F486252

General Info

Members Datasets Scaffolds Average Seq Length
938 524 883 479

Family's Representative Sequence

Representative Sequence 3300025901|Ga0207688_10042921|Ga0207688_100429212
Length 523
Sequence MLLWFVIIYWIISVGIGLWAAMRVKNTADYAVAGRSLPLYIVTATVFATWFGSETVLGIPATFLREGLGGVIADPFGSSMCLILVGLFFARPLYRMQLLTIGDFYRNKYGRTVETLTTLCIVLSYLGWVAAQISALGLVFHVVSEGAMSQSTGMIVGASTVLIYTMWGGMWAVAITDFLQMIIIVIGMLYIGWDVSQLAGGVTAVVSHAADAGKFATFLPEASLAGILGFTAAAITMMLGSIPQQDVFQRVASSKDERTAGRASILGGCLYFCFAFIPMFLAYSATLIDPQLVQKLIDGDKQSQLILPNMILNHAPLFAQVMFFGALLSAIKSCASATLLAPSVTFTENILRPAFKHLGDQQLLRLMRIVVLCFTVLVTLFALNSQLSIYKMVENAYKVTLVSAFVPLAFGLYWKRANTQGALAAIVLGLATWIWLEILAPTAVCPPQLAGFLAALFGMIAGSLAPLVIRHQPASHAGLMTSSVRIRSASVTVASWSSSFEPKCAYRPLLLMPMAAARLPACV

Samples

Sample ID Description Type Environment
1 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
2 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
3 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
4 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
5 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
6 2547132512 Azospira oryzae 6a3 Isolate Unclassified
7 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
8 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
9 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
10 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
11 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
12 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
13 2643221556 Massilia sp. Root1485 Isolate Unclassified
14 2643221585 Pelomonas sp. Root662 Isolate Unclassified
15 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
16 2643221656 Pelomonas sp. Root405 Isolate Unclassified
17 2643221684 Massilia sp. Root133 Isolate Unclassified
18 2687453341 Pirellula sp. SH-Sr6A Isolate Unclassified
19 2738541337 Pelomonas sp. BT06 Isolate Unclassified
20 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
21 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
22 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
23 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
24 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
25 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
26 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
27 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
28 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
29 2843690924 Chromobacterium rhizoryzae JP2-74 Isolate Rhizosphere
30 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
31 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
32 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
33 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
34 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
35 2885266251 Ralstonia sp. SET104 Isolate Nodule
36 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
37 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
38 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
39 2901300506 Cupriavidus sp. UYMSc13B Isolate Unclassified
40 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
41 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
42 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
43 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
44 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
45 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
46 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
47 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
48 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
49 2928058823 Ralstonia sp. 1138 Isolate Unclassified
50 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
51 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
52 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
53 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
54 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
55 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
56 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
57 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
58 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
59 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
60 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
61 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
62 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
63 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
64 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
65 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
66 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
67 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
68 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
69 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
70 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
71 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
72 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
73 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
74 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
75 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
76 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
77 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
78 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
79 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
80 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
81 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
82 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
83 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
84 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
85 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
86 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
87 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
88 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
89 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
90 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
91 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
92 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
93 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
94 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
95 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
96 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
97 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
98 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
99 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
100 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
101 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
102 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
103 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
104 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
105 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
106 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
107 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
108 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
109 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
110 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
111 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
112 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
113 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
114 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
115 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
116 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
117 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
118 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
119 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
120 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
121 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
122 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
123 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
124 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
125 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
126 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
127 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
128 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
129 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
130 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
131 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
132 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
133 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
134 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
135 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
136 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
137 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
138 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
139 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
140 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
141 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
142 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
143 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
144 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
145 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
146 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
147 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
148 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
149 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
150 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
151 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
152 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
153 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
154 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
155 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
156 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
157 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
158 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
159 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
160 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
161 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
162 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
163 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
164 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
165 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
166 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
167 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
168 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
169 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
170 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
171 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
172 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
173 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
174 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
175 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
176 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
177 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
178 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
179 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
180 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
181 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
182 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
183 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
184 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
185 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
186 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
187 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
188 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
189 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
190 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
191 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
192 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
193 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
194 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
195 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
196 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
197 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
198 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
199 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
200 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
201 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
202 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
203 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
204 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
205 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
206 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
207 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
208 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
209 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
210 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
211 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
212 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
213 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
214 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
257 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
258 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
261 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
262 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
263 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
264 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
265 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
267 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
268 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
269 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
270 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
271 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
272 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
273 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
274 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
275 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
276 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
277 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
278 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
279 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
280 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
281 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
282 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
283 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
284 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
285 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
286 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
287 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
288 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
289 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
290 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
291 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
292 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
293 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
294 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
295 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
296 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
297 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
298 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
299 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
300 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
301 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
302 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
303 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
304 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
305 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
306 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
307 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
308 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
309 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
310 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
311 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
312 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
313 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
314 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
315 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
316 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
317 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
318 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
319 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
320 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
321 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
322 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
323 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
324 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
325 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
326 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
327 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
328 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
329 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
330 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
331 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
332 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
333 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
334 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
335 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
336 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
337 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
338 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
339 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
340 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
341 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
342 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
343 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
344 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
345 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
346 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
347 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
348 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
349 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
350 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
351 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
352 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
353 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
354 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
355 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
356 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
357 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
358 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
359 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
360 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
361 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
362 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
363 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
364 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
365 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
366 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
367 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
368 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
369 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
370 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
371 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
372 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
373 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
374 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
375 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
376 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
377 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
378 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
379 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
380 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
381 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
382 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
383 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
384 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
385 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
386 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
387 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
388 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
389 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
390 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
391 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
392 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
393 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
394 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
395 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
396 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
397 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
398 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
399 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
400 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
401 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
402 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
403 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
404 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
405 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
406 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
407 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
408 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
409 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
410 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
411 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
412 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
413 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
414 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
415 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
416 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
417 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
418 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
419 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
420 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
421 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
422 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
423 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
424 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
425 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
426 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
427 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
428 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
429 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
430 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
431 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
432 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
433 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
434 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
435 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
436 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
437 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
438 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
439 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
440 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
441 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
442 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
443 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
444 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
445 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
446 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
447 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
448 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
449 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
450 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
451 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
452 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
453 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
454 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
455 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
456 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
457 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
458 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
459 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
460 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
461 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
462 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
463 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
464 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
465 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
466 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
467 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
468 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
469 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
470 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
471 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
472 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
473 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
474 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
475 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
476 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
477 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
478 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
479 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
480 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
481 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
482 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
483 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
484 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
485 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
486 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
487 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
488 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
489 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
490 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
491 3300049774 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought Metagenome Rhizosphere
492 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
493 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
494 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
495 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
496 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
497 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
498 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
499 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
500 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
501 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
502 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
503 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
504 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
505 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
506 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
507 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
508 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
509 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
510 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
511 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
512 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
513 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
514 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
515 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
516 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
517 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
518 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
519 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
520 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
521 639633007 Azoarcus olearius BH72 Isolate Unclassified
522 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
523 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere
524 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.92
Metatranscriptomes 0.21
Isolates 5.86

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.28
Nodule 1.17
Rhizoplane 1.6
Rhizosphere 80.6
Stem 0
Stem Tuber 0
Unclassified 7.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1000120 3300001915 Bacteria 21131
2 JGI25155J39150_1000205 3300002704 Bacteria 23971
3 JGI25155J39150_1000224 3300002704 Bacteria 22214
4 JGI25155J39150_1000386 3300002704 Bacteria 12552
5 JGI25156J39149_1000357 3300002705 Bacteria 29554
6 JGI25156J39149_1002757 3300002705 Bacteria 6103
7 JGI25156J39149_1003165 3300002705 Bacteria 5528
8 JGI25154J39366_1000298 3300002738 Bacteria 29516
9 JGI25154J39366_1000314 3300002738 Bacteria 28089
10 JGI25154J39366_1001626 3300002738 Bacteria 7580
11 JGI25157J39369_1000262 3300002741 Bacteria 38795
12 JGI25157J39369_1000702 3300002741 Bacteria 18049
13 JGI25151J46595_10002295 3300003187 Bacteria 11698
14 rootH2_10038054 3300003320 Bacteria 8042
15 JGI26145J50221_1000448 3300003371 Bacteria 3576
16 Ga0006562J51391_1127957 3300003578 Bacteria 2566
17 Ga0055538_1000110 3300003751 Bacteria 64583
18 Ga0055539_1000094 3300003752 Bacteria 103196
19 Ga0055539_1000159 3300003752 Bacteria 64583
20 Ga0055533_1000161 3300003756 Bacteria 64583
21 Ga0055532_1000006 3300003758 Bacteria 451244
22 Ga0055532_1000059 3300003758 Bacteria 152948
23 Ga0055525_1000081 3300003759 Bacteria 161329
24 Ga0055525_1000214 3300003759 Bacteria 64583
25 Ga0055525_1000323 3300003759 Bacteria 37297
26 Ga0055527_1003007 3300003760 Bacteria 2632
27 Ga0055535_1000004 3300003761 Bacteria 451244
28 Ga0055542_1000940 3300003762 Bacteria 19156
29 Ga0055529_1000022 3300003763 Bacteria 320108
30 Ga0055526_1000651 3300003771 Bacteria 26844
31 Ga0055526_1003073 3300003771 Bacteria 10849
32 Ga0055526_1004090 3300003771 Bacteria 8916
33 Ga0055526_1006100 3300003771 Bacteria 6656
34 Ga0055537_1001420 3300003773 Bacteria 9394
35 Ga0055524_1000642 3300003775 Bacteria 24850
36 Ga0055524_1006682 3300003775 Bacteria 4983
37 Ga0055536_1000094 3300003781 Bacteria 76734
38 Ga0055536_1000110 3300003781 Bacteria 72378
39 Ga0055534_1000656 3300003784 Bacteria 17498
40 Ga0055534_1001751 3300003784 Bacteria 8196
41 Ga0055531_10000007 3300003794 Bacteria 225289
42 Ga0055541_1000105 3300003841 Bacteria 64583
43 Ga0055541_1000464 3300003841 Bacteria 11612
44 Ga0065704_10077577 3300005289 Bacteria 4689
45 Ga0065712_10096373 3300005290 Bacteria 2185
46 Ga0065707_10082548 3300005295 Bacteria 13907
47 Ga0070676_10008985 3300005328 Bacteria 5405
48 Ga0070683_100015466 3300005329 Bacteria 6704
49 Ga0070690_100001012 3300005330 Bacteria 14375
50 Ga0070690_100012031 3300005330 Bacteria 5079
51 Ga0070670_100000054 3300005331 Bacteria 127396
52 Ga0070670_100007425 3300005331 Bacteria 9309
53 Ga0070670_100024257 3300005331 Bacteria 5217
54 Ga0070677_10001872 3300005333 Bacteria 6654
55 Ga0068869_100124717 3300005334 Unclassified 1974
56 Ga0070666_10008897 3300005335 Bacteria 6245
57 Ga0070666_10015909 3300005335 Bacteria 4806
58 Ga0070682_100039419 3300005337 Bacteria 2903
59 Ga0070682_100078636 3300005337 Bacteria 2128
60 Ga0070682_100096002 3300005337 Bacteria 1948
61 Ga0068868_100045184 3300005338 Bacteria 3445
62 Ga0068868_100086366 3300005338 Bacteria 2522
63 Ga0068868_100160142 3300005338 Bacteria 1858
64 Ga0070660_100003556 3300005339 Bacteria 10762
65 Ga0070660_100004636 3300005339 Bacteria 9517
66 Ga0070660_100100823 3300005339 Bacteria 2287
67 Ga0070689_100000070 3300005340 Bacteria 61448
68 Ga0070689_100040742 3300005340 Bacteria 3562
69 Ga0070689_100042986 3300005340 Bacteria 3471
70 Ga0070691_10000598 3300005341 Bacteria 13822
71 Ga0070687_100013134 3300005343 Bacteria 3680
72 Ga0070661_100000012 3300005344 Bacteria 167998
73 Ga0070661_100005481 3300005344 Bacteria 8749
74 Ga0070668_100005970 3300005347 Bacteria 9034
75 Ga0070669_100000779 3300005353 Bacteria 23159
76 Ga0070669_100002303 3300005353 Bacteria 13840
77 Ga0070675_100013140 3300005354 Bacteria 6506
78 Ga0070671_100000037 3300005355 Bacteria 95248
79 Ga0070671_100053012 3300005355 Unclassified 3372
80 Ga0070674_100001339 3300005356 Bacteria 12993
81 Ga0070674_100006470 3300005356 Bacteria 6837
82 Ga0070673_100000190 3300005364 Bacteria 30180
83 Ga0070673_100001171 3300005364 Bacteria 15046
84 Ga0070673_100153218 3300005364 Bacteria 1954
85 Ga0070688_100000006 3300005365 Bacteria 92017
86 Ga0070659_100001082 3300005366 Bacteria 19884
87 Ga0070659_100001965 3300005366 Bacteria 14678
88 Ga0070659_100006729 3300005366 Bacteria 8311
89 Ga0070659_100053140 3300005366 Bacteria 3188
90 Ga0070667_100000002 3300005367 Bacteria 504831
91 Ga0070667_100121803 3300005367 Unclassified 2269
92 Ga0070701_10000161 3300005438 Bacteria 20802
93 Ga0070700_100000390 3300005441 Bacteria 22595
94 Ga0070700_100053233 3300005441 Bacteria 2525
95 Ga0070694_100029065 3300005444 Unclassified 3604
96 Ga0070694_100075087 3300005444 Bacteria 2338
97 Ga0070663_100000003 3300005455 Bacteria 260492
98 Ga0070663_100014804 3300005455 Bacteria 5014
99 Ga0070678_100075262 3300005456 Bacteria 2539
100 Ga0070662_100000059 3300005457 Bacteria 59672
101 Ga0070662_100018115 3300005457 Bacteria 4760
102 Ga0070662_100091708 3300005457 Bacteria 2282
103 Ga0070681_10032587 3300005458 Bacteria 5231
104 Ga0068867_100000588 3300005459 Bacteria 24065
105 Ga0070685_10000014 3300005466 Bacteria 120530
106 Ga0070685_10000693 3300005466 Bacteria 18235
107 Ga0070706_100035202 3300005467 Bacteria 4624
108 Ga0070707_100000032 3300005468 Bacteria 118776
109 Ga0070707_100082597 3300005468 Bacteria 3103
110 Ga0070707_100193040 3300005468 Bacteria 1986
111 Ga0070698_100097369 3300005471 Unclassified 2918
112 Ga0070699_100005467 3300005518 Bacteria 11135
113 Ga0070699_100049858 3300005518 Bacteria 3623
114 Ga0070684_100149560 3300005535 Unclassified 2115
115 Ga0070697_100035617 3300005536 Bacteria 4016
116 Ga0070697_100055367 3300005536 Bacteria 3225
117 Ga0070672_100000116 3300005543 Bacteria 40577
118 Ga0070672_100000683 3300005543 Bacteria 19990
119 Ga0070672_100173255 3300005543 Bacteria 1795
120 Ga0070686_100000897 3300005544 Bacteria 17311
121 Ga0070686_100002011 3300005544 Bacteria 11273
122 Ga0070695_100027086 3300005545 Bacteria 3548
123 Ga0070695_100077990 3300005545 Bacteria 2183
124 Ga0070696_100000917 3300005546 Bacteria 19177
125 Ga0070696_100002873 3300005546 Bacteria 11454
126 Ga0070665_100079228 3300005548 Bacteria 3291
127 Ga0070665_100252100 3300005548 Bacteria 1766
128 Ga0070704_100025964 3300005549 Bacteria 3863
129 Ga0070704_100131554 3300005549 Unclassified 1940
130 Ga0068855_100002313 3300005563 Bacteria 23555
131 Ga0068855_100296172 3300005563 Unclassified 1792
132 Ga0070664_100000003 3300005564 Bacteria 325604
133 Ga0070664_100002039 3300005564 Bacteria 16186
134 Ga0070664_100018224 3300005564 Bacteria 5762
135 Ga0068857_100004739 3300005577 Bacteria 11524
136 Ga0068857_100130134 3300005577 Bacteria 2270
137 Ga0068854_100000063 3300005578 Bacteria 77198
138 Ga0068854_100014150 3300005578 Bacteria 5253
139 Ga0068854_100028452 3300005578 Bacteria 3862
140 Ga0068856_100000256 3300005614 Bacteria 58184
141 Ga0068856_100150656 3300005614 Bacteria 2335
142 Ga0070702_100047359 3300005615 Bacteria 2442
143 Ga0068852_100002180 3300005616 Bacteria 13425
144 Ga0068852_100022134 3300005616 Bacteria 5092
145 Ga0068859_100046115 3300005617 Bacteria 4378
146 Ga0068859_100187125 3300005617 Bacteria 2154
147 Ga0068864_100000002 3300005618 Bacteria 658857
148 Ga0068866_10019056 3300005718 Bacteria 3116
149 Ga0068861_100050758 3300005719 Bacteria 3146
150 Ga0068861_100057108 3300005719 Unclassified 2981
151 Ga0068851_10056120 3300005834 Bacteria 2008
152 Ga0068858_100001596 3300005842 Bacteria 23124
153 Ga0068858_100003164 3300005842 Bacteria 16479
154 Ga0068858_100026292 3300005842 Bacteria 5410
155 Ga0068858_100084998 3300005842 Bacteria 2943
156 Ga0068860_100000844 3300005843 Bacteria 34309
157 Ga0068860_100014459 3300005843 Bacteria 7728
158 Ga0081455_10000900 3300005937 Bacteria 38337
159 Ga0081539_10042221 3300005985 Bacteria 2658
160 Ga0075363_100034682 3300006048 Bacteria 2635
161 Ga0075364_10051700 3300006051 Bacteria 2684
162 Ga0075432_10000012 3300006058 Bacteria 34480
163 Ga0075366_10008423 3300006195 Bacteria 5733
164 Ga0075366_10020793 3300006195 Bacteria 3809
165 Ga0075366_10036985 3300006195 Bacteria 2880
166 Ga0097621_100021171 3300006237 Bacteria 5024
167 Ga0097621_100021799 3300006237 Bacteria 4964
168 Ga0097621_100041534 3300006237 Bacteria 3702
169 Ga0097621_100173286 3300006237 Bacteria 1861
170 Ga0068871_100012101 3300006358 Bacteria 6350
171 Ga0068871_100019039 3300006358 Bacteria 5234
172 Ga0068871_100075038 3300006358 Bacteria 2791
173 Ga0075428_100051320 3300006844 Bacteria 4523
174 Ga0075430_100002760 3300006846 Bacteria 14668
175 Ga0075430_100005824 3300006846 Bacteria 10398
176 Ga0075431_100004053 3300006847 Bacteria 14278
177 Ga0075431_100021196 3300006847 Bacteria 6641
178 Ga0075431_100090819 3300006847 Bacteria 3152
179 Ga0075431_100092175 3300006847 Bacteria 3127
180 Ga0075433_10006279 3300006852 Bacteria 9383
181 Ga0075429_100028503 3300006880 Bacteria 4848
182 Ga0075429_100041774 3300006880 Bacteria 3993
183 Ga0068865_100003182 3300006881 Bacteria 9837
184 Ga0097620_100046114 3300006931 Bacteria 4378
185 Ga0097620_100187119 3300006931 Bacteria 2154
186 Ga0079104_1002487 3300006946 Bacteria 9833
187 Ga0099826_10000014 3300006948 Bacteria 258520
188 Ga0075435_100022656 3300007076 Bacteria 4847
189 Ga0075435_100054284 3300007076 Bacteria 3233
190 Ga0105244_10036312 3300009036 Bacteria 2582
191 Ga0105244_10063047 3300009036 Bacteria 1862
192 Ga0105240_10002549 3300009093 Bacteria 29203
193 Ga0105240_10006370 3300009093 Bacteria 17381
194 Ga0105240_10052544 3300009093 Bacteria 5121
195 Ga0105240_10067174 3300009093 Bacteria 4445
196 Ga0111539_10000106 3300009094 Bacteria 90149
197 Ga0111539_10006915 3300009094 Bacteria 14568
198 Ga0111539_10013844 3300009094 Bacteria 10084
199 Ga0111539_10125488 3300009094 Bacteria 3007
200 Ga0105245_10016534 3300009098 Bacteria 6437
201 Ga0105245_10067537 3300009098 Bacteria 3238
202 Ga0105247_10042854 3300009101 Bacteria 2772
203 Ga0114129_10003723 3300009147 Bacteria 21500
204 Ga0114129_10016942 3300009147 Bacteria 10375
205 Ga0114129_10020244 3300009147 Bacteria 9469
206 Ga0114129_10041544 3300009147 Bacteria 6479
207 Ga0114129_10081280 3300009147 Bacteria 4504
208 Ga0114129_10395888 3300009147 Bacteria 1821
209 Ga0105243_10001690 3300009148 Bacteria 19014
210 Ga0105243_10029824 3300009148 Bacteria 4197
211 Ga0105243_10034506 3300009148 Bacteria 3917
212 Ga0105243_10083206 3300009148 Bacteria 2618
213 Ga0105241_10021227 3300009174 Bacteria 4798
214 Ga0105242_10000115 3300009176 Bacteria 57986
215 Ga0105242_10000834 3300009176 Bacteria 23976
216 Ga0105242_10033981 3300009176 Bacteria 4087
217 Ga0105242_10156871 3300009176 Bacteria 1989
218 Ga0105248_10004494 3300009177 Bacteria 15438
219 Ga0105248_10020966 3300009177 Bacteria 7244
220 Ga0105248_10042075 3300009177 Bacteria 5124
221 Ga0105237_10014545 3300009545 Bacteria 8222
222 Ga0105237_10040376 3300009545 Bacteria 4706
223 Ga0105238_10000258 3300009551 Bacteria 59300
224 Ga0105238_10000537 3300009551 Bacteria 39712
225 Ga0105249_10107901 3300009553 Bacteria 2628
226 Ga0105239_10003482 3300010375 Bacteria 19261
227 Ga0105239_10012398 3300010375 Bacteria 9492
228 Ga0105246_10000428 3300011119 Bacteria 22446
229 Ga0157373_10037002 3300013100 Bacteria 3501
230 Ga0157373_10042627 3300013100 Bacteria 3243
231 Ga0157371_10000755 3300013102 Bacteria 37443
232 Ga0157370_10000921 3300013104 Bacteria 37306
233 Ga0157369_10026862 3300013105 Bacteria 6384
234 Ga0157369_10111531 3300013105 Bacteria 2907
235 Ga0157374_10003255 3300013296 Bacteria 13642
236 Ga0157374_10005053 3300013296 Bacteria 11065
237 Ga0157374_10110758 3300013296 Bacteria 2640
238 Ga0157374_10201938 3300013296 Bacteria 1947
239 Ga0157378_10005614 3300013297 Bacteria 10990
240 Ga0157378_10056594 3300013297 Bacteria 3495
241 Ga0163162_10013512 3300013306 Bacteria 7972
242 Ga0157372_10002524 3300013307 Bacteria 19852
243 Ga0157375_10072169 3300013308 Bacteria 3468
244 Ga0157375_10096306 3300013308 Bacteria 3032
245 Ga0163163_10004619 3300014325 Bacteria 11758
246 Ga0157380_10003948 3300014326 Bacteria 10238
247 Ga0157380_10033827 3300014326 Unclassified 3938
248 Ga0157380_10090109 3300014326 Bacteria 2529
249 Ga0182008_10013237 3300014497 Bacteria 4337
250 Ga0157377_10055886 3300014745 Bacteria 2240
251 Ga0157376_10005228 3300014969 Bacteria 9063
252 Ga0157376_10024880 3300014969 Bacteria 4708
253 Ga0182006_1002915 3300015261 Bacteria 9073
254 Ga0182007_10009681 3300015262 Bacteria 3865
255 Ga0154015_1057316 3300020610 Bacteria 23087
256 Ga0213872_10000093 3300021361 Bacteria 83513
257 Ga0213872_10002967 3300021361 Bacteria 9599
258 Ga0213872_10003726 3300021361 Bacteria 8334
259 Ga0213872_10027058 3300021361 Bacteria 2633
260 Ga0209435_100032 3300025206 Bacteria 153068
261 Ga0209435_100146 3300025206 Bacteria 23627
262 Ga0209784_100035 3300025224 Bacteria 299760
263 Ga0209784_100223 3300025224 Bacteria 38244
264 Ga0209784_100389 3300025224 Bacteria 20132
265 Ga0209566_100002 3300025225 Bacteria 2614868
266 Ga0209566_100040 3300025225 Bacteria 299760
267 Ga0209566_100597 3300025225 Bacteria 22638
268 Ga0209566_102325 3300025225 Bacteria 3632
269 Ga0209674_100010 3300025226 Bacteria 1038638
270 Ga0209674_100050 3300025226 Bacteria 341738
271 Ga0209674_100057 3300025226 Bacteria 299760
272 Ga0209674_100262 3300025226 Bacteria 42282
273 Ga0209672_100111 3300025228 Bacteria 94440
274 Ga0209147_100015 3300025229 Bacteria 565073
275 Ga0209147_100109 3300025229 Bacteria 153068
276 Ga0209563_100004 3300025230 Bacteria 1814108
277 Ga0209563_100015 3300025230 Bacteria 879901
278 Ga0209563_100026 3300025230 Bacteria 559453
279 Ga0209563_100059 3300025230 Bacteria 299760
280 Ga0209437_100512 3300025233 Bacteria 27460
281 Ga0209258_100021 3300025242 Bacteria 565073
282 Ga0209258_100190 3300025242 Bacteria 126878
283 Ga0209646_1000055 3300025246 Bacteria 271793
284 Ga0209646_1000113 3300025246 Bacteria 153068
285 Ga0209646_1000327 3300025246 Bacteria 36378
286 Ga0209026_1000102 3300025250 Bacteria 153068
287 Ga0209026_1003686 3300025250 Bacteria 4903
288 Ga0209677_100007 3300025253 Bacteria 1021332
289 Ga0209677_100036 3300025253 Bacteria 299760
290 Ga0209677_102096 3300025253 Bacteria 7876
291 Ga0209677_104484 3300025253 Bacteria 4003
292 Ga0209148_1000109 3300025254 Bacteria 204266
293 Ga0209759_1000104 3300025256 Bacteria 153068
294 Ga0209759_1001940 3300025256 Bacteria 10056
295 Ga0209759_1001952 3300025256 Bacteria 9947
296 Ga0209565_1000045 3300025263 Bacteria 226864
297 Ga0209565_1010345 3300025263 Bacteria 2315
298 Ga0209455_1000028 3300025272 Bacteria 565073
299 Ga0209455_1005292 3300025272 Bacteria 4021
300 Ga0209675_1000661 3300025291 Bacteria 24235
301 Ga0209676_1000064 3300025292 Bacteria 321700
302 Ga0209025_1000371 3300025294 Bacteria 94612
303 Ga0209025_1001907 3300025294 Bacteria 24289
304 Ga0209025_1004682 3300025294 Bacteria 11678
305 Ga0209025_1008213 3300025294 Bacteria 7550
306 Ga0209564_1001969 3300025295 Bacteria 18087
307 Ga0209564_1003010 3300025295 Bacteria 12070
308 Ga0209564_1003370 3300025295 Bacteria 11056
309 Ga0209758_1016413 3300025297 Bacteria 3763
310 Ga0209050_1010447 3300025298 Bacteria 4576
311 Ga0209256_1000287 3300025299 Bacteria 88526
312 Ga0209256_1000835 3300025299 Bacteria 38753
313 Ga0209051_1016564 3300025303 Bacteria 3328
314 Ga0209051_1020107 3300025303 Bacteria 2889
315 Ga0209257_1000021 3300025304 Bacteria 771986
316 Ga0207656_10002178 3300025321 Bacteria 6554
317 Ga0207682_10002916 3300025893 Bacteria 7543
318 Ga0207642_10011312 3300025899 Bacteria 3178
319 Ga0207642_10038230 3300025899 Bacteria 2075
320 Ga0207710_10029853 3300025900 Bacteria 2376
321 Ga0207688_10007275 3300025901 Bacteria 6025
322 Ga0207688_10042921 3300025901 Bacteria 2518
323 Ga0207680_10008088 3300025903 Bacteria 5153
324 Ga0207680_10017073 3300025903 Bacteria 3826
325 Ga0207680_10021987 3300025903 Bacteria 3462
326 Ga0207645_10000009 3300025907 Bacteria 142449
327 Ga0207645_10009334 3300025907 Bacteria 6790
328 Ga0207645_10016845 3300025907 Bacteria 4831
329 Ga0207643_10018377 3300025908 Bacteria 3829
330 Ga0207684_10041172 3300025910 Bacteria 3918
331 Ga0207707_10106442 3300025912 Bacteria 2452
332 Ga0207695_10001571 3300025913 Bacteria 37209
333 Ga0207695_10003997 3300025913 Bacteria 20338
334 Ga0207695_10021978 3300025913 Bacteria 7260
335 Ga0207695_10241708 3300025913 Bacteria 1706
336 Ga0207671_10006562 3300025914 Bacteria 10334
337 Ga0207660_10005324 3300025917 Bacteria 8361
338 Ga0207660_10032198 3300025917 Bacteria 3618
339 Ga0207662_10015073 3300025918 Bacteria 4344
340 Ga0207662_10020619 3300025918 Bacteria 3761
341 Ga0207657_10005067 3300025919 Bacteria 13820
342 Ga0207657_10102751 3300025919 Unclassified 2370
343 Ga0207649_10000408 3300025920 Bacteria 31917
344 Ga0207649_10009607 3300025920 Bacteria 5296
345 Ga0207649_10013648 3300025920 Bacteria 4540
346 Ga0207646_10000032 3300025922 Bacteria 216397
347 Ga0207646_10063723 3300025922 Bacteria 3290
348 Ga0207646_10081509 3300025922 Bacteria 2893
349 Ga0207681_10001771 3300025923 Bacteria 13871
350 Ga0207681_10001840 3300025923 Bacteria 13592
351 Ga0207694_10000384 3300025924 Bacteria 41184
352 Ga0207650_10000002 3300025925 Bacteria 1439222
353 Ga0207650_10001415 3300025925 Bacteria 17295
354 Ga0207650_10011570 3300025925 Bacteria 6076
355 Ga0207650_10026204 3300025925 Bacteria 4156
356 Ga0207650_10034544 3300025925 Bacteria 3667
357 Ga0207659_10001981 3300025926 Bacteria 12117
358 Ga0207659_10002634 3300025926 Bacteria 10689
359 Ga0207687_10063307 3300025927 Bacteria 2618
360 Ga0207644_10000114 3300025931 Bacteria 59996
361 Ga0207644_10054530 3300025931 Bacteria 2880
362 Ga0207690_10001518 3300025932 Bacteria 14519
363 Ga0207690_10006028 3300025932 Bacteria 7184
364 Ga0207706_10000134 3300025933 Bacteria 80573
365 Ga0207706_10024959 3300025933 Bacteria 5359
366 Ga0207706_10026965 3300025933 Bacteria 5140
367 Ga0207706_10052507 3300025933 Bacteria 3599
368 Ga0207706_10067903 3300025933 Bacteria 3138
369 Ga0207686_10006468 3300025934 Bacteria 6307
370 Ga0207686_10033668 3300025934 Bacteria 3060
371 Ga0207709_10028889 3300025935 Bacteria 3210
372 Ga0207709_10095548 3300025935 Bacteria 1953
373 Ga0207709_10123125 3300025935 Bacteria 1754
374 Ga0207670_10000160 3300025936 Bacteria 44356
375 Ga0207670_10011882 3300025936 Bacteria 5071
376 Ga0207670_10019416 3300025936 Bacteria 4152
377 Ga0207669_10042504 3300025937 Bacteria 2653
378 Ga0207704_10009221 3300025938 Bacteria 4750
379 Ga0207665_10095622 3300025939 Bacteria 2065
380 Ga0207691_10000015 3300025940 Bacteria 142014
381 Ga0207691_10000066 3300025940 Bacteria 84662
382 Ga0207691_10047442 3300025940 Bacteria 3941
383 Ga0207691_10151284 3300025940 Bacteria 2040
384 Ga0207711_10005430 3300025941 Bacteria 10780
385 Ga0207711_10192370 3300025941 Bacteria 1860
386 Ga0207689_10004460 3300025942 Bacteria 12692
387 Ga0207661_10085137 3300025944 Unclassified 2620
388 Ga0207679_10000007 3300025945 Bacteria 460140
389 Ga0207679_10000931 3300025945 Bacteria 18690
390 Ga0207679_10010190 3300025945 Bacteria 6047
391 Ga0207679_10015279 3300025945 Bacteria 5067
392 Ga0207679_10037901 3300025945 Bacteria 3431
393 Ga0207667_10002083 3300025949 Bacteria 25061
394 Ga0207667_10023865 3300025949 Bacteria 6730
395 Ga0207651_10000209 3300025960 Bacteria 25205
396 Ga0207651_10013780 3300025960 Bacteria 4641
397 Ga0207712_10118138 3300025961 Bacteria 2001
398 Ga0207668_10067417 3300025972 Bacteria 2541
399 Ga0207640_10000132 3300025981 Bacteria 55549
400 Ga0207640_10029086 3300025981 Bacteria 3387
401 Ga0207640_10062780 3300025981 Bacteria 2466
402 Ga0207658_10000001 3300025986 Bacteria 1439333
403 Ga0207658_10017783 3300025986 Bacteria 4898
404 Ga0207677_10027785 3300026023 Bacteria 3569
405 Ga0207703_10007101 3300026035 Bacteria 8909
406 Ga0207703_10036652 3300026035 Bacteria 3904
407 Ga0207678_10000011 3300026067 Bacteria 147685
408 Ga0207678_10004674 3300026067 Bacteria 12296
409 Ga0207678_10059322 3300026067 Bacteria 3292
410 Ga0207678_10135373 3300026067 Bacteria 2102
411 Ga0207708_10000336 3300026075 Bacteria 36973
412 Ga0207708_10001429 3300026075 Bacteria 17906
413 Ga0207708_10015389 3300026075 Bacteria 5738
414 Ga0207708_10063040 3300026075 Bacteria 2832
415 Ga0207708_10071162 3300026075 Bacteria 2664
416 Ga0207702_10000018 3300026078 Bacteria 212617
417 Ga0207702_10116246 3300026078 Bacteria 2387
418 Ga0207641_10010053 3300026088 Bacteria 7781
419 Ga0207641_10010055 3300026088 Bacteria 7779
420 Ga0207648_10000049 3300026089 Bacteria 108876
421 Ga0207648_10003565 3300026089 Bacteria 16280
422 Ga0207648_10007583 3300026089 Bacteria 10641
423 Ga0207676_10000001 3300026095 Bacteria 1439222
424 Ga0207676_10008539 3300026095 Bacteria 7281
425 Ga0207674_10001844 3300026116 Bacteria 27005
426 Ga0207674_10031517 3300026116 Bacteria 5569
427 Ga0207674_10037920 3300026116 Bacteria 5007
428 Ga0207674_10086447 3300026116 Bacteria 3130
429 Ga0207674_10095295 3300026116 Bacteria 2962
430 Ga0207674_10148254 3300026116 Bacteria 2304
431 Ga0207683_10000023 3300026121 Bacteria 114463
432 Ga0207683_10000501 3300026121 Bacteria 36209
433 Ga0207698_10000462 3300026142 Bacteria 23583
434 Ga0207698_10000553 3300026142 Bacteria 21782
435 Ga0207698_10081542 3300026142 Bacteria 2612
436 Ga0207698_10110019 3300026142 Bacteria 2307
437 Ga0209281_1003184 3300027111 Bacteria 5643
438 Ga0209969_1000683 3300027360 Bacteria 4544
439 Ga0209969_1001115 3300027360 Bacteria 3682
440 Ga0209967_1000047 3300027364 Bacteria 15443
441 Ga0209981_1000336 3300027378 Bacteria 6067
442 Ga0209996_1000225 3300027395 Bacteria 7304
443 Ga0209984_1000396 3300027424 Bacteria 4750
444 Ga0210000_1000180 3300027462 Bacteria 9138
445 Ga0209995_1000150 3300027471 Bacteria 11181
446 Ga0209968_1000036 3300027526 Bacteria 24144
447 Ga0209970_1000719 3300027614 Bacteria 5745
448 Ga0209282_1000048 3300027666 Bacteria 111312
449 Ga0209971_1000062 3300027682 Bacteria 34062
450 Ga0209966_1000210 3300027695 Bacteria 23707
451 Ga0209998_10000030 3300027717 Bacteria 60299
452 Ga0209974_10000386 3300027876 Bacteria 14621
453 Ga0209974_10000506 3300027876 Bacteria 13008
454 Ga0207428_10001516 3300027907 Bacteria 24234
455 Ga0207428_10006322 3300027907 Bacteria 10951
456 Ga0207428_10007796 3300027907 Bacteria 9747
457 Ga0268266_10023623 3300028379 Bacteria 5233
458 Ga0268266_10056565 3300028379 Bacteria 3374
459 Ga0268266_10085640 3300028379 Bacteria 2754
460 Ga0268265_10009824 3300028380 Bacteria 6458
461 Ga0268264_10000004 3300028381 Bacteria 1116842
462 Ga0265318_10001430 3300028577 Bacteria 14112
463 Ga0265336_10000511 3300028666 Bacteria 22483
464 Ga0307515_10009616 3300028794 Bacteria 18663
465 Ga0265338_10093773 3300028800 Bacteria 2472
466 Ga0265324_10000011 3300029957 Bacteria 218521
467 Ga0265324_10000340 3300029957 Bacteria 34285
468 Ga0265324_10024393 3300029957 Bacteria 2147
469 Ga0307511_10000022 3300030521 Bacteria 116875
470 Ga0265328_10000447 3300031239 Bacteria 19190
471 Ga0265328_10002460 3300031239 Bacteria 8309
472 Ga0265328_10005254 3300031239 Bacteria 5562
473 Ga0265328_10006977 3300031239 Bacteria 4740
474 Ga0265325_10000125 3300031241 Bacteria 52592
475 Ga0265325_10007301 3300031241 Bacteria 6632
476 Ga0265329_10004482 3300031242 Bacteria 5795
477 Ga0265331_10000070 3300031250 Bacteria 152331
478 Ga0265331_10003188 3300031250 Bacteria 10707
479 Ga0265331_10022219 3300031250 Bacteria 3238
480 Ga0265327_10000068 3300031251 Bacteria 219962
481 Ga0265327_10000156 3300031251 Bacteria 146362
482 Ga0265327_10000205 3300031251 Bacteria 123596
483 Ga0265327_10000706 3300031251 Bacteria 52819
484 Ga0265327_10000719 3300031251 Bacteria 52024
485 Ga0265327_10001333 3300031251 Bacteria 31995
486 Ga0265327_10003120 3300031251 Bacteria 16304
487 Ga0265327_10003549 3300031251 Bacteria 14790
488 Ga0265327_10006214 3300031251 Bacteria 9629
489 Ga0265327_10006520 3300031251 Bacteria 9293
490 Ga0265327_10008435 3300031251 Bacteria 7671
491 Ga0265327_10020927 3300031251 Bacteria 3966
492 Ga0265327_10044401 3300031251 Bacteria 2370
493 Ga0265327_10073494 3300031251 Bacteria 1705
494 Ga0265316_10000005 3300031344 Bacteria 304442
495 Ga0265316_10059298 3300031344 Bacteria 2977
496 Ga0307408_100000023 3300031548 Bacteria 295931
497 Ga0307408_100023759 3300031548 Bacteria 4179
498 Ga0316575_10005752 3300031665 Bacteria 4428
499 Ga0316579_10000015 3300031691 Bacteria 39681
500 Ga0265314_10000134 3300031711 Bacteria 111395
501 Ga0265314_10007756 3300031711 Bacteria 9281
502 Ga0265314_10020023 3300031711 Bacteria 5172
503 Ga0307516_10002741 3300031730 Bacteria 23228
504 Ga0307405_10018136 3300031731 Bacteria 3877
505 Ga0307413_10002623 3300031824 Bacteria 7356
506 Ga0307407_10030521 3300031903 Bacteria 2909
507 Ga0307412_10030943 3300031911 Bacteria 3375
508 Ga0307412_10057247 3300031911 Bacteria 2601
509 Ga0307416_100006355 3300032002 Bacteria 7388
510 Ga0307416_100050238 3300032002 Bacteria 3323
511 Ga0307416_100126947 3300032002 Bacteria 2286
512 Ga0307411_10090392 3300032005 Bacteria 2135
513 Ga0307415_100000756 3300032126 Bacteria 14568
514 Ga0316583_10000483 3300032133 Bacteria 11841
515 Ga0316583_10004823 3300032133 Bacteria 4817
516 Ga0307507_10047428 3300033179 Bacteria 4196
517 Ga0373952_0000324 3300035092 Bacteria 8028
518 Ga0373923_0094106 3300035111 Bacteria 1314
519 Ga0373956_0036076 3300035119 Bacteria 2182
520 Ga0373957_0045731 3300035120 Bacteria 1660
521 Ga0373960_0019946 3300035121 Bacteria 1767
522 Ga0373955_0013547 3300035172 Bacteria 3947
523 Ga0373955_0078224 3300035172 Bacteria 1864
524 Ga0373924_0007992 3300035410 Bacteria 3829
525 Ga0373935_0086873 3300035692 Bacteria 2041
526 Ga0373933_0002452 3300035724 Bacteria 10435
527 Ga0373937_0028631 3300036401 Bacteria 5043
528 Ga0373937_0045752 3300036401 Bacteria 4000
529 Ga0316582_0003674 3300036647 Bacteria 7582
530 Ga0373925_0114893 3300037068 Bacteria 2083
531 Ga0395899_0002272 3300037312 Bacteria 15706
532 Ga0395899_0023327 3300037312 Bacteria 4688
533 Ga0395899_0024592 3300037312 Bacteria 4552
534 Ga0395899_0042010 3300037312 Bacteria 3414
535 Ga0395899_0097786 3300037312 Bacteria 2121
536 Ga0395899_0108211 3300037312 Bacteria 2000
537 Ga0395900_0001906 3300037418 Bacteria 23725
538 Ga0395900_0004368 3300037418 Bacteria 14997
539 Ga0395900_0040940 3300037418 Bacteria 4776
540 Ga0395900_0058716 3300037418 Bacteria 3960
541 Ga0395900_0167746 3300037418 Bacteria 2236
542 Ga0395905_0000043 3300037471 Bacteria 247469
543 Ga0395905_0000242 3300037471 Bacteria 82835
544 Ga0395905_0008311 3300037471 Bacteria 10241
545 Ga0395905_0014548 3300037471 Bacteria 7507
546 Ga0395905_0016517 3300037471 Bacteria 7016
547 Ga0395905_0056374 3300037471 Bacteria 3676
548 Ga0395905_0087784 3300037471 Bacteria 2915
549 Ga0395905_0242384 3300037471 Bacteria 1684
550 Ga0395901_0000307 3300038443 Bacteria 60012
551 Ga0395901_0002559 3300038443 Bacteria 18423
552 Ga0395901_0005833 3300038443 Bacteria 12465
553 Ga0395901_0060610 3300038443 Bacteria 3937
554 Ga0395901_0077433 3300038443 Bacteria 3471
555 Ga0395901_0169831 3300038443 Bacteria 2288
556 Ga0400490_21110 3300038726 Bacteria 5837
557 Ga0436361_0100960 3300039447 Bacteria 8932
558 Ga0436361_0257895 3300039447 Bacteria 4702
559 Ga0436361_0545153 3300039447 Bacteria 4298
560 Ga0436361_0773293 3300039447 Bacteria 38992
561 Ga0436361_1049300 3300039447 Bacteria 3677
562 Ga0439436_0024218 3300041404 Bacteria 1793
563 Ga0439438_010003 3300041405 Bacteria 3033
564 Ga0450911_004719 3300042115 Bacteria 2200
565 Ga0450888_000035 3300042126 Bacteria 9574
566 Ga0450890_000572 3300042127 Bacteria 5368
567 Ga0450891_000065 3300042129 Bacteria 8426
568 Ga0450889_000145 3300042144 Bacteria 7163
569 Ga0439458_0003049 3300042157 Bacteria 3994
570 Ga0450909_002848 3300042185 Bacteria 2458
571 Ga0450893_0001962 3300042532 Bacteria 3197
572 Ga0451577_0000085 3300042876 Bacteria 211141
573 Ga0451577_0008429 3300042876 Bacteria 10034
574 Ga0451577_0008841 3300042876 Bacteria 9752
575 Ga0451577_0018842 3300042876 Bacteria 6353
576 Ga0451577_0019578 3300042876 Bacteria 6221
577 Ga0466969_0019979 3300044656 Bacteria 3472
578 Ga0466969_0039336 3300044656 Bacteria 2375
579 Ga0466972_0000359 3300044658 Bacteria 24761
580 Ga0466972_0017061 3300044658 Bacteria 3632
581 Ga0466977_0013105 3300044666 Bacteria 4867
582 Ga0453683_0000047 3300044673 Bacteria 207763
583 Ga0453683_0006123 3300044673 Bacteria 8290
584 Ga0466966_0015691 3300044684 Bacteria 5008
585 Ga0466966_0018170 3300044684 Bacteria 4639
586 Ga0466966_0026512 3300044684 Bacteria 3783
587 Ga0466966_0036339 3300044684 Bacteria 3180
588 Ga0466961_0001701 3300044693 Bacteria 13704
589 Ga0466961_0019077 3300044693 Bacteria 4412
590 Ga0466961_0020792 3300044693 Bacteria 4224
591 Ga0466964_0000097 3300044706 Bacteria 21037
592 Ga0466964_0011111 3300044706 Bacteria 3400
593 Ga0453684_0000273 3300044712 Bacteria 222658
594 Ga0453684_0000276 3300044712 Bacteria 222326
595 Ga0453684_0000302 3300044712 Bacteria 207763
596 Ga0453684_0004162 3300044712 Bacteria 31248
597 Ga0453684_0034104 3300044712 Bacteria 7074
598 Ga0453684_0036639 3300044712 Bacteria 6755
599 Ga0453684_0038837 3300044712 Bacteria 6496
600 Ga0466968_0000838 3300044735 Bacteria 10735
601 Ga0466968_0045031 3300044735 Bacteria 1871
602 Ga0466970_0002355 3300044765 Bacteria 9130
603 Ga0466957_0001772 3300044842 Bacteria 11366
604 Ga0466957_0006017 3300044842 Bacteria 6844
605 Ga0466957_0047230 3300044842 Bacteria 2615
606 Ga0466957_0098808 3300044842 Bacteria 1837
607 Ga0466959_0016980 3300045049 Bacteria 5327
608 Ga0466959_0038347 3300045049 Bacteria 3540
609 Ga0451576_0000003 3300045051 Bacteria 1550573
610 Ga0451576_0000006 3300045051 Bacteria 949698
611 Ga0451576_0000096 3300045051 Bacteria 221078
612 Ga0451576_0000116 3300045051 Bacteria 207763
613 Ga0451576_0000147 3300045051 Bacteria 179223
614 Ga0451576_0001472 3300045051 Bacteria 39908
615 Ga0451576_0002503 3300045051 Bacteria 27266
616 Ga0451576_0002526 3300045051 Bacteria 27094
617 Ga0451576_0004790 3300045051 Bacteria 17343
618 Ga0451576_0008254 3300045051 Bacteria 12246
619 Ga0451576_0019294 3300045051 Bacteria 7444
620 Ga0451576_0019765 3300045051 Bacteria 7350
621 Ga0451576_0021263 3300045051 Bacteria 7054
622 Ga0451576_0025801 3300045051 Bacteria 6330
623 Ga0451576_0071239 3300045051 Bacteria 3617
624 Ga0451576_0103230 3300045051 Bacteria 2966
625 Ga0451576_0204093 3300045051 Bacteria 2064
626 Ga0451576_0237968 3300045051 Unclassified 1901
627 Ga0466958_0052313 3300045836 Bacteria 2475
628 Ga0466967_0005183 3300045976 Bacteria 8975
629 Ga0466967_0011484 3300045976 Bacteria 6712
630 Ga0466967_0057073 3300045976 Bacteria 3445
631 Ga0495617_000125 3300046452 Bacteria 50630
632 Ga0495592_0020784 3300046454 Bacteria 4994
633 Ga0495590_0002849 3300046457 Bacteria 7124
634 Ga0495651_0084410 3300046462 Bacteria 2393
635 Ga0495653_0041728 3300046463 Bacteria 3579
636 Ga0495653_0116134 3300046463 Bacteria 1914
637 Ga0495580_0036217 3300046472 Bacteria 3543
638 Ga0495582_0000662 3300046473 Bacteria 18974
639 Ga0495605_0000725 3300046474 Bacteria 24295
640 Ga0495605_0000845 3300046474 Bacteria 21424
641 Ga0495584_0000417 3300046491 Bacteria 29344
642 Ga0495584_0032982 3300046491 Bacteria 2619
643 Ga0495585_0003922 3300046492 Bacteria 9850
644 Ga0495585_0004000 3300046492 Bacteria 9711
645 Ga0495585_0020428 3300046492 Bacteria 3809
646 Ga0495594_0006120 3300046499 Bacteria 6188
647 Ga0495594_0038603 3300046499 Bacteria 2608
648 Ga0495594_0060699 3300046499 Bacteria 2091
649 Ga0495596_0001761 3300046500 Bacteria 12120
650 Ga0495596_0004535 3300046500 Bacteria 6748
651 Ga0495596_0005727 3300046500 Bacteria 5832
652 Ga0495607_0000004 3300046501 Bacteria 317271
653 Ga0495607_0001408 3300046501 Bacteria 21405
654 Ga0495607_0003124 3300046501 Bacteria 12858
655 Ga0495607_0036047 3300046501 Bacteria 2985
656 Ga0495583_0000222 3300046506 Bacteria 95964
657 Ga0495583_0006001 3300046506 Bacteria 8055
658 Ga0495606_0018114 3300046507 Bacteria 5294
659 Ga0495606_0019130 3300046507 Bacteria 5106
660 Ga0495608_0023686 3300046511 Bacteria 4205
661 Ga0495631_0001168 3300046518 Bacteria 16231
662 Ga0495643_0002098 3300046522 Bacteria 16504
663 Ga0495643_0002952 3300046522 Bacteria 12877
664 Ga0495644_0019602 3300046523 Bacteria 2582
665 Ga0495644_0022177 3300046523 Bacteria 2420
666 Ga0495648_0000612 3300046524 Bacteria 38167
667 Ga0495648_0002837 3300046524 Bacteria 15598
668 Ga0495666_0000791 3300046526 Bacteria 14659
669 Ga0495666_0006131 3300046526 Bacteria 6047
670 Ga0495642_0000515 3300046528 Bacteria 19938
671 Ga0495642_0013263 3300046528 Bacteria 3185
672 Ga0495652_0064084 3300046529 Bacteria 3092
673 Ga0495665_0003210 3300046531 Bacteria 8842
674 Ga0495586_0028232 3300046535 Bacteria 3003
675 Ga0495587_0062895 3300046536 Bacteria 2172
676 Ga0495587_0072105 3300046536 Bacteria 2008
677 Ga0495587_0087071 3300046536 Bacteria 1807
678 Ga0495622_0010883 3300046557 Bacteria 4196
679 Ga0495633_0006611 3300046558 Bacteria 6844
680 Ga0495667_0091051 3300046559 Bacteria 1976
681 Ga0495656_0004470 3300046615 Bacteria 4793
682 Ga0495634_0106344 3300046642 Bacteria 1808
683 Ga0495611_0002853 3300046648 Bacteria 7726
684 Ga0495661_0000805 3300046665 Bacteria 29621
685 Ga0495661_0004703 3300046665 Bacteria 9801
686 Ga0495661_0005396 3300046665 Bacteria 9088
687 Ga0495661_0007618 3300046665 Bacteria 7543
688 Ga0495661_0053002 3300046665 Bacteria 2441
689 Ga0495588_0002016 3300046674 Bacteria 8685
690 Ga0495588_0013718 3300046674 Bacteria 3864
691 Ga0495657_0060037 3300046675 Bacteria 2521
692 Ga0495623_0018146 3300046679 Bacteria 4543
693 Ga0495670_0005460 3300046691 Bacteria 6240
694 Ga0495670_0019346 3300046691 Bacteria 3354
695 Ga0495649_0020690 3300046694 Bacteria 3688
696 Ga0495589_0000309 3300046794 Bacteria 38979
697 Ga0495589_0001297 3300046794 Bacteria 14743
698 Ga0495600_0021920 3300046809 Bacteria 4097
699 Ga0495660_0000734 3300046810 Bacteria 24893
700 Ga0495581_0001061 3300047315 Bacteria 14904
701 Ga0495581_0005818 3300047315 Bacteria 7149
702 Ga0495604_0040469 3300047317 Bacteria 3659
703 Ga0495636_0023321 3300047318 Bacteria 2504
704 Ga0495672_0000865 3300047320 Bacteria 31951
705 Ga0495680_0061285 3300047322 Bacteria 2895
706 Ga0495687_000656 3300047443 Bacteria 39649
707 Ga0495687_000829 3300047443 Bacteria 33057
708 Ga0495687_000866 3300047443 Bacteria 32045
709 Ga0495687_007801 3300047443 Bacteria 6230
710 Ga0495677_0003090 3300047445 Bacteria 6481
711 Ga0495677_0004391 3300047445 Bacteria 5421
712 Ga0495677_0007440 3300047445 Bacteria 4093
713 Ga0495681_0000511 3300047470 Bacteria 29544
714 Ga0495681_0003757 3300047470 Bacteria 10528
715 Ga0495686_0000285 3300047472 Bacteria 88880
716 Ga0495686_0002310 3300047472 Bacteria 18237
717 Ga0495602_0001988 3300048088 Bacteria 20511
718 Ga0495614_0008722 3300048089 Bacteria 4505
719 Ga0495626_0000292 3300048091 Bacteria 53923
720 Ga0495626_0000613 3300048091 Bacteria 34843
721 Ga0496100_0074995 3300048903 Bacteria 2267
722 Ga0496102_0000544 3300048905 Bacteria 40620
723 Ga0496103_0006831 3300048906 Bacteria 6810
724 Ga0496104_0019038 3300048907 Bacteria 6272
725 Ga0496104_0085381 3300048907 Bacteria 3013
726 Ga0496105_0152772 3300048908 Bacteria 1897
727 Ga0496109_0006786 3300048912 Bacteria 9645
728 Ga0496109_0057917 3300048912 Bacteria 3539
729 Ga0496109_0113160 3300048912 Bacteria 2524
730 Ga0496110_0047848 3300048913 Bacteria 3747
731 Ga0496110_0070412 3300048913 Bacteria 3099
732 Ga0496111_0004898 3300048914 Bacteria 8505
733 Ga0496112_0069132 3300048915 Bacteria 3489
734 Ga0496113_0009852 3300048916 Bacteria 6291
735 Ga0496116_0007586 3300048919 Bacteria 9588
736 Ga0496116_0030764 3300048919 Bacteria 3852
737 Ga0496121_0044676 3300048924 Bacteria 3817
738 Ga0496121_0099040 3300048924 Bacteria 2254
739 Ga0496121_0123323 3300048924 Bacteria 1953
740 Ga0496122_0001645 3300048925 Bacteria 34677
741 Ga0496122_0006420 3300048925 Bacteria 13505
742 Ga0496123_0002540 3300048926 Bacteria 22349
743 Ga0496123_0005186 3300048926 Bacteria 13249
744 Ga0496125_0001339 3300048928 Bacteria 36299
745 Ga0496125_0083060 3300048928 Bacteria 2438
746 Ga0495678_007426 3300049459 Bacteria 5680
747 Ga0501290_000202 3300049513 Bacteria 9807
748 Ga0501291_000129 3300049514 Bacteria 9241
749 Ga0501292_000544 3300049515 Bacteria 4667
750 Ga0501294_000270 3300049517 Bacteria 6383
751 Ga0501296_000163 3300049519 Bacteria 7078
752 Ga0501297_000961 3300049520 Bacteria 2607
753 Ga0501298_000125 3300049521 Bacteria 9223
754 Ga0501299_000033 3300049522 Bacteria 16414
755 Ga0501300_000111 3300049523 Bacteria 11859
756 Ga0501300_005855 3300049523 Bacteria 1809
757 Ga0501301_000402 3300049524 Bacteria 2576
758 Ga0501303_000044 3300049526 Bacteria 9779
759 Ga0501031_0009138 3300049568 Bacteria 6445
760 Ga0501031_0045375 3300049568 Bacteria 2868
761 Ga0501032_0100497 3300049569 Unclassified 1916
762 Ga0501034_0008163 3300049571 Bacteria 11100
763 Ga0501034_0050002 3300049571 Bacteria 4217
764 Ga0501034_0105734 3300049571 Bacteria 2807
765 Ga0501036_0019186 3300049572 Bacteria 5737
766 Ga0501037_0020623 3300049573 Bacteria 4866
767 Ga0501037_0061841 3300049573 Unclassified 2731
768 Ga0501038_0000129 3300049574 Bacteria 64365
769 Ga0501038_0084344 3300049574 Unclassified 2673
770 Ga0501039_0005040 3300049575 Bacteria 10015
771 Ga0501039_0036031 3300049575 Bacteria 3817
772 Ga0501039_0052723 3300049575 Bacteria 3146
773 Ga0501039_0056686 3300049575 Bacteria 3035
774 Ga0501039_0075842 3300049575 Bacteria 2614
775 Ga0501039_0141383 3300049575 Unclassified 1890
776 Ga0501041_0018228 3300049577 Unclassified 4181
777 Ga0501041_0032501 3300049577 Bacteria 3153
778 Ga0501042_0045024 3300049578 Bacteria 3144
779 Ga0501042_0053358 3300049578 Unclassified 2884
780 Ga0501043_0069412 3300049579 Bacteria 2768
781 Ga0501043_0224578 3300049579 Bacteria 1452
782 Ga0501046_0001975 3300049580 Bacteria 19485
783 Ga0501046_0020030 3300049580 Bacteria 5539
784 Ga0501046_0065302 3300049580 Bacteria 2839
785 Ga0501047_0109279 3300049581 Bacteria 2648
786 Ga0501047_0160923 3300049581 Bacteria 2117
787 Ga0501048_0045866 3300049582 Unclassified 3120
788 Ga0501048_0068156 3300049582 Bacteria 2514
789 Ga0501048_0117174 3300049582 Bacteria 1881
790 Ga0501068_0029264 3300049584 Bacteria 3261
791 Ga0501068_0056185 3300049584 Bacteria 2386
792 Ga0501069_0055790 3300049585 Unclassified 2201
793 Ga0501071_0045472 3300049587 Bacteria 3152
794 Ga0501072_0083304 3300049588 Bacteria 2535
795 Ga0501074_0033222 3300049590 Bacteria 3738
796 Ga0501075_0037193 3300049591 Bacteria 3635
797 Ga0501076_0002131 3300049592 Bacteria 13585
798 Ga0501076_0082045 3300049592 Bacteria 2588
799 Ga0501077_0019179 3300049593 Bacteria 4325
800 Ga0501199_000202 3300049650 Bacteria 5090
801 Ga0501201_000008 3300049651 Bacteria 11752
802 Ga0501206_001086 3300049653 Bacteria 3382
803 Ga0501208_000079 3300049655 Bacteria 5609
804 Ga0501209_001129 3300049656 Bacteria 3629
805 Ga0501209_002581 3300049656 Bacteria 2823
806 Ga0501211_003374 3300049658 Bacteria 1649
807 Ga0501216_000568 3300049660 Bacteria 4450
808 Ga0501217_000716 3300049661 Bacteria 5715
809 Ga0501227_005905 3300049665 Bacteria 2626
810 Ga0501233_001847 3300049668 Bacteria 3673
811 Ga0501239_000151 3300049672 Bacteria 4835
812 Ga0501243_001478 3300049675 Bacteria 3364
813 Ga0501246_000473 3300049676 Bacteria 2919
814 Ga0501247_003826 3300049677 Bacteria 1628
815 Ga0501249_000311 3300049679 Bacteria 13576
816 Ga0501252_001635 3300049682 Bacteria 2110
817 Ga0501253_000151 3300049683 Bacteria 5070
818 Ga0501257_000887 3300049686 Bacteria 6039
819 Ga0501260_000071 3300049689 Bacteria 6904
820 Ga0501261_000153 3300049690 Bacteria 9883
821 Ga0501219_001509 3300049703 Bacteria 2180
822 Ga0501221_000243 3300049704 Bacteria 7907
823 Ga0501225_0001799 3300049705 Bacteria 6709
824 Ga0501229_000181 3300049706 Bacteria 6695
825 Ga0501229_000367 3300049706 Bacteria 5103
826 Ga0501245_001642 3300049708 Bacteria 2916
827 Ga0501079_0032234 3300049741 Bacteria 4028
828 Ga0501080_0060090 3300049742 Bacteria 3537
829 Ga0501081_0000696 3300049743 Bacteria 19414
830 Ga0501232_001562 3300049757 Bacteria 1849
831 Ga0501241_003767 3300049758 Bacteria 2856
832 Ga0501266_000300 3300049763 Bacteria 6560
833 Ga0501270_000102 3300049767 Bacteria 6639
834 Ga0501271_000064 3300049768 Bacteria 8080
835 Ga0501272_000006 3300049769 Bacteria 14613
836 Ga0501278_000064 3300049774 Bacteria 7151
837 Ga0501279_000060 3300049775 Bacteria 19728
838 Ga0501280_003287 3300049776 Bacteria 2510
839 Ga0501281_00372 3300049777 Bacteria 4506
840 Ga0501282_002430 3300049778 Bacteria 2026
841 Ga0501283_000255 3300049779 Bacteria 7004
842 Ga0501035_0005765 3300049822 Bacteria 11675
843 Ga0501035_0008524 3300049822 Bacteria 9543
844 Ga0501035_0032289 3300049822 Bacteria 4764
845 Ga0501035_0075320 3300049822 Unclassified 2985
846 Ga0501035_0160598 3300049822 Unclassified 1945
847 Ga0501044_0111665 3300049823 Bacteria 2741
848 Ga0501045_0138021 3300049824 Bacteria 1813
849 Ga0501226_000463 3300049853 Bacteria 5709
850 nmdc:mga00v17_26544_c1 3300050491 Bacteria 3376
851 nmdc:mga0k408_12676_c1 3300050493 Bacteria 4611
852 nmdc:mga0k408_33506_c1 3300050493 Bacteria 2938
853 nmdc:mga0k408_3408_c1 3300050493 Bacteria 8421
854 nmdc:mga05p37_11314_c1 3300050507 Bacteria 10614
855 nmdc:mga05p37_21279_c1 3300050507 Bacteria 7852
856 nmdc:mga05p37_28711_c1 3300050507 Bacteria 6787
857 nmdc:mga05p37_55990_c1 3300050507 Bacteria 4854
858 nmdc:mga09592_1679_c1 3300050508 Bacteria 17838
859 nmdc:mga09592_84091_c1 3300050508 Bacteria 2713
860 nmdc:mga0qj67_4478_c1 3300050509 Bacteria 10121
861 nmdc:mga0qj67_4787_c1 3300050509 Bacteria 9842
862 nmdc:mga0qj67_56868_c1 3300050509 Bacteria 3102
863 nmdc:mga06r32_111951_c1 3300050510 Bacteria 2686
864 nmdc:mga06r32_82324_c1 3300050510 Bacteria 3135
865 nmdc:mga08y16_2953_c1 3300050511 Bacteria 17518
866 nmdc:mga08y16_5521_c1 3300050511 Bacteria 13236
867 nmdc:mga0n895_42530_c1 3300050512 Bacteria 4421
868 nmdc:mga0rr50_14167_c1 3300050513 Bacteria 5221
869 nmdc:mga0rr50_215891_c1 3300050513 Bacteria 1582
870 nmdc:mga08x19_8249_c1 3300050514 Bacteria 6193
871 nmdc:mga0a205_10309_c1 3300050515 Bacteria 8589
872 nmdc:mga0a205_119880_c1 3300050515 Bacteria 2530
873 nmdc:mga0sz30_14682_c1 3300050516 Bacteria 3087
874 Ga0495619_0047189 3300053085 Bacteria 2836
875 Ga0495619_0108036 3300053085 Unclassified 1898
876 Ga0500646_0000154 3300053090 Bacteria 20271
877 Ga0500641_0054808 3300053096 Bacteria 1649
878 Ga0500636_0000250 3300053177 Bacteria 29581
879 Ga0501084_0011541 3300054114 Bacteria 7315
880 Ga0590077_008026 3300059426 Bacteria 2162
881 Ga0501082_0000754 3300060353 Bacteria 28420
882 Ga0466962_0002290 3300061719 Bacteria 9078
883 Ga0466962_0005722 3300061719 Bacteria 5973

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300014326 Ga0157380_10090109 Ga0157380_100901091 393
2 3300035111 Ga0373923_0094106 Ga0373923_0094106_17_1222 394
3 3300049579 Ga0501043_0224578 Ga0501043_0224578_16_1263 400
4 iso_pu_bacteria 2884811622 2884816143 402
5 3300042185 Ga0450909_002848 Ga0450909_002848_1167_2420 408
6 3300049822 Ga0501035_0160598 Ga0501035_0160598_680_1933 411
7 3300038443 Ga0395901_0169831 Ga0395901_0169831_996_2276 413
8 3300045051 Ga0451576_0204093 Ga0451576_0204093_765_2051 416
9 3300049705 Ga0501225_0001799 Ga0501225_0001799_5408_6694 422
10 3300037471 Ga0395905_0008311 Ga0395905_0008311_8184_9638 424
11 3300035172 Ga0373955_0078224 Ga0373955_0078224_34_1338 427
12 3300046665 Ga0495661_0053002 Ga0495661_0053002_1100_2428 429
13 3300048928 Ga0496125_0083060 Ga0496125_0083060_39_1466 434
14 3300005457 Ga0070662_100018115 Ga0070662_1000181153 437
15 3300025933 Ga0207706_10026965 Ga0207706_100269653 437
16 3300026142 Ga0207698_10110019 Ga0207698_101100191 437
17 3300049523 Ga0501300_005855 Ga0501300_005855_116_1579 439
18 3300049665 Ga0501227_005905 Ga0501227_005905_814_2277 439
19 3300049704 Ga0501221_000243 Ga0501221_000243_1519_2982 439
20 3300049706 Ga0501229_000367 Ga0501229_000367_179_1642 439
21 3300049757 Ga0501232_001562 Ga0501232_001562_256_1719 439
22 3300031731 Ga0307405_10018136 Ga0307405_100181361 444
23 3300031824 Ga0307413_10002623 Ga0307413_100026236 444
24 3300031903 Ga0307407_10030521 Ga0307407_100305211 444
25 3300031911 Ga0307412_10030943 Ga0307412_100309431 444
26 3300032002 Ga0307416_100006355 Ga0307416_1000063553 444
27 3300032005 Ga0307411_10090392 Ga0307411_100903921 444
28 3300032126 Ga0307415_100000756 Ga0307415_1000007561 444
29 3300044712 Ga0453684_0004162 Ga0453684_0004162_17481_18848 444
30 3300045051 Ga0451576_0000003 Ga0451576_0000003_250914_252314 447
31 3300028794 Ga0307515_10009616 Ga0307515_1000961614 448
32 3300042126 Ga0450888_000035 Ga0450888_000035_1738_3201 448
33 3300042127 Ga0450890_000572 Ga0450890_000572_1365_2828 448
34 3300042129 Ga0450891_000065 Ga0450891_000065_1634_3097 448
35 3300042144 Ga0450889_000145 Ga0450889_000145_3938_5401 448
36 3300042532 Ga0450893_0001962 Ga0450893_0001962_1590_3053 448
37 3300046524 Ga0495648_0002837 Ga0495648_0002837_6929_8386 448
38 3300047472 Ga0495686_0002310 Ga0495686_0002310_1986_3416 448
39 3300049575 Ga0501039_0056686 Ga0501039_0056686_1501_2925 448
40 3300049579 Ga0501043_0069412 Ga0501043_0069412_684_2108 448
41 3300049584 Ga0501068_0029264 Ga0501068_0029264_121_1545 448
42 3300049592 Ga0501076_0002131 Ga0501076_0002131_10915_12339 448
43 3300049676 Ga0501246_000473 Ga0501246_000473_17_1366 448
44 3300049743 Ga0501081_0000696 Ga0501081_0000696_12563_13987 448
45 3300049824 Ga0501045_0138021 Ga0501045_0138021_291_1715 448
46 3300054114 Ga0501084_0011541 Ga0501084_0011541_2422_3846 448
47 3300060353 Ga0501082_0000754 Ga0501082_0000754_12458_13882 448
48 3300044684 Ga0466966_0015691 Ga0466966_0015691_1886_3316 449
49 3300044842 Ga0466957_0098808 Ga0466957_0098808_69_1532 449
50 3300047443 Ga0495687_000656 Ga0495687_000656_9949_11379 449
51 3300042115 Ga0450911_004719 Ga0450911_004719_328_1785 450
52 3300044706 Ga0466964_0011111 Ga0466964_0011111_395_1852 450
53 3300044735 Ga0466968_0000838 Ga0466968_0000838_3925_5382 450
54 3300047445 Ga0495677_0003090 Ga0495677_0003090_1219_2670 450
55 3300048914 Ga0496111_0004898 Ga0496111_0004898_6967_8424 450
56 3300049775 Ga0501279_000060 Ga0501279_000060_17842_19209 450
57 3300009147 Ga0114129_10395888 Ga0114129_103958881 451
58 3300009174 Ga0105241_10021227 Ga0105241_100212271 451
59 3300026116 Ga0207674_10148254 Ga0207674_101482541 451
60 3300031239 Ga0265328_10006977 Ga0265328_100069774 451
61 3300046492 Ga0495585_0004000 Ga0495585_0004000_3606_5135 451
62 3300046528 Ga0495642_0000515 Ga0495642_0000515_7115_8572 451
63 3300046648 Ga0495611_0002853 Ga0495611_0002853_2661_4190 451
64 3300028666 Ga0265336_10000511 Ga0265336_1000051113 452
65 3300029957 Ga0265324_10000011 Ga0265324_10000011203 452
66 3300031241 Ga0265325_10000125 Ga0265325_1000012535 452
67 3300031711 Ga0265314_10007756 Ga0265314_100077562 452
68 3300046474 Ga0495605_0000725 Ga0495605_0000725_7315_8772 453
69 3300046501 Ga0495607_0003124 Ga0495607_0003124_5145_6602 453
70 3300046522 Ga0495643_0002952 Ga0495643_0002952_4103_5560 453
71 3300046694 Ga0495649_0020690 Ga0495649_0020690_1450_2907 453
72 3300046794 Ga0495589_0000309 Ga0495589_0000309_35254_36711 453
73 3300046810 Ga0495660_0000734 Ga0495660_0000734_9335_10792 453
74 3300047320 Ga0495672_0000865 Ga0495672_0000865_23576_25033 453
75 3300047443 Ga0495687_000866 Ga0495687_000866_23582_25039 453
76 3300047445 Ga0495677_0004391 Ga0495677_0004391_3864_5321 453
77 3300048091 Ga0495626_0000292 Ga0495626_0000292_34296_35753 453
78 3300005339 Ga0070660_100100823 Ga0070660_1001008232 454
79 3300005366 Ga0070659_100053140 Ga0070659_1000531402 454
80 3300005457 Ga0070662_100091708 Ga0070662_1000917081 454
81 3300009036 Ga0105244_10063047 Ga0105244_100630472 454
82 3300044842 Ga0466957_0006017 Ga0466957_0006017_2878_4329 454
83 3300046491 Ga0495584_0000417 Ga0495584_0000417_7199_8656 454
84 3300047443 Ga0495687_000829 Ga0495687_000829_7741_9198 454
85 iso_pu_bacteria 2910245624 2910250707 454
86 3300025922 Ga0207646_10081509 Ga0207646_100815092 455
87 3300037418 Ga0395900_0001906 Ga0395900_0001906_11710_13167 455
88 3300038443 Ga0395901_0000307 Ga0395901_0000307_7403_8860 455
89 3300046501 Ga0495607_0036047 Ga0495607_0036047_873_2330 455
90 3300046665 Ga0495661_0000805 Ga0495661_0000805_24698_26155 455
91 3300046665 Ga0495661_0007618 Ga0495661_0007618_2586_4043 455
92 3300049822 Ga0501035_0005765 Ga0501035_0005765_9002_10459 455
93 3300050513 nmdc:mga0rr50_215891_c1 nmdc:mga0rr50_215891_c1_191_1561 455
94 3300031239 Ga0265328_10005254 Ga0265328_100052543 456
95 3300031251 Ga0265327_10000205 Ga0265327_1000020529 456
96 3300044684 Ga0466966_0026512 Ga0466966_0026512_1587_3041 456
97 3300044693 Ga0466961_0020792 Ga0466961_0020792_1933_3387 456
98 3300046674 Ga0495588_0002016 Ga0495588_0002016_5088_6551 456
99 3300061719 Ga0466962_0002290 Ga0466962_0002290_1418_2872 456
100 3300006880 Ga0075429_100028503 Ga0075429_1000285034 457
101 3300046506 Ga0495583_0006001 Ga0495583_0006001_5478_6932 457
102 3300049574 Ga0501038_0000129 Ga0501038_0000129_38901_40466 457
103 3300050508 nmdc:mga09592_1679_c1 nmdc:mga09592_1679_c1_1784_3247 457
104 3300032002 Ga0307416_100126947 Ga0307416_1001269472 458
105 3300006195 Ga0075366_10036985 Ga0075366_100369852 459
106 3300025945 Ga0207679_10037901 Ga0207679_100379012 459
107 3300026067 Ga0207678_10059322 Ga0207678_100593222 459
108 3300037471 Ga0395905_0000242 Ga0395905_0000242_33717_35180 459
109 3300050493 nmdc:mga0k408_33506_c1 nmdc:mga0k408_33506_c1_436_1899 459
110 3300050514 nmdc:mga08x19_8249_c1 nmdc:mga08x19_8249_c1_2195_3619 459
111 3300005985 Ga0081539_10042221 Ga0081539_100422212 460
112 3300009147 Ga0114129_10041544 Ga0114129_100415444 460
113 3300009148 Ga0105243_10029824 Ga0105243_100298243 460
114 3300025935 Ga0207709_10028889 Ga0207709_100288892 460
115 3300031251 Ga0265327_10003549 Ga0265327_100035496 460
116 3300031344 Ga0265316_10059298 Ga0265316_100592983 460
117 3300031548 Ga0307408_100023759 Ga0307408_1000237593 460
118 3300042157 Ga0439458_0003049 Ga0439458_0003049_1302_2759 460
119 3300044684 Ga0466966_0018170 Ga0466966_0018170_1373_2830 460
120 3300044842 Ga0466957_0001772 Ga0466957_0001772_9483_10940 460
121 3300045976 Ga0466967_0011484 Ga0466967_0011484_1817_3274 460
122 3300048908 Ga0496105_0152772 Ga0496105_0152772_66_1523 460
123 3300050507 nmdc:mga05p37_55990_c1 nmdc:mga05p37_55990_c1_1209_2675 460
124 3300037418 Ga0395900_0004368 Ga0395900_0004368_6180_7637 461
125 3300038443 Ga0395901_0002559 Ga0395901_0002559_6983_8440 461
126 3300048912 Ga0496109_0057917 Ga0496109_0057917_1272_2729 461
127 3300049587 Ga0501071_0045472 Ga0501071_0045472_908_2326 461
128 3300005563 Ga0068855_100296172 Ga0068855_1002961721 463
129 3300006846 Ga0075430_100002760 Ga0075430_1000027602 463
130 3300006847 Ga0075431_100021196 Ga0075431_1000211965 463
131 3300027876 Ga0209974_10000506 Ga0209974_100005066 463
132 3300037471 Ga0395905_0016517 Ga0395905_0016517_3002_4456 463
133 3300037471 Ga0395905_0242384 Ga0395905_0242384_241_1671 463
134 3300050509 nmdc:mga0qj67_4787_c1 nmdc:mga0qj67_4787_c1_8301_9707 463
135 3300003794 Ga0055531_10000007 Ga0055531_1000000778 464
136 3300025298 Ga0209050_1010447 Ga0209050_10104472 464
137 3300025304 Ga0209257_1000021 Ga0209257_1000021150 464
138 3300031911 Ga0307412_10057247 Ga0307412_100572471 464
139 3300041405 Ga0439438_010003 Ga0439438_010003_17_1429 464
140 3300049513 Ga0501290_000202 Ga0501290_000202_3498_4910 464
141 3300049514 Ga0501291_000129 Ga0501291_000129_3786_5198 464
142 3300049515 Ga0501292_000544 Ga0501292_000544_3193_4605 464
143 3300049517 Ga0501294_000270 Ga0501294_000270_4642_6054 464
144 3300049519 Ga0501296_000163 Ga0501296_000163_5592_7004 464
145 3300049520 Ga0501297_000961 Ga0501297_000961_199_1611 464
146 3300049521 Ga0501298_000125 Ga0501298_000125_2650_4062 464
147 3300049522 Ga0501299_000033 Ga0501299_000033_5826_7238 464
148 3300049523 Ga0501300_000111 Ga0501300_000111_5391_6803 464
149 3300049524 Ga0501301_000402 Ga0501301_000402_535_1947 464
150 3300049526 Ga0501303_000044 Ga0501303_000044_240_1652 464
151 3300049650 Ga0501199_000202 Ga0501199_000202_273_1685 464
152 3300049651 Ga0501201_000008 Ga0501201_000008_4924_6336 464
153 3300049653 Ga0501206_001086 Ga0501206_001086_190_1602 464
154 3300049655 Ga0501208_000079 Ga0501208_000079_4167_5579 464
155 3300049656 Ga0501209_002581 Ga0501209_002581_709_2121 464
156 3300049658 Ga0501211_003374 Ga0501211_003374_156_1568 464
157 3300049660 Ga0501216_000568 Ga0501216_000568_688_2100 464
158 3300049661 Ga0501217_000716 Ga0501217_000716_4176_5588 464
159 3300049668 Ga0501233_001847 Ga0501233_001847_63_1475 464
160 3300049672 Ga0501239_000151 Ga0501239_000151_1009_2421 464
161 3300049675 Ga0501243_001478 Ga0501243_001478_1844_3256 464
162 3300049677 Ga0501247_003826 Ga0501247_003826_27_1439 464
163 3300049679 Ga0501249_000311 Ga0501249_000311_3787_5199 464
164 3300049682 Ga0501252_001635 Ga0501252_001635_104_1516 464
165 3300049683 Ga0501253_000151 Ga0501253_000151_600_2012 464
166 3300049686 Ga0501257_000887 Ga0501257_000887_3886_5298 464
167 3300049689 Ga0501260_000071 Ga0501260_000071_17_1429 464
168 3300049690 Ga0501261_000153 Ga0501261_000153_6962_8374 464
169 3300049703 Ga0501219_001509 Ga0501219_001509_367_1779 464
170 3300049706 Ga0501229_000181 Ga0501229_000181_3445_4857 464
171 3300049708 Ga0501245_001642 Ga0501245_001642_877_2289 464
172 3300049758 Ga0501241_003767 Ga0501241_003767_817_2229 464
173 3300049763 Ga0501266_000300 Ga0501266_000300_742_2154 464
174 3300049767 Ga0501270_000102 Ga0501270_000102_2580_3992 464
175 3300049768 Ga0501271_000064 Ga0501271_000064_5900_7312 464
176 3300049769 Ga0501272_000006 Ga0501272_000006_3605_5017 464
177 3300049774 Ga0501278_000064 Ga0501278_000064_4047_5459 464
178 3300049776 Ga0501280_003287 Ga0501280_003287_53_1465 464
179 3300049777 Ga0501281_00372 Ga0501281_00372_80_1492 464
180 3300049778 Ga0501282_002430 Ga0501282_002430_532_1944 464
181 3300049779 Ga0501283_000255 Ga0501283_000255_3512_4924 464
182 3300049853 Ga0501226_000463 Ga0501226_000463_891_2303 464
183 iso_pu_bacteria 2857576091 2857578848 465
184 3300003371 JGI26145J50221_1000448 JGI26145J50221_10004482 466
185 3300005289 Ga0065704_10077577 Ga0065704_100775772 466
186 3300005295 Ga0065707_10082548 Ga0065707_100825483 466
187 3300005328 Ga0070676_10008985 Ga0070676_100089853 466
188 3300005329 Ga0070683_100015466 Ga0070683_1000154662 466
189 3300005331 Ga0070670_100024257 Ga0070670_1000242573 466
190 3300005333 Ga0070677_10001872 Ga0070677_100018726 466
191 3300005335 Ga0070666_10015909 Ga0070666_100159092 466
192 3300005338 Ga0068868_100086366 Ga0068868_1000863662 466
193 3300005339 Ga0070660_100003556 Ga0070660_1000035566 466
194 3300005340 Ga0070689_100040742 Ga0070689_1000407422 466
195 3300005341 Ga0070691_10000598 Ga0070691_1000059812 466
196 3300005347 Ga0070668_100005970 Ga0070668_1000059705 466
197 3300005353 Ga0070669_100000779 Ga0070669_10000077922 466
198 3300005356 Ga0070674_100001339 Ga0070674_1000013391 466
199 3300005364 Ga0070673_100001171 Ga0070673_10000117114 466
200 3300005366 Ga0070659_100001082 Ga0070659_10000108222 466
201 3300005367 Ga0070667_100121803 Ga0070667_1001218032 466
202 3300005441 Ga0070700_100053233 Ga0070700_1000532333 466
203 3300005457 Ga0070662_100000059 Ga0070662_10000005924 466
204 3300005458 Ga0070681_10032587 Ga0070681_100325871 466
205 3300005459 Ga0068867_100000588 Ga0068867_10000058820 466
206 3300005535 Ga0070684_100149560 Ga0070684_1001495602 466
207 3300005543 Ga0070672_100000683 Ga0070672_1000006838 466
208 3300005546 Ga0070696_100000917 Ga0070696_1000009172 466
209 3300005549 Ga0070704_100131554 Ga0070704_1001315541 466
210 3300005578 Ga0068854_100028452 Ga0068854_1000284522 466
211 3300005718 Ga0068866_10019056 Ga0068866_100190562 466
212 3300005843 Ga0068860_100014459 Ga0068860_1000144596 466
213 3300006058 Ga0075432_10000012 Ga0075432_1000001217 466
214 3300006237 Ga0097621_100021799 Ga0097621_1000217994 466
215 3300006358 Ga0068871_100019039 Ga0068871_1000190394 466
216 3300006844 Ga0075428_100051320 Ga0075428_1000513202 466
217 3300006847 Ga0075431_100004053 Ga0075431_1000040531 466
218 3300006852 Ga0075433_10006279 Ga0075433_100062793 466
219 3300006880 Ga0075429_100041774 Ga0075429_1000417742 466
220 3300006881 Ga0068865_100003182 Ga0068865_1000031828 466
221 3300007076 Ga0075435_100022656 Ga0075435_1000226565 466
222 3300009093 Ga0105240_10067174 Ga0105240_100671742 466
223 3300009094 Ga0111539_10013844 Ga0111539_100138448 466
224 3300009098 Ga0105245_10016534 Ga0105245_100165346 466
225 3300009147 Ga0114129_10020244 Ga0114129_100202446 466
226 3300009148 Ga0105243_10001690 Ga0105243_100016906 466
227 3300009176 Ga0105242_10000834 Ga0105242_100008342 466
228 3300010375 Ga0105239_10012398 Ga0105239_100123985 466
229 3300011119 Ga0105246_10000428 Ga0105246_1000042821 466
230 3300013296 Ga0157374_10005053 Ga0157374_1000505310 466
231 3300013297 Ga0157378_10056594 Ga0157378_100565941 466
232 3300013306 Ga0163162_10013512 Ga0163162_100135126 466
233 3300013308 Ga0157375_10072169 Ga0157375_100721692 466
234 3300014969 Ga0157376_10005228 Ga0157376_100052286 466
235 3300025899 Ga0207642_10011312 Ga0207642_100113122 466
236 3300025901 Ga0207688_10007275 Ga0207688_100072752 466
237 3300025903 Ga0207680_10008088 Ga0207680_100080883 466
238 3300025907 Ga0207645_10000009 Ga0207645_1000000945 466
239 3300025918 Ga0207662_10015073 Ga0207662_100150733 466
240 3300025919 Ga0207657_10005067 Ga0207657_100050673 466
241 3300025920 Ga0207649_10013648 Ga0207649_100136484 466
242 3300025923 Ga0207681_10001771 Ga0207681_1000177114 466
243 3300025925 Ga0207650_10026204 Ga0207650_100262043 466
244 3300025926 Ga0207659_10001981 Ga0207659_100019819 466
245 3300025927 Ga0207687_10063307 Ga0207687_100633072 466
246 3300025931 Ga0207644_10054530 Ga0207644_100545302 466
247 3300025933 Ga0207706_10000134 Ga0207706_1000013454 466
248 3300025934 Ga0207686_10006468 Ga0207686_100064684 466
249 3300025936 Ga0207670_10019416 Ga0207670_100194162 466
250 3300025937 Ga0207669_10042504 Ga0207669_100425043 466
251 3300025938 Ga0207704_10009221 Ga0207704_100092213 466
252 3300025940 Ga0207691_10000066 Ga0207691_1000006642 466
253 3300025942 Ga0207689_10004460 Ga0207689_100044602 466
254 3300025944 Ga0207661_10085137 Ga0207661_100851372 466
255 3300025945 Ga0207679_10000931 Ga0207679_100009316 466
256 3300025960 Ga0207651_10013780 Ga0207651_100137803 466
257 3300025981 Ga0207640_10029086 Ga0207640_100290862 466
258 3300025986 Ga0207658_10017783 Ga0207658_100177833 466
259 3300026023 Ga0207677_10027785 Ga0207677_100277852 466
260 3300026067 Ga0207678_10135373 Ga0207678_101353732 466
261 3300026075 Ga0207708_10000336 Ga0207708_1000033628 466
262 3300026089 Ga0207648_10000049 Ga0207648_1000004982 466
263 3300026116 Ga0207674_10031517 Ga0207674_100315173 466
264 3300026121 Ga0207683_10000023 Ga0207683_1000002351 466
265 3300027360 Ga0209969_1000683 Ga0209969_10006832 466
266 3300027364 Ga0209967_1000047 Ga0209967_100004714 466
267 3300027378 Ga0209981_1000336 Ga0209981_10003364 466
268 3300027395 Ga0209996_1000225 Ga0209996_10002253 466
269 3300027424 Ga0209984_1000396 Ga0209984_10003962 466
270 3300027462 Ga0210000_1000180 Ga0210000_10001802 466
271 3300027471 Ga0209995_1000150 Ga0209995_10001507 466
272 3300027526 Ga0209968_1000036 Ga0209968_100003627 466
273 3300027614 Ga0209970_1000719 Ga0209970_10007192 466
274 3300027682 Ga0209971_1000062 Ga0209971_100006229 466
275 3300027695 Ga0209966_1000210 Ga0209966_100021023 466
276 3300027717 Ga0209998_10000030 Ga0209998_1000003046 466
277 3300027876 Ga0209974_10000386 Ga0209974_100003864 466
278 3300027907 Ga0207428_10001516 Ga0207428_100015166 466
279 3300031251 Ga0265327_10000719 Ga0265327_1000071915 466
280 3300045051 Ga0451576_0237968 Ga0451576_0237968_389_1807 466
281 3300050507 nmdc:mga05p37_28711_c1 nmdc:mga05p37_28711_c1_556_1974 466
282 3300050509 nmdc:mga0qj67_56868_c1 nmdc:mga0qj67_56868_c1_738_2156 466
283 3300050511 nmdc:mga08y16_5521_c1 nmdc:mga08y16_5521_c1_11062_12480 466
284 3300050512 nmdc:mga0n895_42530_c1 nmdc:mga0n895_42530_c1_1089_2507 466
285 3300050513 nmdc:mga0rr50_14167_c1 nmdc:mga0rr50_14167_c1_3458_4876 466
286 3300050515 nmdc:mga0a205_10309_c1 nmdc:mga0a205_10309_c1_6083_7501 466
287 3300035092 Ga0373952_0000324 Ga0373952_0000324_5728_7164 467
288 3300035121 Ga0373960_0019946 Ga0373960_0019946_56_1492 467
289 3300046506 Ga0495583_0000222 Ga0495583_0000222_71239_72678 467
290 3300049572 Ga0501036_0019186 Ga0501036_0019186_2762_4183 467
291 3300049575 Ga0501039_0141383 Ga0501039_0141383_62_1483 467
292 3300049577 Ga0501041_0032501 Ga0501041_0032501_345_1766 467
293 3300049582 Ga0501048_0068156 Ga0501048_0068156_991_2412 467
294 3300049584 Ga0501068_0056185 Ga0501068_0056185_901_2322 467
295 3300049585 Ga0501069_0055790 Ga0501069_0055790_446_1867 467
296 3300049588 Ga0501072_0083304 Ga0501072_0083304_414_1835 467
297 3300049590 Ga0501074_0033222 Ga0501074_0033222_2246_3667 467
298 3300049591 Ga0501075_0037193 Ga0501075_0037193_851_2272 467
299 3300049592 Ga0501076_0082045 Ga0501076_0082045_795_2216 467
300 3300049593 Ga0501077_0019179 Ga0501077_0019179_2580_4001 467
301 3300049741 Ga0501079_0032234 Ga0501079_0032234_406_1827 467
302 3300049742 Ga0501080_0060090 Ga0501080_0060090_1890_3311 467
303 3300005290 Ga0065712_10096373 Ga0065712_100963732 468
304 3300005330 Ga0070690_100001012 Ga0070690_10000101211 468
305 3300005330 Ga0070690_100012031 Ga0070690_1000120315 468
306 3300005334 Ga0068869_100124717 Ga0068869_1001247171 468
307 3300005340 Ga0070689_100000070 Ga0070689_10000007051 468
308 3300005340 Ga0070689_100042986 Ga0070689_1000429862 468
309 3300005343 Ga0070687_100013134 Ga0070687_1000131342 468
310 3300005365 Ga0070688_100000006 Ga0070688_10000000679 468
311 3300005438 Ga0070701_10000161 Ga0070701_1000016110 468
312 3300005441 Ga0070700_100000390 Ga0070700_10000039010 468
313 3300005444 Ga0070694_100029065 Ga0070694_1000290651 468
314 3300005444 Ga0070694_100075087 Ga0070694_1000750873 468
315 3300005466 Ga0070685_10000693 Ga0070685_1000069311 468
316 3300005467 Ga0070706_100035202 Ga0070706_1000352024 468
317 3300005468 Ga0070707_100000032 Ga0070707_10000003213 468
318 3300005468 Ga0070707_100082597 Ga0070707_1000825972 468
319 3300005468 Ga0070707_100193040 Ga0070707_1001930401 468
320 3300005471 Ga0070698_100097369 Ga0070698_1000973693 468
321 3300005518 Ga0070699_100005467 Ga0070699_1000054674 468
322 3300005518 Ga0070699_100049858 Ga0070699_1000498584 468
323 3300005536 Ga0070697_100035617 Ga0070697_1000356172 468
324 3300005536 Ga0070697_100055367 Ga0070697_1000553671 468
325 3300005544 Ga0070686_100000897 Ga0070686_1000008976 468
326 3300005544 Ga0070686_100002011 Ga0070686_1000020117 468
327 3300005545 Ga0070695_100027086 Ga0070695_1000270864 468
328 3300005564 Ga0070664_100002039 Ga0070664_1000020398 468
329 3300005615 Ga0070702_100047359 Ga0070702_1000473591 468
330 3300005719 Ga0068861_100057108 Ga0068861_1000571082 468
331 3300007076 Ga0075435_100054284 Ga0075435_1000542842 468
332 3300009098 Ga0105245_10067537 Ga0105245_100675372 468
333 3300009147 Ga0114129_10003723 Ga0114129_1000372310 468
334 3300009176 Ga0105242_10033981 Ga0105242_100339812 468
335 3300009176 Ga0105242_10156871 Ga0105242_101568711 468
336 3300009177 Ga0105248_10004494 Ga0105248_100044949 468
337 3300013296 Ga0157374_10003255 Ga0157374_1000325513 468
338 3300014326 Ga0157380_10003948 Ga0157380_100039485 468
339 3300014326 Ga0157380_10033827 Ga0157380_100338272 468
340 3300021361 Ga0213872_10003726 Ga0213872_100037264 468
341 3300021361 Ga0213872_10027058 Ga0213872_100270582 468
342 3300025903 Ga0207680_10021987 Ga0207680_100219871 468
343 3300025910 Ga0207684_10041172 Ga0207684_100411721 468
344 3300025912 Ga0207707_10106442 Ga0207707_101064422 468
345 3300025917 Ga0207660_10005324 Ga0207660_100053244 468
346 3300025918 Ga0207662_10020619 Ga0207662_100206192 468
347 3300025922 Ga0207646_10000032 Ga0207646_1000003255 468
348 3300025922 Ga0207646_10063723 Ga0207646_100637232 468
349 3300025936 Ga0207670_10000160 Ga0207670_1000016011 468
350 3300025940 Ga0207691_10047442 Ga0207691_100474422 468
351 3300025941 Ga0207711_10005430 Ga0207711_100054301 468
352 3300025945 Ga0207679_10010190 Ga0207679_100101906 468
353 3300026075 Ga0207708_10001429 Ga0207708_100014299 468
354 3300026075 Ga0207708_10063040 Ga0207708_100630401 468
355 3300026089 Ga0207648_10003565 Ga0207648_100035657 468
356 3300031251 Ga0265327_10020927 Ga0265327_100209272 468
357 3300031344 Ga0265316_10000005 Ga0265316_100000057 468
358 3300035120 Ga0373957_0045731 Ga0373957_0045731_143_1570 468
359 3300035692 Ga0373935_0086873 Ga0373935_0086873_165_1592 468
360 3300036401 Ga0373937_0045752 Ga0373937_0045752_567_1994 468
361 3300037068 Ga0373925_0114893 Ga0373925_0114893_628_2055 468
362 3300039447 Ga0436361_0257895 Ga0436361_0257895_2852_4285 468
363 3300039447 Ga0436361_0545153 Ga0436361_0545153_2851_4284 468
364 3300045051 Ga0451576_0008254 Ga0451576_0008254_6374_7792 468
365 3300046499 Ga0495594_0006120 Ga0495594_0006120_815_2242 468
366 3300046536 Ga0495587_0062895 Ga0495587_0062895_701_2128 468
367 3300050507 nmdc:mga05p37_21279_c1 nmdc:mga05p37_21279_c1_305_1714 468
368 3300050509 nmdc:mga0qj67_4478_c1 nmdc:mga0qj67_4478_c1_8194_9612 468
369 3300050515 nmdc:mga0a205_119880_c1 nmdc:mga0a205_119880_c1_1066_2475 468
370 3300053085 Ga0495619_0047189 Ga0495619_0047189_1384_2811 468
371 3300053085 Ga0495619_0108036 Ga0495619_0108036_422_1837 468
372 3300059426 Ga0590077_008026 Ga0590077_008026_61_1479 468
373 iso_pu_bacteria 2574179768 2574432118 468
374 iso_pu_bacteria 2643221556 2643800528 468
375 iso_pu_bacteria 2643221684 2644470437 468
376 iso_pu_bacteria 2808606418 2809144042 468
377 iso_pu_bacteria 2891633521 2891633621 468
378 iso_pu_bacteria 8047673197 8047678833 468
379 3300003759 Ga0055525_1000081 Ga0055525_1000081117 469
380 3300005549 Ga0070704_100025964 Ga0070704_1000259643 469
381 3300005937 Ga0081455_10000900 Ga0081455_1000090031 469
382 3300009147 Ga0114129_10016942 Ga0114129_100169427 469
383 3300009551 Ga0105238_10000258 Ga0105238_1000025848 469
384 3300013296 Ga0157374_10201938 Ga0157374_102019382 469
385 3300021361 Ga0213872_10000093 Ga0213872_1000009325 469
386 3300025230 Ga0209563_100015 Ga0209563_100015671 469
387 3300025253 Ga0209677_104484 Ga0209677_1044842 469
388 3300025917 Ga0207660_10032198 Ga0207660_100321982 469
389 3300031250 Ga0265331_10022219 Ga0265331_100222192 469
390 3300031251 Ga0265327_10003120 Ga0265327_100031208 469
391 3300037312 Ga0395899_0024592 Ga0395899_0024592_1489_2946 469
392 3300037312 Ga0395899_0042010 Ga0395899_0042010_343_1800 469
393 3300037312 Ga0395899_0108211 Ga0395899_0108211_489_1946 469
394 3300037418 Ga0395900_0167746 Ga0395900_0167746_238_1695 469
395 3300037471 Ga0395905_0087784 Ga0395905_0087784_773_2230 469
396 3300039447 Ga0436361_0773293 Ga0436361_0773293_9951_11423 469
397 3300039447 Ga0436361_1049300 Ga0436361_1049300_1527_2951 469
398 3300044656 Ga0466969_0039336 Ga0466969_0039336_368_1825 469
399 3300044693 Ga0466961_0019077 Ga0466961_0019077_1234_2691 469
400 3300044706 Ga0466964_0000097 Ga0466964_0000097_14209_15687 469
401 3300045049 Ga0466959_0038347 Ga0466959_0038347_1872_3329 469
402 3300045836 Ga0466958_0052313 Ga0466958_0052313_454_1911 469
403 3300046452 Ga0495617_000125 Ga0495617_000125_38252_39709 469
404 3300046457 Ga0495590_0002849 Ga0495590_0002849_2907_4358 469
405 3300046463 Ga0495653_0041728 Ga0495653_0041728_1176_2627 469
406 3300046463 Ga0495653_0116134 Ga0495653_0116134_43_1494 469
407 3300046472 Ga0495580_0036217 Ga0495580_0036217_399_1850 469
408 3300046473 Ga0495582_0000662 Ga0495582_0000662_1694_3145 469
409 3300046474 Ga0495605_0000845 Ga0495605_0000845_10551_12008 469
410 3300046491 Ga0495584_0032982 Ga0495584_0032982_539_2071 469
411 3300046492 Ga0495585_0003922 Ga0495585_0003922_1598_3061 469
412 3300046492 Ga0495585_0020428 Ga0495585_0020428_1076_2539 469
413 3300046499 Ga0495594_0038603 Ga0495594_0038603_798_2249 469
414 3300046499 Ga0495594_0060699 Ga0495594_0060699_317_1774 469
415 3300046500 Ga0495596_0004535 Ga0495596_0004535_1241_2698 469
416 3300046500 Ga0495596_0005727 Ga0495596_0005727_3296_4753 469
417 3300046501 Ga0495607_0000004 Ga0495607_0000004_95521_97011 469
418 3300046501 Ga0495607_0001408 Ga0495607_0001408_10551_12008 469
419 3300046507 Ga0495606_0018114 Ga0495606_0018114_226_1686 469
420 3300046518 Ga0495631_0001168 Ga0495631_0001168_6084_7541 469
421 3300046523 Ga0495644_0019602 Ga0495644_0019602_167_1624 469
422 3300046523 Ga0495644_0022177 Ga0495644_0022177_131_1588 469
423 3300046524 Ga0495648_0000612 Ga0495648_0000612_1768_3225 469
424 3300046526 Ga0495666_0000791 Ga0495666_0000791_7567_9027 469
425 3300046526 Ga0495666_0006131 Ga0495666_0006131_2916_4367 469
426 3300046528 Ga0495642_0013263 Ga0495642_0013263_35_1492 469
427 3300046529 Ga0495652_0064084 Ga0495652_0064084_747_2198 469
428 3300046531 Ga0495665_0003210 Ga0495665_0003210_5584_7035 469
429 3300046535 Ga0495586_0028232 Ga0495586_0028232_1212_2663 469
430 3300046536 Ga0495587_0087071 Ga0495587_0087071_125_1576 469
431 3300046557 Ga0495622_0010883 Ga0495622_0010883_1388_2848 469
432 3300046558 Ga0495633_0006611 Ga0495633_0006611_2462_3925 469
433 3300046615 Ga0495656_0004470 Ga0495656_0004470_2305_3762 469
434 3300046642 Ga0495634_0106344 Ga0495634_0106344_213_1664 469
435 3300046665 Ga0495661_0005396 Ga0495661_0005396_5033_6496 469
436 3300046674 Ga0495588_0013718 Ga0495588_0013718_1617_3068 469
437 3300046679 Ga0495623_0018146 Ga0495623_0018146_2464_3915 469
438 3300046691 Ga0495670_0005460 Ga0495670_0005460_3050_4513 469
439 3300046691 Ga0495670_0019346 Ga0495670_0019346_1100_2557 469
440 3300046794 Ga0495589_0001297 Ga0495589_0001297_907_2364 469
441 3300046809 Ga0495600_0021920 Ga0495600_0021920_483_1934 469
442 3300047315 Ga0495581_0001061 Ga0495581_0001061_8073_9533 469
443 3300047315 Ga0495581_0005818 Ga0495581_0005818_1665_3122 469
444 3300047317 Ga0495604_0040469 Ga0495604_0040469_798_2249 469
445 3300047445 Ga0495677_0007440 Ga0495677_0007440_1620_3077 469
446 3300047470 Ga0495681_0000511 Ga0495681_0000511_11681_13138 469
447 3300047470 Ga0495681_0003757 Ga0495681_0003757_7810_9267 469
448 3300047472 Ga0495686_0000285 Ga0495686_0000285_65089_66546 469
449 3300048088 Ga0495602_0001988 Ga0495602_0001988_9907_11358 469
450 3300048089 Ga0495614_0008722 Ga0495614_0008722_1615_3072 469
451 3300048091 Ga0495626_0000613 Ga0495626_0000613_10021_11472 469
452 3300048903 Ga0496100_0074995 Ga0496100_0074995_376_1833 469
453 3300048906 Ga0496103_0006831 Ga0496103_0006831_1853_3310 469
454 3300048912 Ga0496109_0006786 Ga0496109_0006786_5154_6611 469
455 3300048915 Ga0496112_0069132 Ga0496112_0069132_210_1667 469
456 3300048916 Ga0496113_0009852 Ga0496113_0009852_3743_5200 469
457 3300048919 Ga0496116_0030764 Ga0496116_0030764_1402_2811 469
458 3300048924 Ga0496121_0123323 Ga0496121_0123323_374_1831 469
459 3300048925 Ga0496122_0001645 Ga0496122_0001645_19303_20760 469
460 3300048926 Ga0496123_0002540 Ga0496123_0002540_19793_21250 469
461 3300048928 Ga0496125_0001339 Ga0496125_0001339_19066_20523 469
462 3300049459 Ga0495678_007426 Ga0495678_007426_957_2426 469
463 3300050507 nmdc:mga05p37_11314_c1 nmdc:mga05p37_11314_c1_7793_9226 469
464 iso_pu_bacteria 2939631187 2939634185 469
465 3300005545 Ga0070695_100077990 Ga0070695_1000779902 470
466 3300005546 Ga0070696_100002873 Ga0070696_1000028736 470
467 3300031251 Ga0265327_10044401 Ga0265327_100444012 470
468 3300031251 Ga0265327_10073494 Ga0265327_100734942 470
469 3300045051 Ga0451576_0019765 Ga0451576_0019765_4380_5867 470
470 3300046522 Ga0495643_0002098 Ga0495643_0002098_10700_12130 470
471 3300046665 Ga0495661_0004703 Ga0495661_0004703_4393_5823 470
472 3300047443 Ga0495687_007801 Ga0495687_007801_2181_3611 470
473 3300005355 Ga0070671_100053012 Ga0070671_1000530122 471
474 3300009094 Ga0111539_10000106 Ga0111539_1000010633 471
475 3300025919 Ga0207657_10102751 Ga0207657_101027512 471
476 3300027907 Ga0207428_10007796 Ga0207428_100077966 471
477 3300031251 Ga0265327_10006214 Ga0265327_100062143 471
478 3300031730 Ga0307516_10002741 Ga0307516_1000274119 471
479 3300037312 Ga0395899_0023327 Ga0395899_0023327_301_1797 471
480 3300037312 Ga0395899_0097786 Ga0395899_0097786_298_1794 471
481 3300037418 Ga0395900_0040940 Ga0395900_0040940_799_2295 471
482 3300037471 Ga0395905_0014548 Ga0395905_0014548_531_1985 471
483 3300038443 Ga0395901_0060610 Ga0395901_0060610_1541_3037 471
484 3300044656 Ga0466969_0019979 Ga0466969_0019979_1047_2486 471
485 3300044658 Ga0466972_0000359 Ga0466972_0000359_14913_16376 471
486 3300044666 Ga0466977_0013105 Ga0466977_0013105_1911_3350 471
487 3300047318 Ga0495636_0023321 Ga0495636_0023321_781_2235 471
488 3300048905 Ga0496102_0000544 Ga0496102_0000544_11292_12758 471
489 3300049571 Ga0501034_0050002 Ga0501034_0050002_1329_2768 471
490 3300049823 Ga0501044_0111665 Ga0501044_0111665_679_2175 471
491 iso_pu_bacteria 2511231026 2511384922 471
492 iso_pu_bacteria 2643221544 2643743826 471
493 iso_pu_bacteria 2643221585 2643937216 471
494 iso_pu_bacteria 2643221603 2644027150 471
495 iso_pu_bacteria 2643221656 2644318381 471
496 iso_pu_bacteria 2738541337 2739056453 471
497 3300003771 Ga0055526_1000651 Ga0055526_10006514 472
498 3300005337 Ga0070682_100039419 Ga0070682_1000394193 472
499 3300005337 Ga0070682_100096002 Ga0070682_1000960022 472
500 3300005339 Ga0070660_100004636 Ga0070660_1000046362 472
501 3300005344 Ga0070661_100005481 Ga0070661_1000054814 472
502 3300005364 Ga0070673_100153218 Ga0070673_1001532181 472
503 3300005366 Ga0070659_100001965 Ga0070659_10000196511 472
504 3300005455 Ga0070663_100014804 Ga0070663_1000148041 472
505 3300005456 Ga0070678_100075262 Ga0070678_1000752622 472
506 3300005564 Ga0070664_100018224 Ga0070664_1000182244 472
507 3300005577 Ga0068857_100130134 Ga0068857_1001301342 472
508 3300005617 Ga0068859_100187125 Ga0068859_1001871252 472
509 3300005842 Ga0068858_100003164 Ga0068858_1000031646 472
510 3300005842 Ga0068858_100026292 Ga0068858_1000262923 472
511 3300006051 Ga0075364_10051700 Ga0075364_100517002 472
512 3300006195 Ga0075366_10008423 Ga0075366_100084235 472
513 3300006195 Ga0075366_10020793 Ga0075366_100207934 472
514 3300006237 Ga0097621_100173286 Ga0097621_1001732862 472
515 3300006931 Ga0097620_100187119 Ga0097620_1001871192 472
516 3300009094 Ga0111539_10006915 Ga0111539_1000691513 472
517 3300009148 Ga0105243_10083206 Ga0105243_100832062 472
518 3300009176 Ga0105242_10000115 Ga0105242_1000011518 472
519 3300009177 Ga0105248_10020966 Ga0105248_100209662 472
520 3300009177 Ga0105248_10042075 Ga0105248_100420753 472
521 3300013105 Ga0157369_10111531 Ga0157369_101115312 472
522 3300013296 Ga0157374_10110758 Ga0157374_101107582 472
523 3300013308 Ga0157375_10096306 Ga0157375_100963062 472
524 3300025920 Ga0207649_10009607 Ga0207649_100096073 472
525 3300025932 Ga0207690_10001518 Ga0207690_100015184 472
526 3300025933 Ga0207706_10052507 Ga0207706_100525072 472
527 3300025934 Ga0207686_10033668 Ga0207686_100336682 472
528 3300025935 Ga0207709_10095548 Ga0207709_100955481 472
529 3300025935 Ga0207709_10123125 Ga0207709_101231251 472
530 3300025936 Ga0207670_10011882 Ga0207670_100118823 472
531 3300025940 Ga0207691_10151284 Ga0207691_101512842 472
532 3300025945 Ga0207679_10015279 Ga0207679_100152794 472
533 3300026035 Ga0207703_10036652 Ga0207703_100366523 472
534 3300026067 Ga0207678_10004674 Ga0207678_100046747 472
535 3300026075 Ga0207708_10071162 Ga0207708_100711622 472
536 3300026116 Ga0207674_10037920 Ga0207674_100379203 472
537 3300027907 Ga0207428_10006322 Ga0207428_1000632211 472
538 3300028379 Ga0268266_10085640 Ga0268266_100856402 472
539 3300031241 Ga0265325_10007301 Ga0265325_100073014 472
540 3300031548 Ga0307408_100000023 Ga0307408_10000002366 472
541 3300037312 Ga0395899_0002272 Ga0395899_0002272_13963_15432 472
542 3300042876 Ga0451577_0000085 Ga0451577_0000085_18897_20369 472
543 3300044658 Ga0466972_0017061 Ga0466972_0017061_621_2084 472
544 3300044673 Ga0453683_0000047 Ga0453683_0000047_15519_16991 472
545 3300044684 Ga0466966_0036339 Ga0466966_0036339_1420_2892 472
546 3300044712 Ga0453684_0000273 Ga0453684_0000273_205537_207012 472
547 3300044712 Ga0453684_0000302 Ga0453684_0000302_190773_192245 472
548 3300045051 Ga0451576_0000116 Ga0451576_0000116_15519_16991 472
549 3300045051 Ga0451576_0103230 Ga0451576_0103230_1234_2673 472
550 3300045976 Ga0466967_0057073 Ga0466967_0057073_141_1589 472
551 3300046454 Ga0495592_0020784 Ga0495592_0020784_3364_4794 472
552 3300046462 Ga0495651_0084410 Ga0495651_0084410_605_2035 472
553 3300046507 Ga0495606_0019130 Ga0495606_0019130_2102_3535 472
554 3300046511 Ga0495608_0023686 Ga0495608_0023686_1328_2758 472
555 3300046536 Ga0495587_0072105 Ga0495587_0072105_484_1914 472
556 3300046559 Ga0495667_0091051 Ga0495667_0091051_185_1615 472
557 3300046675 Ga0495657_0060037 Ga0495657_0060037_730_2160 472
558 3300048912 Ga0496109_0113160 Ga0496109_0113160_663_2132 472
559 3300049568 Ga0501031_0045375 Ga0501031_0045375_192_1637 472
560 3300049656 Ga0501209_001129 Ga0501209_001129_1811_3304 472
561 3300050491 nmdc:mga00v17_26544_c1 nmdc:mga00v17_26544_c1_1612_3042 472
562 3300050493 nmdc:mga0k408_12676_c1 nmdc:mga0k408_12676_c1_186_1616 472
563 3300050493 nmdc:mga0k408_3408_c1 nmdc:mga0k408_3408_c1_726_2189 472
564 3300050511 nmdc:mga08y16_2953_c1 nmdc:mga08y16_2953_c1_10086_11516 472
565 3300050516 nmdc:mga0sz30_14682_c1 nmdc:mga0sz30_14682_c1_946_2376 472
566 3300053096 Ga0500641_0054808 Ga0500641_0054808_65_1495 472
567 3300005337 Ga0070682_100078636 Ga0070682_1000786362 473
568 3300006946 Ga0079104_1002487 Ga0079104_10024877 473
569 3300027111 Ga0209281_1003184 Ga0209281_10031844 473
570 3300031665 Ga0316575_10005752 Ga0316575_100057522 473
571 3300031691 Ga0316579_10000015 Ga0316579_100000154 473
572 3300032133 Ga0316583_10000483 Ga0316583_100004832 473
573 3300032133 Ga0316583_10004823 Ga0316583_100048233 473
574 3300035119 Ga0373956_0036076 Ga0373956_0036076_585_2027 473
575 3300035172 Ga0373955_0013547 Ga0373955_0013547_93_1535 473
576 3300035410 Ga0373924_0007992 Ga0373924_0007992_1600_3042 473
577 3300035724 Ga0373933_0002452 Ga0373933_0002452_7250_8692 473
578 3300036647 Ga0316582_0003674 Ga0316582_0003674_4219_5664 473
579 3300037471 Ga0395905_0000043 Ga0395905_0000043_155572_157044 473
580 3300037471 Ga0395905_0056374 Ga0395905_0056374_1013_2485 473
581 3300038443 Ga0395901_0005833 Ga0395901_0005833_519_1988 473
582 3300038443 Ga0395901_0077433 Ga0395901_0077433_733_2205 473
583 3300038726 Ga0400490_21110 Ga0400490_21110_121_1584 473
584 3300041404 Ga0439436_0024218 Ga0439436_0024218_17_1504 473
585 3300044673 Ga0453683_0006123 Ga0453683_0006123_1871_3352 473
586 3300044712 Ga0453684_0038837 Ga0453684_0038837_2909_4363 473
587 3300045051 Ga0451576_0019294 Ga0451576_0019294_3235_4692 473
588 3300045051 Ga0451576_0025801 Ga0451576_0025801_3125_4606 473
589 3300047322 Ga0495680_0061285 Ga0495680_0061285_1401_2843 473
590 iso_pu_bacteria 2511231003 2511248687 473
591 iso_pu_bacteria 2818991445 2819594916 473
592 iso_pu_bacteria 2843690924 2843691366 473
593 3300005331 Ga0070670_100000054 Ga0070670_10000005470 474
594 3300005335 Ga0070666_10008897 Ga0070666_100088974 474
595 3300005353 Ga0070669_100002303 Ga0070669_1000023039 474
596 3300005355 Ga0070671_100000037 Ga0070671_10000003744 474
597 3300005367 Ga0070667_100000002 Ga0070667_100000002424 474
598 3300005466 Ga0070685_10000014 Ga0070685_1000001464 474
599 3300005548 Ga0070665_100079228 Ga0070665_1000792282 474
600 3300005617 Ga0068859_100046115 Ga0068859_1000461153 474
601 3300005618 Ga0068864_100000002 Ga0068864_10000000249 474
602 3300005843 Ga0068860_100000844 Ga0068860_10000084410 474
603 3300006931 Ga0097620_100046114 Ga0097620_1000461142 474
604 3300009101 Ga0105247_10042854 Ga0105247_100428542 474
605 3300009553 Ga0105249_10107901 Ga0105249_101079012 474
606 3300014325 Ga0163163_10004619 Ga0163163_100046192 474
607 3300025900 Ga0207710_10029853 Ga0207710_100298531 474
608 3300025903 Ga0207680_10017073 Ga0207680_100170733 474
609 3300025923 Ga0207681_10001840 Ga0207681_100018408 474
610 3300025925 Ga0207650_10000002 Ga0207650_1000000249 474
611 3300025931 Ga0207644_10000114 Ga0207644_1000011452 474
612 3300025961 Ga0207712_10118138 Ga0207712_101181381 474
613 3300025986 Ga0207658_10000001 Ga0207658_100000011305 474
614 3300026088 Ga0207641_10010053 Ga0207641_100100532 474
615 3300026088 Ga0207641_10010055 Ga0207641_100100552 474
616 3300026095 Ga0207676_10000001 Ga0207676_1000000149 474
617 3300028379 Ga0268266_10056565 Ga0268266_100565652 474
618 3300028380 Ga0268265_10009824 Ga0268265_100098244 474
619 3300028381 Ga0268264_10000004 Ga0268264_1000000446 474
620 3300031251 Ga0265327_10000068 Ga0265327_1000006899 474
621 3300031251 Ga0265327_10008435 Ga0265327_100084357 474
622 3300042876 Ga0451577_0019578 Ga0451577_0019578_2234_3748 474
623 3300044712 Ga0453684_0000276 Ga0453684_0000276_77913_79427 474
624 3300044712 Ga0453684_0034104 Ga0453684_0034104_1563_3077 474
625 3300045051 Ga0451576_0001472 Ga0451576_0001472_24932_26446 474
626 3300045051 Ga0451576_0071239 Ga0451576_0071239_1563_3077 474
627 3300049568 Ga0501031_0009138 Ga0501031_0009138_624_2078 474
628 3300049569 Ga0501032_0100497 Ga0501032_0100497_380_1834 474
629 3300049577 Ga0501041_0018228 Ga0501041_0018228_452_1906 474
630 3300049580 Ga0501046_0001975 Ga0501046_0001975_11412_12866 474
631 3300049581 Ga0501047_0109279 Ga0501047_0109279_924_2471 474
632 3300049822 Ga0501035_0075320 Ga0501035_0075320_606_2060 474
633 3300053177 Ga0500636_0000250 Ga0500636_0000250_12076_13569 474
634 iso_pu_bacteria 2513237150 2513953929 474
635 iso_pu_bacteria 2513237165 2514040064 474
636 iso_pu_bacteria 2834641062 2834641195 474
637 iso_pu_bacteria 2901300506 2901309945 474
638 iso_pu_bacteria 644736347 644746724 474
639 iso_pu_bacteria 8003400568 8003403938 474
640 3300002704 JGI25155J39150_1000205 JGI25155J39150_10002056 475
641 3300002704 JGI25155J39150_1000224 JGI25155J39150_100022417 475
642 3300002704 JGI25155J39150_1000386 JGI25155J39150_100038610 475
643 3300002705 JGI25156J39149_1000357 JGI25156J39149_100035717 475
644 3300002705 JGI25156J39149_1002757 JGI25156J39149_10027574 475
645 3300002738 JGI25154J39366_1000298 JGI25154J39366_100029817 475
646 3300002738 JGI25154J39366_1000314 JGI25154J39366_100031418 475
647 3300002741 JGI25157J39369_1000262 JGI25157J39369_10002624 475
648 3300002741 JGI25157J39369_1000702 JGI25157J39369_10007025 475
649 3300003320 rootH2_10038054 rootH2_1003805410 475
650 3300003758 Ga0055532_1000059 Ga0055532_100005916 475
651 3300005842 Ga0068858_100001596 Ga0068858_10000159626 475
652 3300006048 Ga0075363_100034682 Ga0075363_1000346822 475
653 3300025206 Ga0209435_100032 Ga0209435_100032124 475
654 3300025206 Ga0209435_100146 Ga0209435_1001465 475
655 3300025229 Ga0209147_100109 Ga0209147_100109124 475
656 3300025242 Ga0209258_100190 Ga0209258_10019097 475
657 3300025246 Ga0209646_1000113 Ga0209646_1000113124 475
658 3300025246 Ga0209646_1000327 Ga0209646_100032721 475
659 3300025250 Ga0209026_1000102 Ga0209026_1000102124 475
660 3300025250 Ga0209026_1003686 Ga0209026_10036862 475
661 3300025256 Ga0209759_1000104 Ga0209759_1000104124 475
662 3300025256 Ga0209759_1001952 Ga0209759_10019526 475
663 3300025272 Ga0209455_1005292 Ga0209455_10052922 475
664 3300025925 Ga0207650_10011570 Ga0207650_100115702 475
665 3300025939 Ga0207665_10095622 Ga0207665_100956222 475
666 3300026035 Ga0207703_10007101 Ga0207703_1000710110 475
667 3300036401 Ga0373937_0028631 Ga0373937_0028631_1569_3008 475
668 iso_pu_bacteria 2548876994 2550693494 475
669 iso_pu_bacteria 2596583598 2597030830 475
670 iso_pu_bacteria 2599185178 2599447060 475
671 iso_pu_bacteria 2884836552 2884838231 475
672 iso_pu_bacteria 2884852848 2884854523 475
673 iso_pu_bacteria 2885266251 2885268996 475
674 iso_pu_bacteria 2896154374 2896159220 475
675 iso_pu_bacteria 2900577576 2900582237 475
676 iso_pu_bacteria 2928058823 2928061237 475
677 iso_pu_bacteria 639633007 639785485 475
678 3300005331 Ga0070670_100007425 Ga0070670_1000074254 476
679 3300005338 Ga0068868_100045184 Ga0068868_1000451844 476
680 3300005354 Ga0070675_100013140 Ga0070675_1000131405 476
681 3300005356 Ga0070674_100006470 Ga0070674_1000064704 476
682 3300005364 Ga0070673_100000190 Ga0070673_10000019012 476
683 3300005543 Ga0070672_100000116 Ga0070672_10000011639 476
684 3300006237 Ga0097621_100021171 Ga0097621_1000211714 476
685 3300006358 Ga0068871_100075038 Ga0068871_1000750381 476
686 3300006847 Ga0075431_100092175 Ga0075431_1000921752 476
687 3300009093 Ga0105240_10052544 Ga0105240_100525443 476
688 3300009147 Ga0114129_10081280 Ga0114129_100812803 476
689 3300013297 Ga0157378_10005614 Ga0157378_100056143 476
690 3300014969 Ga0157376_10024880 Ga0157376_100248802 476
691 3300025907 Ga0207645_10009334 Ga0207645_100093344 476
692 3300025925 Ga0207650_10001415 Ga0207650_100014154 476
693 3300025926 Ga0207659_10002634 Ga0207659_100026348 476
694 3300025933 Ga0207706_10024959 Ga0207706_100249593 476
695 3300025940 Ga0207691_10000015 Ga0207691_1000001570 476
696 3300025960 Ga0207651_10000209 Ga0207651_1000020924 476
697 3300026121 Ga0207683_10000501 Ga0207683_1000050134 476
698 3300027360 Ga0209969_1001115 Ga0209969_10011154 476
699 3300028379 Ga0268266_10023623 Ga0268266_100236235 476
700 3300028800 Ga0265338_10093773 Ga0265338_100937732 476
701 3300029957 Ga0265324_10000340 Ga0265324_1000034012 476
702 3300029957 Ga0265324_10024393 Ga0265324_100243932 476
703 3300030521 Ga0307511_10000022 Ga0307511_1000002231 476
704 3300031250 Ga0265331_10003188 Ga0265331_1000318811 476
705 3300031251 Ga0265327_10001333 Ga0265327_100013336 476
706 3300031711 Ga0265314_10000134 Ga0265314_1000013411 476
707 3300031711 Ga0265314_10020023 Ga0265314_100200235 476
708 3300032002 Ga0307416_100050238 Ga0307416_1000502381 476
709 3300033179 Ga0307507_10047428 Ga0307507_100474282 476
710 3300048907 Ga0496104_0085381 Ga0496104_0085381_353_1801 476
711 3300048913 Ga0496110_0047848 Ga0496110_0047848_2145_3593 476
712 3300050508 nmdc:mga09592_84091_c1 nmdc:mga09592_84091_c1_904_2385 476
713 3300050510 nmdc:mga06r32_82324_c1 nmdc:mga06r32_82324_c1_168_1649 476
714 3300053090 Ga0500646_0000154 Ga0500646_0000154_17306_18826 476
715 3300005338 Ga0068868_100160142 Ga0068868_1001601421 477
716 3300005543 Ga0070672_100173255 Ga0070672_1001732551 477
717 3300005548 Ga0070665_100252100 Ga0070665_1002521002 477
718 3300005616 Ga0068852_100002180 Ga0068852_1000021807 477
719 3300005616 Ga0068852_100022134 Ga0068852_1000221342 477
720 3300005719 Ga0068861_100050758 Ga0068861_1000507581 477
721 3300005842 Ga0068858_100084998 Ga0068858_1000849982 477
722 3300006237 Ga0097621_100041534 Ga0097621_1000415342 477
723 3300006358 Ga0068871_100012101 Ga0068871_1000121016 477
724 3300006846 Ga0075430_100005824 Ga0075430_1000058246 477
725 3300006847 Ga0075431_100090819 Ga0075431_1000908191 477
726 3300009093 Ga0105240_10002549 Ga0105240_1000254922 477
727 3300009093 Ga0105240_10006370 Ga0105240_100063709 477
728 3300009094 Ga0111539_10125488 Ga0111539_101254883 477
729 3300009148 Ga0105243_10034506 Ga0105243_100345062 477
730 3300013100 Ga0157373_10042627 Ga0157373_100426272 477
731 3300014745 Ga0157377_10055886 Ga0157377_100558862 477
732 3300025321 Ga0207656_10002178 Ga0207656_100021786 477
733 3300025893 Ga0207682_10002916 Ga0207682_100029163 477
734 3300025899 Ga0207642_10038230 Ga0207642_100382302 477
735 3300025907 Ga0207645_10016845 Ga0207645_100168454 477
736 3300025908 Ga0207643_10018377 Ga0207643_100183772 477
737 3300025913 Ga0207695_10001571 Ga0207695_1000157114 477
738 3300025913 Ga0207695_10241708 Ga0207695_102417081 477
739 3300025925 Ga0207650_10034544 Ga0207650_100345443 477
740 3300025933 Ga0207706_10067903 Ga0207706_100679032 477
741 3300025941 Ga0207711_10192370 Ga0207711_101923702 477
742 3300025972 Ga0207668_10067417 Ga0207668_100674172 477
743 3300026075 Ga0207708_10015389 Ga0207708_100153894 477
744 3300026089 Ga0207648_10007583 Ga0207648_100075838 477
745 3300026095 Ga0207676_10008539 Ga0207676_100085394 477
746 3300026116 Ga0207674_10095295 Ga0207674_100952952 477
747 3300026142 Ga0207698_10000462 Ga0207698_1000046211 477
748 3300026142 Ga0207698_10000553 Ga0207698_100005532 477
749 3300028577 Ga0265318_10001430 Ga0265318_100014303 477
750 3300031239 Ga0265328_10002460 Ga0265328_100024603 477
751 3300031242 Ga0265329_10004482 Ga0265329_100044823 477
752 3300045051 Ga0451576_0000147 Ga0451576_0000147_158449_159945 477
753 3300048907 Ga0496104_0019038 Ga0496104_0019038_4374_5816 477
754 3300048913 Ga0496110_0070412 Ga0496110_0070412_121_1563 477
755 3300048919 Ga0496116_0007586 Ga0496116_0007586_2597_4048 477
756 3300048924 Ga0496121_0099040 Ga0496121_0099040_337_1800 477
757 3300048925 Ga0496122_0006420 Ga0496122_0006420_6171_7622 477
758 3300048926 Ga0496123_0005186 Ga0496123_0005186_5641_7092 477
759 3300049571 Ga0501034_0008163 Ga0501034_0008163_111_1550 477
760 3300049573 Ga0501037_0020623 Ga0501037_0020623_968_2413 477
761 3300049573 Ga0501037_0061841 Ga0501037_0061841_205_1650 477
762 3300049574 Ga0501038_0084344 Ga0501038_0084344_1175_2620 477
763 3300049575 Ga0501039_0005040 Ga0501039_0005040_2288_3733 477
764 3300049575 Ga0501039_0075842 Ga0501039_0075842_646_2100 477
765 3300049578 Ga0501042_0053358 Ga0501042_0053358_654_2099 477
766 3300049580 Ga0501046_0020030 Ga0501046_0020030_3903_5348 477
767 3300049581 Ga0501047_0160923 Ga0501047_0160923_68_1507 477
768 3300049582 Ga0501048_0045866 Ga0501048_0045866_854_2299 477
769 3300050510 nmdc:mga06r32_111951_c1 nmdc:mga06r32_111951_c1_1208_2650 477
770 iso_pu_bacteria 2521172590 2521560947 477
771 iso_pu_bacteria 2547132512 2548846380 477
772 iso_pu_bacteria 2551306416 2553006168 477
773 iso_pu_bacteria 2687453341 2688391132 477
774 iso_pu_bacteria 2765235838 2765567376 477
775 iso_pu_bacteria 2808606386 2808985031 477
776 iso_pu_bacteria 2808606415 2809132178 477
777 iso_pu_bacteria 2808606419 2809151803 477
778 iso_pu_bacteria 2818991449 2819617332 477
779 iso_pu_bacteria 2839094727 2839095282 477
780 iso_pu_bacteria 2852618963 2852621911 477
781 iso_pu_bacteria 2904439833 2904442434 477
782 iso_pu_bacteria 2904530477 2904533701 477
783 iso_pu_bacteria 2904584206 2904586658 477
784 iso_pu_bacteria 2904589729 2904591528 477
785 iso_pu_bacteria 2904601388 2904602334 477
786 iso_pu_bacteria 2919046199 2919050681 477
787 iso_pu_bacteria 2919079590 2919083341 477
788 iso_pu_bacteria 2923510766 2923514786 477
789 iso_pu_bacteria 2928130867 2928133709 477
790 3300003187 JGI25151J46595_10002295 JGI25151J46595_100022954 478
791 3300003771 Ga0055526_1003073 Ga0055526_10030734 478
792 3300003771 Ga0055526_1004090 Ga0055526_10040904 478
793 3300003771 Ga0055526_1006100 Ga0055526_10061004 478
794 3300003773 Ga0055537_1001420 Ga0055537_10014207 478
795 3300003775 Ga0055524_1000642 Ga0055524_10006429 478
796 3300003775 Ga0055524_1006682 Ga0055524_10066823 478
797 3300003781 Ga0055536_1000094 Ga0055536_100009416 478
798 3300003781 Ga0055536_1000110 Ga0055536_100011062 478
799 3300003784 Ga0055534_1000656 Ga0055534_100065611 478
800 3300003784 Ga0055534_1001751 Ga0055534_10017514 478
801 3300005614 Ga0068856_100150656 Ga0068856_1001506561 478
802 3300006948 Ga0099826_10000014 Ga0099826_10000014198 478
803 3300014497 Ga0182008_10013237 Ga0182008_100132373 478
804 3300025233 Ga0209437_100512 Ga0209437_10051219 478
805 3300025263 Ga0209565_1000045 Ga0209565_100004529 478
806 3300025263 Ga0209565_1010345 Ga0209565_10103454 478
807 3300025291 Ga0209675_1000661 Ga0209675_10006614 478
808 3300025292 Ga0209676_1000064 Ga0209676_1000064239 478
809 3300025294 Ga0209025_1000371 Ga0209025_10003714 478
810 3300025294 Ga0209025_1001907 Ga0209025_10019074 478
811 3300025294 Ga0209025_1004682 Ga0209025_10046829 478
812 3300025294 Ga0209025_1008213 Ga0209025_10082135 478
813 3300025295 Ga0209564_1001969 Ga0209564_10019699 478
814 3300025295 Ga0209564_1003010 Ga0209564_10030104 478
815 3300025295 Ga0209564_1003370 Ga0209564_10033704 478
816 3300025297 Ga0209758_1016413 Ga0209758_10164134 478
817 3300025299 Ga0209256_1000287 Ga0209256_10002875 478
818 3300025299 Ga0209256_1000835 Ga0209256_100083529 478
819 3300025303 Ga0209051_1016564 Ga0209051_10165643 478
820 3300025303 Ga0209051_1020107 Ga0209051_10201074 478
821 3300025949 Ga0207667_10023865 Ga0207667_100238652 478
822 3300026078 Ga0207702_10116246 Ga0207702_101162461 478
823 3300027666 Ga0209282_1000048 Ga0209282_100004864 478
824 3300042876 Ga0451577_0008429 Ga0451577_0008429_78_1583 478
825 3300042876 Ga0451577_0008841 Ga0451577_0008841_4237_5742 478
826 3300042876 Ga0451577_0018842 Ga0451577_0018842_4645_6198 478
827 3300044712 Ga0453684_0036639 Ga0453684_0036639_407_1960 478
828 3300045051 Ga0451576_0000006 Ga0451576_0000006_185724_187232 478
829 3300045051 Ga0451576_0000096 Ga0451576_0000096_42976_44529 478
830 3300045051 Ga0451576_0002503 Ga0451576_0002503_13459_14964 478
831 3300045051 Ga0451576_0002526 Ga0451576_0002526_13501_15006 478
832 3300046500 Ga0495596_0001761 Ga0495596_0001761_1709_3145 478
833 3300048924 Ga0496121_0044676 Ga0496121_0044676_1069_2505 478
834 3300049571 Ga0501034_0105734 Ga0501034_0105734_949_2445 478
835 3300049575 Ga0501039_0036031 Ga0501039_0036031_831_2321 478
836 3300001915 JGI24741J21665_1000120 JGI24741J21665_10001202 479
837 3300002705 JGI25156J39149_1003165 JGI25156J39149_10031654 479
838 3300002738 JGI25154J39366_1001626 JGI25154J39366_10016262 479
839 3300003578 Ga0006562J51391_1127957 Ga0006562J51391_11279573 479
840 3300003751 Ga0055538_1000110 Ga0055538_100011027 479
841 3300003752 Ga0055539_1000094 Ga0055539_100009490 479
842 3300003752 Ga0055539_1000159 Ga0055539_100015927 479
843 3300003756 Ga0055533_1000161 Ga0055533_100016127 479
844 3300003758 Ga0055532_1000006 Ga0055532_1000006170 479
845 3300003759 Ga0055525_1000214 Ga0055525_100021427 479
846 3300003759 Ga0055525_1000323 Ga0055525_100032310 479
847 3300003760 Ga0055527_1003007 Ga0055527_10030072 479
848 3300003761 Ga0055535_1000004 Ga0055535_1000004170 479
849 3300003762 Ga0055542_1000940 Ga0055542_100094011 479
850 3300003763 Ga0055529_1000022 Ga0055529_1000022151 479
851 3300003841 Ga0055541_1000105 Ga0055541_100010527 479
852 3300003841 Ga0055541_1000464 Ga0055541_10004643 479
853 3300005344 Ga0070661_100000012 Ga0070661_10000001299 479
854 3300005366 Ga0070659_100006729 Ga0070659_1000067296 479
855 3300005455 Ga0070663_100000003 Ga0070663_100000003224 479
856 3300005563 Ga0068855_100002313 Ga0068855_10000231316 479
857 3300005564 Ga0070664_100000003 Ga0070664_100000003151 479
858 3300005577 Ga0068857_100004739 Ga0068857_1000047398 479
859 3300005578 Ga0068854_100000063 Ga0068854_10000006357 479
860 3300005578 Ga0068854_100014150 Ga0068854_1000141504 479
861 3300005614 Ga0068856_100000256 Ga0068856_10000025645 479
862 3300005834 Ga0068851_10056120 Ga0068851_100561201 479
863 3300009036 Ga0105244_10036312 Ga0105244_100363122 479
864 3300009545 Ga0105237_10014545 Ga0105237_100145454 479
865 3300009545 Ga0105237_10040376 Ga0105237_100403762 479
866 3300009551 Ga0105238_10000537 Ga0105238_1000053715 479
867 3300010375 Ga0105239_10003482 Ga0105239_1000348213 479
868 3300013100 Ga0157373_10037002 Ga0157373_100370023 479
869 3300013102 Ga0157371_10000755 Ga0157371_1000075524 479
870 3300013104 Ga0157370_10000921 Ga0157370_1000092110 479
871 3300013105 Ga0157369_10026862 Ga0157369_100268623 479
872 3300013307 Ga0157372_10002524 Ga0157372_100025247 479
873 3300015261 Ga0182006_1002915 Ga0182006_10029157 479
874 3300015262 Ga0182007_10009681 Ga0182007_100096813 479
875 3300020610 Ga0154015_1057316 Ga0154015_10573168 479
876 3300021361 Ga0213872_10002967 Ga0213872_100029677 479
877 3300025224 Ga0209784_100035 Ga0209784_100035223 479
878 3300025224 Ga0209784_100223 Ga0209784_10022316 479
879 3300025224 Ga0209784_100389 Ga0209784_10038910 479
880 3300025225 Ga0209566_100002 Ga0209566_100002899 479
881 3300025225 Ga0209566_100040 Ga0209566_100040223 479
882 3300025225 Ga0209566_100597 Ga0209566_10059710 479
883 3300025225 Ga0209566_102325 Ga0209566_1023252 479
884 3300025226 Ga0209674_100010 Ga0209674_100010238 479
885 3300025226 Ga0209674_100050 Ga0209674_100050173 479
886 3300025226 Ga0209674_100057 Ga0209674_100057223 479
887 3300025226 Ga0209674_100262 Ga0209674_10026228 479
888 3300025228 Ga0209672_100111 Ga0209672_10011184 479
889 3300025229 Ga0209147_100015 Ga0209147_100015373 479
890 3300025230 Ga0209563_100004 Ga0209563_100004310 479
891 3300025230 Ga0209563_100026 Ga0209563_100026438 479
892 3300025230 Ga0209563_100059 Ga0209563_100059223 479
893 3300025242 Ga0209258_100021 Ga0209258_100021373 479
894 3300025246 Ga0209646_1000055 Ga0209646_1000055206 479
895 3300025253 Ga0209677_100007 Ga0209677_100007898 479
896 3300025253 Ga0209677_100036 Ga0209677_100036223 479
897 3300025253 Ga0209677_102096 Ga0209677_1020962 479
898 3300025254 Ga0209148_1000109 Ga0209148_100010998 479
899 3300025256 Ga0209759_1001940 Ga0209759_10019404 479
900 3300025272 Ga0209455_1000028 Ga0209455_1000028373 479
901 3300025901 Ga0207688_10042921 Ga0207688_100429212 479
902 3300025913 Ga0207695_10003997 Ga0207695_1000399716 479
903 3300025913 Ga0207695_10021978 Ga0207695_100219784 479
904 3300025914 Ga0207671_10006562 Ga0207671_100065627 479
905 3300025920 Ga0207649_10000408 Ga0207649_1000040815 479
906 3300025924 Ga0207694_10000384 Ga0207694_1000038416 479
907 3300025932 Ga0207690_10006028 Ga0207690_100060283 479
908 3300025945 Ga0207679_10000007 Ga0207679_1000000768 479
909 3300025949 Ga0207667_10002083 Ga0207667_1000208316 479
910 3300025981 Ga0207640_10000132 Ga0207640_1000013234 479
911 3300025981 Ga0207640_10062780 Ga0207640_100627801 479
912 3300026067 Ga0207678_10000011 Ga0207678_10000011100 479
913 3300026078 Ga0207702_10000018 Ga0207702_1000001811 479
914 3300026116 Ga0207674_10001844 Ga0207674_1000184415 479
915 3300026116 Ga0207674_10086447 Ga0207674_100864472 479
916 3300026142 Ga0207698_10081542 Ga0207698_100815423 479
917 3300031239 Ga0265328_10000447 Ga0265328_1000044711 479
918 3300031250 Ga0265331_10000070 Ga0265331_1000007020 479
919 3300031251 Ga0265327_10000156 Ga0265327_10000156125 479
920 3300031251 Ga0265327_10000706 Ga0265327_1000070626 479
921 3300031251 Ga0265327_10006520 Ga0265327_100065207 479
922 3300037418 Ga0395900_0058716 Ga0395900_0058716_211_1650 479
923 3300039447 Ga0436361_0100960 Ga0436361_0100960_1209_2666 479
924 3300044693 Ga0466961_0001701 Ga0466961_0001701_2654_4093 479
925 3300044735 Ga0466968_0045031 Ga0466968_0045031_368_1807 479
926 3300044765 Ga0466970_0002355 Ga0466970_0002355_1156_2595 479
927 3300044842 Ga0466957_0047230 Ga0466957_0047230_414_1853 479
928 3300045049 Ga0466959_0016980 Ga0466959_0016980_2612_4051 479
929 3300045051 Ga0451576_0004790 Ga0451576_0004790_7053_8540 479
930 3300045051 Ga0451576_0021263 Ga0451576_0021263_4030_5520 479
931 3300045976 Ga0466967_0005183 Ga0466967_0005183_4872_6311 479
932 3300049575 Ga0501039_0052723 Ga0501039_0052723_89_1552 479
933 3300049578 Ga0501042_0045024 Ga0501042_0045024_51_1514 479
934 3300049580 Ga0501046_0065302 Ga0501046_0065302_168_1631 479
935 3300049582 Ga0501048_0117174 Ga0501048_0117174_396_1859 479
936 3300049822 Ga0501035_0008524 Ga0501035_0008524_5921_7384 479
937 3300049822 Ga0501035_0032289 Ga0501035_0032289_2790_4274 479
938 3300061719 Ga0466962_0005722 Ga0466962_0005722_3268_4707 479

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00474

SSF

Sodium:solute symporter family

30

429

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hdh-assembly1.cif.gz_A structure of human sglt2-map17 complex with canagliflozin 0.8683 2 461
8hez-assembly1.cif.gz_A structure of human sglt2-map17 complex with dapagliflozin 0.8554 2 461
7vsi-assembly1.cif.gz_A structure of human sglt2-map17 complex bound with empagliflozin 0.8528 2 467
7wmv-assembly1.cif.gz_A structure of human sglt1-map17 complex bound with lx2761 0.8498 2 461
7ynj-assembly1.cif.gz_A structure of human sglt2-map17 complex bound with substrate amg in the occluded conformation 0.8395 5 461
ID Description Score Start End Superfamily
af_Q2FWY7_34_506_1.20.1730.10 Mainly Alpha;Up-down Bundle;Sodium/glucose cotransporter;Sodium/glucose cotransporter 0.8862 19 460 1.20.1730.10
af_Q1EHB4_32_596_1.20.1730.10 Mainly Alpha;Up-down Bundle;Sodium/glucose cotransporter;Sodium/glucose cotransporter 0.8821 26 461 1.20.1730.10
af_P32705_52_542_1.20.1730.10 Mainly Alpha;Up-down Bundle;Sodium/glucose cotransporter;Sodium/glucose cotransporter 0.8806 19 460 1.20.1730.10
af_P07117_23_496_1.20.1730.10 Mainly Alpha;Up-down Bundle;Sodium/glucose cotransporter;Sodium/glucose cotransporter 0.877 20 461 1.20.1730.10
af_Q9VE46_30_497_1.20.1730.10 Mainly Alpha;Up-down Bundle;Sodium/glucose cotransporter;Sodium/glucose cotransporter 0.8757 26 460 1.20.1730.10
ID Description Score Start End GO Terms
AF-A0A258M527-F1-model_v4 Sodium:solute symporter 0.9936 1 459 GO:0005886
GO:0022857
AF-A0A5S9BP82-F1-model_v4 deleted 0.9898 1 468
AF-A0A258M527-F1-model_v4 Sodium:solute symporter 0.9893 1 459 GO:0005886
GO:0022857
AF-A0A7X0CFM7-F1-model_v4 SSS family transporter 0.9876 2 469 GO:0005886
GO:0022857
AF-A0A819B154-F1-model_v4 ABC transporter domain-containing protein 0.9652 18 470 GO:0005524
GO:0016887
GO:0019867
GO:0022857
GO:0043190
GO:0046942

Feature Viewer

pLDDT pTM Quality
89.81 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map