F485964

General Info

Members Datasets Scaffolds Average Seq Length
927 513 759 316

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2928163908|2928164701
Length 358
Sequence RPIRRRSCIMHQEEVMLDITSGRTPAVDKQARQRRRDLIQKFAALGSLVVLIVAFSLTSAAFFSVGNLMTVSLQVTSIAYLGVAATCVIITGGIDLSVGSVLALAGVAAALLVKAGIPVPVAMLGGMLVGAACGWVNGICVTHMGLPPFIATLGMMLVARGLALQITGARPVSGLGDAFGELGNGALFKISHIGADGFPDTIFPGIPYPVVIMVALFVAVSVLLSRTSLGRHIYAVGSNAEAARLSGVNVQGVKLFTYVLSGLLAGATGCVLMSRLVTAQPNEGVMYELDAIASAVIGGTSLMGGVGTISGTAIGAFVIGVLRNGLNMNGVSSFIQQIIIGVVILGTVWIDQLRNRKL

Samples

Sample ID Description Type Environment
1 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
2 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
3 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
4 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
5 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
6 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
7 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
8 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
9 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
10 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
11 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
12 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
13 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
14 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
15 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
16 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
17 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
18 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
19 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
20 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
21 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
22 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
23 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
24 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
25 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
26 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
27 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
28 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
29 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
30 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
31 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
32 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
33 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
34 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
35 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
36 2643221568 Rhizobium sp. Root564 Isolate Unclassified
37 2643221582 Rhizobium sp. Root651 Isolate Unclassified
38 2643221585 Pelomonas sp. Root662 Isolate Unclassified
39 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
40 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
41 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
42 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
43 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
44 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
45 2643221656 Pelomonas sp. Root405 Isolate Unclassified
46 2643221693 Rhizobium sp. Root491 Isolate Unclassified
47 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
48 2711768156 Atlantibacter hermannii DDE1 Isolate Unclassified
49 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
50 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
51 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
52 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
53 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
54 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
55 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
56 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
57 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
58 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
59 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
60 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
61 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
62 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
63 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
64 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
65 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
66 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
67 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
68 2818991452 Burkholderia cepacia 561 Isolate Unclassified
69 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
70 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
71 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
72 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
73 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
74 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
75 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
76 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
77 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
78 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
79 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
80 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
81 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
82 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
83 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
84 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
85 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
86 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
87 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
88 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
89 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
90 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
91 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
92 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
93 2842711865 Duganella sp. R-73148 Isolate Unclassified
94 2851182111 Bosea sp. Tri-44 Isolate Nodule
95 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
96 2854911287 Brucella lupini LUP21 Isolate Unclassified
97 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
98 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
99 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
100 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
101 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
102 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
103 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
104 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
105 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
106 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
107 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
108 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
109 2904564687 Burkholderia sp. 571 Isolate Unclassified
110 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
111 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
112 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
113 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
114 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
115 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
116 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
117 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
118 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
119 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
120 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
121 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
122 2928058823 Ralstonia sp. 1138 Isolate Unclassified
123 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
124 2928163908 Burkholderia sp. 567 Isolate Unclassified
125 2928170801 Burkholderia sp. 572 Isolate Unclassified
126 2928536128 Burkholderia sola 565 Isolate Unclassified
127 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
128 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
129 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
130 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
131 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
132 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
133 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
134 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
135 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
136 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
137 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
138 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
139 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
140 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
141 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
142 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
143 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
144 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
145 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
146 3000017691 Rhodobacteraceae bacterium GH2-2 Isolate Rhizosphere
147 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
148 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
149 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
150 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
151 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
152 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
153 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
154 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
155 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
156 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
157 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
158 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
159 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
160 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
161 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
162 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
163 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
164 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
165 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
166 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
167 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
168 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
169 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
170 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
171 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
172 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
173 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
174 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
175 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
176 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
177 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
178 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
179 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
180 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
181 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
182 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
183 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
184 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
185 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
186 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
187 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
188 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
189 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
190 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
191 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
192 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
193 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
194 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
195 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
196 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
197 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
198 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
199 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
200 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
201 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
202 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
203 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
204 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
205 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
206 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
207 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
208 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
209 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
210 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
211 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
212 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
213 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
214 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
215 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
216 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
217 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
218 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
219 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
220 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
221 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
222 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
223 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
224 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
225 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
226 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
227 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
228 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
229 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
230 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
231 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
232 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
233 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
234 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
235 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
236 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
237 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
238 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
239 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
240 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
241 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
242 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
243 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
244 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
245 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
246 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
247 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
248 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
249 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
250 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
251 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
252 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
253 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
254 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
255 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
256 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
257 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
258 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
259 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
260 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
261 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
262 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
263 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
264 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
265 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
266 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
267 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
268 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
269 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
270 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
271 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
272 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
273 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
274 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
275 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
276 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
291 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
292 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
293 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
294 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
295 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
296 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
297 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
298 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
299 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
300 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
301 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
302 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
303 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
304 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
305 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
306 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
307 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
308 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
309 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
310 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
311 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
312 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
313 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
314 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
315 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
316 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
317 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
318 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
319 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
320 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
321 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
322 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
323 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
324 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
325 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
326 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
327 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
328 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
329 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
330 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
331 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
332 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
333 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
334 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
335 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
336 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
337 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
338 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
339 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
340 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
341 3300042117 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 Metagenome Rhizosphere
342 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
343 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
344 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
345 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
346 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
347 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
348 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
349 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
350 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
351 3300044650 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4E Metagenome Unclassified
352 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
353 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
354 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
355 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
356 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
357 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
358 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
359 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
360 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
361 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
362 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
363 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
364 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
365 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
366 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
367 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
368 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
369 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
370 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
371 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
372 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
373 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
374 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
375 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
376 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
377 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
378 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
379 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
380 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
381 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
382 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
383 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
384 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
385 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
386 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
387 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
388 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
389 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
390 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
391 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
392 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
393 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
394 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
395 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
396 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
397 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
398 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
399 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
400 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
401 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
402 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
403 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
404 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
405 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
406 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
407 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
408 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
409 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
410 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
411 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
412 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
413 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
414 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
415 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
416 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
417 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
418 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
419 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
420 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
421 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
422 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
423 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
424 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
425 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
426 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
427 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
428 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
429 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
430 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
431 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
432 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
433 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
434 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
435 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
436 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
437 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
438 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
439 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
440 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
441 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
442 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
443 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
444 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
445 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
446 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
447 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
448 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
449 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
450 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
451 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
452 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
453 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
454 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
455 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
456 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
457 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
458 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
459 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
460 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
461 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
462 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
463 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
464 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
465 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
466 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
467 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
468 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
469 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
470 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
471 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
472 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
473 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
474 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
475 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
476 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
477 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
478 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
479 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
480 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
481 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
482 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
483 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
484 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
485 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
486 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
487 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
488 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
489 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
490 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
491 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
492 641228493 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified
493 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
494 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
495 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
496 643348555 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified
497 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
498 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
499 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
500 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
501 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
502 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
503 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
504 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
505 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
506 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
507 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
508 8054002106 Azospirillum lipoferum 59b Isolate Unclassified
509 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
510 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
511 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule
512 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
513 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 81.34
Metatranscriptomes 0.43
Isolates 18.23

Biome Distribution

Category Percentage (%)
Aerial Root 0.65
Bulb 0
Endosphere 20.6
Nodule 4.64
Rhizoplane 3.02
Rhizosphere 50.27
Stem 0
Stem Tuber 0
Unclassified 20.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000445 3300001979 Bacteria 17693
2 JGI24740J21852_10001163 3300001979 Bacteria 11886
3 JGI24740J21852_10015020 3300001979 Bacteria 2838
4 JGI24739J22299_10001899 3300001989 Bacteria 7988
5 JGI25155J39150_1000102 3300002704 Bacteria 45181
6 JGI25155J39150_1000115 3300002704 Bacteria 39668
7 JGI25156J39149_1000010 3300002705 Bacteria 200080
8 JGI25156J39149_1000026 3300002705 Bacteria 132099
9 JGI25156J39149_1000099 3300002705 Bacteria 63582
10 JGI25156J39149_1000608 3300002705 Bacteria 19880
11 JGI25156J39149_1003020 3300002705 Bacteria 5708
12 JGI25156J39149_1009040 3300002705 Bacteria 2453
13 JGI25154J39366_1000027 3300002738 Bacteria 200075
14 JGI25154J39366_1000119 3300002738 Bacteria 63565
15 JGI25154J39366_1001003 3300002738 Bacteria 11384
16 JGI25154J39366_1002064 3300002738 Bacteria 5711
17 JGI25157J39369_1000008 3300002741 Bacteria 211083
18 JGI25157J39369_1000094 3300002741 Bacteria 76378
19 JGI25157J39369_1000146 3300002741 Bacteria 59929
20 JGI25164J39214_1002959 3300002772 Bacteria 2320
21 JGI25152J39213_1002844 3300002773 Bacteria 6204
22 JGI25150J39212_1001681 3300002774 Bacteria 5988
23 JGI25150J39212_1003645 3300002774 Bacteria 3571
24 JGI25159J45721_1000700 3300002987 Bacteria 14634
25 JGI25159J45721_1004029 3300002987 Bacteria 4999
26 JGI25151J46595_10005547 3300003187 Bacteria 6499
27 JGI25151J46595_10014423 3300003187 Bacteria 3520
28 JGI25151J46595_10026038 3300003187 Bacteria 2367
29 JGI25165J46597_1000998 3300003214 Bacteria 18793
30 JGI25153J46596_10000446 3300003215 Bacteria 26563
31 JGI25153J46596_10011743 3300003215 Bacteria 3845
32 rootH1_10015263 3300003316 Bacteria 8415
33 rootH2_10025414 3300003320 Bacteria 10758
34 rootL2_10005468 3300003322 Bacteria 3922
35 rootL2_10007942 3300003322 Bacteria 10165
36 rootL2_10173988 3300003322 Bacteria 1920
37 rootH1_10039966 3300003316 Bacteria 1041
38 rootH1_10039966 3300003323 Bacteria 11109
39 rootH1_10240694 3300003323 Bacteria 1310
40 JGI25160J50197_1000059 3300003354 Bacteria 116962
41 JGI25161J50226_1000109 3300003374 Bacteria 64835
42 Ga0055539_1000042 3300003752 Bacteria 199725
43 Ga0055539_1000100 3300003752 Bacteria 100406
44 Ga0055539_1000900 3300003752 Bacteria 6752
45 Ga0055533_1000006 3300003756 Bacteria 635559
46 Ga0055533_1000111 3300003756 Bacteria 97611
47 Ga0055533_1000586 3300003756 Bacteria 12694
48 Ga0055533_1000892 3300003756 Bacteria 8995
49 Ga0055532_1000017 3300003758 Bacteria 306880
50 Ga0055532_1000026 3300003758 Bacteria 238584
51 Ga0055532_1000127 3300003758 Bacteria 75964
52 Ga0055532_1000347 3300003758 Bacteria 24993
53 Ga0055525_1000487 3300003759 Bacteria 20653
54 Ga0055525_1000661 3300003759 Bacteria 13282
55 Ga0055527_1000018 3300003760 Bacteria 238584
56 Ga0055527_1000748 3300003760 Bacteria 9108
57 Ga0055527_1001540 3300003760 Bacteria 4705
58 Ga0055535_1000020 3300003761 Bacteria 238584
59 Ga0055535_1000140 3300003761 Bacteria 75964
60 Ga0055535_1000251 3300003761 Bacteria 56744
61 Ga0055535_1003234 3300003761 Bacteria 4771
62 Ga0055535_1008594 3300003761 Bacteria 1829
63 Ga0055542_1000031 3300003762 Bacteria 238584
64 Ga0055542_1000280 3300003762 Bacteria 57147
65 Ga0055542_1002532 3300003762 Bacteria 5873
66 Ga0055529_1000036 3300003763 Bacteria 238584
67 Ga0055529_1000213 3300003763 Bacteria 76328
68 Ga0055529_1000230 3300003763 Bacteria 71040
69 Ga0055529_1000330 3300003763 Bacteria 53265
70 Ga0055526_1002106 3300003771 Bacteria 13658
71 Ga0055537_1000737 3300003773 Bacteria 16770
72 Ga0055524_1000279 3300003775 Bacteria 50624
73 Ga0055524_1003439 3300003775 Bacteria 7679
74 Ga0055536_1010876 3300003781 Bacteria 3553
75 Ga0055536_1018809 3300003781 Bacteria 2197
76 Ga0055534_1001717 3300003784 Bacteria 8307
77 Ga0055528_1002889 3300003790 Bacteria 8932
78 Ga0055528_1004301 3300003790 Bacteria 6884
79 Ga0055530_10003553 3300003791 Bacteria 8782
80 Ga0055540_1000553 3300003792 Bacteria 27912
81 Ga0055531_10000726 3300003794 Bacteria 27911
82 Ga0055531_10003858 3300003794 Bacteria 9381
83 Ga0055531_10045532 3300003794 Bacteria 1217
84 Ga0055541_1000241 3300003841 Bacteria 20499
85 Ga0055543_1000138 3300004625 Bacteria 60628
86 Ga0070658_10004931 3300005327 Bacteria 10879
87 Ga0070658_10016476 3300005327 Bacteria 5915
88 Ga0070658_10041811 3300005327 Bacteria 3698
89 Ga0070660_100057608 3300005339 Bacteria 3010
90 Ga0070660_100084300 3300005339 Bacteria 2497
91 Ga0070660_100164023 3300005339 Bacteria 1792
92 Ga0070661_100000119 3300005344 Bacteria 65829
93 Ga0070661_100296270 3300005344 Bacteria 1258
94 Ga0070671_100027713 3300005355 Bacteria 4664
95 Ga0070673_100024912 3300005364 Bacteria 4394
96 Ga0070659_100000023 3300005366 Bacteria 150907
97 Ga0070659_100004537 3300005366 Bacteria 9918
98 Ga0070663_100000035 3300005455 Bacteria 66161
99 Ga0070663_100213052 3300005455 Bacteria 1513
100 Ga0070662_100014865 3300005457 Bacteria 5204
101 Ga0068867_100000385 3300005459 Bacteria 29434
102 Ga0068853_100021645 3300005539 Bacteria 5363
103 Ga0070665_100001728 3300005548 Bacteria 24967
104 Ga0070665_100022779 3300005548 Bacteria 6306
105 Ga0068855_100007034 3300005563 Bacteria 13652
106 Ga0068855_100008161 3300005563 Bacteria 12658
107 Ga0068855_100020883 3300005563 Bacteria 7854
108 Ga0068855_100037217 3300005563 Bacteria 5788
109 Ga0070664_100000008 3300005564 Bacteria 173734
110 Ga0068857_100000864 3300005577 Bacteria 22757
111 Ga0068857_100031848 3300005577 Bacteria 4659
112 Ga0068857_100195507 3300005577 Bacteria 1843
113 Ga0068854_100012088 3300005578 Bacteria 5645
114 Ga0068856_100000862 3300005614 Bacteria 32543
115 Ga0068856_100003775 3300005614 Bacteria 15174
116 Ga0068852_100015181 3300005616 Bacteria 5961
117 Ga0068852_100178896 3300005616 Bacteria 1993
118 Ga0068852_100221685 3300005616 Bacteria 1799
119 Ga0068864_100030015 3300005618 Bacteria 4608
120 Ga0068861_100301417 3300005719 Bacteria 1388
121 Ga0068858_100162348 3300005842 Bacteria 2104
122 Ga0075365_10013181 3300006038 Bacteria 4932
123 Ga0075364_10000250 3300006051 Bacteria 25876
124 Ga0075364_10003020 3300006051 Bacteria 9505
125 Ga0075364_10184356 3300006051 Bacteria 1413
126 Ga0075367_10085334 3300006178 Bacteria 1916
127 Ga0075366_10008344 3300006195 Bacteria 5755
128 Ga0075366_10013004 3300006195 Bacteria 4732
129 Ga0075370_10069300 3300006353 Bacteria 2015
130 Ga0068871_100110131 3300006358 Bacteria 2315
131 Ga0099823_1001212 3300006944 Bacteria 20620
132 Ga0079104_1000044 3300006946 Bacteria 185367
133 Ga0105251_10027099 3300009011 Bacteria 2910
134 Ga0105244_10003500 3300009036 Bacteria 11157
135 Ga0105240_10000586 3300009093 Bacteria 67524
136 Ga0105240_10000866 3300009093 Bacteria 54504
137 Ga0105240_10022793 3300009093 Bacteria 8295
138 Ga0105240_10023732 3300009093 Bacteria 8101
139 Ga0105240_10067725 3300009093 Bacteria 4425
140 Ga0105245_10343321 3300009098 Bacteria 1477
141 Ga0105245_10514417 3300009098 Bacteria 1215
142 Ga0105243_10002463 3300009148 Bacteria 15464
143 Ga0105241_10177676 3300009174 Bacteria 1763
144 Ga0105241_10202168 3300009174 Bacteria 1660
145 Ga0105237_10001081 3300009545 Bacteria 36547
146 Ga0105237_10045726 3300009545 Bacteria 4404
147 Ga0105237_10118317 3300009545 Bacteria 2643
148 Ga0105238_10011183 3300009551 Bacteria 9027
149 Ga0105238_10019462 3300009551 Bacteria 6914
150 Ga0105239_10002017 3300010375 Bacteria 26336
151 Ga0105239_10014145 3300010375 Bacteria 8854
152 Ga0105239_10041095 3300010375 Bacteria 5067
153 Ga0157319_1000048 3300012497 Bacteria 16986
154 Ga0157373_10003991 3300013100 Bacteria 11126
155 Ga0157373_10019216 3300013100 Bacteria 4975
156 Ga0157371_10000071 3300013102 Bacteria 164088
157 Ga0157371_10000413 3300013102 Bacteria 52929
158 Ga0157371_10006310 3300013102 Bacteria 9818
159 Ga0157371_10025596 3300013102 Bacteria 4298
160 Ga0157370_10000079 3300013104 Bacteria 107305
161 Ga0157370_10000456 3300013104 Bacteria 51071
162 Ga0157369_10000470 3300013105 Bacteria 53426
163 Ga0157369_10002006 3300013105 Bacteria 24529
164 Ga0157369_10010276 3300013105 Bacteria 10677
165 Ga0163162_10005218 3300013306 Bacteria 12529
166 Ga0163162_10055427 3300013306 Bacteria 3991
167 Ga0157372_10000142 3300013307 Bacteria 79172
168 Ga0157372_10088388 3300013307 Bacteria 3518
169 Ga0157375_10003789 3300013308 Bacteria 13106
170 Ga0157375_10005367 3300013308 Bacteria 11140
171 Ga0163163_10203074 3300014325 Bacteria 2030
172 Ga0182008_10000949 3300014497 Bacteria 20195
173 Ga0157377_10000223 3300014745 Bacteria 29679
174 Ga0157379_10010278 3300014968 Bacteria 8150
175 Ga0182006_1000004 3300015261 Bacteria 622190
176 Ga0182006_1002877 3300015261 Bacteria 9147
177 Ga0182006_1005567 3300015261 Bacteria 5984
178 Ga0182007_10000018 3300015262 Bacteria 198916
179 Ga0182007_10007390 3300015262 Bacteria 4611
180 Ga0182005_1000011 3300015265 Bacteria 420605
181 Ga0163161_10004852 3300017792 Bacteria 9362
182 Ga0163161_10150747 3300017792 Bacteria 1767
183 Ga0163161_10241246 3300017792 Bacteria 1406
184 Ga0206356_10161681 3300020070 Bacteria 2281
185 Ga0206351_10994603 3300020077 Bacteria 3530
186 Ga0154015_1049643 3300020610 Bacteria 16414
187 Ga0224712_10016820 3300022467 Bacteria 2411
188 Ga0209435_100003 3300025206 Bacteria 669534
189 Ga0209435_100015 3300025206 Bacteria 321177
190 Ga0209436_105708 3300025208 Bacteria 2818
191 Ga0209784_100003 3300025224 Bacteria 1379451
192 Ga0209784_100771 3300025224 Bacteria 7839
193 Ga0209566_100002 3300025225 Bacteria 2614868
194 Ga0209566_101176 3300025225 Bacteria 9507
195 Ga0209566_102258 3300025225 Bacteria 3748
196 Ga0209674_100003 3300025226 Bacteria 2196646
197 Ga0209674_100008 3300025226 Bacteria 1076909
198 Ga0209674_100020 3300025226 Bacteria 672397
199 Ga0209674_100113 3300025226 Bacteria 139708
200 Ga0209674_100118 3300025226 Bacteria 135635
201 Ga0209672_100013 3300025228 Bacteria 740693
202 Ga0209672_100044 3300025228 Bacteria 270292
203 Ga0209672_100818 3300025228 Bacteria 14658
204 Ga0209147_100002 3300025229 Bacteria 2158988
205 Ga0209147_100004 3300025229 Bacteria 1371850
206 Ga0209147_100013 3300025229 Bacteria 660057
207 Ga0209147_100039 3300025229 Bacteria 311101
208 Ga0209563_100004 3300025230 Bacteria 1814108
209 Ga0209563_100010 3300025230 Bacteria 1337457
210 Ga0209563_102543 3300025230 Bacteria 4090
211 Ga0207427_100220 3300025231 Bacteria 49507
212 Ga0209437_113554 3300025233 Bacteria 1162
213 Ga0209258_100002 3300025242 Bacteria 2158988
214 Ga0209258_100016 3300025242 Bacteria 668622
215 Ga0209258_100062 3300025242 Bacteria 311101
216 Ga0209258_100304 3300025242 Bacteria 79331
217 Ga0209258_101073 3300025242 Bacteria 11831
218 Ga0209258_111605 3300025242 Bacteria 1106
219 Ga0207425_1000246 3300025245 Bacteria 41185
220 Ga0207425_1013547 3300025245 Bacteria 1880
221 Ga0209646_1000008 3300025246 Bacteria 669534
222 Ga0209646_1000039 3300025246 Bacteria 349637
223 Ga0209646_1000040 3300025246 Bacteria 347867
224 Ga0209646_1000059 3300025246 Bacteria 256909
225 Ga0209026_1000006 3300025250 Bacteria 677225
226 Ga0209026_1000007 3300025250 Bacteria 669534
227 Ga0209026_1000034 3300025250 Bacteria 306953
228 Ga0209677_100009 3300025253 Bacteria 749530
229 Ga0209677_100026 3300025253 Bacteria 382520
230 Ga0209677_100131 3300025253 Bacteria 72722
231 Ga0209677_100730 3300025253 Bacteria 16741
232 Ga0209677_102100 3300025253 Bacteria 7851
233 Ga0209148_1000020 3300025254 Bacteria 740693
234 Ga0209148_1000021 3300025254 Bacteria 714645
235 Ga0209148_1000075 3300025254 Bacteria 311101
236 Ga0209148_1003029 3300025254 Bacteria 5009
237 Ga0209759_1000002 3300025256 Bacteria 1027596
238 Ga0209759_1000019 3300025256 Bacteria 357908
239 Ga0209759_1000020 3300025256 Bacteria 344904
240 Ga0209759_1000049 3300025256 Bacteria 221692
241 Ga0209759_1000083 3300025256 Bacteria 169561
242 Ga0209759_1001907 3300025256 Bacteria 10238
243 Ga0209759_1002026 3300025256 Bacteria 9584
244 Ga0209759_1005995 3300025256 Bacteria 4149
245 Ga0209759_1006312 3300025256 Bacteria 4003
246 Ga0209129_1000478 3300025258 Bacteria 29327
247 Ga0209233_1000153 3300025261 Bacteria 169839
248 Ga0209565_1000028 3300025263 Bacteria 348536
249 Ga0209565_1003334 3300025263 Bacteria 5251
250 Ga0209565_1012809 3300025263 Bacteria 1987
251 Ga0209455_1000017 3300025272 Bacteria 740693
252 Ga0209455_1000021 3300025272 Bacteria 699993
253 Ga0209455_1000033 3300025272 Bacteria 504606
254 Ga0209455_1000067 3300025272 Bacteria 311101
255 Ga0209673_1000035 3300025273 Bacteria 328411
256 Ga0209673_1000044 3300025273 Bacteria 290647
257 Ga0209673_1008509 3300025273 Bacteria 4558
258 Ga0209130_1000052 3300025284 Bacteria 216971
259 Ga0209130_1000759 3300025284 Bacteria 27970
260 Ga0209675_1000111 3300025291 Bacteria 114805
261 Ga0209675_1026270 3300025291 Bacteria 1452
262 Ga0209676_1000286 3300025292 Bacteria 103478
263 Ga0209676_1000634 3300025292 Bacteria 50573
264 Ga0209676_1007805 3300025292 Bacteria 4925
265 Ga0209676_1017095 3300025292 Bacteria 2582
266 Ga0209025_1002244 3300025294 Bacteria 21261
267 Ga0209025_1003486 3300025294 Bacteria 14832
268 Ga0209025_1004606 3300025294 Bacteria 11807
269 Ga0209025_1005752 3300025294 Bacteria 9962
270 Ga0209025_1007267 3300025294 Bacteria 8321
271 Ga0209564_1000395 3300025295 Bacteria 78052
272 Ga0209564_1000714 3300025295 Bacteria 48032
273 Ga0209564_1001718 3300025295 Bacteria 20581
274 Ga0209564_1004565 3300025295 Bacteria 8388
275 Ga0209564_1004599 3300025295 Bacteria 8328
276 Ga0209758_1000091 3300025297 Bacteria 242583
277 Ga0209758_1006279 3300025297 Bacteria 8638
278 Ga0209758_1056830 3300025297 Bacteria 1319
279 Ga0209050_1000023 3300025298 Bacteria 537172
280 Ga0209050_1000283 3300025298 Bacteria 107761
281 Ga0209050_1000951 3300025298 Bacteria 37656
282 Ga0209050_1005481 3300025298 Bacteria 7946
283 Ga0209050_1028274 3300025298 Bacteria 1823
284 Ga0209256_1000003 3300025299 Bacteria 1661127
285 Ga0209256_1000158 3300025299 Bacteria 140925
286 Ga0209256_1011504 3300025299 Bacteria 3527
287 Ga0209256_1029076 3300025299 Bacteria 1547
288 Ga0207426_1000306 3300025302 Bacteria 96112
289 Ga0207426_1004867 3300025302 Bacteria 6359
290 Ga0209051_1000017 3300025303 Bacteria 537172
291 Ga0209051_1001665 3300025303 Bacteria 17946
292 Ga0209051_1005705 3300025303 Bacteria 7186
293 Ga0209051_1006230 3300025303 Bacteria 6766
294 Ga0209051_1013498 3300025303 Bacteria 3885
295 Ga0209257_1000041 3300025304 Bacteria 537172
296 Ga0209257_1000162 3300025304 Bacteria 175776
297 Ga0209257_1002069 3300025304 Bacteria 21175
298 Ga0209257_1007516 3300025304 Bacteria 6552
299 Ga0209257_1011909 3300025304 Bacteria 4104
300 Ga0207713_1044224 3300025735 Bacteria 1831
301 Ga0207647_10015505 3300025904 Bacteria 5222
302 Ga0207705_10000625 3300025909 Bacteria 29536
303 Ga0207705_10251801 3300025909 Bacteria 1347
304 Ga0207654_10117965 3300025911 Bacteria 1662
305 Ga0207695_10000661 3300025913 Bacteria 67973
306 Ga0207695_10002210 3300025913 Bacteria 29273
307 Ga0207695_10004730 3300025913 Bacteria 18442
308 Ga0207695_10040480 3300025913 Bacteria 4995
309 Ga0207695_10059609 3300025913 Bacteria 3957
310 Ga0207695_10227627 3300025913 Bacteria 1770
311 Ga0207695_10412375 3300025913 Bacteria 1235
312 Ga0207671_10001229 3300025914 Bacteria 30320
313 Ga0207671_10020363 3300025914 Bacteria 5050
314 Ga0207671_10069368 3300025914 Bacteria 2627
315 Ga0207657_10000001 3300025919 Bacteria 458536
316 Ga0207657_10013054 3300025919 Bacteria 8163
317 Ga0207657_10093079 3300025919 Bacteria 2511
318 Ga0207657_10155858 3300025919 Bacteria 1857
319 Ga0207681_10021557 3300025923 Bacteria 4098
320 Ga0207694_10005574 3300025924 Bacteria 9645
321 Ga0207694_10006512 3300025924 Bacteria 8886
322 Ga0207694_10023944 3300025924 Bacteria 4637
323 Ga0207687_10023335 3300025927 Bacteria 4122
324 Ga0207687_10210755 3300025927 Bacteria 1524
325 Ga0207690_10000029 3300025932 Bacteria 160406
326 Ga0207690_10008417 3300025932 Bacteria 6124
327 Ga0207690_10016779 3300025932 Bacteria 4463
328 Ga0207690_10064782 3300025932 Bacteria 2497
329 Ga0207706_10001106 3300025933 Bacteria 27447
330 Ga0207709_10002492 3300025935 Bacteria 11541
331 Ga0207711_10055280 3300025941 Bacteria 3408
332 Ga0207711_10115242 3300025941 Bacteria 2394
333 Ga0207679_10000001 3300025945 Bacteria 777444
334 Ga0207667_10003915 3300025949 Bacteria 18324
335 Ga0207667_10003989 3300025949 Bacteria 18136
336 Ga0207667_10006950 3300025949 Bacteria 13679
337 Ga0207667_10019894 3300025949 Bacteria 7481
338 Ga0207651_10021728 3300025960 Bacteria 3907
339 Ga0207712_10124632 3300025961 Bacteria 1954
340 Ga0207640_10003953 3300025981 Bacteria 7999
341 Ga0207640_10008428 3300025981 Bacteria 5727
342 Ga0207703_10089798 3300026035 Bacteria 2581
343 Ga0207639_10064517 3300026041 Bacteria 2839
344 Ga0207639_10099169 3300026041 Bacteria 2350
345 Ga0207678_10000227 3300026067 Bacteria 50150
346 Ga0207678_10002602 3300026067 Bacteria 16443
347 Ga0207678_10087651 3300026067 Bacteria 2660
348 Ga0207702_10000024 3300026078 Bacteria 187719
349 Ga0207702_10010043 3300026078 Bacteria 7936
350 Ga0207641_10036140 3300026088 Bacteria 4122
351 Ga0207648_10001151 3300026089 Bacteria 29631
352 Ga0207674_10000509 3300026116 Bacteria 50984
353 Ga0207674_10054990 3300026116 Bacteria 4050
354 Ga0207674_10418056 3300026116 Bacteria 1295
355 Ga0207675_100032071 3300026118 Bacteria 4893
356 Ga0207683_10061545 3300026121 Bacteria 3304
357 Ga0209281_1000129 3300027111 Bacteria 194490
358 Ga0209389_1030840 3300027296 Bacteria 4508
359 Ga0209371_1000479 3300027312 Bacteria 38955
360 Ga0209371_1014589 3300027312 Bacteria 2149
361 Ga0209282_1002590 3300027666 Bacteria 10510
362 Ga0209974_10004470 3300027876 Bacteria 4979
363 Ga0268266_10006181 3300028379 Bacteria 11004
364 Ga0268266_10168960 3300028379 Bacteria 1984
365 Ga0265336_10000003 3300028666 Bacteria 423158
366 Ga0307517_10027980 3300028786 Bacteria 6743
367 Ga0307517_10081474 3300028786 Bacteria 2758
368 Ga0307515_10000221 3300028794 Bacteria 141099
369 Ga0307515_10010535 3300028794 Bacteria 17708
370 Ga0307515_10063957 3300028794 Bacteria 5153
371 Ga0307515_10195360 3300028794 Bacteria 1918
372 Ga0265324_10001082 3300029957 Bacteria 16396
373 Ga0268256_1000409 3300030500 Bacteria 38955
374 Ga0268256_1016163 3300030500 Bacteria 2149
375 Ga0307512_10055380 3300030522 Bacteria 3128
376 Ga0316181_1246728 3300030744 Bacteria 4449
377 Ga0307513_10001844 3300031456 Bacteria 30098
378 Ga0307513_10218514 3300031456 Bacteria 1729
379 Ga0307509_10019393 3300031507 Bacteria 7756
380 Ga0307509_10280123 3300031507 Bacteria 1429
381 Ga0307408_100000087 3300031548 Bacteria 101616
382 Ga0307408_100022443 3300031548 Bacteria 4289
383 Ga0307408_100069627 3300031548 Bacteria 2595
384 Ga0307408_100117512 3300031548 Bacteria 2054
385 Ga0307508_10002913 3300031616 Bacteria 17687
386 Ga0307516_10008188 3300031730 Bacteria 11874
387 Ga0307516_10033906 3300031730 Bacteria 5134
388 Ga0307413_10085049 3300031824 Bacteria 2041
389 Ga0307413_10131054 3300031824 Bacteria 1716
390 Ga0307406_10012115 3300031901 Bacteria 4908
391 Ga0307412_10000002 3300031911 Bacteria 743446
392 Ga0307412_10054802 3300031911 Bacteria 2649
393 Ga0307412_10087268 3300031911 Bacteria 2173
394 Ga0307412_10253501 3300031911 Bacteria 1368
395 Ga0307411_10098479 3300032005 Bacteria 2061
396 Ga0307510_10013619 3300033180 Bacteria 9642
397 Ga0373959_0001416 3300034820 Bacteria 3835
398 Ga0373934_0025868 3300035086 Bacteria 2275
399 Ga0373960_0000543 3300035121 Bacteria 7590
400 Ga0373962_0003028 3300035242 Bacteria 4025
401 Ga0373931_0000475 3300035691 Bacteria 16350
402 Ga0373931_0000950 3300035691 Bacteria 12188
403 Ga0395899_0000005 3300037312 Bacteria 772966
404 Ga0395899_0008573 3300037312 Bacteria 7871
405 Ga0395900_0000003 3300037418 Bacteria 587648
406 Ga0395900_0000053 3300037418 Bacteria 221135
407 Ga0395900_0001932 3300037418 Bacteria 23486
408 Ga0395900_0089743 3300037418 Bacteria 3159
409 Ga0395898_0000003 3300037466 Bacteria 772986
410 Ga0395898_0000347 3300037466 Bacteria 104341
411 Ga0395898_0060450 3300037466 Bacteria 3682
412 Ga0395898_0082079 3300037466 Bacteria 3107
413 Ga0395905_0000009 3300037471 Bacteria 488729
414 Ga0395905_0006099 3300037471 Bacteria 12177
415 Ga0395905_0014008 3300037471 Bacteria 7669
416 Ga0395905_0133525 3300037471 Bacteria 2335
417 Ga0395905_0256000 3300037471 Bacteria 1635
418 Ga0395905_0388346 3300037471 Bacteria 1290
419 Ga0395901_0000122 3300038443 Bacteria 100003
420 Ga0395901_0000736 3300038443 Bacteria 36993
421 Ga0395901_0006051 3300038443 Bacteria 12257
422 Ga0395901_0055537 3300038443 Bacteria 4119
423 Ga0436361_0722541 3300039447 Bacteria 3528
424 Ga0436361_1117331 3300039447 Bacteria 2109
425 Ga0439465_0020229 3300041413 Bacteria 2084
426 Ga0439437_000191 3300042000 Bacteria 5309
427 Ga0439449_0038913 3300042007 Bacteria 1768
428 Ga0450913_001025 3300042117 Bacteria 1422
429 Ga0450917_000035 3300042120 Bacteria 6615
430 Ga0450888_000064 3300042126 Bacteria 7969
431 Ga0450890_001534 3300042127 Bacteria 3318
432 Ga0450890_001600 3300042127 Bacteria 3245
433 Ga0450891_000201 3300042129 Bacteria 5907
434 Ga0450892_000498 3300042130 Bacteria 4546
435 Ga0450889_000618 3300042144 Bacteria 3952
436 Ga0439459_0000269 3300042438 Bacteria 6105
437 Ga0450893_0004741 3300042532 Bacteria 2169
438 Ga0451577_0042346 3300042876 Bacteria 4084
439 Ga0466986_0136556 3300044650 Bacteria 1667
440 Ga0466969_0001062 3300044656 Bacteria 14838
441 Ga0466969_0010370 3300044656 Bacteria 4940
442 Ga0466969_0011904 3300044656 Bacteria 4599
443 Ga0466969_0030281 3300044656 Bacteria 2758
444 Ga0466972_0008642 3300044658 Bacteria 5107
445 Ga0466972_0077594 3300044658 Bacteria 1582
446 Ga0466982_0020541 3300044672 Bacteria 3756
447 Ga0453683_0028810 3300044673 Bacteria 3514
448 Ga0466965_0000562 3300044683 Bacteria 13423
449 Ga0466965_0000839 3300044683 Bacteria 11628
450 Ga0466965_0002704 3300044683 Bacteria 7595
451 Ga0466965_0009438 3300044683 Bacteria 4535
452 Ga0466965_0013624 3300044683 Bacteria 3839
453 Ga0466965_0020503 3300044683 Bacteria 3178
454 Ga0466966_0000037 3300044684 Bacteria 97578
455 Ga0466966_0000841 3300044684 Bacteria 19544
456 Ga0466966_0002400 3300044684 Bacteria 12230
457 Ga0466966_0002944 3300044684 Bacteria 11203
458 Ga0466966_0005943 3300044684 Bacteria 8052
459 Ga0466966_0015901 3300044684 Bacteria 4974
460 Ga0466966_0038423 3300044684 Bacteria 3085
461 Ga0466961_0000258 3300044693 Bacteria 35598
462 Ga0466961_0000266 3300044693 Bacteria 34936
463 Ga0466961_0000327 3300044693 Bacteria 31367
464 Ga0466961_0000435 3300044693 Bacteria 26633
465 Ga0466961_0016500 3300044693 Bacteria 4744
466 Ga0466961_0059532 3300044693 Bacteria 2429
467 Ga0466963_0003439 3300044694 Bacteria 9063
468 Ga0466963_0110000 3300044694 Bacteria 1891
469 Ga0466963_0117134 3300044694 Bacteria 1831
470 Ga0466963_0170623 3300044694 Bacteria 1516
471 Ga0466964_0000998 3300044706 Bacteria 9396
472 Ga0466964_0001045 3300044706 Bacteria 9227
473 Ga0466964_0027646 3300044706 Bacteria 2228
474 Ga0466964_0061900 3300044706 Bacteria 1559
475 Ga0453684_0007265 3300044712 Bacteria 20503
476 Ga0453684_0011827 3300044712 Bacteria 14545
477 Ga0453684_0049949 3300044712 Bacteria 5507
478 Ga0453684_0055783 3300044712 Bacteria 5134
479 Ga0453684_0070070 3300044712 Bacteria 4443
480 Ga0453684_0109655 3300044712 Bacteria 3357
481 Ga0453684_0219058 3300044712 Bacteria 2206
482 Ga0453684_0243437 3300044712 Bacteria 2069
483 Ga0453684_0499170 3300044712 Bacteria 1347
484 Ga0466971_0004358 3300044719 Bacteria 6104
485 Ga0466971_0006298 3300044719 Bacteria 5153
486 Ga0466971_0071030 3300044719 Bacteria 1581
487 Ga0466971_0101220 3300044719 Bacteria 1324
488 Ga0466968_0005483 3300044735 Bacteria 4747
489 Ga0466968_0026183 3300044735 Bacteria 2392
490 Ga0466970_0000271 3300044765 Bacteria 25244
491 Ga0466970_0003837 3300044765 Bacteria 7358
492 Ga0466970_0005264 3300044765 Bacteria 6406
493 Ga0466970_0083424 3300044765 Bacteria 1729
494 Ga0466957_0001159 3300044842 Bacteria 13647
495 Ga0466957_0001316 3300044842 Bacteria 12979
496 Ga0466957_0003808 3300044842 Bacteria 8336
497 Ga0466957_0030357 3300044842 Bacteria 3227
498 Ga0466960_0005296 3300044901 Bacteria 5100
499 Ga0466959_0000903 3300045049 Bacteria 17528
500 Ga0466959_0002163 3300045049 Bacteria 12484
501 Ga0451576_0044928 3300045051 Bacteria 4654
502 Ga0466958_0006489 3300045836 Bacteria 6370
503 Ga0466958_0006505 3300045836 Bacteria 6366
504 Ga0466958_0022033 3300045836 Bacteria 3727
505 Ga0466958_0027145 3300045836 Bacteria 3388
506 Ga0466967_0024687 3300045976 Bacteria 4946
507 Ga0466967_0181472 3300045976 Bacteria 1986
508 Ga0495592_0000021 3300046454 Bacteria 140462
509 Ga0495592_0004187 3300046454 Bacteria 10535
510 Ga0495603_0005918 3300046455 Bacteria 7310
511 Ga0495629_0006015 3300046459 Bacteria 9026
512 Ga0495629_0088622 3300046459 Bacteria 2158
513 Ga0495638_0054916 3300046460 Bacteria 2475
514 Ga0495651_0039412 3300046462 Bacteria 3678
515 Ga0495651_0115269 3300046462 Bacteria 1981
516 Ga0495653_0053650 3300046463 Bacteria 3083
517 Ga0495650_0013889 3300046471 Bacteria 4230
518 Ga0495580_0003235 3300046472 Bacteria 13934
519 Ga0495580_0035281 3300046472 Bacteria 3597
520 Ga0495580_0040333 3300046472 Bacteria 3335
521 Ga0495580_0125205 3300046472 Bacteria 1783
522 Ga0495582_0019880 3300046473 Bacteria 3673
523 Ga0495582_0124206 3300046473 Bacteria 1456
524 Ga0495605_0016813 3300046474 Bacteria 3952
525 Ga0495664_0006088 3300046477 Bacteria 6657
526 Ga0495664_0068446 3300046477 Bacteria 2118
527 Ga0495596_0002121 3300046500 Bacteria 10856
528 Ga0495596_0033179 3300046500 Bacteria 2054
529 Ga0495607_0000149 3300046501 Bacteria 73673
530 Ga0495583_0000034 3300046506 Bacteria 246856
531 Ga0495583_0000189 3300046506 Bacteria 103518
532 Ga0495583_0015916 3300046506 Bacteria 4067
533 Ga0495583_0071699 3300046506 Bacteria 1521
534 Ga0495606_0000070 3300046507 Bacteria 177343
535 Ga0495606_0000295 3300046507 Bacteria 85796
536 Ga0495606_0001750 3300046507 Bacteria 27863
537 Ga0495606_0057506 3300046507 Bacteria 2504
538 Ga0495608_0003727 3300046511 Bacteria 10945
539 Ga0495608_0005487 3300046511 Bacteria 9064
540 Ga0495610_0075554 3300046512 Bacteria 1560
541 Ga0495616_0033558 3300046513 Bacteria 2673
542 Ga0495618_0004143 3300046514 Bacteria 8950
543 Ga0495620_0001169 3300046515 Bacteria 16084
544 Ga0495628_0009550 3300046516 Bacteria 8282
545 Ga0495628_0310986 3300046516 Bacteria 1164
546 Ga0495630_0018080 3300046517 Bacteria 5173
547 Ga0495632_0020608 3300046519 Bacteria 3566
548 Ga0495632_0061824 3300046519 Bacteria 1817
549 Ga0495643_0014447 3300046522 Bacteria 4699
550 Ga0495643_0039007 3300046522 Bacteria 2599
551 Ga0495648_0003703 3300046524 Bacteria 13354
552 Ga0495648_0019587 3300046524 Bacteria 4752
553 Ga0495648_0124062 3300046524 Bacteria 1383
554 Ga0495666_0009856 3300046526 Bacteria 4771
555 Ga0495666_0189255 3300046526 Bacteria 948
556 Ga0495652_0013449 3300046529 Bacteria 7366
557 Ga0495652_0023494 3300046529 Bacteria 5465
558 Ga0495654_0000122 3300046530 Bacteria 86717
559 Ga0495640_0010778 3300046533 Bacteria 7053
560 Ga0495640_0027964 3300046533 Bacteria 4062
561 Ga0495586_0009149 3300046535 Bacteria 5269
562 Ga0495586_0043104 3300046535 Bacteria 2431
563 Ga0495597_0010797 3300046542 Bacteria 4450
564 Ga0495645_0144066 3300046543 Bacteria 1660
565 Ga0495622_0051194 3300046557 Bacteria 1915
566 Ga0495633_0000204 3300046558 Bacteria 75182
567 Ga0495633_0101763 3300046558 Bacteria 1333
568 Ga0495633_0177608 3300046558 Bacteria 980
569 Ga0495668_0003093 3300046616 Bacteria 12858
570 Ga0495668_0012335 3300046616 Bacteria 5070
571 Ga0495668_0014791 3300046616 Bacteria 4568
572 Ga0495634_0005227 3300046642 Bacteria 10027
573 Ga0495634_0006551 3300046642 Bacteria 8837
574 Ga0495611_0133432 3300046648 Bacteria 1159
575 Ga0495625_0001208 3300046660 Bacteria 32802
576 Ga0495625_0005759 3300046660 Bacteria 11206
577 Ga0495625_0017327 3300046660 Bacteria 5642
578 Ga0495625_0134968 3300046660 Bacteria 1669
579 Ga0495635_0001735 3300046663 Bacteria 14688
580 Ga0495635_0007719 3300046663 Bacteria 7507
581 Ga0495661_0004114 3300046665 Bacteria 10594
582 Ga0495661_0016099 3300046665 Bacteria 4968
583 Ga0495588_0000867 3300046674 Bacteria 13358
584 Ga0495599_0012623 3300046678 Bacteria 5209
585 Ga0495599_0058861 3300046678 Bacteria 2403
586 Ga0495646_0035026 3300046680 Bacteria 3114
587 Ga0495658_0205307 3300046683 Bacteria 1229
588 Ga0495669_0012961 3300046684 Bacteria 3551
589 Ga0495613_0001984 3300046689 Bacteria 15543
590 Ga0495624_0036467 3300046690 Bacteria 3169
591 Ga0495671_0068925 3300046692 Bacteria 1739
592 Ga0495649_0000470 3300046694 Bacteria 34696
593 Ga0495649_0115222 3300046694 Bacteria 1423
594 Ga0495589_0001576 3300046794 Bacteria 13109
595 Ga0495589_0005062 3300046794 Bacteria 6974
596 Ga0495589_0063778 3300046794 Bacteria 1807
597 Ga0495600_0007581 3300046809 Bacteria 6645
598 Ga0495581_0001751 3300047315 Bacteria 12111
599 Ga0495581_0020768 3300047315 Bacteria 3809
600 Ga0495604_0000231 3300047317 Bacteria 50021
601 Ga0495604_0003598 3300047317 Bacteria 12348
602 Ga0495674_0006151 3300047319 Bacteria 11527
603 Ga0495674_0018696 3300047319 Bacteria 6449
604 Ga0495674_0095893 3300047319 Bacteria 2528
605 Ga0495674_0113532 3300047319 Bacteria 2294
606 Ga0495672_0000132 3300047320 Bacteria 111537
607 Ga0495672_0000667 3300047320 Bacteria 38172
608 Ga0495672_0006497 3300047320 Bacteria 9037
609 Ga0495672_0009673 3300047320 Bacteria 6955
610 Ga0495676_0031912 3300047321 Bacteria 4450
611 Ga0495676_0129087 3300047321 Bacteria 1828
612 Ga0495680_0011187 3300047322 Bacteria 7967
613 Ga0495683_0001355 3300047323 Bacteria 16324
614 Ga0495687_000636 3300047443 Bacteria 40190
615 Ga0495687_006586 3300047443 Bacteria 7072
616 Ga0495687_012424 3300047443 Bacteria 4503
617 Ga0495687_024799 3300047443 Bacteria 2845
618 Ga0495675_0008409 3300047444 Bacteria 6391
619 Ga0495675_0047488 3300047444 Bacteria 2731
620 Ga0495675_0211369 3300047444 Bacteria 1177
621 Ga0495673_0003445 3300047469 Bacteria 10420
622 Ga0495673_0008478 3300047469 Bacteria 5778
623 Ga0495673_0025601 3300047469 Bacteria 2829
624 Ga0495673_0068453 3300047469 Bacteria 1500
625 Ga0495681_0004420 3300047470 Bacteria 9598
626 Ga0495684_0022558 3300047471 Bacteria 4841
627 Ga0495686_0130908 3300047472 Bacteria 1487
628 Ga0495593_0011788 3300047673 Bacteria 5013
629 Ga0495593_0156245 3300047673 Bacteria 1152
630 Ga0495593_0166022 3300047673 Bacteria 1113
631 Ga0495602_0158399 3300048088 Bacteria 1770
632 Ga0495602_0232046 3300048088 Bacteria 1385
633 Ga0495614_0006756 3300048089 Bacteria 5134
634 Ga0495626_0062692 3300048091 Bacteria 1688
635 Ga0496100_0000069 3300048903 Bacteria 57607
636 Ga0496101_0001306 3300048904 Bacteria 14894
637 Ga0496101_0014607 3300048904 Bacteria 5280
638 Ga0496101_0113901 3300048904 Bacteria 2038
639 Ga0496102_0000247 3300048905 Bacteria 70783
640 Ga0496102_0165780 3300048905 Bacteria 2079
641 Ga0496103_0001129 3300048906 Bacteria 18564
642 Ga0496104_0020297 3300048907 Bacteria 6089
643 Ga0496110_0068806 3300048913 Bacteria 3134
644 Ga0496111_0001899 3300048914 Bacteria 12367
645 Ga0496111_0016619 3300048914 Bacteria 5074
646 Ga0496112_0001514 3300048915 Bacteria 17893
647 Ga0496113_0011776 3300048916 Bacteria 5856
648 Ga0496113_0018646 3300048916 Bacteria 4837
649 Ga0496113_0238272 3300048916 Bacteria 1451
650 Ga0496115_0043092 3300048918 Bacteria 3598
651 Ga0496116_0000057 3300048919 Bacteria 281652
652 Ga0496116_0063385 3300048919 Bacteria 2381
653 Ga0496116_0083394 3300048919 Bacteria 1973
654 Ga0496117_0000011 3300048920 Bacteria 610930
655 Ga0496117_0000031 3300048920 Bacteria 381048
656 Ga0496117_0000445 3300048920 Bacteria 68610
657 Ga0496117_0009251 3300048920 Bacteria 9208
658 Ga0496117_0043664 3300048920 Bacteria 3256
659 Ga0496118_0000010 3300048921 Bacteria 610930
660 Ga0496118_0000138 3300048921 Bacteria 128826
661 Ga0496118_0000208 3300048921 Bacteria 102645
662 Ga0496118_0016812 3300048921 Bacteria 6687
663 Ga0496118_0033362 3300048921 Bacteria 4225
664 Ga0496118_0036695 3300048921 Bacteria 3957
665 Ga0496118_0067877 3300048921 Bacteria 2593
666 Ga0496118_0087822 3300048921 Bacteria 2154
667 Ga0496118_0089498 3300048921 Bacteria 2125
668 Ga0496119_0001518 3300048922 Bacteria 27736
669 Ga0496119_0012786 3300048922 Bacteria 6773
670 Ga0496119_0098593 3300048922 Bacteria 1645
671 Ga0496119_0119057 3300048922 Bacteria 1454
672 Ga0496120_0000387 3300048923 Bacteria 71224
673 Ga0496120_0017712 3300048923 Bacteria 4606
674 Ga0496120_0054609 3300048923 Bacteria 2263
675 Ga0496121_0000034 3300048924 Bacteria 377095
676 Ga0496121_0001611 3300048924 Bacteria 37466
677 Ga0496121_0002266 3300048924 Bacteria 29939
678 Ga0496121_0004661 3300048924 Bacteria 18211
679 Ga0496121_0005348 3300048924 Bacteria 16508
680 Ga0496121_0007352 3300048924 Bacteria 13320
681 Ga0496121_0010317 3300048924 Bacteria 10562
682 Ga0496121_0022473 3300048924 Bacteria 6121
683 Ga0496122_0000023 3300048925 Bacteria 381035
684 Ga0496122_0000106 3300048925 Bacteria 193672
685 Ga0496122_0001233 3300048925 Bacteria 43226
686 Ga0496122_0001941 3300048925 Bacteria 31047
687 Ga0496122_0003057 3300048925 Bacteria 22632
688 Ga0496122_0026040 3300048925 Bacteria 5060
689 Ga0496122_0038906 3300048925 Bacteria 3800
690 Ga0496122_0042198 3300048925 Bacteria 3592
691 Ga0496122_0124810 3300048925 Bacteria 1650
692 Ga0496123_0000022 3300048926 Bacteria 361832
693 Ga0496123_0000027 3300048926 Bacteria 306773
694 Ga0496123_0001561 3300048926 Bacteria 31370
695 Ga0496123_0012061 3300048926 Bacteria 7411
696 Ga0496123_0077788 3300048926 Bacteria 2036
697 Ga0496123_0100192 3300048926 Bacteria 1688
698 Ga0496124_0000294 3300048927 Bacteria 93153
699 Ga0496124_0005671 3300048927 Bacteria 13921
700 Ga0496124_0007810 3300048927 Bacteria 11298
701 Ga0496124_0010712 3300048927 Bacteria 9249
702 Ga0496124_0017360 3300048927 Bacteria 6784
703 Ga0496124_0033998 3300048927 Bacteria 4480
704 Ga0496124_0037608 3300048927 Bacteria 4208
705 Ga0496124_0044950 3300048927 Bacteria 3787
706 Ga0496124_0059717 3300048927 Bacteria 3202
707 Ga0496124_0165069 3300048927 Bacteria 1722
708 Ga0496125_0000030 3300048928 Bacteria 375023
709 Ga0496125_0002526 3300048928 Bacteria 23616
710 Ga0496125_0115383 3300048928 Bacteria 1931
711 Ga0496126_0000115 3300048929 Bacteria 188546
712 Ga0496126_0000272 3300048929 Bacteria 110072
713 Ga0495682_0000030 3300049460 Bacteria 139542
714 Ga0495682_0001932 3300049460 Bacteria 10296
715 Ga0495682_0003951 3300049460 Bacteria 6467
716 Ga0501298_028178 3300049521 Bacteria 1089
717 Ga0501032_0113439 3300049569 Bacteria 1793
718 Ga0501034_0000193 3300049571 Bacteria 115072
719 Ga0501207_010232 3300049654 Bacteria 1381
720 Ga0501211_002225 3300049658 Bacteria 2060
721 Ga0501223_017748 3300049663 Bacteria 1404
722 Ga0501249_004207 3300049679 Bacteria 2919
723 Ga0501255_002432 3300049684 Bacteria 1637
724 Ga0501267_002586 3300049764 Bacteria 1620
725 Ga0501272_000765 3300049769 Bacteria 2914
726 nmdc:mga03683_6568_c1 3300050489 Bacteria 3990
727 nmdc:mga00v17_106189_c1 3300050491 Bacteria 1777
728 nmdc:mga00v17_15_c1 3300050491 Bacteria 126234
729 nmdc:mga00v17_2140_c1 3300050491 Bacteria 10153
730 nmdc:mga00v17_402_c1 3300050491 Bacteria 23341
731 nmdc:mga00v17_91534_c1 3300050491 Bacteria 1911
732 nmdc:mga0yw44_1123_c1 3300050492 Bacteria 8528
733 nmdc:mga0yw44_4743_c1 3300050492 Bacteria 6297
734 nmdc:mga0k408_11477_c1 3300050493 Bacteria 4827
735 nmdc:mga0k408_28803_c1 3300050493 Bacteria 3158
736 nmdc:mga0k408_29249_c1 3300050493 Bacteria 3135
737 nmdc:mga07m45_22884_c1 3300050496 Bacteria 3413
738 nmdc:mga0sz30_6529_c1 3300050516 Bacteria 4334
739 Ga0500635_0003943 3300053080 Bacteria 3782
740 Ga0500578_0000025 3300053086 Bacteria 151485
741 Ga0500644_0005908 3300053088 Bacteria 3110
742 Ga0500651_0102668 3300053093 Bacteria 1752
743 Ga0500572_003078 3300053111 Bacteria 3875
744 Ga0500593_000553 3300053117 Bacteria 14510
745 Ga0500618_000654 3300053125 Bacteria 20609
746 Ga0500618_003417 3300053125 Bacteria 5460
747 Ga0500559_0028631 3300053136 Bacteria 2381
748 Ga0500561_0000122 3300053137 Bacteria 14939
749 Ga0500561_0015201 3300053137 Bacteria 1703
750 Ga0500573_0029309 3300053140 Bacteria 3173
751 Ga0500616_0000442 3300053153 Bacteria 54652
752 Ga0500624_000836 3300053157 Bacteria 6979
753 Ga0500634_0018827 3300053161 Bacteria 3713
754 Ga0500634_0031487 3300053161 Bacteria 2892
755 Ga0500636_0005102 3300053177 Bacteria 7459
756 Ga0500636_0025280 3300053177 Bacteria 3508
757 Ga0466962_0001781 3300061719 Bacteria 10132
758 Ga0466962_0013859 3300061719 Bacteria 3881
759 Ga0466962_0022747 3300061719 Bacteria 3012

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046558 Ga0495633_0177608 Ga0495633_0177608_19_891 189
2 3300048088 Ga0495602_0232046 Ga0495602_0232046_46_915 190
3 3300046526 Ga0495666_0189255 Ga0495666_0189255_44_913 196
4 3300003316 rootH1_10015263 rootH1_100152634 210
5 3300046524 Ga0495648_0019587 Ga0495648_0019587_15_938 216
6 3300044683 Ga0466965_0020503 Ga0466965_0020503_933_1916 219
7 3300046506 Ga0495583_0000189 Ga0495583_0000189_91587_92693 220
8 3300046616 Ga0495668_0003093 Ga0495668_0003093_2438_3553 234
9 3300048091 Ga0495626_0062692 Ga0495626_0062692_509_1615 234
10 3300025298 Ga0209050_1000283 Ga0209050_100028344 235
11 3300025303 Ga0209051_1013498 Ga0209051_10134982 235
12 3300005548 Ga0070665_100001728 Ga0070665_1000017289 239
13 3300013100 Ga0157373_10003991 Ga0157373_100039913 239
14 3300013102 Ga0157371_10000071 Ga0157371_1000007182 239
15 3300013104 Ga0157370_10000079 Ga0157370_1000007930 239
16 3300025923 Ga0207681_10021557 Ga0207681_100215574 239
17 3300028379 Ga0268266_10006181 Ga0268266_100061812 239
18 3300046462 Ga0495651_0039412 Ga0495651_0039412_2037_3053 239
19 3300046472 Ga0495580_0040333 Ga0495580_0040333_2144_3160 239
20 3300046522 Ga0495643_0039007 Ga0495643_0039007_752_1774 239
21 3300046558 Ga0495633_0101763 Ga0495633_0101763_166_1188 239
22 3300046674 Ga0495588_0000867 Ga0495588_0000867_10760_11782 239
23 3300046690 Ga0495624_0036467 Ga0495624_0036467_1369_2385 239
24 3300047319 Ga0495674_0113532 Ga0495674_0113532_983_1999 239
25 3300047321 Ga0495676_0129087 Ga0495676_0129087_779_1795 239
26 3300047444 Ga0495675_0211369 Ga0495675_0211369_15_1031 239
27 3300047470 Ga0495681_0004420 Ga0495681_0004420_6198_7220 239
28 3300047471 Ga0495684_0022558 Ga0495684_0022558_973_1989 239
29 3300047673 Ga0495593_0166022 Ga0495593_0166022_12_1028 239
30 3300048916 Ga0496113_0018646 Ga0496113_0018646_2856_3878 239
31 3300048920 Ga0496117_0000031 Ga0496117_0000031_303683_304705 239
32 3300048921 Ga0496118_0000208 Ga0496118_0000208_48084_49106 239
33 3300048922 Ga0496119_0119057 Ga0496119_0119057_311_1333 239
34 3300048923 Ga0496120_0000387 Ga0496120_0000387_69129_70151 239
35 3300048925 Ga0496122_0000023 Ga0496122_0000023_303671_304693 239
36 3300048926 Ga0496123_0000027 Ga0496123_0000027_76343_77365 239
37 3300048927 Ga0496124_0007810 Ga0496124_0007810_3888_4910 239
38 3300048928 Ga0496125_0115383 Ga0496125_0115383_419_1441 239
39 3300050489 nmdc:mga03683_6568_c1 nmdc:mga03683_6568_c1_1625_2647 239
40 3300050491 nmdc:mga00v17_15_c1 nmdc:mga00v17_15_c1_51754_52776 239
41 3300050492 nmdc:mga0yw44_4743_c1 nmdc:mga0yw44_4743_c1_3157_4179 239
42 3300050516 nmdc:mga0sz30_6529_c1 nmdc:mga0sz30_6529_c1_1975_2997 239
43 3300053137 Ga0500561_0000122 Ga0500561_0000122_1025_2047 239
44 3300053157 Ga0500624_000836 Ga0500624_000836_1116_2138 239
45 3300053161 Ga0500634_0018827 Ga0500634_0018827_353_1375 239
46 3300006178 Ga0075367_10085334 Ga0075367_100853342 240
47 3300027666 Ga0209282_1002590 Ga0209282_100259011 240
48 3300030744 Ga0316181_1246728 Ga0316181_12467282 240
49 3300031548 Ga0307408_100117512 Ga0307408_1001175122 240
50 3300032005 Ga0307411_10098479 Ga0307411_100984792 240
51 3300046472 Ga0495580_0125205 Ga0495580_0125205_233_1249 240
52 3300046678 Ga0495599_0058861 Ga0495599_0058861_165_1181 240
53 3300048929 Ga0496126_0000272 Ga0496126_0000272_84720_85736 240
54 3300053125 Ga0500618_003417 Ga0500618_003417_2758_3795 240
55 3300037466 Ga0395898_0060450 Ga0395898_0060450_1632_2615 241
56 3300038443 Ga0395901_0006051 Ga0395901_0006051_423_1406 241
57 3300044656 Ga0466969_0011904 Ga0466969_0011904_378_1361 242
58 3300044693 Ga0466961_0000266 Ga0466961_0000266_17695_18678 242
59 3300028786 Ga0307517_10027980 Ga0307517_100279806 243
60 3300031456 Ga0307513_10218514 Ga0307513_102185142 243
61 3300044694 Ga0466963_0110000 Ga0466963_0110000_500_1483 243
62 3300046542 Ga0495597_0010797 Ga0495597_0010797_810_1793 243
63 3300047443 Ga0495687_000636 Ga0495687_000636_28017_29000 243
64 3300006353 Ga0075370_10069300 Ga0075370_100693002 244
65 3300031730 Ga0307516_10033906 Ga0307516_100339062 244
66 3300046506 Ga0495583_0015916 Ga0495583_0015916_3178_4050 244
67 3300046692 Ga0495671_0068925 Ga0495671_0068925_705_1724 244
68 3300048907 Ga0496104_0020297 Ga0496104_0020297_5157_6029 244
69 3300048923 Ga0496120_0054609 Ga0496120_0054609_1368_2240 244
70 3300014497 Ga0182008_10000949 Ga0182008_1000094920 245
71 3300015261 Ga0182006_1000004 Ga0182006_1000004349 245
72 3300015265 Ga0182005_1000011 Ga0182005_100001132 245
73 3300025303 Ga0209051_1001665 Ga0209051_100166513 245
74 3300033180 Ga0307510_10013619 Ga0307510_100136193 245
75 3300014968 Ga0157379_10010278 Ga0157379_100102785 246
76 3300046454 Ga0495592_0004187 Ga0495592_0004187_1801_2817 246
77 3300046459 Ga0495629_0088622 Ga0495629_0088622_1030_2046 246
78 3300046463 Ga0495653_0053650 Ga0495653_0053650_988_2004 246
79 3300046477 Ga0495664_0068446 Ga0495664_0068446_662_1678 246
80 3300046500 Ga0495596_0033179 Ga0495596_0033179_455_1471 246
81 3300046511 Ga0495608_0005487 Ga0495608_0005487_3070_4086 246
82 3300046512 Ga0495610_0075554 Ga0495610_0075554_29_949 246
83 3300046516 Ga0495628_0009550 Ga0495628_0009550_382_1398 246
84 3300046524 Ga0495648_0003703 Ga0495648_0003703_5588_6604 246
85 3300046529 Ga0495652_0023494 Ga0495652_0023494_770_1786 246
86 3300046533 Ga0495640_0010778 Ga0495640_0010778_5074_6090 246
87 3300046535 Ga0495586_0043104 Ga0495586_0043104_489_1505 246
88 3300046642 Ga0495634_0005227 Ga0495634_0005227_7423_8439 246
89 3300046663 Ga0495635_0001735 Ga0495635_0001735_7711_8727 246
90 3300046665 Ga0495661_0004114 Ga0495661_0004114_1057_2073 246
91 3300046680 Ga0495646_0035026 Ga0495646_0035026_753_1769 246
92 3300046689 Ga0495613_0001984 Ga0495613_0001984_9220_10236 246
93 3300046794 Ga0495589_0001576 Ga0495589_0001576_7380_8396 246
94 3300047315 Ga0495581_0020768 Ga0495581_0020768_2772_3788 246
95 3300047317 Ga0495604_0003598 Ga0495604_0003598_5901_6917 246
96 3300047319 Ga0495674_0095893 Ga0495674_0095893_1058_2074 246
97 3300047322 Ga0495680_0011187 Ga0495680_0011187_1364_2380 246
98 3300047469 Ga0495673_0068453 Ga0495673_0068453_454_1470 246
99 3300047673 Ga0495593_0156245 Ga0495593_0156245_12_1028 246
100 3300048088 Ga0495602_0158399 Ga0495602_0158399_327_1343 246
101 3300048089 Ga0495614_0006756 Ga0495614_0006756_205_1221 246
102 3300047320 Ga0495672_0006497 Ga0495672_0006497_3590_4606 247
103 3300047469 Ga0495673_0025601 Ga0495673_0025601_1436_2452 247
104 3300048921 Ga0496118_0016812 Ga0496118_0016812_1711_2727 247
105 3300048924 Ga0496121_0010317 Ga0496121_0010317_6872_7888 247
106 3300028786 Ga0307517_10081474 Ga0307517_100814742 248
107 3300044712 Ga0453684_0499170 Ga0453684_0499170_190_1260 248
108 3300046660 Ga0495625_0134968 Ga0495625_0134968_509_1564 248
109 3300049460 Ga0495682_0001932 Ga0495682_0001932_8663_9679 248
110 3300053125 Ga0500618_000654 Ga0500618_000654_13384_14439 248
111 3300006946 Ga0079104_1000044 Ga0079104_100004468 249
112 3300027111 Ga0209281_1000129 Ga0209281_1000129104 249
113 3300044712 Ga0453684_0011827 Ga0453684_0011827_5949_7028 249
114 3300046530 Ga0495654_0000122 Ga0495654_0000122_70745_71800 249
115 3300002705 JGI25156J39149_1000026 JGI25156J39149_100002649 250
116 3300002738 JGI25154J39366_1002064 JGI25154J39366_10020643 250
117 3300002741 JGI25157J39369_1000008 JGI25157J39369_100000846 250
118 3300002773 JGI25152J39213_1002844 JGI25152J39213_10028446 250
119 3300003215 JGI25153J46596_10000446 JGI25153J46596_1000044614 250
120 3300003752 Ga0055539_1000900 Ga0055539_10009004 250
121 3300005339 Ga0070660_100164023 Ga0070660_1001640232 250
122 3300005563 Ga0068855_100020883 Ga0068855_1000208838 250
123 3300005577 Ga0068857_100000864 Ga0068857_10000086414 250
124 3300005614 Ga0068856_100003775 Ga0068856_1000037753 250
125 3300009093 Ga0105240_10067725 Ga0105240_100677254 250
126 3300009551 Ga0105238_10019462 Ga0105238_100194624 250
127 3300010375 Ga0105239_10041095 Ga0105239_100410951 250
128 3300025245 Ga0207425_1000246 Ga0207425_100024611 250
129 3300025246 Ga0209646_1000039 Ga0209646_1000039209 250
130 3300025250 Ga0209026_1000006 Ga0209026_1000006392 250
131 3300025253 Ga0209677_100131 Ga0209677_10013160 250
132 3300025256 Ga0209759_1000020 Ga0209759_100002047 250
133 3300025258 Ga0209129_1000478 Ga0209129_100047810 250
134 3300025295 Ga0209564_1000395 Ga0209564_100039512 250
135 3300025297 Ga0209758_1000091 Ga0209758_1000091178 250
136 3300025299 Ga0209256_1011504 Ga0209256_10115043 250
137 3300025913 Ga0207695_10059609 Ga0207695_100596094 250
138 3300025919 Ga0207657_10155858 Ga0207657_101558582 250
139 3300025924 Ga0207694_10006512 Ga0207694_100065125 250
140 3300025927 Ga0207687_10210755 Ga0207687_102107552 250
141 3300025949 Ga0207667_10019894 Ga0207667_100198948 250
142 3300025981 Ga0207640_10003953 Ga0207640_100039532 250
143 3300026078 Ga0207702_10010043 Ga0207702_100100437 250
144 3300026116 Ga0207674_10000509 Ga0207674_1000050931 250
145 3300026121 Ga0207683_10061545 Ga0207683_100615452 251
146 3300050491 nmdc:mga00v17_91534_c1 nmdc:mga00v17_91534_c1_515_1501 251
147 3300053140 Ga0500573_0029309 Ga0500573_0029309_662_1681 251
148 3300003752 Ga0055539_1000042 Ga0055539_1000042104 252
149 3300003756 Ga0055533_1000006 Ga0055533_1000006276 252
150 3300003759 Ga0055525_1000661 Ga0055525_10006613 252
151 3300009098 Ga0105245_10343321 Ga0105245_103433212 252
152 3300025226 Ga0209674_100003 Ga0209674_1000031060 252
153 3300025230 Ga0209563_100010 Ga0209563_100010788 252
154 3300025253 Ga0209677_100026 Ga0209677_100026146 252
155 3300025932 Ga0207690_10064782 Ga0207690_100647822 252
156 3300034820 Ga0373959_0001416 Ga0373959_0001416_688_1671 252
157 3300046506 Ga0495583_0071699 Ga0495583_0071699_230_1255 252
158 3300050493 nmdc:mga0k408_29249_c1 nmdc:mga0k408_29249_c1_1366_2349 252
159 3300053093 Ga0500651_0102668 Ga0500651_0102668_466_1449 252
160 3300046454 Ga0495592_0000021 Ga0495592_0000021_133580_134563 253
161 3300048924 Ga0496121_0022473 Ga0496121_0022473_3566_4621 253
162 3300003323 rootH1_10240694 rootH1_102406941 254
163 3300005577 Ga0068857_100195507 Ga0068857_1001955072 254
164 3300026116 Ga0207674_10418056 Ga0207674_104180562 254
165 3300031911 Ga0307412_10054802 Ga0307412_100548022 254
166 3300047319 Ga0495674_0018696 Ga0495674_0018696_1710_2738 254
167 3300047320 Ga0495672_0000667 Ga0495672_0000667_32486_33514 254
168 3300048919 Ga0496116_0000057 Ga0496116_0000057_77874_78896 254
169 3300048921 Ga0496118_0089498 Ga0496118_0089498_17_1039 254
170 3300048925 Ga0496122_0042198 Ga0496122_0042198_150_1172 254
171 3300048929 Ga0496126_0000115 Ga0496126_0000115_77951_78973 254
172 3300005457 Ga0070662_100014865 Ga0070662_1000148654 255
173 3300005616 Ga0068852_100221685 Ga0068852_1002216852 255
174 3300015262 Ga0182007_10000018 Ga0182007_1000001822 255
175 3300025933 Ga0207706_10001106 Ga0207706_1000110614 255
176 3300037471 Ga0395905_0256000 Ga0395905_0256000_486_1469 255
177 3300045976 Ga0466967_0024687 Ga0466967_0024687_2223_3206 255
178 3300048914 Ga0496111_0016619 Ga0496111_0016619_3069_4043 255
179 3300048919 Ga0496116_0083394 Ga0496116_0083394_861_1835 255
180 3300048920 Ga0496117_0000011 Ga0496117_0000011_390264_391238 255
181 3300048921 Ga0496118_0000010 Ga0496118_0000010_219693_220667 255
182 3300048927 Ga0496124_0044950 Ga0496124_0044950_707_1681 255
183 3300003320 rootH2_10025414 rootH2_100254146 256
184 3300031456 Ga0307513_10001844 Ga0307513_100018444 256
185 3300005355 Ga0070671_100027713 Ga0070671_1000277132 257
186 3300005618 Ga0068864_100030015 Ga0068864_1000300153 257
187 3300005842 Ga0068858_100162348 Ga0068858_1001623482 257
188 3300006038 Ga0075365_10013181 Ga0075365_100131812 257
189 3300006358 Ga0068871_100110131 Ga0068871_1001101312 257
190 3300009093 Ga0105240_10000866 Ga0105240_100008667 257
191 3300009098 Ga0105245_10514417 Ga0105245_105144172 257
192 3300009545 Ga0105237_10001081 Ga0105237_1000108113 257
193 3300009551 Ga0105238_10011183 Ga0105238_100111833 257
194 3300010375 Ga0105239_10002017 Ga0105239_100020179 257
195 3300013306 Ga0163162_10055427 Ga0163162_100554273 257
196 3300013308 Ga0157375_10005367 Ga0157375_1000536710 257
197 3300014325 Ga0163163_10203074 Ga0163163_102030742 257
198 3300025913 Ga0207695_10004730 Ga0207695_100047307 257
199 3300025914 Ga0207671_10001229 Ga0207671_1000122915 257
200 3300025924 Ga0207694_10023944 Ga0207694_100239442 257
201 3300025927 Ga0207687_10023335 Ga0207687_100233351 257
202 3300026035 Ga0207703_10089798 Ga0207703_100897982 257
203 3300026088 Ga0207641_10036140 Ga0207641_100361402 257
204 3300028794 Ga0307515_10063957 Ga0307515_100639573 257
205 3300031507 Ga0307509_10280123 Ga0307509_102801232 257
206 3300031548 Ga0307408_100069627 Ga0307408_1000696272 257
207 3300031824 Ga0307413_10131054 Ga0307413_101310542 257
208 3300031911 Ga0307412_10087268 Ga0307412_100872682 257
209 3300041413 Ga0439465_0020229 Ga0439465_0020229_805_1827 257
210 3300044683 Ga0466965_0002704 Ga0466965_0002704_5326_6309 257
211 3300044706 Ga0466964_0027646 Ga0466964_0027646_1228_2211 257
212 3300044712 Ga0453684_0109655 Ga0453684_0109655_2189_3172 257
213 3300044735 Ga0466968_0026183 Ga0466968_0026183_1127_2110 257
214 3300050492 nmdc:mga0yw44_1123_c1 nmdc:mga0yw44_1123_c1_5980_7008 257
215 iso_pu_bacteria 641228493 641336610 257
216 3300025263 Ga0209565_1012809 Ga0209565_10128092 259
217 3300025294 Ga0209025_1007267 Ga0209025_10072673 259
218 3300025295 Ga0209564_1001718 Ga0209564_10017187 259
219 3300031548 Ga0307408_100000087 Ga0307408_10000008761 259
220 3300035086 Ga0373934_0025868 Ga0373934_0025868_472_1455 259
221 3300035691 Ga0373931_0000475 Ga0373931_0000475_10083_11066 260
222 3300044712 Ga0453684_0243437 Ga0453684_0243437_464_1534 260
223 3300053161 Ga0500634_0031487 Ga0500634_0031487_1709_2728 260
224 3300045051 Ga0451576_0044928 Ga0451576_0044928_1282_2265 261
225 3300046473 Ga0495582_0124206 Ga0495582_0124206_234_1217 261
226 3300046683 Ga0495658_0205307 Ga0495658_0205307_172_1155 261
227 3300047321 Ga0495676_0031912 Ga0495676_0031912_297_1280 261
228 3300047673 Ga0495593_0011788 Ga0495593_0011788_414_1397 261
229 3300009011 Ga0105251_10027099 Ga0105251_100270993 262
230 3300009036 Ga0105244_10003500 Ga0105244_100035009 262
231 3300013105 Ga0157369_10010276 Ga0157369_100102765 262
232 3300025735 Ga0207713_1044224 Ga0207713_10442242 262
233 3300048927 Ga0496124_0000294 Ga0496124_0000294_15970_16992 262
234 3300006195 Ga0075366_10008344 Ga0075366_100083445 263
235 3300013102 Ga0157371_10025596 Ga0157371_100255964 263
236 3300044712 Ga0453684_0219058 Ga0453684_0219058_1028_1993 263
237 3300050493 nmdc:mga0k408_11477_c1 nmdc:mga0k408_11477_c1_1494_2477 263
238 3300017792 Ga0163161_10004852 Ga0163161_100048528 264
239 3300026041 Ga0207639_10099169 Ga0207639_100991692 264
240 3300046557 Ga0495622_0051194 Ga0495622_0051194_169_1143 264
241 3300046558 Ga0495633_0000204 Ga0495633_0000204_4537_5511 264
242 3300048924 Ga0496121_0002266 Ga0496121_0002266_10620_11594 264
243 3300048924 Ga0496121_0004661 Ga0496121_0004661_2221_3195 264
244 3300048925 Ga0496122_0003057 Ga0496122_0003057_20257_21231 264
245 3300048926 Ga0496123_0077788 Ga0496123_0077788_836_1810 264
246 3300049460 Ga0495682_0003951 Ga0495682_0003951_2041_3015 264
247 3300006195 Ga0075366_10013004 Ga0075366_100130042 265
248 3300028794 Ga0307515_10010535 Ga0307515_100105357 265
249 3300031507 Ga0307509_10019393 Ga0307509_100193934 265
250 3300031616 Ga0307508_10002913 Ga0307508_1000291314 265
251 3300048925 Ga0496122_0001941 Ga0496122_0001941_15380_16402 265
252 3300050493 nmdc:mga0k408_28803_c1 nmdc:mga0k408_28803_c1_643_1626 265
253 3300002704 JGI25155J39150_1000102 JGI25155J39150_10001027 266
254 3300002705 JGI25156J39149_1000010 JGI25156J39149_1000010167 266
255 3300002738 JGI25154J39366_1000027 JGI25154J39366_1000027167 266
256 3300002741 JGI25157J39369_1000146 JGI25157J39369_100014661 266
257 3300003322 rootL2_10005468 rootL2_100054684 266
258 3300003763 Ga0055529_1000330 Ga0055529_100033010 266
259 3300025206 Ga0209435_100003 Ga0209435_100003445 266
260 3300025233 Ga0209437_113554 Ga0209437_1135542 266
261 3300025246 Ga0209646_1000008 Ga0209646_1000008445 266
262 3300025250 Ga0209026_1000007 Ga0209026_1000007445 266
263 3300025256 Ga0209759_1000019 Ga0209759_1000019166 266
264 3300025272 Ga0209455_1000033 Ga0209455_100003342 266
265 3300025292 Ga0209676_1000286 Ga0209676_100028632 266
266 3300028666 Ga0265336_10000003 Ga0265336_100000036 266
267 3300029957 Ga0265324_10001082 Ga0265324_100010825 266
268 3300044684 Ga0466966_0005943 Ga0466966_0005943_218_1249 266
269 3300044712 Ga0453684_0055783 Ga0453684_0055783_739_1722 266
270 3300046507 Ga0495606_0057506 Ga0495606_0057506_954_1985 266
271 3300047323 Ga0495683_0001355 Ga0495683_0001355_9336_10367 266
272 3300048927 Ga0496124_0010712 Ga0496124_0010712_4848_5831 266
273 3300053111 Ga0500572_003078 Ga0500572_003078_341_1363 266
274 3300053177 Ga0500636_0025280 Ga0500636_0025280_898_1920 266
275 3300001989 JGI24739J22299_10001899 JGI24739J22299_100018996 267
276 3300005327 Ga0070658_10041811 Ga0070658_100418112 267
277 3300005563 Ga0068855_100008161 Ga0068855_1000081615 267
278 3300009093 Ga0105240_10023732 Ga0105240_100237322 267
279 3300017792 Ga0163161_10150747 Ga0163161_101507472 267
280 3300027876 Ga0209974_10004470 Ga0209974_100044702 267
281 3300028794 Ga0307515_10000221 Ga0307515_100002212 267
282 3300030522 Ga0307512_10055380 Ga0307512_100553802 267
283 3300031730 Ga0307516_10008188 Ga0307516_100081884 267
284 3300031901 Ga0307406_10012115 Ga0307406_100121152 267
285 3300037471 Ga0395905_0014008 Ga0395905_0014008_30_1013 267
286 3300044656 Ga0466969_0001062 Ga0466969_0001062_2949_3932 267
287 3300044656 Ga0466969_0010370 Ga0466969_0010370_2783_3766 267
288 3300044683 Ga0466965_0000839 Ga0466965_0000839_660_1643 267
289 3300044684 Ga0466966_0002400 Ga0466966_0002400_5767_6750 267
290 3300044684 Ga0466966_0038423 Ga0466966_0038423_1722_2705 267
291 3300044693 Ga0466961_0016500 Ga0466961_0016500_810_1793 267
292 3300044706 Ga0466964_0000998 Ga0466964_0000998_5766_6749 267
293 3300044735 Ga0466968_0005483 Ga0466968_0005483_1807_2790 267
294 3300044765 Ga0466970_0003837 Ga0466970_0003837_3215_4198 267
295 3300044842 Ga0466957_0003808 Ga0466957_0003808_804_1787 267
296 3300044842 Ga0466957_0030357 Ga0466957_0030357_442_1425 267
297 3300045836 Ga0466958_0022033 Ga0466958_0022033_2699_3682 267
298 3300045976 Ga0466967_0181472 Ga0466967_0181472_831_1814 267
299 3300046519 Ga0495632_0020608 Ga0495632_0020608_679_1662 267
300 3300046522 Ga0495643_0014447 Ga0495643_0014447_2403_3386 267
301 3300046660 Ga0495625_0001208 Ga0495625_0001208_4182_5165 267
302 3300053088 Ga0500644_0005908 Ga0500644_0005908_235_1218 267
303 3300053136 Ga0500559_0028631 Ga0500559_0028631_161_1147 267
304 3300061719 Ga0466962_0013859 Ga0466962_0013859_1213_2196 267
305 3300002774 JGI25150J39212_1001681 JGI25150J39212_10016816 268
306 3300003187 JGI25151J46595_10014423 JGI25151J46595_100144233 268
307 3300005366 Ga0070659_100000023 Ga0070659_10000002387 268
308 3300006051 Ga0075364_10184356 Ga0075364_101843561 268
309 3300025245 Ga0207425_1013547 Ga0207425_10135472 268
310 3300025291 Ga0209675_1026270 Ga0209675_10262702 268
311 3300025294 Ga0209025_1004606 Ga0209025_10046069 268
312 3300025914 Ga0207671_10020363 Ga0207671_100203632 268
313 3300025919 Ga0207657_10000001 Ga0207657_1000000154 268
314 3300025924 Ga0207694_10005574 Ga0207694_100055747 268
315 3300025932 Ga0207690_10000029 Ga0207690_1000002991 268
316 3300025949 Ga0207667_10003915 Ga0207667_100039156 268
317 3300026067 Ga0207678_10000227 Ga0207678_100002277 268
318 3300031548 Ga0307408_100022443 Ga0307408_1000224433 268
319 3300031824 Ga0307413_10085049 Ga0307413_100850492 268
320 3300031911 Ga0307412_10253501 Ga0307412_102535012 268
321 3300047469 Ga0495673_0008478 Ga0495673_0008478_1987_3027 268
322 3300048904 Ga0496101_0113901 Ga0496101_0113901_925_1974 268
323 3300048913 Ga0496110_0068806 Ga0496110_0068806_396_1436 268
324 3300048924 Ga0496121_0007352 Ga0496121_0007352_3171_4220 268
325 3300048925 Ga0496122_0124810 Ga0496122_0124810_429_1478 268
326 3300048927 Ga0496124_0017360 Ga0496124_0017360_2832_3872 268
327 3300048927 Ga0496124_0033998 Ga0496124_0033998_480_1529 268
328 3300050491 nmdc:mga00v17_106189_c1 nmdc:mga00v17_106189_c1_474_1457 268
329 3300005344 Ga0070661_100296270 Ga0070661_1002962701 269
330 3300005548 Ga0070665_100022779 Ga0070665_1000227796 270
331 3300010375 Ga0105239_10014145 Ga0105239_100141459 270
332 3300025298 Ga0209050_1028274 Ga0209050_10282742 270
333 3300025303 Ga0209051_1006230 Ga0209051_10062304 270
334 3300028379 Ga0268266_10168960 Ga0268266_101689602 270
335 3300048925 Ga0496122_0000106 Ga0496122_0000106_81198_82235 270
336 3300048926 Ga0496123_0000022 Ga0496123_0000022_279922_280959 270
337 3300003215 JGI25153J46596_10011743 JGI25153J46596_100117432 271
338 3300003781 Ga0055536_1018809 Ga0055536_10188092 271
339 3300005616 Ga0068852_100015181 Ga0068852_1000151815 271
340 3300025292 Ga0209676_1017095 Ga0209676_10170952 271
341 3300025297 Ga0209758_1006279 Ga0209758_10062795 271
342 3300025297 Ga0209758_1056830 Ga0209758_10568302 271
343 3300025304 Ga0209257_1007516 Ga0209257_10075164 271
344 3300028794 Ga0307515_10195360 Ga0307515_101953602 271
345 3300044684 Ga0466966_0000841 Ga0466966_0000841_14023_15006 271
346 3300044693 Ga0466961_0059532 Ga0466961_0059532_630_1613 271
347 3300044712 Ga0453684_0070070 Ga0453684_0070070_573_1538 271
348 3300044765 Ga0466970_0083424 Ga0466970_0083424_559_1542 271
349 3300047472 Ga0495686_0130908 Ga0495686_0130908_152_1159 271
350 3300048916 Ga0496113_0238272 Ga0496113_0238272_334_1383 271
351 3300003322 rootL2_10007942 rootL2_100079424 272
352 3300042876 Ga0451577_0042346 Ga0451577_0042346_1105_2088 272
353 3300044673 Ga0453683_0028810 Ga0453683_0028810_218_1201 272
354 3300044712 Ga0453684_0049949 Ga0453684_0049949_2670_3653 272
355 3300053086 Ga0500578_0000025 Ga0500578_0000025_103148_104131 273
356 3300003758 Ga0055532_1000347 Ga0055532_100034712 274
357 3300003760 Ga0055527_1000748 Ga0055527_10007487 274
358 3300003761 Ga0055535_1000251 Ga0055535_100025131 274
359 3300003762 Ga0055542_1000280 Ga0055542_100028031 274
360 3300003763 Ga0055529_1000213 Ga0055529_100021331 274
361 3300003790 Ga0055528_1004301 Ga0055528_10043015 274
362 3300025228 Ga0209672_100044 Ga0209672_100044105 274
363 3300025229 Ga0209147_100039 Ga0209147_100039105 274
364 3300025242 Ga0209258_100062 Ga0209258_100062105 274
365 3300025254 Ga0209148_1000075 Ga0209148_1000075105 274
366 3300025263 Ga0209565_1003334 Ga0209565_10033344 274
367 3300025272 Ga0209455_1000067 Ga0209455_1000067105 274
368 3300025273 Ga0209673_1000044 Ga0209673_1000044208 274
369 3300025295 Ga0209564_1004565 Ga0209564_10045654 274
370 3300027312 Ga0209371_1000479 Ga0209371_100047920 274
371 3300030500 Ga0268256_1000409 Ga0268256_100040920 274
372 3300037418 Ga0395900_0089743 Ga0395900_0089743_1422_2453 274
373 3300037466 Ga0395898_0000347 Ga0395898_0000347_28321_29352 274
374 3300038443 Ga0395901_0000736 Ga0395901_0000736_22740_23771 274
375 iso_pu_bacteria 2600255292 2601669513 274
376 iso_pu_bacteria 2857547612 2857549633 274
377 iso_pu_bacteria 2932410948 2932414782 274
378 iso_pu_bacteria 2932416698 2932420698 274
379 3300025256 Ga0209759_1000002 Ga0209759_1000002285 275
380 3300046462 Ga0495651_0115269 Ga0495651_0115269_495_1544 275
381 3300046678 Ga0495599_0012623 Ga0495599_0012623_275_1324 275
382 3300047317 Ga0495604_0000231 Ga0495604_0000231_23654_24703 275
383 3300047444 Ga0495675_0008409 Ga0495675_0008409_5256_6305 275
384 3300005459 Ga0068867_100000385 Ga0068867_10000038525 276
385 3300009148 Ga0105243_10002463 Ga0105243_1000246312 276
386 3300014745 Ga0157377_10000223 Ga0157377_100002238 276
387 3300025242 Ga0209258_111605 Ga0209258_1116052 276
388 3300025935 Ga0207709_10002492 Ga0207709_100024926 276
389 3300026089 Ga0207648_10001151 Ga0207648_1000115125 276
390 3300037312 Ga0395899_0008573 Ga0395899_0008573_5527_6558 276
391 3300037418 Ga0395900_0000053 Ga0395900_0000053_20528_21559 276
392 3300037466 Ga0395898_0082079 Ga0395898_0082079_1040_2071 276
393 3300038443 Ga0395901_0000122 Ga0395901_0000122_43704_44735 276
394 3300044683 Ga0466965_0013624 Ga0466965_0013624_1532_2518 276
395 3300005327 Ga0070658_10004931 Ga0070658_100049317 277
396 3300005563 Ga0068855_100007034 Ga0068855_1000070344 277
397 3300009545 Ga0105237_10118317 Ga0105237_101183172 277
398 3300025909 Ga0207705_10000625 Ga0207705_1000062511 277
399 3300025913 Ga0207695_10412375 Ga0207695_104123751 277
400 3300025914 Ga0207671_10069368 Ga0207671_100693682 277
401 3300025949 Ga0207667_10003989 Ga0207667_100039897 277
402 3300044684 Ga0466966_0002944 Ga0466966_0002944_10011_11042 277
403 3300044694 Ga0466963_0170623 Ga0466963_0170623_288_1319 277
404 3300044719 Ga0466971_0004358 Ga0466971_0004358_2510_3541 277
405 3300061719 Ga0466962_0001781 Ga0466962_0001781_1365_2396 277
406 iso_pu_bacteria 2511231002 2511245629 277
407 iso_pu_bacteria 2585428058 2587734050 277
408 iso_pu_bacteria 2585428062 2587754405 277
409 iso_pu_bacteria 2588253510 2588292943 277
410 iso_pu_bacteria 2643221544 2643746758 277
411 iso_pu_bacteria 2643221585 2643933569 277
412 iso_pu_bacteria 2643221592 2643969741 277
413 iso_pu_bacteria 2643221625 2644141326 277
414 iso_pu_bacteria 2643221639 2644218859 277
415 iso_pu_bacteria 2643221644 2644245947 277
416 iso_pu_bacteria 2643221646 2644258173 277
417 iso_pu_bacteria 2643221648 2644274367 277
418 iso_pu_bacteria 2643221656 2644315069 277
419 iso_pu_bacteria 2818991445 2819592158 277
420 iso_pu_bacteria 2842711865 2842712540 277
421 iso_pu_bacteria 2919704043 2919705382 277
422 iso_pu_bacteria 643348555 643390401 277
423 3300039447 Ga0436361_1117331 Ga0436361_1117331_782_1813 278
424 3300048914 Ga0496111_0001899 Ga0496111_0001899_4479_5549 278
425 3300048925 Ga0496122_0026040 Ga0496122_0026040_1128_2198 278
426 3300048926 Ga0496123_0012061 Ga0496123_0012061_4228_5298 278
427 3300048927 Ga0496124_0037608 Ga0496124_0037608_1204_2274 278
428 iso_pu_bacteria 2510065053 2510281796 278
429 iso_pu_bacteria 2510065055 2510292042 278
430 iso_pu_bacteria 2510065058 2510309944 278
431 iso_pu_bacteria 2711768156 2712470513 278
432 iso_pu_bacteria 2773857672 2774130025 278
433 iso_pu_bacteria 2974298342 2974300407 278
434 iso_pu_bacteria 2984499530 2984502819 278
435 3300003322 rootL2_10173988 rootL2_101739882 279
436 3300037471 Ga0395905_0000009 Ga0395905_0000009_465850_466881 279
437 3300046519 Ga0495632_0061824 Ga0495632_0061824_568_1710 279
438 iso_pu_bacteria 2765235802 2765464477 279
439 iso_pu_bacteria 2775506902 2776267069 279
440 iso_pu_bacteria 2775506904 2776284895 279
441 iso_pu_bacteria 2839993093 2839996388 279
442 iso_pu_bacteria 2840764183 2840770238 279
443 3300006051 Ga0075364_10000250 Ga0075364_1000025016 280
444 3300006051 Ga0075364_10003020 Ga0075364_100030203 280
445 3300009093 Ga0105240_10000586 Ga0105240_1000058637 280
446 3300009545 Ga0105237_10045726 Ga0105237_100457262 280
447 3300025913 Ga0207695_10000661 Ga0207695_1000066113 280
448 3300047320 Ga0495672_0000132 Ga0495672_0000132_55111_56250 280
449 3300048919 Ga0496116_0063385 Ga0496116_0063385_184_1206 280
450 3300048920 Ga0496117_0043664 Ga0496117_0043664_888_1910 280
451 3300048921 Ga0496118_0033362 Ga0496118_0033362_2299_3321 280
452 3300048922 Ga0496119_0001518 Ga0496119_0001518_6434_7465 280
453 3300048922 Ga0496119_0012786 Ga0496119_0012786_1838_2860 280
454 3300048923 Ga0496120_0017712 Ga0496120_0017712_880_1902 280
455 3300048924 Ga0496121_0000034 Ga0496121_0000034_79193_80215 280
456 3300048925 Ga0496122_0001233 Ga0496122_0001233_36485_37516 280
457 3300048925 Ga0496122_0038906 Ga0496122_0038906_2595_3617 280
458 3300048926 Ga0496123_0001561 Ga0496123_0001561_5777_6808 280
459 3300048926 Ga0496123_0100192 Ga0496123_0100192_240_1262 280
460 3300048927 Ga0496124_0005671 Ga0496124_0005671_713_1735 280
461 3300048928 Ga0496125_0000030 Ga0496125_0000030_294723_295745 280
462 3300050491 nmdc:mga00v17_2140_c1 nmdc:mga00v17_2140_c1_6805_7827 280
463 3300050491 nmdc:mga00v17_402_c1 nmdc:mga00v17_402_c1_17896_18960 280
464 3300001979 JGI24740J21852_10001163 JGI24740J21852_100011639 281
465 3300002704 JGI25155J39150_1000115 JGI25155J39150_10001155 281
466 3300002705 JGI25156J39149_1000099 JGI25156J39149_100009957 281
467 3300002738 JGI25154J39366_1000119 JGI25154J39366_10001195 281
468 3300002741 JGI25157J39369_1000094 JGI25157J39369_100009469 281
469 3300002772 JGI25164J39214_1002959 JGI25164J39214_10029591 281
470 3300002774 JGI25150J39212_1003645 JGI25150J39212_10036453 281
471 3300002987 JGI25159J45721_1000700 JGI25159J45721_100070016 281
472 3300002987 JGI25159J45721_1004029 JGI25159J45721_10040295 281
473 3300003187 JGI25151J46595_10005547 JGI25151J46595_100055471 281
474 3300003187 JGI25151J46595_10026038 JGI25151J46595_100260382 281
475 3300003323 rootH1_10039966 rootH1_100399663 281
476 3300003354 JGI25160J50197_1000059 JGI25160J50197_100005941 281
477 3300003374 JGI25161J50226_1000109 JGI25161J50226_100010914 281
478 3300003758 Ga0055532_1000017 Ga0055532_1000017272 281
479 3300003761 Ga0055535_1003234 Ga0055535_10032342 281
480 3300003761 Ga0055535_1008594 Ga0055535_10085942 281
481 3300003771 Ga0055526_1002106 Ga0055526_10021064 281
482 3300003773 Ga0055537_1000737 Ga0055537_10007378 281
483 3300003775 Ga0055524_1000279 Ga0055524_10002798 281
484 3300003775 Ga0055524_1003439 Ga0055524_10034395 281
485 3300003781 Ga0055536_1010876 Ga0055536_10108763 281
486 3300003784 Ga0055534_1001717 Ga0055534_10017172 281
487 3300003790 Ga0055528_1002889 Ga0055528_10028895 281
488 3300003791 Ga0055530_10003553 Ga0055530_100035538 281
489 3300003792 Ga0055540_1000553 Ga0055540_100055319 281
490 3300003794 Ga0055531_10000726 Ga0055531_100007268 281
491 3300003794 Ga0055531_10003858 Ga0055531_1000385810 281
492 3300003794 Ga0055531_10045532 Ga0055531_100455322 281
493 3300004625 Ga0055543_1000138 Ga0055543_100013856 281
494 3300005327 Ga0070658_10016476 Ga0070658_100164764 281
495 3300005339 Ga0070660_100057608 Ga0070660_1000576082 281
496 3300005339 Ga0070660_100084300 Ga0070660_1000843002 281
497 3300005364 Ga0070673_100024912 Ga0070673_1000249124 281
498 3300005539 Ga0068853_100021645 Ga0068853_1000216453 281
499 3300005563 Ga0068855_100037217 Ga0068855_1000372172 281
500 3300005719 Ga0068861_100301417 Ga0068861_1003014172 281
501 3300006944 Ga0099823_1001212 Ga0099823_10012123 281
502 3300009093 Ga0105240_10022793 Ga0105240_100227933 281
503 3300012497 Ga0157319_1000048 Ga0157319_10000481 281
504 3300025206 Ga0209435_100015 Ga0209435_100015285 281
505 3300025208 Ga0209436_105708 Ga0209436_1057082 281
506 3300025229 Ga0209147_100004 Ga0209147_100004942 281
507 3300025231 Ga0207427_100220 Ga0207427_10022028 281
508 3300025242 Ga0209258_100304 Ga0209258_1003045 281
509 3300025242 Ga0209258_101073 Ga0209258_1010736 281
510 3300025246 Ga0209646_1000040 Ga0209646_1000040315 281
511 3300025250 Ga0209026_1000034 Ga0209026_10000345 281
512 3300025253 Ga0209677_100730 Ga0209677_1007302 281
513 3300025256 Ga0209759_1000049 Ga0209759_1000049199 281
514 3300025256 Ga0209759_1001907 Ga0209759_10019078 281
515 3300025256 Ga0209759_1002026 Ga0209759_10020267 281
516 3300025263 Ga0209565_1000028 Ga0209565_100002890 281
517 3300025273 Ga0209673_1000035 Ga0209673_1000035245 281
518 3300025273 Ga0209673_1008509 Ga0209673_10085095 281
519 3300025284 Ga0209130_1000052 Ga0209130_1000052163 281
520 3300025284 Ga0209130_1000759 Ga0209130_10007598 281
521 3300025291 Ga0209675_1000111 Ga0209675_10001112 281
522 3300025292 Ga0209676_1000634 Ga0209676_100063431 281
523 3300025292 Ga0209676_1007805 Ga0209676_10078051 281
524 3300025294 Ga0209025_1003486 Ga0209025_10034869 281
525 3300025294 Ga0209025_1005752 Ga0209025_10057522 281
526 3300025295 Ga0209564_1000714 Ga0209564_10007145 281
527 3300025295 Ga0209564_1004599 Ga0209564_10045995 281
528 3300025298 Ga0209050_1000023 Ga0209050_1000023512 281
529 3300025298 Ga0209050_1000951 Ga0209050_10009515 281
530 3300025298 Ga0209050_1005481 Ga0209050_10054812 281
531 3300025299 Ga0209256_1000003 Ga0209256_10000031262 281
532 3300025299 Ga0209256_1000158 Ga0209256_1000158105 281
533 3300025299 Ga0209256_1029076 Ga0209256_10290762 281
534 3300025302 Ga0207426_1000306 Ga0207426_100030656 281
535 3300025302 Ga0207426_1004867 Ga0207426_10048675 281
536 3300025303 Ga0209051_1000017 Ga0209051_1000017512 281
537 3300025303 Ga0209051_1005705 Ga0209051_10057053 281
538 3300025304 Ga0209257_1000041 Ga0209257_1000041512 281
539 3300025304 Ga0209257_1000162 Ga0209257_100016272 281
540 3300025304 Ga0209257_1002069 Ga0209257_10020693 281
541 3300025304 Ga0209257_1011909 Ga0209257_10119091 281
542 3300025904 Ga0207647_10015505 Ga0207647_100155054 281
543 3300025909 Ga0207705_10251801 Ga0207705_102518012 281
544 3300025913 Ga0207695_10040480 Ga0207695_100404803 281
545 3300025919 Ga0207657_10013054 Ga0207657_100130545 281
546 3300025919 Ga0207657_10093079 Ga0207657_100930792 281
547 3300025932 Ga0207690_10008417 Ga0207690_100084172 281
548 3300025949 Ga0207667_10006950 Ga0207667_100069505 281
549 3300025960 Ga0207651_10021728 Ga0207651_100217284 281
550 3300025961 Ga0207712_10124632 Ga0207712_101246322 281
551 3300026041 Ga0207639_10064517 Ga0207639_100645172 281
552 3300026118 Ga0207675_100032071 Ga0207675_1000320712 281
553 3300027296 Ga0209389_1030840 Ga0209389_10308404 281
554 3300031911 Ga0307412_10000002 Ga0307412_10000002240 281
555 3300035121 Ga0373960_0000543 Ga0373960_0000543_971_1954 281
556 3300035242 Ga0373962_0003028 Ga0373962_0003028_2025_3008 281
557 3300035691 Ga0373931_0000950 Ga0373931_0000950_994_1977 281
558 3300037471 Ga0395905_0006099 Ga0395905_0006099_4366_5349 281
559 3300042000 Ga0439437_000191 Ga0439437_000191_3865_4848 281
560 3300042007 Ga0439449_0038913 Ga0439449_0038913_401_1384 281
561 3300042117 Ga0450913_001025 Ga0450913_001025_176_1159 281
562 3300042120 Ga0450917_000035 Ga0450917_000035_2978_3961 281
563 3300042126 Ga0450888_000064 Ga0450888_000064_2232_3215 281
564 3300042127 Ga0450890_001534 Ga0450890_001534_927_1910 281
565 3300042127 Ga0450890_001600 Ga0450890_001600_1105_2088 281
566 3300042129 Ga0450891_000201 Ga0450891_000201_567_1550 281
567 3300042130 Ga0450892_000498 Ga0450892_000498_1147_2130 281
568 3300042144 Ga0450889_000618 Ga0450889_000618_1637_2620 281
569 3300042438 Ga0439459_0000269 Ga0439459_0000269_511_1494 281
570 3300042532 Ga0450893_0004741 Ga0450893_0004741_138_1121 281
571 3300044712 Ga0453684_0007265 Ga0453684_0007265_18472_19455 281
572 3300046500 Ga0495596_0002121 Ga0495596_0002121_4022_5071 281
573 3300046506 Ga0495583_0000034 Ga0495583_0000034_83193_84176 281
574 3300046507 Ga0495606_0001750 Ga0495606_0001750_21980_22963 281
575 3300046616 Ga0495668_0014791 Ga0495668_0014791_3176_4159 281
576 3300046660 Ga0495625_0005759 Ga0495625_0005759_7970_8953 281
577 3300046660 Ga0495625_0017327 Ga0495625_0017327_2845_3828 281
578 3300046684 Ga0495669_0012961 Ga0495669_0012961_1376_2359 281
579 3300046694 Ga0495649_0000470 Ga0495649_0000470_11165_12148 281
580 3300046794 Ga0495589_0005062 Ga0495589_0005062_5210_6193 281
581 3300046794 Ga0495589_0063778 Ga0495589_0063778_273_1322 281
582 3300047443 Ga0495687_006586 Ga0495687_006586_3458_4507 281
583 3300048920 Ga0496117_0009251 Ga0496117_0009251_4187_5236 281
584 3300048921 Ga0496118_0036695 Ga0496118_0036695_1189_2238 281
585 3300049521 Ga0501298_028178 Ga0501298_028178_21_1004 281
586 3300049569 Ga0501032_0113439 Ga0501032_0113439_534_1553 281
587 3300049571 Ga0501034_0000193 Ga0501034_0000193_92754_93773 281
588 3300049654 Ga0501207_010232 Ga0501207_010232_341_1324 281
589 3300049658 Ga0501211_002225 Ga0501211_002225_246_1229 281
590 3300049663 Ga0501223_017748 Ga0501223_017748_366_1349 281
591 3300049679 Ga0501249_004207 Ga0501249_004207_1072_2055 281
592 3300049684 Ga0501255_002432 Ga0501255_002432_86_1069 281
593 3300049764 Ga0501267_002586 Ga0501267_002586_438_1421 281
594 3300049769 Ga0501272_000765 Ga0501272_000765_1084_2067 281
595 3300050496 nmdc:mga07m45_22884_c1 nmdc:mga07m45_22884_c1_161_1144 281
596 3300053080 Ga0500635_0003943 Ga0500635_0003943_1462_2445 281
597 3300053117 Ga0500593_000553 Ga0500593_000553_8108_9091 281
598 3300053137 Ga0500561_0015201 Ga0500561_0015201_301_1284 281
599 3300053177 Ga0500636_0005102 Ga0500636_0005102_1661_2644 281
600 3300002705 JGI25156J39149_1000608 JGI25156J39149_10006086 282
601 3300003214 JGI25165J46597_1000998 JGI25165J46597_100099813 282
602 3300003756 Ga0055533_1000111 Ga0055533_100011112 282
603 3300003758 Ga0055532_1000026 Ga0055532_100002615 282
604 3300003760 Ga0055527_1000018 Ga0055527_1000018248 282
605 3300003761 Ga0055535_1000020 Ga0055535_1000020249 282
606 3300003762 Ga0055542_1000031 Ga0055542_1000031249 282
607 3300003763 Ga0055529_1000036 Ga0055529_100003615 282
608 3300037312 Ga0395899_0000005 Ga0395899_0000005_706336_707367 282
609 3300037418 Ga0395900_0000003 Ga0395900_0000003_65600_66631 282
610 3300037466 Ga0395898_0000003 Ga0395898_0000003_706356_707387 282
611 3300025226 Ga0209674_100020 Ga0209674_100020135 283
612 3300025228 Ga0209672_100013 Ga0209672_100013247 283
613 3300025229 Ga0209147_100013 Ga0209147_100013123 283
614 3300025230 Ga0209563_102543 Ga0209563_1025434 283
615 3300025242 Ga0209258_100016 Ga0209258_100016247 283
616 3300025254 Ga0209148_1000020 Ga0209148_1000020247 283
617 3300025256 Ga0209759_1000083 Ga0209759_1000083138 283
618 3300025261 Ga0209233_1000153 Ga0209233_1000153135 283
619 3300025272 Ga0209455_1000017 Ga0209455_1000017247 283
620 3300037471 Ga0395905_0388346 Ga0395905_0388346_117_1166 283
621 3300046459 Ga0495629_0006015 Ga0495629_0006015_2306_3337 283
622 3300046471 Ga0495650_0013889 Ga0495650_0013889_345_1376 283
623 3300046472 Ga0495580_0035281 Ga0495580_0035281_1575_2606 283
624 3300046473 Ga0495582_0019880 Ga0495582_0019880_876_1907 283
625 3300046477 Ga0495664_0006088 Ga0495664_0006088_4187_5218 283
626 3300046511 Ga0495608_0003727 Ga0495608_0003727_6611_7642 283
627 3300046514 Ga0495618_0004143 Ga0495618_0004143_7036_8067 283
628 3300046516 Ga0495628_0310986 Ga0495628_0310986_54_1085 283
629 3300046517 Ga0495630_0018080 Ga0495630_0018080_3863_4894 283
630 3300046526 Ga0495666_0009856 Ga0495666_0009856_2159_3190 283
631 3300046529 Ga0495652_0013449 Ga0495652_0013449_4218_5249 283
632 3300046533 Ga0495640_0027964 Ga0495640_0027964_1717_2748 283
633 3300046535 Ga0495586_0009149 Ga0495586_0009149_568_1599 283
634 3300046642 Ga0495634_0006551 Ga0495634_0006551_3405_4436 283
635 3300046663 Ga0495635_0007719 Ga0495635_0007719_2072_3103 283
636 3300046694 Ga0495649_0115222 Ga0495649_0115222_372_1403 283
637 3300046809 Ga0495600_0007581 Ga0495600_0007581_2636_3667 283
638 3300047315 Ga0495581_0001751 Ga0495581_0001751_999_2030 283
639 3300047443 Ga0495687_024799 Ga0495687_024799_677_1708 283
640 3300047444 Ga0495675_0047488 Ga0495675_0047488_829_1860 283
641 3300027312 Ga0209371_1014589 Ga0209371_10145892 284
642 3300030500 Ga0268256_1016163 Ga0268256_10161632 284
643 3300046507 Ga0495606_0000070 Ga0495606_0000070_167067_168119 284
644 iso_pu_bacteria 2889914905 2889915508 284
645 3300053153 Ga0500616_0000442 Ga0500616_0000442_36186_37214 285
646 3300044719 Ga0466971_0071030 Ga0466971_0071030_23_1021 286
647 3300046543 Ga0495645_0144066 Ga0495645_0144066_148_1179 286
648 3300005455 Ga0070663_100213052 Ga0070663_1002130521 287
649 3300009174 Ga0105241_10202168 Ga0105241_102021682 287
650 3300013307 Ga0157372_10088388 Ga0157372_100883881 287
651 3300020070 Ga0206356_10161681 Ga0206356_101616812 287
652 3300022467 Ga0224712_10016820 Ga0224712_100168202 287
653 3300025913 Ga0207695_10227627 Ga0207695_102276272 287
654 3300026067 Ga0207678_10087651 Ga0207678_100876511 287
655 iso_pu_bacteria 3003665799 3003669850 287
656 3300048924 Ga0496121_0001611 Ga0496121_0001611_30519_31571 288
657 iso_pu_bacteria 2842324504 2842329462 288
658 iso_pu_bacteria 2842348783 2842354439 288
659 iso_pu_bacteria 2842454564 2842456325 288
660 iso_pu_bacteria 2854911287 2854913374 288
661 iso_pu_bacteria 3000017691 3000020913 288
662 iso_pu_bacteria 8056875544 8056878897 288
663 3300003756 Ga0055533_1000892 Ga0055533_10008929 289
664 iso_pu_bacteria 2537561587 2537873561 289
665 iso_pu_bacteria 2554235003 2554248980 289
666 iso_pu_bacteria 2558860242 2559296068 289
667 iso_pu_bacteria 2599185210 2599603139 289
668 iso_pu_bacteria 2600255279 2601610956 289
669 iso_pu_bacteria 2600255308 2601747730 289
670 iso_pu_bacteria 2643221568 2643854832 289
671 iso_pu_bacteria 2643221582 2643921592 289
672 iso_pu_bacteria 2643221693 2644521646 289
673 iso_pu_bacteria 2808606387 2808988106 289
674 iso_pu_bacteria 2818991439 2819561078 289
675 iso_pu_bacteria 2838675328 2838678551 289
676 iso_pu_bacteria 2838714209 2838718361 289
677 iso_pu_bacteria 2838719591 2838722847 289
678 iso_pu_bacteria 2838724970 2838728427 289
679 iso_pu_bacteria 2841846520 2841850403 289
680 iso_pu_bacteria 2841859092 2841863344 289
681 iso_pu_bacteria 2842124991 2842129087 289
682 iso_pu_bacteria 2842130223 2842133444 289
683 iso_pu_bacteria 2842152218 2842155645 289
684 iso_pu_bacteria 2842170452 2842174397 289
685 iso_pu_bacteria 2842175837 2842179058 289
686 iso_pu_bacteria 2842187318 2842190785 289
687 iso_pu_bacteria 2842211629 2842214891 289
688 iso_pu_bacteria 2842224351 2842227612 289
689 iso_pu_bacteria 2842515876 2842519919 289
690 iso_pu_bacteria 2899792073 2899794828 289
691 iso_pu_bacteria 2899845264 2899849419 289
692 iso_pu_bacteria 2919114240 2919118382 289
693 iso_pu_bacteria 2919166419 2919170468 289
694 iso_pu_bacteria 2926754445 2926754911 289
695 iso_pu_bacteria 2926760298 2926762076 289
696 iso_pu_bacteria 2929138655 2929141992 289
697 iso_pu_bacteria 2933006813 2933010509 289
698 iso_pu_bacteria 2933011516 2933015819 289
699 iso_pu_bacteria 2933594066 2933597443 289
700 iso_pu_bacteria 2978969890 2978972736 289
701 iso_pu_bacteria 2979095461 2979099954 289
702 iso_pu_bacteria 2979100975 2979104627 289
703 iso_pu_bacteria 2984509177 2984513576 289
704 iso_pu_bacteria 2984518228 2984522844 289
705 iso_pu_bacteria 2984537506 2984542151 289
706 iso_pu_bacteria 2984587000 2984590988 289
707 iso_pu_bacteria 2984601300 2984601580 289
708 iso_pu_bacteria 650716007 650741284 289
709 iso_pu_bacteria 8003570095 8003573654 289
710 iso_pu_bacteria 8018150411 8018154438 289
711 iso_pu_bacteria 8054460903 8054463876 289
712 3300025226 Ga0209674_100113 Ga0209674_10011375 290
713 3300047469 Ga0495673_0003445 Ga0495673_0003445_8545_9585 290
714 iso_pu_bacteria 2851182111 2851184315 290
715 iso_pu_bacteria 2863421361 2863422948 290
716 iso_pu_bacteria 2870068957 2870075747 290
717 iso_pu_bacteria 2904564687 2904566434 290
718 iso_pu_bacteria 2904571731 2904573479 290
719 iso_pu_bacteria 2928170801 2928173556 290
720 iso_pu_bacteria 2928536128 2928539681 290
721 iso_pu_bacteria 8055431914 8055434893 290
722 3300046616 Ga0495668_0012335 Ga0495668_0012335_218_1258 291
723 3300048918 Ga0496115_0043092 Ga0496115_0043092_883_1902 291
724 iso_pu_bacteria 2510917026 2511173984 291
725 iso_pu_bacteria 2585427633 2585992946 291
726 iso_pu_bacteria 2585427634 2586003668 291
727 iso_pu_bacteria 2600254933 2600376953 291
728 iso_pu_bacteria 2821123053 2821127233 291
729 iso_pu_bacteria 2838736955 2838740624 291
730 iso_pu_bacteria 2841840854 2841844465 291
731 iso_pu_bacteria 2842140634 2842144467 291
732 iso_pu_bacteria 2854896431 2854898131 291
733 iso_pu_bacteria 2854916844 2854919807 291
734 iso_pu_bacteria 2857531043 2857534786 291
735 iso_pu_bacteria 2919171160 2919176665 291
736 iso_pu_bacteria 2512047030 2512352398 292
737 iso_pu_bacteria 2562617112 2563061028 292
738 iso_pu_bacteria 2599185236 2599720755 292
739 iso_pu_bacteria 2711768613 2713475987 292
740 iso_pu_bacteria 2791355253 2793282774 292
741 iso_pu_bacteria 2919450847 2919451146 292
742 iso_pu_bacteria 2921643360 2921649295 292
743 iso_pu_bacteria 8055266321 8055270598 292
744 iso_pu_bacteria 2501025504 2501407840 293
745 iso_pu_bacteria 2510917014 2511097713 293
746 iso_pu_bacteria 2510917015 2511109367 293
747 iso_pu_bacteria 2513237082 2513556722 293
748 iso_pu_bacteria 2513237083 2513563990 293
749 iso_pu_bacteria 2513237166 2514049817 293
750 iso_pu_bacteria 2526164713 2527075278 293
751 iso_pu_bacteria 2599185178 2599444490 293
752 iso_pu_bacteria 2599185239 2599737855 293
753 iso_pu_bacteria 2600255067 2600812767 293
754 iso_pu_bacteria 2738541296 2738820534 293
755 iso_pu_bacteria 2738541298 2738833014 293
756 iso_pu_bacteria 2738541306 2738874541 293
757 iso_pu_bacteria 2738543002 2739186171 293
758 iso_pu_bacteria 2738543008 2739221139 293
759 iso_pu_bacteria 2744054900 2746085520 293
760 iso_pu_bacteria 2744054901 2746094897 293
761 iso_pu_bacteria 2808606384 2808972574 293
762 iso_pu_bacteria 2808606390 2809007433 293
763 iso_pu_bacteria 2808606391 2809014541 293
764 iso_pu_bacteria 2818991452 2819631700 293
765 iso_pu_bacteria 2885270888 2885276024 293
766 iso_pu_bacteria 2900577576 2900577905 293
767 iso_pu_bacteria 2900634093 2900640691 293
768 iso_pu_bacteria 2904483920 2904488779 293
769 iso_pu_bacteria 2904615490 2904624386 293
770 iso_pu_bacteria 2919481497 2919483569 293
771 iso_pu_bacteria 2919527303 2919529388 293
772 iso_pu_bacteria 2928058823 2928063029 293
773 iso_pu_bacteria 2928157003 2928159243 293
774 iso_pu_bacteria 642555112 642598019 293
775 iso_pu_bacteria 642555113 642616557 293
776 iso_pu_bacteria 8003955200 8003960075 293
777 iso_pu_bacteria 8018845410 8018847426 293
778 iso_pu_bacteria 8020938398 8020940463 293
779 iso_pu_bacteria 8020945358 8020951115 293
780 iso_pu_bacteria 8020953355 8020955158 293
781 iso_pu_bacteria 8021120328 8021124969 293
782 iso_pu_bacteria 8055301274 8055303420 293
783 3300013102 Ga0157371_10006310 Ga0157371_100063108 294
784 3300013105 Ga0157369_10000470 Ga0157369_1000047024 294
785 3300025294 Ga0209025_1002244 Ga0209025_100224411 294
786 3300038443 Ga0395901_0055537 Ga0395901_0055537_110_1141 294
787 3300039447 Ga0436361_0722541 Ga0436361_0722541_653_1684 294
788 3300044658 Ga0466972_0077594 Ga0466972_0077594_21_1052 294
789 3300044683 Ga0466965_0000562 Ga0466965_0000562_8363_9394 294
790 3300044683 Ga0466965_0009438 Ga0466965_0009438_3285_4316 294
791 3300044684 Ga0466966_0000037 Ga0466966_0000037_33658_34689 294
792 3300044684 Ga0466966_0015901 Ga0466966_0015901_3515_4546 294
793 3300044693 Ga0466961_0000258 Ga0466961_0000258_3711_4742 294
794 3300044693 Ga0466961_0000327 Ga0466961_0000327_25820_26851 294
795 3300044694 Ga0466963_0003439 Ga0466963_0003439_4003_5034 294
796 3300044694 Ga0466963_0117134 Ga0466963_0117134_142_1173 294
797 3300044706 Ga0466964_0061900 Ga0466964_0061900_253_1284 294
798 3300044719 Ga0466971_0006298 Ga0466971_0006298_49_1080 294
799 3300044719 Ga0466971_0101220 Ga0466971_0101220_89_1120 294
800 3300044765 Ga0466970_0005264 Ga0466970_0005264_4332_5363 294
801 3300044842 Ga0466957_0001159 Ga0466957_0001159_10776_11807 294
802 3300044842 Ga0466957_0001316 Ga0466957_0001316_6574_7605 294
803 3300045049 Ga0466959_0000903 Ga0466959_0000903_5885_6916 294
804 3300045836 Ga0466958_0006489 Ga0466958_0006489_2882_3913 294
805 3300045836 Ga0466958_0006505 Ga0466958_0006505_652_1683 294
806 3300045836 Ga0466958_0027145 Ga0466958_0027145_1972_3003 294
807 3300061719 Ga0466962_0022747 Ga0466962_0022747_134_1165 294
808 iso_pu_bacteria 8001845381 8001846897 294
809 3300013306 Ga0163162_10005218 Ga0163162_100052186 296
810 3300013308 Ga0157375_10003789 Ga0157375_1000378910 296
811 3300017792 Ga0163161_10241246 Ga0163161_102412462 296
812 3300046455 Ga0495603_0005918 Ga0495603_0005918_1377_2411 296
813 3300046472 Ga0495580_0003235 Ga0495580_0003235_8889_9923 296
814 3300046474 Ga0495605_0016813 Ga0495605_0016813_1505_2539 296
815 3300046513 Ga0495616_0033558 Ga0495616_0033558_1291_2325 296
816 3300046648 Ga0495611_0133432 Ga0495611_0133432_100_1134 296
817 3300047319 Ga0495674_0006151 Ga0495674_0006151_6128_7162 296
818 3300047320 Ga0495672_0009673 Ga0495672_0009673_1339_2373 296
819 3300047443 Ga0495687_012424 Ga0495687_012424_52_1086 296
820 3300048903 Ga0496100_0000069 Ga0496100_0000069_10637_11671 296
821 3300048904 Ga0496101_0001306 Ga0496101_0001306_5178_6212 296
822 3300048904 Ga0496101_0014607 Ga0496101_0014607_2808_3842 296
823 3300048905 Ga0496102_0000247 Ga0496102_0000247_54924_55958 296
824 3300048906 Ga0496103_0001129 Ga0496103_0001129_2632_3666 296
825 3300048915 Ga0496112_0001514 Ga0496112_0001514_10929_11963 296
826 3300048916 Ga0496113_0011776 Ga0496113_0011776_4648_5682 296
827 3300048920 Ga0496117_0000445 Ga0496117_0000445_55111_56145 296
828 3300048921 Ga0496118_0000138 Ga0496118_0000138_98066_99100 296
829 3300048922 Ga0496119_0098593 Ga0496119_0098593_156_1190 296
830 3300048924 Ga0496121_0005348 Ga0496121_0005348_6792_7826 296
831 3300048927 Ga0496124_0059717 Ga0496124_0059717_1124_2161 296
832 iso_pu_bacteria 8005658619 8005662225 296
833 iso_pu_bacteria 8054002106 8054008053 296
834 3300001979 JGI24740J21852_10000445 JGI24740J21852_1000044514 297
835 3300001979 JGI24740J21852_10015020 JGI24740J21852_100150202 297
836 3300002705 JGI25156J39149_1003020 JGI25156J39149_10030204 297
837 3300002705 JGI25156J39149_1009040 JGI25156J39149_10090403 297
838 3300002738 JGI25154J39366_1001003 JGI25154J39366_10010034 297
839 3300003752 Ga0055539_1000100 Ga0055539_100010088 297
840 3300003756 Ga0055533_1000586 Ga0055533_10005866 297
841 3300003758 Ga0055532_1000127 Ga0055532_10001279 297
842 3300003759 Ga0055525_1000487 Ga0055525_10004879 297
843 3300003760 Ga0055527_1001540 Ga0055527_10015402 297
844 3300003761 Ga0055535_1000140 Ga0055535_10001409 297
845 3300003762 Ga0055542_1002532 Ga0055542_10025324 297
846 3300003763 Ga0055529_1000230 Ga0055529_10002303 297
847 3300003841 Ga0055541_1000241 Ga0055541_100024117 297
848 3300005344 Ga0070661_100000119 Ga0070661_10000011945 297
849 3300005366 Ga0070659_100004537 Ga0070659_1000045379 297
850 3300005455 Ga0070663_100000035 Ga0070663_10000003549 297
851 3300005564 Ga0070664_100000008 Ga0070664_100000008167 297
852 3300005577 Ga0068857_100031848 Ga0068857_1000318483 297
853 3300005578 Ga0068854_100012088 Ga0068854_1000120883 297
854 3300005614 Ga0068856_100000862 Ga0068856_10000086227 297
855 3300005616 Ga0068852_100178896 Ga0068852_1001788962 297
856 3300009174 Ga0105241_10177676 Ga0105241_101776762 297
857 3300013100 Ga0157373_10019216 Ga0157373_100192163 297
858 3300013102 Ga0157371_10000413 Ga0157371_1000041346 297
859 3300013104 Ga0157370_10000456 Ga0157370_1000045645 297
860 3300013105 Ga0157369_10002006 Ga0157369_100020067 297
861 3300013307 Ga0157372_10000142 Ga0157372_100001429 297
862 3300015261 Ga0182006_1002877 Ga0182006_10028779 297
863 3300015261 Ga0182006_1005567 Ga0182006_10055674 297
864 3300015262 Ga0182007_10007390 Ga0182007_100073902 297
865 3300020077 Ga0206351_10994603 Ga0206351_109946032 297
866 3300020610 Ga0154015_1049643 Ga0154015_10496439 297
867 3300025224 Ga0209784_100003 Ga0209784_100003993 297
868 3300025224 Ga0209784_100771 Ga0209784_1007714 297
869 3300025225 Ga0209566_100002 Ga0209566_1000021947 297
870 3300025225 Ga0209566_101176 Ga0209566_1011769 297
871 3300025225 Ga0209566_102258 Ga0209566_1022582 297
872 3300025226 Ga0209674_100008 Ga0209674_100008238 297
873 3300025226 Ga0209674_100118 Ga0209674_10011863 297
874 3300025228 Ga0209672_100818 Ga0209672_1008187 297
875 3300025229 Ga0209147_100002 Ga0209147_1000021422 297
876 3300025230 Ga0209563_100004 Ga0209563_1000041364 297
877 3300025242 Ga0209258_100002 Ga0209258_1000021422 297
878 3300025246 Ga0209646_1000059 Ga0209646_1000059229 297
879 3300025253 Ga0209677_100009 Ga0209677_100009268 297
880 3300025253 Ga0209677_102100 Ga0209677_1021005 297
881 3300025254 Ga0209148_1000021 Ga0209148_100002171 297
882 3300025254 Ga0209148_1003029 Ga0209148_10030293 297
883 3300025256 Ga0209759_1005995 Ga0209759_10059952 297
884 3300025256 Ga0209759_1006312 Ga0209759_10063122 297
885 3300025272 Ga0209455_1000021 Ga0209455_10000219 297
886 3300025911 Ga0207654_10117965 Ga0207654_101179651 297
887 3300025913 Ga0207695_10002210 Ga0207695_100022102 297
888 3300025932 Ga0207690_10016779 Ga0207690_100167792 297
889 3300025941 Ga0207711_10055280 Ga0207711_100552803 297
890 3300025941 Ga0207711_10115242 Ga0207711_101152422 297
891 3300025945 Ga0207679_10000001 Ga0207679_100000019 297
892 3300025981 Ga0207640_10008428 Ga0207640_100084283 297
893 3300026067 Ga0207678_10002602 Ga0207678_100026029 297
894 3300026078 Ga0207702_10000024 Ga0207702_10000024113 297
895 3300026116 Ga0207674_10054990 Ga0207674_100549902 297
896 3300037418 Ga0395900_0001932 Ga0395900_0001932_10304_11335 297
897 3300037471 Ga0395905_0133525 Ga0395905_0133525_1289_2320 297
898 3300044650 Ga0466986_0136556 Ga0466986_0136556_373_1404 297
899 3300044656 Ga0466969_0030281 Ga0466969_0030281_565_1596 297
900 3300044658 Ga0466972_0008642 Ga0466972_0008642_2109_3140 297
901 3300044672 Ga0466982_0020541 Ga0466982_0020541_481_1512 297
902 3300044693 Ga0466961_0000435 Ga0466961_0000435_19093_20124 297
903 3300044706 Ga0466964_0001045 Ga0466964_0001045_3444_4475 297
904 3300044765 Ga0466970_0000271 Ga0466970_0000271_17842_18873 297
905 3300044901 Ga0466960_0005296 Ga0466960_0005296_1272_2303 297
906 3300045049 Ga0466959_0002163 Ga0466959_0002163_4703_5734 297
907 3300046460 Ga0495638_0054916 Ga0495638_0054916_769_1800 297
908 3300046501 Ga0495607_0000149 Ga0495607_0000149_4016_5056 297
909 3300046507 Ga0495606_0000295 Ga0495606_0000295_82007_83047 297
910 3300046515 Ga0495620_0001169 Ga0495620_0001169_3843_4883 297
911 3300046524 Ga0495648_0124062 Ga0495648_0124062_163_1203 297
912 3300046665 Ga0495661_0016099 Ga0495661_0016099_2310_3350 297
913 3300048905 Ga0496102_0165780 Ga0496102_0165780_624_1655 297
914 3300048921 Ga0496118_0067877 Ga0496118_0067877_439_1470 297
915 3300048921 Ga0496118_0087822 Ga0496118_0087822_76_1107 297
916 3300048927 Ga0496124_0165069 Ga0496124_0165069_134_1165 297
917 3300048928 Ga0496125_0002526 Ga0496125_0002526_12023_13054 297
918 3300049460 Ga0495682_0000030 Ga0495682_0000030_116353_117393 297
919 iso_pu_bacteria 2508501125 2509127866 297
920 iso_pu_bacteria 2515154123 2515689755 297
921 iso_pu_bacteria 2599185355 2600208325 297
922 iso_pu_bacteria 2675903129 2676744008 297
923 iso_pu_bacteria 2928163908 2928164701 297
924 iso_pu_bacteria 2945934425 2945938685 297
925 iso_pu_bacteria 2981990288 2981993665 297
926 iso_pu_bacteria 2990703756 2990708684 297
927 iso_pu_bacteria 641736151 642426418 297

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02653

BPD_transp_2

Branched-chain amino acid transport system / permease component

67

348

0.95

Feature Viewer

pLDDT pTM Quality
51.8 0.47 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map