_0000043 | Ga0395905_0000043_155572_157044 | 473 |
| 580 | 3300037471 | Ga0395905_0056374 | Ga0395905_0056374_1013_2485 | 473 |
| 581 | 3300038443 | Ga0395901_0005833 | Ga0395901_0005833_519_1988 | 473 |
| 582 | 3300038443 | Ga0395901_0077433 | Ga0395901_0077433_733_2205 | 473 |
| 583 | 3300038726 | Ga0400490_21110 | Ga0400490_21110_121_1584 | 473 |
| 584 | 3300041404 | Ga0439436_0024218 | Ga0439436_0024218_17_1504 | 473 |
| 585 | 3300044673 | Ga0453683_0006123 | Ga0453683_0006123_1871_3352 | 473 |
| 586 | 3300044712 | Ga0453684_0038837 | Ga0453684_0038837_2909_4363 | 473 |
| 587 | 3300045051 | Ga0451576_0019294 | Ga0451576_0019294_3235_4692 | 473 |
| 588 | 3300045051 | Ga0451576_0025801 | Ga0451576_0025801_3125_4606 | 473 |
| 589 | 3300047322 | Ga0495680_0061285 | Ga0495680_0061285_1401_2843 | 473 |
| 590 | iso_pu_bacteria | 2511231003 | 2511248687 | 473 |
| 591 | iso_pu_bacteria | 2818991445 | 2819594916 | 473 |
| 592 | iso_pu_bacteria | 2843690924 | 2843691366 | 473 |
| 593 | 3300005331 | Ga0070670_100000054 | Ga0070670_10000005470 | 474 |
| 594 | 3300005335 | Ga0070666_10008897 | Ga0070666_100088974 | 474 |
| 595 | 3300005353 | Ga0070669_100002303 | Ga0070669_1000023039 | 474 |
| 596 | 3300005355 | Ga0070671_100000037 | Ga0070671_10000003744 | 474 |
| 597 | 3300005367 | Ga0070667_100000002 | Ga0070667_100000002424 | 474 |
| 598 | 3300005466 | Ga0070685_10000014 | Ga0070685_1000001464 | 474 |
| 599 | 3300005548 | Ga0070665_100079228 | Ga0070665_1000792282 | 474 |
| 600 | 3300005617 | Ga0068859_100046115 | Ga0068859_1000461153 | 474 |
| 601 | 3300005618 | Ga0068864_100000002 | Ga0068864_10000000249 | 474 |
| 602 | 3300005843 | Ga0068860_100000844 | Ga0068860_10000084410 | 474 |
| 603 | 3300006931 | Ga0097620_100046114 | Ga0097620_1000461142 | 474 |
| 604 | 3300009101 | Ga0105247_10042854 | Ga0105247_100428542 | 474 |
| 605 | 3300009553 | Ga0105249_10107901 | Ga0105249_101079012 | 474 |
| 606 | 3300014325 | Ga0163163_10004619 | Ga0163163_100046192 | 474 |
| 607 | 3300025900 | Ga0207710_10029853 | Ga0207710_100298531 | 474 |
| 608 | 3300025903 | Ga0207680_10017073 | Ga0207680_100170733 | 474 |
| 609 | 3300025923 | Ga0207681_10001840 | Ga0207681_100018408 | 474 |
| 610 | 3300025925 | Ga0207650_10000002 | Ga0207650_1000000249 | 474 |
| 611 | 3300025931 | Ga0207644_10000114 | Ga0207644_1000011452 | 474 |
| 612 | 3300025961 | Ga0207712_10118138 | Ga0207712_101181381 | 474 |
| 613 | 3300025986 | Ga0207658_10000001 | Ga0207658_100000011305 | 474 |
| 614 | 3300026088 | Ga0207641_10010053 | Ga0207641_100100532 | 474 |
| 615 | 3300026088 | Ga0207641_10010055 | Ga0207641_100100552 | 474 |
| 616 | 3300026095 | Ga0207676_10000001 | Ga0207676_1000000149 | 474 |
| 617 | 3300028379 | Ga0268266_10056565 | Ga0268266_100565652 | 474 |
| 618 | 3300028380 | Ga0268265_10009824 | Ga0268265_100098244 | 474 |
| 619 | 3300028381 | Ga0268264_10000004 | Ga0268264_1000000446 | 474 |
| 620 | 3300031251 | Ga0265327_10000068 | Ga0265327_1000006899 | 474 |
| 621 | 3300031251 | Ga0265327_10008435 | Ga0265327_100084357 | 474 |
| 622 | 3300042876 | Ga0451577_0019578 | Ga0451577_0019578_2234_3748 | 474 |
| 623 | 3300044712 | Ga0453684_0000276 | Ga0453684_0000276_77913_79427 | 474 |
| 624 | 3300044712 | Ga0453684_0034104 | Ga0453684_0034104_1563_3077 | 474 |
| 625 | 3300045051 | Ga0451576_0001472 | Ga0451576_0001472_24932_26446 | 474 |
| 626 | 3300045051 | Ga0451576_0071239 | Ga0451576_0071239_1563_3077 | 474 |
| 627 | 3300049568 | Ga0501031_0009138 | Ga0501031_0009138_624_2078 | 474 |
| 628 | 3300049569 | Ga0501032_0100497 | Ga0501032_0100497_380_1834 | 474 |
| 629 | 3300049577 | Ga0501041_0018228 | Ga0501041_0018228_452_1906 | 474 |
| 630 | 3300049580 | Ga0501046_0001975 | Ga0501046_0001975_11412_12866 | 474 |
| 631 | 3300049581 | Ga0501047_0109279 | Ga0501047_0109279_924_2471 | 474 |
| 632 | 3300049822 | Ga0501035_0075320 | Ga0501035_0075320_606_2060 | 474 |
| 633 | 3300053177 | Ga0500636_0000250 | Ga0500636_0000250_12076_13569 | 474 |
| 634 | iso_pu_bacteria | 2513237150 | 2513953929 | 474 |
| 635 | iso_pu_bacteria | 2513237165 | 2514040064 | 474 |
| 636 | iso_pu_bacteria | 2834641062 | 2834641195 | 474 |
| 637 | iso_pu_bacteria | 2901300506 | 2901309945 | 474 |
| 638 | iso_pu_bacteria | 644736347 | 644746724 | 474 |
| 639 | iso_pu_bacteria | 8003400568 | 8003403938 | 474 |
| 640 | 3300002704 | JGI25155J39150_1000205 | JGI25155J39150_10002056 | 475 |
| 641 | 3300002704 | JGI25155J39150_1000224 | JGI25155J39150_100022417 | 475 |
| 642 | 3300002704 | JGI25155J39150_1000386 | JGI25155J39150_100038610 | 475 |
| 643 | 3300002705 | JGI25156J39149_1000357 | JGI25156J39149_100035717 | 475 |
| 644 | 3300002705 | JGI25156J39149_1002757 | JGI25156J39149_10027574 | 475 |
| 645 | 3300002738 | JGI25154J39366_1000298 | JGI25154J39366_100029817 | 475 |
| 646 | 3300002738 | JGI25154J39366_1000314 | JGI25154J39366_100031418 | 475 |
| 647 | 3300002741 | JGI25157J39369_1000262 | JGI25157J39369_10002624 | 475 |
| 648 | 3300002741 | JGI25157J39369_1000702 | JGI25157J39369_10007025 | 475 |
| 649 | 3300003320 | rootH2_10038054 | rootH2_1003805410 | 475 |
| 650 | 3300003758 | Ga0055532_1000059 | Ga0055532_100005916 | 475 |
| 651 | 3300005842 | Ga0068858_100001596 | Ga0068858_10000159626 | 475 |
| 652 | 3300006048 | Ga0075363_100034682 | Ga0075363_1000346822 | 475 |
| 653 | 3300025206 | Ga0209435_100032 | Ga0209435_100032124 | 475 |
| 654 | 3300025206 | Ga0209435_100146 | Ga0209435_1001465 | 475 |
| 655 | 3300025229 | Ga0209147_100109 | Ga0209147_100109124 | 475 |
| 656 | 3300025242 | Ga0209258_100190 | Ga0209258_10019097 | 475 |
| 657 | 3300025246 | Ga0209646_1000113 | Ga0209646_1000113124 | 475 |
| 658 | 3300025246 | Ga0209646_1000327 | Ga0209646_100032721 | 475 |
| 659 | 3300025250 | Ga0209026_1000102 | Ga0209026_1000102124 | 475 |
| 660 | 3300025250 | Ga0209026_1003686 | Ga0209026_10036862 | 475 |
| 661 | 3300025256 | Ga0209759_1000104 | Ga0209759_1000104124 | 475 |
| 662 | 3300025256 | Ga0209759_1001952 | Ga0209759_10019526 | 475 |
| 663 | 3300025272 | Ga0209455_1005292 | Ga0209455_10052922 | 475 |
| 664 | 3300025925 | Ga0207650_10011570 | Ga0207650_100115702 | 475 |
| 665 | 3300025939 | Ga0207665_10095622 | Ga0207665_100956222 | 475 |
| 666 | 3300026035 | Ga0207703_10007101 | Ga0207703_1000710110 | 475 |
| 667 | 3300036401 | Ga0373937_0028631 | Ga0373937_0028631_1569_3008 | 475 |
| 668 | iso_pu_bacteria | 2548876994 | 2550693494 | 475 |
| 669 | iso_pu_bacteria | 2596583598 | 2597030830 | 475 |
| 670 | iso_pu_bacteria | 2599185178 | 2599447060 | 475 |
| 671 | iso_pu_bacteria | 2884836552 | 2884838231 | 475 |
| 672 | iso_pu_bacteria | 2884852848 | 2884854523 | 475 |
| 673 | iso_pu_bacteria | 2885266251 | 2885268996 | 475 |
| 674 | iso_pu_bacteria | 2896154374 | 2896159220 | 475 |
| 675 | iso_pu_bacteria | 2900577576 | 2900582237 | 475 |
| 676 | iso_pu_bacteria | 2928058823 | 2928061237 | 475 |
| 677 | iso_pu_bacteria | 639633007 | 639785485 | 475 |
| 678 | 3300005331 | Ga0070670_100007425 | Ga0070670_1000074254 | 476 |
| 679 | 3300005338 | Ga0068868_100045184 | Ga0068868_1000451844 | 476 |
| 680 | 3300005354 | Ga0070675_100013140 | Ga0070675_1000131405 | 476 |
| 681 | 3300005356 | Ga0070674_100006470 | Ga0070674_1000064704 | 476 |
| 682 | 3300005364 | Ga0070673_100000190 | Ga0070673_10000019012 | 476 |
| 683 | 3300005543 | Ga0070672_100000116 | Ga0070672_10000011639 | 476 |
| 684 | 3300006237 | Ga0097621_100021171 | Ga0097621_1000211714 | 476 |
| 685 | 3300006358 | Ga0068871_100075038 | Ga0068871_1000750381 | 476 |
| 686 | 3300006847 | Ga0075431_100092175 | Ga0075431_1000921752 | 476 |
| 687 | 3300009093 | Ga0105240_10052544 | Ga0105240_100525443 | 476 |
| 688 | 3300009147 | Ga0114129_10081280 | Ga0114129_100812803 | 476 |
| 689 | 3300013297 | Ga0157378_10005614 | Ga0157378_100056143 | 476 |
| 690 | 3300014969 | Ga0157376_10024880 | Ga0157376_100248802 | 476 |
| 691 | 3300025907 | Ga0207645_10009334 | Ga0207645_100093344 | 476 |
| 692 | 3300025925 | Ga0207650_10001415 | Ga0207650_100014154 | 476 |
| 693 | 3300025926 | Ga0207659_10002634 | Ga0207659_100026348 | 476 |
| 694 | 3300025933 | Ga0207706_10024959 | Ga0207706_100249593 | 476 |
| 695 | 3300025940 | Ga0207691_10000015 | Ga0207691_1000001570 | 476 |
| 696 | 3300025960 | Ga0207651_10000209 | Ga0207651_1000020924 | 476 |
| 697 | 3300026121 | Ga0207683_10000501 | Ga0207683_1000050134 | 476 |
| 698 | 3300027360 | Ga0209969_1001115 | Ga0209969_10011154 | 476 |
| 699 | 3300028379 | Ga0268266_10023623 | Ga0268266_100236235 | 476 |
| 700 | 3300028800 | Ga0265338_10093773 | Ga0265338_100937732 | 476 |
| 701 | 3300029957 | Ga0265324_10000340 | Ga0265324_1000034012 | 476 |
| 702 | 3300029957 | Ga0265324_10024393 | Ga0265324_100243932 | 476 |
| 703 | 3300030521 | Ga0307511_10000022 | Ga0307511_1000002231 | 476 |
| 704 | 3300031250 | Ga0265331_10003188 | Ga0265331_1000318811 | 476 |
| 705 | 3300031251 | Ga0265327_10001333 | Ga0265327_100013336 | 476 |
| 706 | 3300031711 | Ga0265314_10000134 | Ga0265314_1000013411 | 476 |
| 707 | 3300031711 | Ga0265314_10020023 | Ga0265314_100200235 | 476 |
| 708 | 3300032002 | Ga0307416_100050238 | Ga0307416_1000502381 | 476 |
| 709 | 3300033179 | Ga0307507_10047428 | Ga0307507_100474282 | 476 |
| 710 | 3300048907 | Ga0496104_0085381 | Ga0496104_0085381_353_1801 | 476 |
| 711 | 3300048913 | Ga0496110_0047848 | Ga0496110_0047848_2145_3593 | 476 |
| 712 | 3300050508 | nmdc:mga09592_84091_c1 | nmdc:mga09592_84091_c1_904_2385 | 476 |
| 713 | 3300050510 | nmdc:mga06r32_82324_c1 | nmdc:mga06r32_82324_c1_168_1649 | 476 |
| 714 | 3300053090 | Ga0500646_0000154 | Ga0500646_0000154_17306_18826 | 476 |
| 715 | 3300005338 | Ga0068868_100160142 | Ga0068868_1001601421 | 477 |
| 716 | 3300005543 | Ga0070672_100173255 | Ga0070672_1001732551 | 477 |
| 717 | 3300005548 | Ga0070665_100252100 | Ga0070665_1002521002 | 477 |
| 718 | 3300005616 | Ga0068852_100002180 | Ga0068852_1000021807 | 477 |
| 719 | 3300005616 | Ga0068852_100022134 | Ga0068852_1000221342 | 477 |
| 720 | 3300005719 | Ga0068861_100050758 | Ga0068861_1000507581 | 477 |
| 721 | 3300005842 | Ga0068858_100084998 | Ga0068858_1000849982 | 477 |
| 722 | 3300006237 | Ga0097621_100041534 | Ga0097621_1000415342 | 477 |
| 723 | 3300006358 | Ga0068871_100012101 | Ga0068871_1000121016 | 477 |
| 724 | 3300006846 | Ga0075430_100005824 | Ga0075430_1000058246 | 477 |
| 725 | 3300006847 | Ga0075431_100090819 | Ga0075431_1000908191 | 477 |
| 726 | 3300009093 | Ga0105240_10002549 | Ga0105240_1000254922 | 477 |
| 727 | 3300009093 | Ga0105240_10006370 | Ga0105240_100063709 | 477 |
| 728 | 3300009094 | Ga0111539_10125488 | Ga0111539_101254883 | 477 |
| 729 | 3300009148 | Ga0105243_10034506 | Ga0105243_100345062 | 477 |
| 730 | 3300013100 | Ga0157373_10042627 | Ga0157373_100426272 | 477 |
| 731 | 3300014745 | Ga0157377_10055886 | Ga0157377_100558862 | 477 |
| 732 | 3300025321 | Ga0207656_10002178 | Ga0207656_100021786 | 477 |
| 733 | 3300025893 | Ga0207682_10002916 | Ga0207682_100029163 | 477 |
| 734 | 3300025899 | Ga0207642_10038230 | Ga0207642_100382302 | 477 |
| 735 | 3300025907 | Ga0207645_10016845 | Ga0207645_100168454 | 477 |
| 736 | 3300025908 | Ga0207643_10018377 | Ga0207643_100183772 | 477 |
| 737 | 3300025913 | Ga0207695_10001571 | Ga0207695_1000157114 | 477 |
| 738 | 3300025913 | Ga0207695_10241708 | Ga0207695_102417081 | 477 |
| 739 | 3300025925 | Ga0207650_10034544 | Ga0207650_100345443 | 477 |
| 740 | 3300025933 | Ga0207706_10067903 | Ga0207706_100679032 | 477 |
| 741 | 3300025941 | Ga0207711_10192370 | Ga0207711_101923702 | 477 |
| 742 | 3300025972 | Ga0207668_10067417 | Ga0207668_100674172 | 477 |
| 743 | 3300026075 | Ga0207708_10015389 | Ga0207708_100153894 | 477 |
| 744 | 3300026089 | Ga0207648_10007583 | Ga0207648_100075838 | 477 |
| 745 | 3300026095 | Ga0207676_10008539 | Ga0207676_100085394 | 477 |
| 746 | 3300026116 | Ga0207674_10095295 | Ga0207674_100952952 | 477 |
| 747 | 3300026142 | Ga0207698_10000462 | Ga0207698_1000046211 | 477 |
| 748 | 3300026142 | Ga0207698_10000553 | Ga0207698_100005532 | 477 |
| 749 | 3300028577 | Ga0265318_10001430 | Ga0265318_100014303 | 477 |
| 750 | 3300031239 | Ga0265328_10002460 | Ga0265328_100024603 | 477 |
| 751 | 3300031242 | Ga0265329_10004482 | Ga0265329_100044823 | 477 |
| 752 | 3300045051 | Ga0451576_0000147 | Ga0451576_0000147_158449_159945 | 477 |
| 753 | 3300048907 | Ga0496104_0019038 | Ga0496104_0019038_4374_5816 | 477 |
| 754 | 3300048913 | Ga0496110_0070412 | Ga0496110_0070412_121_1563 | 477 |
| 755 | 3300048919 | Ga0496116_0007586 | Ga0496116_0007586_2597_4048 | 477 |
| 756 | 3300048924 | Ga0496121_0099040 | Ga0496121_0099040_337_1800 | 477 |
| 757 | 3300048925 | Ga0496122_0006420 | Ga0496122_0006420_6171_7622 | 477 |
| 758 | 3300048926 | Ga0496123_0005186 | Ga0496123_0005186_5641_7092 | 477 |
| 759 | 3300049571 | Ga0501034_0008163 | Ga0501034_0008163_111_1550 | 477 |
| 760 | 3300049573 | Ga0501037_0020623 | Ga0501037_0020623_968_2413 | 477 |
| 761 | 3300049573 | Ga0501037_0061841 | Ga0501037_0061841_205_1650 | 477 |
| 762 | 3300049574 | Ga0501038_0084344 | Ga0501038_0084344_1175_2620 | 477 |
| 763 | 3300049575 | Ga0501039_0005040 | Ga0501039_0005040_2288_3733 | 477 |
| 764 | 3300049575 | Ga0501039_0075842 | Ga0501039_0075842_646_2100 | 477 |
| 765 | 3300049578 | Ga0501042_0053358 | Ga0501042_0053358_654_2099 | 477 |
| 766 | 3300049580 | Ga0501046_0020030 | Ga0501046_0020030_3903_5348 | 477 |
| 767 | 3300049581 | Ga0501047_0160923 | Ga0501047_0160923_68_1507 | 477 |
| 768 | 3300049582 | Ga0501048_0045866 | Ga0501048_0045866_854_2299 | 477 |
| 769 | 3300050510 | nmdc:mga06r32_111951_c1 | nmdc:mga06r32_111951_c1_1208_2650 | 477 |
| 770 | iso_pu_bacteria | 2521172590 | 2521560947 | 477 |
| 771 | iso_pu_bacteria | 2547132512 | 2548846380 | 477 |
| 772 | iso_pu_bacteria | 2551306416 | 2553006168 | 477 |
| 773 | iso_pu_bacteria | 2687453341 | 2688391132 | 477 |
| 774 | iso_pu_bacteria | 2765235838 | 2765567376 | 477 |
| 775 | iso_pu_bacteria | 2808606386 | 2808985031 | 477 |
| 776 | iso_pu_bacteria | 2808606415 | 2809132178 | 477 |
| 777 | iso_pu_bacteria | 2808606419 | 2809151803 | 477 |
| 778 | iso_pu_bacteria | 2818991449 | 2819617332 | 477 |
| 779 | iso_pu_bacteria | 2839094727 | 2839095282 | 477 |
| 780 | iso_pu_bacteria | 2852618963 | 2852621911 | 477 |
| 781 | iso_pu_bacteria | 2904439833 | 2904442434 | 477 |
| 782 | iso_pu_bacteria | 2904530477 | 2904533701 | 477 |
| 783 | iso_pu_bacteria | 2904584206 | 2904586658 | 477 |
| 784 | iso_pu_bacteria | 2904589729 | 2904591528 | 477 |
| 785 | iso_pu_bacteria | 2904601388 | 2904602334 | 477 |
| 786 | iso_pu_bacteria | 2919046199 | 2919050681 | 477 |
| 787 | iso_pu_bacteria | 2919079590 | 2919083341 | 477 |
| 788 | iso_pu_bacteria | 2923510766 | 2923514786 | 477 |
| 789 | iso_pu_bacteria | 2928130867 | 2928133709 | 477 |
| 790 | 3300003187 | JGI25151J46595_10002295 | JGI25151J46595_100022954 | 478 |
| 791 | 3300003771 | Ga0055526_1003073 | Ga0055526_10030734 | 478 |
| 792 | 3300003771 | Ga0055526_1004090 | Ga0055526_10040904 | 478 |
| 793 | 3300003771 | Ga0055526_1006100 | Ga0055526_10061004 | 478 |
| 794 | 3300003773 | Ga0055537_1001420 | Ga0055537_10014207 | 478 |
| 795 | 3300003775 | Ga0055524_1000642 | Ga0055524_10006429 | 478 |
| 796 | 3300003775 | Ga0055524_1006682 | Ga0055524_10066823 | 478 |
| 797 | 3300003781 | Ga0055536_1000094 | Ga0055536_100009416 | 478 |
| 798 | 3300003781 | Ga0055536_1000110 | Ga0055536_100011062 | 478 |
| 799 | 3300003784 | Ga0055534_1000656 | Ga0055534_100065611 | 478 |
| 800 | 3300003784 | Ga0055534_1001751 | Ga0055534_10017514 | 478 |
| 801 | 3300005614 | Ga0068856_100150656 | Ga0068856_1001506561 | 478 |
| 802 | 3300006948 | Ga0099826_10000014 | Ga0099826_10000014198 | 478 |
| 803 | 3300014497 | Ga0182008_10013237 | Ga0182008_100132373 | 478 |
| 804 | 3300025233 | Ga0209437_100512 | Ga0209437_10051219 | 478 |
| 805 | 3300025263 | Ga0209565_1000045 | Ga0209565_100004529 | 478 |
| 806 | 3300025263 | Ga0209565_1010345 | Ga0209565_10103454 | 478 |
| 807 | 3300025291 | Ga0209675_1000661 | Ga0209675_10006614 | 478 |
| 808 | 3300025292 | Ga0209676_1000064 | Ga0209676_1000064239 | 478 |
| 809 | 3300025294 | Ga0209025_1000371 | Ga0209025_10003714 | 478 |
| 810 | 3300025294 | Ga0209025_1001907 | Ga0209025_10019074 | 478 |
| 811 | 3300025294 | Ga0209025_1004682 | Ga0209025_10046829 | 478 |
| 812 | 3300025294 | Ga0209025_1008213 | Ga0209025_10082135 | 478 |
| 813 | 3300025295 | Ga0209564_1001969 | Ga0209564_10019699 | 478 |
| 814 | 3300025295 | Ga0209564_1003010 | Ga0209564_10030104 | 478 |
| 815 | 3300025295 | Ga0209564_1003370 | Ga0209564_10033704 | 478 |
| 816 | 3300025297 | Ga0209758_1016413 | Ga0209758_10164134 | 478 |
| 817 | 3300025299 | Ga0209256_1000287 | Ga0209256_10002875 | 478 |
| 818 | 3300025299 | Ga0209256_1000835 | Ga0209256_100083529 | 478 |
| 819 | 3300025303 | Ga0209051_1016564 | Ga0209051_10165643 | 478 |
| 820 | 3300025303 | Ga0209051_1020107 | Ga0209051_10201074 | 478 |
| 821 | 3300025949 | Ga0207667_10023865 | Ga0207667_100238652 | 478 |
| 822 | 3300026078 | Ga0207702_10116246 | Ga0207702_101162461 | 478 |
| 823 | 3300027666 | Ga0209282_1000048 | Ga0209282_100004864 | 478 |
| 824 | 3300042876 | Ga0451577_0008429 | Ga0451577_0008429_78_1583 | 478 |
| 825 | 3300042876 | Ga0451577_0008841 | Ga0451577_0008841_4237_5742 | 478 |
| 826 | 3300042876 | Ga0451577_0018842 | Ga0451577_0018842_4645_6198 | 478 |
| 827 | 3300044712 | Ga0453684_0036639 | Ga0453684_0036639_407_1960 | 478 |
| 828 | 3300045051 | Ga0451576_0000006 | Ga0451576_0000006_185724_187232 | 478 |
| 829 | 3300045051 | Ga0451576_0000096 | Ga0451576_0000096_42976_44529 | 478 |
| 830 | 3300045051 | Ga0451576_0002503 | Ga0451576_0002503_13459_14964 | 478 |
| 831 | 3300045051 | Ga0451576_0002526 | Ga0451576_0002526_13501_15006 | 478 |
| 832 | 3300046500 | Ga0495596_0001761 | Ga0495596_0001761_1709_3145 | 478 |
| 833 | 3300048924 | Ga0496121_0044676 | Ga0496121_0044676_1069_2505 | 478 |
| 834 | 3300049571 | Ga0501034_0105734 | Ga0501034_0105734_949_2445 | 478 |
| 835 | 3300049575 | Ga0501039_0036031 | Ga0501039_0036031_831_2321 | 478 |
| 836 | 3300001915 | JGI24741J21665_1000120 | JGI24741J21665_10001202 | 479 |
| 837 | 3300002705 | JGI25156J39149_1003165 | JGI25156J39149_10031654 | 479 |
| 838 | 3300002738 | JGI25154J39366_1001626 | JGI25154J39366_10016262 | 479 |
| 839 | 3300003578 | Ga0006562J51391_1127957 | Ga0006562J51391_11279573 | 479 |
| 840 | 3300003751 | Ga0055538_1000110 | Ga0055538_100011027 | 479 |
| 841 | 3300003752 | Ga0055539_1000094 | Ga0055539_100009490 | 479 |
| 842 | 3300003752 | Ga0055539_1000159 | Ga0055539_100015927 | 479 |
| 843 | 3300003756 | Ga0055533_1000161 | Ga0055533_100016127 | 479 |
| 844 | 3300003758 | Ga0055532_1000006 | Ga0055532_1000006170 | 479 |
| 845 | 3300003759 | Ga0055525_1000214 | Ga0055525_100021427 | 479 |
| 846 | 3300003759 | Ga0055525_1000323 | Ga0055525_100032310 | 479 |
| 847 | 3300003760 | Ga0055527_1003007 | Ga0055527_10030072 | 479 |
| 848 | 3300003761 | Ga0055535_1000004 | Ga0055535_1000004170 | 479 |
| 849 | 3300003762 | Ga0055542_1000940 | Ga0055542_100094011 | 479 |
| 850 | 3300003763 | Ga0055529_1000022 | Ga0055529_1000022151 | 479 |
| 851 | 3300003841 | Ga0055541_1000105 | Ga0055541_100010527 | 479 |
| 852 | 3300003841 | Ga0055541_1000464 | Ga0055541_10004643 | 479 |
| 853 | 3300005344 | Ga0070661_100000012 | Ga0070661_10000001299 | 479 |
| 854 | 3300005366 | Ga0070659_100006729 | Ga0070659_1000067296 | 479 |
| 855 | 3300005455 | Ga0070663_100000003 | Ga0070663_100000003224 | 479 |
| 856 | 3300005563 | Ga0068855_100002313 | Ga0068855_10000231316 | 479 |
| 857 | 3300005564 | Ga0070664_100000003 | Ga0070664_100000003151 | 479 |
| 858 | 3300005577 | Ga0068857_100004739 | Ga0068857_1000047398 | 479 |
| 859 | 3300005578 | Ga0068854_100000063 | Ga0068854_10000006357 | 479 |
| 860 | 3300005578 | Ga0068854_100014150 | Ga0068854_1000141504 | 479 |
| 861 | 3300005614 | Ga0068856_100000256 | Ga0068856_10000025645 | 479 |
| 862 | 3300005834 | Ga0068851_10056120 | Ga0068851_100561201 | 479 |
| 863 | 3300009036 | Ga0105244_10036312 | Ga0105244_100363122 | 479 |
| 864 | 3300009545 | Ga0105237_10014545 | Ga0105237_100145454 | 479 |
| 865 | 3300009545 | Ga0105237_10040376 | Ga0105237_100403762 | 479 |
| 866 | 3300009551 | Ga0105238_10000537 | Ga0105238_1000053715 | 479 |
| 867 | 3300010375 | Ga0105239_10003482 | Ga0105239_1000348213 | 479 |
| 868 | 3300013100 | Ga0157373_10037002 | Ga0157373_100370023 | 479 |
| 869 | 3300013102 | Ga0157371_10000755 | Ga0157371_1000075524 | 479 |
| 870 | 3300013104 | Ga0157370_10000921 | Ga0157370_1000092110 | 479 |
| 871 | 3300013105 | Ga0157369_10026862 | Ga0157369_100268623 | 479 |
| 872 | 3300013307 | Ga0157372_10002524 | Ga0157372_100025247 | 479 |
| 873 | 3300015261 | Ga0182006_1002915 | Ga0182006_10029157 | 479 |
| 874 | 3300015262 | Ga0182007_10009681 | Ga0182007_100096813 | 479 |
| 875 | 3300020610 | Ga0154015_1057316 | Ga0154015_10573168 | 479 |
| 876 | 3300021361 | Ga0213872_10002967 | Ga0213872_100029677 | 479 |
| 877 | 3300025224 | Ga0209784_100035 | Ga0209784_100035223 | 479 |
| 878 | 3300025224 | Ga0209784_100223 | Ga0209784_10022316 | 479 |
| 879 | 3300025224 | Ga0209784_100389 | Ga0209784_10038910 | 479 |
| 880 | 3300025225 | Ga0209566_100002 | Ga0209566_100002899 | 479 |
| 881 | 3300025225 | Ga0209566_100040 | Ga0209566_100040223 | 479 |
| 882 | 3300025225 | Ga0209566_100597 | Ga0209566_10059710 | 479 |
| 883 | 3300025225 | Ga0209566_102325 | Ga0209566_1023252 | 479 |
| 884 | 3300025226 | Ga0209674_100010 | Ga0209674_100010238 | 479 |
| 885 | 3300025226 | Ga0209674_100050 | Ga0209674_100050173 | 479 |
| 886 | 3300025226 | Ga0209674_100057 | Ga0209674_100057223 | 479 |
| 887 | 3300025226 | Ga0209674_100262 | Ga0209674_10026228 | 479 |
| 888 | 3300025228 | Ga0209672_100111 | Ga0209672_10011184 | 479 |
| 889 | 3300025229 | Ga0209147_100015 | Ga0209147_100015373 | 479 |
| 890 | 3300025230 | Ga0209563_100004 | Ga0209563_100004310 | 479 |
| 891 | 3300025230 | Ga0209563_100026 | Ga0209563_100026438 | 479 |
| 892 | 3300025230 | Ga0209563_100059 | Ga0209563_100059223 | 479 |
| 893 | 3300025242 | Ga0209258_100021 | Ga0209258_100021373 | 479 |
| 894 | 3300025246 | Ga0209646_1000055 | Ga0209646_1000055206 | 479 |
| 895 | 3300025253 | Ga0209677_100007 | Ga0209677_100007898 | 479 |
| 896 | 3300025253 | Ga0209677_100036 | Ga0209677_100036223 | 479 |
| 897 | 3300025253 | Ga0209677_102096 | Ga0209677_1020962 | 479 |
| 898 | 3300025254 | Ga0209148_1000109 | Ga0209148_100010998 | 479 |
| 899 | 3300025256 | Ga0209759_1001940 | Ga0209759_10019404 | 479 |
| 900 | 3300025272 | Ga0209455_1000028 | Ga0209455_1000028373 | 479 |
| 901 | 3300025901 | Ga0207688_10042921 | Ga0207688_100429212 | 479 |
| 902 | 3300025913 | Ga0207695_10003997 | Ga0207695_1000399716 | 479 |
| 903 | 3300025913 | Ga0207695_10021978 | Ga0207695_100219784 | 479 |
| 904 | 3300025914 | Ga0207671_10006562 | Ga0207671_100065627 | 479 |
| 905 | 3300025920 | Ga0207649_10000408 | Ga0207649_1000040815 | 479 |
| 906 | 3300025924 | Ga0207694_10000384 | Ga0207694_1000038416 | 479 |
| 907 | 3300025932 | Ga0207690_10006028 | Ga0207690_100060283 | 479 |
| 908 | 3300025945 | Ga0207679_10000007 | Ga0207679_1000000768 | 479 |
| 909 | 3300025949 | Ga0207667_10002083 | Ga0207667_1000208316 | 479 |
| 910 | 3300025981 | Ga0207640_10000132 | Ga0207640_1000013234 | 479 |
| 911 | 3300025981 | Ga0207640_10062780 | Ga0207640_100627801 | 479 |
| 912 | 3300026067 | Ga0207678_10000011 | Ga0207678_10000011100 | 479 |
| 913 | 3300026078 | Ga0207702_10000018 | Ga0207702_1000001811 | 479 |
| 914 | 3300026116 | Ga0207674_10001844 | Ga0207674_1000184415 | 479 |
| 915 | 3300026116 | Ga0207674_10086447 | Ga0207674_100864472 | 479 |
| 916 | 3300026142 | Ga0207698_10081542 | Ga0207698_100815423 | 479 |
| 917 | 3300031239 | Ga0265328_10000447 | Ga0265328_1000044711 | 479 |
| 918 | 3300031250 | Ga0265331_10000070 | Ga0265331_1000007020 | 479 |
| 919 | 3300031251 | Ga0265327_10000156 | Ga0265327_10000156125 | 479 |
| 920 | 3300031251 | Ga0265327_10000706 | Ga0265327_1000070626 | 479 |
| 921 | 3300031251 | Ga0265327_10006520 | Ga0265327_100065207 | 479 |
| 922 | 3300037418 | Ga0395900_0058716 | Ga0395900_0058716_211_1650 | 479 |
| 923 | 3300039447 | Ga0436361_0100960 | Ga0436361_0100960_1209_2666 | 479 |
| 924 | 3300044693 | Ga0466961_0001701 | Ga0466961_0001701_2654_4093 | 479 |
| 925 | 3300044735 | Ga0466968_0045031 | Ga0466968_0045031_368_1807 | 479 |
| 926 | 3300044765 | Ga0466970_0002355 | Ga0466970_0002355_1156_2595 | 479 |
| 927 | 3300044842 | Ga0466957_0047230 | Ga0466957_0047230_414_1853 | 479 |
| 928 | 3300045049 | Ga0466959_0016980 | Ga0466959_0016980_2612_4051 | 479 |
| 929 | 3300045051 | Ga0451576_0004790 | Ga0451576_0004790_7053_8540 | 479 |
| 930 | 3300045051 | Ga0451576_0021263 | Ga0451576_0021263_4030_5520 | 479 |
| 931 | 3300045976 | Ga0466967_0005183 | Ga0466967_0005183_4872_6311 | 479 |
| 932 | 3300049575 | Ga0501039_0052723 | Ga0501039_0052723_89_1552 | 479 |
| 933 | 3300049578 | Ga0501042_0045024 | Ga0501042_0045024_51_1514 | 479 |
| 934 | 3300049580 | Ga0501046_0065302 | Ga0501046_0065302_168_1631 | 479 |
| 935 | 3300049582 | Ga0501048_0117174 | Ga0501048_0117174_396_1859 | 479 |
| 936 | 3300049822 | Ga0501035_0008524 | Ga0501035_0008524_5921_7384 | 479 |
| 937 | 3300049822 | Ga0501035_0032289 | Ga0501035_0032289_2790_4274 | 479 |
| 938 | 3300061719 | Ga0466962_0005722 | Ga0466962_0005722_3268_4707 | 479 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8hdh-assembly1.cif.gz_A | structure of human sglt2-map17 complex with canagliflozin | 0.8683 | 2 | 461 |
| 8hez-assembly1.cif.gz_A | structure of human sglt2-map17 complex with dapagliflozin | 0.8554 | 2 | 461 |
| 7vsi-assembly1.cif.gz_A | structure of human sglt2-map17 complex bound with empagliflozin | 0.8528 | 2 | 467 |
| 7wmv-assembly1.cif.gz_A | structure of human sglt1-map17 complex bound with lx2761 | 0.8498 | 2 | 461 |
| 7ynj-assembly1.cif.gz_A | structure of human sglt2-map17 complex bound with substrate amg in the occluded conformation | 0.8395 | 5 | 461 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FWY7_34_506_1.20.1730.10 | Mainly Alpha;Up-down Bundle;Sodium/glucose cotransporter;Sodium/glucose cotransporter | 0.8862 | 19 | 460 | 1.20.1730.10 |
| af_Q1EHB4_32_596_1.20.1730.10 | Mainly Alpha;Up-down Bundle;Sodium/glucose cotransporter;Sodium/glucose cotransporter | 0.8821 | 26 | 461 | 1.20.1730.10 |
| af_P32705_52_542_1.20.1730.10 | Mainly Alpha;Up-down Bundle;Sodium/glucose cotransporter;Sodium/glucose cotransporter | 0.8806 | 19 | 460 | 1.20.1730.10 |
| af_P07117_23_496_1.20.1730.10 | Mainly Alpha;Up-down Bundle;Sodium/glucose cotransporter;Sodium/glucose cotransporter | 0.877 | 20 | 461 | 1.20.1730.10 |
| af_Q9VE46_30_497_1.20.1730.10 | Mainly Alpha;Up-down Bundle;Sodium/glucose cotransporter;Sodium/glucose cotransporter | 0.8757 | 26 | 460 | 1.20.1730.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A258M527-F1-model_v4 | Sodium:solute symporter | 0.9936 | 1 | 459 |
GO:0005886
GO:0022857 |
| AF-A0A5S9BP82-F1-model_v4 | deleted | 0.9898 | 1 | 468 |
|
| AF-A0A258M527-F1-model_v4 | Sodium:solute symporter | 0.9893 | 1 | 459 |
GO:0005886
GO:0022857 |
| AF-A0A7X0CFM7-F1-model_v4 | SSS family transporter | 0.9876 | 2 | 469 |
GO:0005886
GO:0022857 |
| AF-A0A819B154-F1-model_v4 | ABC transporter domain-containing protein | 0.9652 | 18 | 470 |
GO:0005524
GO:0016887 GO:0019867 GO:0022857 GO:0043190 GO:0046942 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar