F485897

General Info

Members Datasets Scaffolds Average Seq Length
925 419 925 139

Family's Representative Sequence

Representative Sequence 3300046516|Ga0495628_0571158|Ga0495628_0571158_32_511
Length 159
Sequence MCDYSLHLVASRPAKVGDKLVATDFAKSITGGFAAVGEPDVAVCLLPGTELAFEENVQYQRAFSLFGRARVDHKVARFRQVNVNDPNLHHDALEFPSGQIVMVTRLVAGQRATVLQLPASTRDHGGAKESEQVSSTGRIEACRQYARVPCHVTWPDLGD

Samples

Sample ID Description Type Environment
1 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
2 3300003160 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_22 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003559 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300003568 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_24 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
8 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
9 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
10 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
11 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
12 3300003735 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
13 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
14 3300004785 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
15 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
16 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
17 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
18 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
19 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
26 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
29 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
30 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
35 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
38 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
39 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
40 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
41 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
42 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
43 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
44 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
45 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
46 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
47 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
48 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
49 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
50 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
51 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
52 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
53 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
54 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
55 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
56 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
57 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
58 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
59 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
60 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
61 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
62 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
63 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
64 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
65 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
66 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
67 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
68 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
69 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
70 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
71 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
72 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
73 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
74 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
75 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
76 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
77 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
78 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
79 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
80 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
81 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
82 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
83 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
84 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
85 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
86 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
87 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
88 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
89 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
90 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
91 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
92 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
93 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
94 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
96 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
97 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
98 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
99 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
100 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
101 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
102 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
103 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
104 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
105 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
106 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
107 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
108 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
109 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
110 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
111 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
112 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
113 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
114 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
115 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
116 3300013052 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
117 3300013059 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
118 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
119 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
120 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
121 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
122 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
123 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
124 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
125 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
126 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
127 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
128 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
129 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
130 3300019161 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA2 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
131 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
132 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
133 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
134 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
135 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
136 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
137 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
138 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
139 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
140 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
141 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
142 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
143 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
144 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
145 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
203 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
204 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300030863 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
207 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
208 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
209 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
210 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
211 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
212 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
213 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
214 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
215 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
216 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
217 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
218 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
219 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
220 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
221 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
222 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
223 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
224 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
225 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
226 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
227 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
228 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
229 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
230 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
231 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
232 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
233 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
234 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
235 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
236 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
237 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
238 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
239 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
240 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
241 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
242 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
243 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
244 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
245 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
246 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
247 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
248 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
249 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
250 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
251 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
252 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
253 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
254 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
255 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
256 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
257 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
258 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
259 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
260 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
261 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
262 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
263 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
264 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
265 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
266 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
267 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
268 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
269 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
270 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
271 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
272 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
273 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
274 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
275 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
276 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
277 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
278 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
279 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
280 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
281 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
282 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
283 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
284 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
285 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
286 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
287 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
288 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
289 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
290 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
291 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
292 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
293 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
294 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
295 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
296 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
297 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
298 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
299 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
300 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
301 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
302 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
303 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
304 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
305 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
306 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
307 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
308 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
309 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
310 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
311 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
312 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
313 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
314 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
315 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
316 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
317 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
318 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
319 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
320 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
321 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
322 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
323 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
324 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
325 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
326 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
327 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
328 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
329 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
330 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
331 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
332 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
333 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
334 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
335 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
336 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
337 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
338 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
339 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
340 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
341 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
342 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
343 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
344 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
345 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
346 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
347 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
348 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
349 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
350 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
351 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
352 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
353 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
354 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
355 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
356 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
357 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
358 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
359 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
360 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
361 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
362 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
363 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
364 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
365 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
366 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
367 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
368 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
369 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
370 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
371 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
372 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
373 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
374 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
375 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
376 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
377 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
378 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
379 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
380 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
381 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
382 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
383 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
384 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
385 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
386 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
387 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
388 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
389 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
390 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
391 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
392 3300059514 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
393 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
394 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
395 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
396 3300059608 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 166R_SD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
397 3300059609 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 227R_SD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
398 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
399 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
400 3300059625 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
401 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
402 3300059628 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
403 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
404 3300059631 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
405 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
406 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
407 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
408 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
409 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
410 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
411 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
412 3300059651 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
413 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
414 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
415 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
416 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
417 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
418 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
419 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 80.22
Metatranscriptomes 19.78
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.7
Nodule 0
Rhizoplane 10.16
Rhizosphere 85.51
Stem 0
Stem Tuber 0
Unclassified 1.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24033J26618_1009174 3300002155 Bacteria 1148
2 Ga0006779J45831_105002 3300003160 Unclassified 634
3 Ga0006778J45830_1025721 3300003162 Unclassified 636
4 Ga0007417J51691_1007401 3300003544 Bacteria 770
5 Ga0007417J51691_1016276 3300003544 Unclassified 871
6 Ga0007427J51700_101877 3300003559 Bacteria 638
7 Ga0007427J51700_111823 3300003559 Unclassified 831
8 Ga0006781J51513_1002506 3300003568 Bacteria 711
9 Ga0006781J51513_1011320 3300003568 Unclassified 697
10 Ga0007410J51695_1040494 3300003574 Unclassified 707
11 Ga0007409J51694_1084557 3300003575 Unclassified 593
12 Ga0007416J51690_1003489 3300003577 Bacteria 774
13 Ga0007416J51690_1013219 3300003577 Bacteria 1275
14 Ga0007429J51699_1001323 3300003579 Bacteria 696
15 Ga0007429J51699_1024338 3300003579 Unclassified 674
16 Ga0007429J51699_1065486 3300003579 Bacteria 667
17 Ga0007429J51699_1074725 3300003579 Unclassified 637
18 Ga0032354_1000148 3300003693 Bacteria 777
19 Ga0032354_1017980 3300003693 Unclassified 673
20 Ga0032354_1086103 3300003693 Unclassified 637
21 Ga0006780_1000018 3300003735 Bacteria 775
22 JGI25405J52794_10069082 3300003911 Bacteria 770
23 Ga0058858_1018139 3300004785 Bacteria 646
24 Ga0058858_1395822 3300004785 Bacteria 693
25 Ga0058859_10132773 3300004798 Bacteria 964
26 Ga0058859_11468875 3300004798 Bacteria 749
27 Ga0058859_11832506 3300004798 Unclassified 515
28 Ga0058861_10078353 3300004800 Bacteria 647
29 Ga0058860_11971673 3300004801 Bacteria 729
30 Ga0058860_12096257 3300004801 Unclassified 621
31 Ga0058862_10052381 3300004803 Unclassified 549
32 Ga0058862_12066838 3300004803 Bacteria 630
33 Ga0070676_10134024 3300005328 Bacteria 1570
34 Ga0070683_100359412 3300005329 Bacteria 1387
35 Ga0070690_100026431 3300005330 Bacteria 3580
36 Ga0070670_100018116 3300005331 Bacteria 6045
37 Ga0070670_100018448 3300005331 Bacteria 5986
38 Ga0068869_101838936 3300005334 Bacteria 542
39 Ga0070666_10044401 3300005335 Bacteria 2977
40 Ga0070666_10057607 3300005335 Bacteria 2626
41 Ga0070680_100812430 3300005336 Bacteria 806
42 Ga0070682_100546721 3300005337 Bacteria 905
43 Ga0070660_100937673 3300005339 Unclassified 731
44 Ga0070689_100102269 3300005340 Unclassified 2269
45 Ga0070691_10597363 3300005341 Bacteria 651
46 Ga0070687_100037005 3300005343 Bacteria 2436
47 Ga0070661_100416323 3300005344 Bacteria 1064
48 Ga0070692_10719776 3300005345 Unclassified 674
49 Ga0070668_100320190 3300005347 Unclassified 1305
50 Ga0070669_100117314 3300005353 Bacteria 2026
51 Ga0070669_100139195 3300005353 Bacteria 1870
52 Ga0070669_100149900 3300005353 Bacteria 1805
53 Ga0070675_100049189 3300005354 Bacteria 3459
54 Ga0070675_100235398 3300005354 Bacteria 1599
55 Ga0070675_100755168 3300005354 Bacteria 888
56 Ga0070671_100009476 3300005355 Bacteria 7817
57 Ga0070671_100064152 3300005355 Bacteria 3060
58 Ga0070671_101337993 3300005355 Bacteria 632
59 Ga0070674_100079286 3300005356 Bacteria 2342
60 Ga0070674_100591146 3300005356 Bacteria 937
61 Ga0070674_101533903 3300005356 Unclassified 599
62 Ga0070673_100657716 3300005364 Bacteria 960
63 Ga0070673_100718001 3300005364 Unclassified 919
64 Ga0070688_100018344 3300005365 Bacteria 4037
65 Ga0070688_100027605 3300005365 Bacteria 3381
66 Ga0070688_100906394 3300005365 Unclassified 696
67 Ga0070659_100113034 3300005366 Unclassified 2193
68 Ga0070667_101023746 3300005367 Bacteria 771
69 Ga0070667_101388972 3300005367 Unclassified 659
70 Ga0070709_10082879 3300005434 Bacteria 2096
71 Ga0070709_10944450 3300005434 Bacteria 684
72 Ga0070714_100020696 3300005435 Bacteria 5376
73 Ga0070714_100168281 3300005435 Bacteria 1987
74 Ga0070714_100904232 3300005435 Unclassified 857
75 Ga0070713_100493046 3300005436 Bacteria 1155
76 Ga0070713_100962474 3300005436 Bacteria 823
77 Ga0070713_101547507 3300005436 Unclassified 644
78 Ga0070710_10083071 3300005437 Bacteria 1873
79 Ga0070710_10149717 3300005437 Bacteria 1438
80 Ga0070710_10428008 3300005437 Bacteria 893
81 Ga0070701_10013534 3300005438 Bacteria 3715
82 Ga0070701_10506565 3300005438 Unclassified 785
83 Ga0070711_100016144 3300005439 Bacteria 4737
84 Ga0070711_100179263 3300005439 Bacteria 1621
85 Ga0070711_100207346 3300005439 Unclassified 1516
86 Ga0070711_100775950 3300005439 Bacteria 811
87 Ga0070700_100014676 3300005441 Bacteria 4427
88 Ga0070700_100140161 3300005441 Bacteria 1642
89 Ga0070700_100420429 3300005441 Bacteria 1010
90 Ga0070694_100412145 3300005444 Unclassified 1060
91 Ga0070708_100043659 3300005445 Bacteria 3939
92 Ga0070708_100054827 3300005445 Bacteria 3543
93 Ga0070663_100035496 3300005455 Bacteria 3460
94 Ga0070663_100074305 3300005455 Bacteria 2482
95 Ga0070678_100139918 3300005456 Bacteria 1935
96 Ga0070662_100067984 3300005457 Bacteria 2618
97 Ga0070662_100278377 3300005457 Bacteria 1353
98 Ga0068867_100104962 3300005459 Bacteria 2163
99 Ga0068867_100505359 3300005459 Unclassified 1040
100 Ga0070685_10369189 3300005466 Bacteria 986
101 Ga0070685_10564061 3300005466 Bacteria 815
102 Ga0070706_100122485 3300005467 Bacteria 2424
103 Ga0070706_100236050 3300005467 Bacteria 1707
104 Ga0070706_100331581 3300005467 Bacteria 1419
105 Ga0070706_101976066 3300005467 Unclassified 528
106 Ga0070707_100109187 3300005468 Unclassified 2683
107 Ga0070707_100136149 3300005468 Unclassified 2389
108 Ga0070707_100708605 3300005468 Unclassified 969
109 Ga0070707_101215129 3300005468 Unclassified 720
110 Ga0070707_101337567 3300005468 Bacteria 683
111 Ga0070698_100069880 3300005471 Bacteria 3525
112 Ga0070698_100152669 3300005471 Bacteria 2256
113 Ga0070698_100200879 3300005471 Bacteria 1929
114 Ga0070698_100233903 3300005471 Bacteria 1771
115 Ga0070698_100341178 3300005471 Unclassified 1430
116 Ga0070698_100462008 3300005471 Bacteria 1205
117 Ga0070698_100766110 3300005471 Unclassified 908
118 Ga0070699_100058152 3300005518 Bacteria 3349
119 Ga0070699_100251049 3300005518 Bacteria 1580
120 Ga0070699_100534231 3300005518 Bacteria 1067
121 Ga0070679_100615437 3300005530 Bacteria 1029
122 Ga0070684_100066380 3300005535 Bacteria 3167
123 Ga0070684_100387179 3300005535 Bacteria 1288
124 Ga0070697_100104226 3300005536 Bacteria 2358
125 Ga0070697_100126657 3300005536 Bacteria 2140
126 Ga0070697_100639363 3300005536 Bacteria 937
127 Ga0068853_100822949 3300005539 Unclassified 890
128 Ga0068853_101284691 3300005539 Bacteria 707
129 Ga0070672_100158598 3300005543 Bacteria 1875
130 Ga0070672_100606769 3300005543 Bacteria 953
131 Ga0070686_100096914 3300005544 Bacteria 1984
132 Ga0070696_100065176 3300005546 Bacteria 2553
133 Ga0070696_101213112 3300005546 Bacteria 638
134 Ga0070696_101427220 3300005546 Unclassified 591
135 Ga0070693_100455422 3300005547 Unclassified 899
136 Ga0070693_101545512 3300005547 Bacteria 520
137 Ga0070665_100128607 3300005548 Bacteria 2535
138 Ga0070665_102079851 3300005548 Bacteria 572
139 Ga0068855_100834263 3300005563 Bacteria 978
140 Ga0070664_100366081 3300005564 Bacteria 1313
141 Ga0068857_100753197 3300005577 Bacteria 928
142 Ga0068854_100352165 3300005578 Bacteria 1205
143 Ga0068854_100495779 3300005578 Bacteria 1028
144 Ga0068856_100646029 3300005614 Bacteria 1079
145 Ga0068856_100756512 3300005614 Bacteria 992
146 Ga0070702_100014870 3300005615 Bacteria 3960
147 Ga0068852_100214320 3300005616 Unclassified 1828
148 Ga0068864_100352638 3300005618 Bacteria 1388
149 Ga0068866_10074827 3300005718 Unclassified 1801
150 Ga0068861_100415278 3300005719 Bacteria 1198
151 Ga0068861_100593441 3300005719 Bacteria 1015
152 Ga0068861_102063585 3300005719 Unclassified 569
153 Ga0068870_10004501 3300005840 Bacteria 6002
154 Ga0068870_10326393 3300005840 Bacteria 977
155 Ga0068863_100308785 3300005841 Bacteria 1535
156 Ga0068860_100114443 3300005843 Bacteria 2579
157 Ga0068860_100415553 3300005843 Bacteria 1333
158 Ga0068860_100947404 3300005843 Unclassified 878
159 Ga0081455_10000369 3300005937 Bacteria 59441
160 Ga0081455_10028989 3300005937 Bacteria 5050
161 Ga0081455_10057457 3300005937 Bacteria 3297
162 Ga0081455_10106478 3300005937 Bacteria 2238
163 Ga0081455_10151957 3300005937 Bacteria 1784
164 Ga0081455_10541644 3300005937 Unclassified 772
165 Ga0081538_10017526 3300005981 Bacteria 5432
166 Ga0081538_10043091 3300005981 Bacteria 2839
167 Ga0081540_1001551 3300005983 Bacteria 19695
168 Ga0081540_1007072 3300005983 Bacteria 8064
169 Ga0070717_10081935 3300006028 Bacteria 2710
170 Ga0070717_10120438 3300006028 Bacteria 2248
171 Ga0070717_10188478 3300006028 Bacteria 1801
172 Ga0070717_10191779 3300006028 Bacteria 1786
173 Ga0070717_10303427 3300006028 Bacteria 1420
174 Ga0070717_10383847 3300006028 Unclassified 1260
175 Ga0070717_10469421 3300006028 Unclassified 1136
176 Ga0070717_10586378 3300006028 Bacteria 1011
177 Ga0070717_10854552 3300006028 Bacteria 828
178 Ga0070717_11059482 3300006028 Bacteria 738
179 Ga0075365_10045129 3300006038 Bacteria 2890
180 Ga0075365_10071606 3300006038 Bacteria 2334
181 Ga0075365_10099783 3300006038 Bacteria 1987
182 Ga0075365_10228597 3300006038 Bacteria 1306
183 Ga0075365_10253798 3300006038 Unclassified 1236
184 Ga0075365_10306378 3300006038 Unclassified 1118
185 Ga0075368_10146708 3300006042 Bacteria 985
186 Ga0075364_10050177 3300006051 Bacteria 2723
187 Ga0075364_10646212 3300006051 Bacteria 722
188 Ga0070715_10029214 3300006163 Bacteria 2219
189 Ga0070715_10868930 3300006163 Bacteria 553
190 Ga0070716_100094027 3300006173 Bacteria 1821
191 Ga0070716_100159984 3300006173 Bacteria 1458
192 Ga0070716_101160769 3300006173 Unclassified 618
193 Ga0070712_100002439 3300006175 Bacteria 11462
194 Ga0070712_100589261 3300006175 Unclassified 940
195 Ga0070712_100611300 3300006175 Unclassified 923
196 Ga0070712_100639843 3300006175 Unclassified 903
197 Ga0075362_10028304 3300006177 Bacteria 2406
198 Ga0075362_10161142 3300006177 Bacteria 1080
199 Ga0075367_10217031 3300006178 Bacteria 1196
200 Ga0075367_10325693 3300006178 Bacteria 968
201 Ga0097621_100236927 3300006237 Bacteria 1594
202 Ga0075428_100015732 3300006844 Bacteria 8383
203 Ga0075428_101774664 3300006844 Unclassified 643
204 Ga0075430_100034490 3300006846 Bacteria 4295
205 Ga0075430_100236502 3300006846 Unclassified 1514
206 Ga0075431_100167687 3300006847 Bacteria 2257
207 Ga0075431_100408046 3300006847 Bacteria 1359
208 Ga0075431_100656759 3300006847 Bacteria 1029
209 Ga0075431_101444810 3300006847 Bacteria 647
210 Ga0075433_10250985 3300006852 Unclassified 1570
211 Ga0075433_10602357 3300006852 Unclassified 965
212 Ga0075433_10644391 3300006852 Bacteria 929
213 Ga0075433_10694826 3300006852 Bacteria 891
214 Ga0075434_100105190 3300006871 Bacteria 2832
215 Ga0075434_100145464 3300006871 Bacteria 2390
216 Ga0075434_100975042 3300006871 Bacteria 862
217 Ga0075429_100168341 3300006880 Bacteria 1920
218 Ga0075429_100344047 3300006880 Bacteria 1305
219 Ga0068865_100049206 3300006881 Bacteria 2904
220 Ga0068865_100991666 3300006881 Unclassified 735
221 Ga0075436_100507205 3300006914 Bacteria 883
222 Ga0075436_100903018 3300006914 Unclassified 661
223 Ga0075436_101278735 3300006914 Bacteria 555
224 Ga0075435_100355131 3300007076 Bacteria 1257
225 Ga0075435_100854686 3300007076 Bacteria 793
226 Ga0075435_100909488 3300007076 Bacteria 767
227 Ga0099794_10070478 3300007265 Bacteria 1711
228 Ga0099794_10471596 3300007265 Unclassified 659
229 Ga0099795_10143175 3300007788 Bacteria 974
230 Ga0111539_10085197 3300009094 Bacteria 3715
231 Ga0111539_10289881 3300009094 Bacteria 1905
232 Ga0111539_10293474 3300009094 Unclassified 1892
233 Ga0105245_10204641 3300009098 Unclassified 1897
234 Ga0105245_11334946 3300009098 Bacteria 766
235 Ga0105247_10015282 3300009101 Bacteria 4600
236 Ga0105247_10230807 3300009101 Bacteria 1257
237 Ga0105247_10843521 3300009101 Unclassified 703
238 Ga0114129_10051640 3300009147 Bacteria 5771
239 Ga0114129_10131074 3300009147 Bacteria 3443
240 Ga0114129_10289264 3300009147 Bacteria 2187
241 Ga0114129_10343536 3300009147 Bacteria 1979
242 Ga0114129_10531829 3300009147 Bacteria 1531
243 Ga0114129_11497206 3300009147 Unclassified 829
244 Ga0105243_10194213 3300009148 Bacteria 1775
245 Ga0105243_10536808 3300009148 Unclassified 1115
246 Ga0105243_10772170 3300009148 Bacteria 944
247 Ga0105243_11241022 3300009148 Bacteria 760
248 Ga0105241_10161373 3300009174 Bacteria 1843
249 Ga0105241_11522126 3300009174 Bacteria 644
250 Ga0105242_12778776 3300009176 Unclassified 540
251 Ga0105248_10407732 3300009177 Bacteria 1530
252 Ga0105248_10534073 3300009177 Bacteria 1323
253 Ga0105249_10159072 3300009553 Bacteria 2181
254 Ga0105249_10378338 3300009553 Bacteria 1441
255 Ga0105249_12877806 3300009553 Unclassified 552
256 Ga0105239_10405762 3300010375 Bacteria 1542
257 Ga0105239_11025479 3300010375 Bacteria 949
258 Ga0154014_150331 3300013052 Bacteria 697
259 Ga0154012_140635 3300013059 Bacteria 563
260 Ga0157373_10285172 3300013100 Bacteria 1171
261 Ga0157374_10270410 3300013296 Bacteria 1676
262 Ga0157374_10402074 3300013296 Bacteria 1366
263 Ga0157374_10643125 3300013296 Bacteria 1072
264 Ga0157378_10438659 3300013297 Unclassified 1294
265 Ga0157378_10439831 3300013297 Bacteria 1292
266 Ga0157378_10590715 3300013297 Unclassified 1120
267 Ga0157378_10942317 3300013297 Bacteria 896
268 Ga0157378_11211075 3300013297 Bacteria 795
269 Ga0163162_10333384 3300013306 Bacteria 1649
270 Ga0163162_11485757 3300013306 Unclassified 772
271 Ga0163162_11834814 3300013306 Unclassified 693
272 Ga0157372_10807664 3300013307 Bacteria 1090
273 Ga0157372_11606258 3300013307 Bacteria 748
274 Ga0157375_10184232 3300013308 Bacteria 2240
275 Ga0163163_10040709 3300014325 Bacteria 4539
276 Ga0163163_10535215 3300014325 Unclassified 1234
277 Ga0157380_10068098 3300014326 Unclassified 2868
278 Ga0157380_10223193 3300014326 Unclassified 1687
279 Ga0157377_10084988 3300014745 Unclassified 1857
280 Ga0157377_10097628 3300014745 Unclassified 1745
281 Ga0157379_11207434 3300014968 Bacteria 728
282 Ga0157376_10244502 3300014969 Bacteria 1673
283 Ga0157376_10452972 3300014969 Bacteria 1252
284 Ga0157376_10641105 3300014969 Unclassified 1062
285 Ga0157376_11168024 3300014969 Unclassified 797
286 Ga0163161_10261456 3300017792 Unclassified 1352
287 Ga0184602_102655 3300019161 Unclassified 933
288 Ga0197907_10378417 3300020069 Bacteria 1021
289 Ga0197907_10412332 3300020069 Bacteria 682
290 Ga0197907_10436085 3300020069 Bacteria 583
291 Ga0197907_10581883 3300020069 Unclassified 703
292 Ga0197907_11123152 3300020069 Unclassified 528
293 Ga0197907_11475688 3300020069 Bacteria 781
294 Ga0206356_10020745 3300020070 Unclassified 884
295 Ga0206356_10234046 3300020070 Bacteria 874
296 Ga0206356_10379118 3300020070 Unclassified 641
297 Ga0206356_10790521 3300020070 Unclassified 739
298 Ga0206349_1199217 3300020075 Unclassified 722
299 Ga0206349_1200178 3300020075 Bacteria 740
300 Ga0206349_1738978 3300020075 Bacteria 730
301 Ga0206355_1492172 3300020076 Unclassified 516
302 Ga0206355_1592198 3300020076 Bacteria 681
303 Ga0206351_10277121 3300020077 Unclassified 615
304 Ga0206352_10013594 3300020078 Bacteria 752
305 Ga0206352_10517138 3300020078 Bacteria 884
306 Ga0206352_11307728 3300020078 Bacteria 694
307 Ga0206350_10243537 3300020080 Bacteria 694
308 Ga0206350_10444938 3300020080 Bacteria 1101
309 Ga0206350_11413227 3300020080 Unclassified 730
310 Ga0206350_11521557 3300020080 Bacteria 875
311 Ga0206350_11522061 3300020080 Unclassified 694
312 Ga0206350_11526535 3300020080 Unclassified 535
313 Ga0206354_10360926 3300020081 Unclassified 744
314 Ga0206354_10615845 3300020081 Bacteria 815
315 Ga0206354_11704864 3300020081 Bacteria 804
316 Ga0206353_11020452 3300020082 Bacteria 687
317 Ga0206353_11470667 3300020082 Bacteria 850
318 Ga0154015_1199851 3300020610 Bacteria 670
319 Ga0154015_1542634 3300020610 Unclassified 769
320 Ga0213872_10010968 3300021361 Bacteria 4299
321 Ga0213872_10210754 3300021361 Unclassified 830
322 Ga0213875_10613492 3300021388 Unclassified 526
323 Ga0224712_10179313 3300022467 Bacteria 954
324 Ga0224712_10289323 3300022467 Unclassified 764
325 Ga0224712_10310290 3300022467 Bacteria 739
326 Ga0224712_10313619 3300022467 Unclassified 736
327 Ga0224712_10316245 3300022467 Unclassified 733
328 Ga0224572_1036098 3300024225 Unclassified 936
329 Ga0207697_10156602 3300025315 Bacteria 992
330 Ga0207653_10078321 3300025885 Bacteria 1140
331 Ga0207642_10114573 3300025899 Bacteria 1379
332 Ga0207710_10019040 3300025900 Bacteria 2927
333 Ga0207710_10054606 3300025900 Bacteria 1799
334 Ga0207688_10001492 3300025901 Bacteria 12273
335 Ga0207688_10043206 3300025901 Bacteria 2509
336 Ga0207680_10116578 3300025903 Bacteria 1741
337 Ga0207680_10117441 3300025903 Bacteria 1735
338 Ga0207647_10064305 3300025904 Bacteria 2230
339 Ga0207647_10080204 3300025904 Bacteria 1958
340 Ga0207685_10030385 3300025905 Bacteria 1923
341 Ga0207685_10640220 3300025905 Unclassified 574
342 Ga0207699_10501460 3300025906 Bacteria 876
343 Ga0207699_10742264 3300025906 Bacteria 720
344 Ga0207645_10052747 3300025907 Bacteria 2598
345 Ga0207645_10335667 3300025907 Bacteria 1010
346 Ga0207643_10018058 3300025908 Bacteria 3864
347 Ga0207684_10107883 3300025910 Bacteria 2382
348 Ga0207684_10196637 3300025910 Bacteria 1739
349 Ga0207684_10267010 3300025910 Unclassified 1476
350 Ga0207684_10565391 3300025910 Bacteria 972
351 Ga0207671_11099007 3300025914 Bacteria 625
352 Ga0207693_10002798 3300025915 Bacteria 15117
353 Ga0207693_10163241 3300025915 Bacteria 1753
354 Ga0207693_10204105 3300025915 Bacteria 1554
355 Ga0207693_10334493 3300025915 Bacteria 1185
356 Ga0207663_10081200 3300025916 Bacteria 2122
357 Ga0207663_10311355 3300025916 Bacteria 1180
358 Ga0207663_10349900 3300025916 Bacteria 1118
359 Ga0207662_10025767 3300025918 Bacteria 3388
360 Ga0207657_10079354 3300025919 Bacteria 2761
361 Ga0207649_10111499 3300025920 Unclassified 1828
362 Ga0207652_11317848 3300025921 Bacteria 625
363 Ga0207646_10045133 3300025922 Bacteria 3956
364 Ga0207646_10269889 3300025922 Bacteria 1538
365 Ga0207681_10111477 3300025923 Bacteria 1991
366 Ga0207681_10845443 3300025923 Bacteria 765
367 Ga0207694_10469753 3300025924 Bacteria 1051
368 Ga0207650_10011646 3300025925 Bacteria 6059
369 Ga0207650_10272415 3300025925 Bacteria 1376
370 Ga0207650_10521552 3300025925 Bacteria 994
371 Ga0207659_10050312 3300025926 Bacteria 2960
372 Ga0207659_10057568 3300025926 Bacteria 2787
373 Ga0207687_10640293 3300025927 Bacteria 899
374 Ga0207687_10695188 3300025927 Bacteria 863
375 Ga0207700_10018269 3300025928 Bacteria 4707
376 Ga0207700_10057402 3300025928 Bacteria 2935
377 Ga0207700_10064917 3300025928 Bacteria 2783
378 Ga0207700_10221903 3300025928 Bacteria 1603
379 Ga0207700_10816416 3300025928 Unclassified 834
380 Ga0207664_10042402 3300025929 Bacteria 3552
381 Ga0207664_11314259 3300025929 Unclassified 643
382 Ga0207644_10037382 3300025931 Bacteria 3415
383 Ga0207644_10148115 3300025931 Bacteria 1814
384 Ga0207644_11390860 3300025931 Bacteria 589
385 Ga0207690_10783564 3300025932 Bacteria 787
386 Ga0207706_10019204 3300025933 Bacteria 6146
387 Ga0207706_10053851 3300025933 Bacteria 3552
388 Ga0207706_10255294 3300025933 Bacteria 1531
389 Ga0207686_10819032 3300025934 Bacteria 747
390 Ga0207709_10285542 3300025935 Bacteria 1221
391 Ga0207670_11421203 3300025936 Unclassified 589
392 Ga0207670_11713481 3300025936 Bacteria 535
393 Ga0207669_10040790 3300025937 Bacteria 2696
394 Ga0207704_10476776 3300025938 Bacteria 1001
395 Ga0207704_10521424 3300025938 Unclassified 961
396 Ga0207665_10036946 3300025939 Bacteria 3249
397 Ga0207665_10340854 3300025939 Bacteria 1129
398 Ga0207665_10938475 3300025939 Bacteria 687
399 Ga0207665_11354262 3300025939 Bacteria 567
400 Ga0207665_11396694 3300025939 Bacteria 557
401 Ga0207691_10066198 3300025940 Bacteria 3269
402 Ga0207691_10079100 3300025940 Unclassified 2959
403 Ga0207711_10265841 3300025941 Bacteria 1577
404 Ga0207689_10007050 3300025942 Bacteria 9880
405 Ga0207689_10581826 3300025942 Bacteria 941
406 Ga0207661_10409730 3300025944 Bacteria 1230
407 Ga0207712_11368901 3300025961 Bacteria 633
408 Ga0207668_10112818 3300025972 Unclassified 2043
409 Ga0207668_11078746 3300025972 Bacteria 719
410 Ga0207640_10417989 3300025981 Bacteria 1096
411 Ga0207658_10733060 3300025986 Bacteria 894
412 Ga0207658_10980433 3300025986 Unclassified 771
413 Ga0207677_10026042 3300026023 Bacteria 3661
414 Ga0207639_10105939 3300026041 Bacteria 2282
415 Ga0207678_10031904 3300026067 Bacteria 4593
416 Ga0207678_10139592 3300026067 Bacteria 2068
417 Ga0207708_10147770 3300026075 Bacteria 1848
418 Ga0207708_10263372 3300026075 Bacteria 1392
419 Ga0207708_11474352 3300026075 Bacteria 598
420 Ga0207702_10542294 3300026078 Unclassified 1137
421 Ga0207702_10995276 3300026078 Bacteria 832
422 Ga0207702_11280215 3300026078 Bacteria 727
423 Ga0207641_10023833 3300026088 Bacteria 5044
424 Ga0207641_10277864 3300026088 Bacteria 1574
425 Ga0207648_10009264 3300026089 Bacteria 9460
426 Ga0207648_10037591 3300026089 Bacteria 4265
427 Ga0207676_10625800 3300026095 Bacteria 1036
428 Ga0207676_10950511 3300026095 Bacteria 845
429 Ga0207674_10591420 3300026116 Unclassified 1072
430 Ga0207675_100013837 3300026118 Bacteria 7524
431 Ga0207675_100046797 3300026118 Bacteria 4041
432 Ga0207683_10100309 3300026121 Bacteria 2585
433 Ga0207683_10169191 3300026121 Bacteria 1978
434 Ga0207698_10136964 3300026142 Bacteria 2102
435 Ga0207698_10819419 3300026142 Unclassified 934
436 Ga0209588_1042858 3300027671 Bacteria 1462
437 Ga0209813_10106034 3300027866 Bacteria 962
438 Ga0207428_10450726 3300027907 Bacteria 938
439 Ga0207428_10463291 3300027907 Bacteria 923
440 Ga0207428_10938687 3300027907 Bacteria 610
441 Ga0268266_10603264 3300028379 Unclassified 1055
442 Ga0268265_10188166 3300028380 Bacteria 1780
443 Ga0268265_10542824 3300028380 Unclassified 1102
444 Ga0265766_1024928 3300030863 Unclassified 510
445 Ga0265760_10062728 3300031090 Unclassified 1131
446 Ga0373958_0106043 3300034819 Unclassified 665
447 Ga0373926_0043233 3300035083 Bacteria 1612
448 Ga0373926_0105224 3300035083 Bacteria 1057
449 Ga0373928_0076374 3300035084 Unclassified 838
450 Ga0373944_0028444 3300035089 Bacteria 1663
451 Ga0373944_0067261 3300035089 Bacteria 1160
452 Ga0373923_0198581 3300035111 Unclassified 927
453 Ga0373936_0038713 3300035113 Bacteria 1907
454 Ga0373936_0243616 3300035113 Unclassified 802
455 Ga0373936_0255210 3300035113 Unclassified 784
456 Ga0373939_0056791 3300035114 Unclassified 1233
457 Ga0373941_0208639 3300035115 Bacteria 746
458 Ga0373945_0174761 3300035116 Unclassified 881
459 Ga0373945_0421712 3300035116 Unclassified 587
460 Ga0373954_0635367 3300035118 Unclassified 529
461 Ga0373956_0217585 3300035119 Unclassified 907
462 Ga0373960_0042344 3300035121 Bacteria 1322
463 Ga0373960_0128896 3300035121 Unclassified 847
464 Ga0373943_0011464 3300035170 Bacteria 3989
465 Ga0373946_0031188 3300035171 Bacteria 2132
466 Ga0373946_0064428 3300035171 Bacteria 1567
467 Ga0373955_0073988 3300035172 Bacteria 1911
468 Ga0373931_0199159 3300035691 Bacteria 1195
469 Ga0373931_0213772 3300035691 Bacteria 1158
470 Ga0373935_0082821 3300035692 Bacteria 2087
471 Ga0373935_0118621 3300035692 Bacteria 1765
472 Ga0373927_0084446 3300035695 Bacteria 2059
473 Ga0373927_0137977 3300035695 Bacteria 1594
474 Ga0373927_0670210 3300035695 Unclassified 685
475 Ga0373947_0036818 3300035725 Bacteria 2902
476 Ga0373947_0060402 3300035725 Bacteria 2301
477 Ga0373947_0139526 3300035725 Bacteria 1554
478 Ga0373947_0163619 3300035725 Bacteria 1440
479 Ga0373937_0502873 3300036401 Bacteria 1151
480 Ga0373925_0032932 3300037068 Bacteria 3817
481 Ga0373925_0262751 3300037068 Bacteria 1387
482 Ga0373925_0339501 3300037068 Bacteria 1218
483 Ga0373925_1456352 3300037068 Bacteria 561
484 Ga0373925_1500860 3300037068 Bacteria 551
485 Ga0395899_0445565 3300037312 Bacteria 849
486 Ga0395900_0033259 3300037418 Bacteria 5308
487 Ga0395898_0227433 3300037466 Bacteria 1779
488 Ga0436364_0130205 3300037853 Unclassified 706
489 Ga0436364_0455480 3300037853 Bacteria 1218
490 Ga0436364_1473917 3300037853 Bacteria 1585
491 Ga0395901_0076997 3300038443 Bacteria 3481
492 Ga0436365_0570744 3300039437 Bacteria 1352
493 Ga0436361_0136579 3300039447 Bacteria 1423
494 Ga0436361_0393863 3300039447 Bacteria 3169
495 Ga0436361_0664153 3300039447 Bacteria 1781
496 Ga0436363_0534351 3300039450 Unclassified 544
497 Ga0436363_1444669 3300039450 Bacteria 1990
498 Ga0436362_0339453 3300039453 Bacteria 729
499 Ga0451798_0335678 3300041458 Bacteria 1009
500 Ga0451798_0894894 3300041458 Bacteria 686
501 Ga0451855_1305352 3300041511 Unclassified 512
502 Ga0495617_038478 3300046452 Bacteria 1600
503 Ga0495627_059643 3300046453 Unclassified 1132
504 Ga0495627_125542 3300046453 Unclassified 723
505 Ga0495603_0066454 3300046455 Bacteria 2123
506 Ga0495603_0167209 3300046455 Bacteria 1274
507 Ga0495590_0429765 3300046457 Unclassified 509
508 Ga0495591_048624 3300046458 Unclassified 1169
509 Ga0495629_0035675 3300046459 Bacteria 3514
510 Ga0495629_0043791 3300046459 Bacteria 3143
511 Ga0495629_0081757 3300046459 Bacteria 2255
512 Ga0495629_0124602 3300046459 Bacteria 1795
513 Ga0495629_0271400 3300046459 Unclassified 1165
514 Ga0495629_0802591 3300046459 Unclassified 621
515 Ga0495638_0022603 3300046460 Bacteria 4127
516 Ga0495653_0161513 3300046463 Bacteria 1555
517 Ga0495580_0654799 3300046472 Unclassified 690
518 Ga0495639_0054466 3300046475 Unclassified 1823
519 Ga0495662_0166335 3300046476 Bacteria 1087
520 Ga0495662_0399627 3300046476 Unclassified 675
521 Ga0495584_0009320 3300046491 Bacteria 5057
522 Ga0495584_0124494 3300046491 Unclassified 1306
523 Ga0495584_0186355 3300046491 Unclassified 1054
524 Ga0495585_0041635 3300046492 Bacteria 2576
525 Ga0495585_0190493 3300046492 Bacteria 1049
526 Ga0495585_0250009 3300046492 Unclassified 885
527 Ga0495594_0102317 3300046499 Bacteria 1611
528 Ga0495594_0528553 3300046499 Unclassified 669
529 Ga0495594_0691601 3300046499 Unclassified 577
530 Ga0495596_0039117 3300046500 Bacteria 1874
531 Ga0495607_0395560 3300046501 Unclassified 629
532 Ga0495583_0390121 3300046506 Unclassified 547
533 Ga0495606_0283027 3300046507 Unclassified 906
534 Ga0495608_0062828 3300046511 Bacteria 2439
535 Ga0495610_0249085 3300046512 Bacteria 705
536 Ga0495616_0026655 3300046513 Bacteria 3073
537 Ga0495616_0028735 3300046513 Bacteria 2941
538 Ga0495618_0025650 3300046514 Bacteria 3659
539 Ga0495620_0248352 3300046515 Unclassified 678
540 Ga0495628_0571158 3300046516 Unclassified 810
541 Ga0495628_0594921 3300046516 Bacteria 790
542 Ga0495628_1016061 3300046516 Unclassified 570
543 Ga0495630_0104869 3300046517 Bacteria 2140
544 Ga0495631_0118505 3300046518 Bacteria 1138
545 Ga0495632_0146783 3300046519 Bacteria 1092
546 Ga0495637_0038718 3300046520 Bacteria 2063
547 Ga0495637_0174619 3300046520 Unclassified 800
548 Ga0495637_0241336 3300046520 Unclassified 652
549 Ga0495644_0043123 3300046523 Bacteria 1698
550 Ga0495648_0506372 3300046524 Unclassified 517
551 Ga0495663_0205145 3300046525 Unclassified 689
552 Ga0495666_0240630 3300046526 Unclassified 826
553 Ga0495642_0400698 3300046528 Unclassified 605
554 Ga0495642_0476056 3300046528 Unclassified 552
555 Ga0495652_0762871 3300046529 Unclassified 646
556 Ga0495652_0790651 3300046529 Bacteria 632
557 Ga0495665_0310028 3300046531 Bacteria 807
558 Ga0495640_0123472 3300046533 Bacteria 1681
559 Ga0495640_0139880 3300046533 Bacteria 1561
560 Ga0495586_0471821 3300046535 Unclassified 724
561 Ga0495598_0010304 3300046537 Bacteria 2236
562 Ga0495598_0017257 3300046537 Unclassified 1858
563 Ga0495609_0095672 3300046538 Bacteria 1289
564 Ga0495609_0243053 3300046538 Unclassified 742
565 Ga0495621_0185335 3300046539 Unclassified 832
566 Ga0495597_0143210 3300046542 Unclassified 985
567 Ga0495645_0281890 3300046543 Bacteria 1092
568 Ga0495633_0058444 3300046558 Bacteria 1810
569 Ga0495633_0075711 3300046558 Bacteria 1567
570 Ga0495633_0211275 3300046558 Unclassified 889
571 Ga0495633_0408322 3300046558 Bacteria 614
572 Ga0495667_0337257 3300046559 Unclassified 953
573 Ga0495667_1028887 3300046559 Unclassified 502
574 Ga0495656_0119896 3300046615 Unclassified 1240
575 Ga0495656_0127217 3300046615 Bacteria 1209
576 Ga0495656_0231333 3300046615 Bacteria 927
577 Ga0495668_0164011 3300046616 Bacteria 1217
578 Ga0495634_0343018 3300046642 Bacteria 896
579 Ga0495611_0116533 3300046648 Unclassified 1245
580 Ga0495611_0252210 3300046648 Unclassified 818
581 Ga0495625_0242043 3300046660 Unclassified 1174
582 Ga0495625_0354669 3300046660 Unclassified 926
583 Ga0495635_0122933 3300046663 Unclassified 1770
584 Ga0495635_0559655 3300046663 Unclassified 749
585 Ga0495659_0076163 3300046664 Unclassified 1265
586 Ga0495659_0412984 3300046664 Unclassified 584
587 Ga0495599_0095535 3300046678 Bacteria 1854
588 Ga0495599_0210619 3300046678 Unclassified 1192
589 Ga0495623_0255186 3300046679 Unclassified 984
590 Ga0495646_0175699 3300046680 Unclassified 1178
591 Ga0495647_0008405 3300046681 Bacteria 3470
592 Ga0495658_0112460 3300046683 Bacteria 1638
593 Ga0495658_0282871 3300046683 Unclassified 1047
594 Ga0495669_0053743 3300046684 Bacteria 1812
595 Ga0495669_0131197 3300046684 Unclassified 1179
596 Ga0495669_0167702 3300046684 Bacteria 1044
597 Ga0495669_0170172 3300046684 Unclassified 1036
598 Ga0495613_0102427 3300046689 Bacteria 2067
599 Ga0495613_0307028 3300046689 Unclassified 1097
600 Ga0495613_0774292 3300046689 Unclassified 627
601 Ga0495624_0114140 3300046690 Bacteria 1660
602 Ga0495624_0804938 3300046690 Unclassified 555
603 Ga0495670_0184118 3300046691 Bacteria 1103
604 Ga0495670_0336396 3300046691 Unclassified 811
605 Ga0495671_0217896 3300046692 Bacteria 924
606 Ga0495649_0140567 3300046694 Unclassified 1271
607 Ga0495649_0179154 3300046694 Unclassified 1106
608 Ga0495589_0057749 3300046794 Bacteria 1908
609 Ga0495660_0098305 3300046810 Unclassified 1510
610 Ga0495581_0111882 3300047315 Unclassified 1588
611 Ga0495581_0241406 3300047315 Bacteria 1056
612 Ga0495604_0350610 3300047317 Unclassified 981
613 Ga0495674_0046376 3300047319 Bacteria 3857
614 Ga0495674_0177442 3300047319 Bacteria 1775
615 Ga0495674_0299228 3300047319 Bacteria 1314
616 Ga0495672_0086989 3300047320 Bacteria 1727
617 Ga0495676_0073309 3300047321 Bacteria 2625
618 Ga0495680_0112053 3300047322 Bacteria 2021
619 Ga0495680_0196768 3300047322 Bacteria 1448
620 Ga0495677_0024394 3300047445 Bacteria 2193
621 Ga0495677_0193927 3300047445 Unclassified 789
622 Ga0495679_073765 3300047446 Bacteria 978
623 Ga0495673_0223815 3300047469 Unclassified 695
624 Ga0495681_0195869 3300047470 Unclassified 822
625 Ga0495684_0329125 3300047471 Unclassified 1090
626 Ga0495686_0516199 3300047472 Unclassified 627
627 Ga0495602_0410245 3300048088 Bacteria 964
628 Ga0495615_0075505 3300048090 Unclassified 916
629 Ga0495626_0030220 3300048091 Bacteria 2614
630 Ga0496100_0058339 3300048903 Bacteria 2532
631 Ga0496100_0087223 3300048903 Unclassified 2121
632 Ga0496100_0115981 3300048903 Bacteria 1868
633 Ga0496100_0160958 3300048903 Bacteria 1609
634 Ga0496100_0310618 3300048903 Bacteria 1182
635 Ga0496101_0006724 3300048904 Bacteria 7417
636 Ga0496101_0090268 3300048904 Bacteria 2278
637 Ga0496101_0228373 3300048904 Bacteria 1446
638 Ga0496101_0258627 3300048904 Bacteria 1357
639 Ga0496101_0285117 3300048904 Bacteria 1291
640 Ga0496101_1428651 3300048904 Unclassified 539
641 Ga0496102_0038319 3300048905 Bacteria 4325
642 Ga0496102_0041461 3300048905 Bacteria 4168
643 Ga0496102_0318810 3300048905 Bacteria 1464
644 Ga0496102_0544406 3300048905 Unclassified 1083
645 Ga0496103_0010647 3300048906 Bacteria 5441
646 Ga0496103_0023086 3300048906 Bacteria 3750
647 Ga0496103_0031270 3300048906 Bacteria 3242
648 Ga0496103_0743595 3300048906 Unclassified 620
649 Ga0496104_0001137 3300048907 Bacteria 22780
650 Ga0496104_0010505 3300048907 Bacteria 8271
651 Ga0496104_0021805 3300048907 Bacteria 5884
652 Ga0496104_0064657 3300048907 Bacteria 3470
653 Ga0496104_0064904 3300048907 Bacteria 3463
654 Ga0496104_0085402 3300048907 Bacteria 3012
655 Ga0496104_0134091 3300048907 Unclassified 2379
656 Ga0496105_0011037 3300048908 Bacteria 7121
657 Ga0496105_0030976 3300048908 Bacteria 4385
658 Ga0496105_0122680 3300048908 Unclassified 2142
659 Ga0496105_0226026 3300048908 Bacteria 1522
660 Ga0496105_0322248 3300048908 Bacteria 1238
661 Ga0496105_0324484 3300048908 Bacteria 1233
662 Ga0496105_0654795 3300048908 Unclassified 810
663 Ga0496106_0001821 3300048909 Bacteria 15941
664 Ga0496106_0033337 3300048909 Bacteria 3842
665 Ga0496106_0173654 3300048909 Bacteria 1709
666 Ga0496106_0388893 3300048909 Unclassified 1121
667 Ga0496106_0400258 3300048909 Unclassified 1103
668 Ga0496107_0000115 3300048910 Bacteria 39165
669 Ga0496107_0016920 3300048910 Bacteria 5126
670 Ga0496107_0350201 3300048910 Bacteria 1099
671 Ga0496107_0620438 3300048910 Unclassified 798
672 Ga0496108_0017532 3300048911 Bacteria 5859
673 Ga0496108_0026124 3300048911 Bacteria 4816
674 Ga0496108_0155991 3300048911 Bacteria 1971
675 Ga0496108_0271517 3300048911 Bacteria 1476
676 Ga0496109_0009939 3300048912 Bacteria 8125
677 Ga0496109_0058956 3300048912 Bacteria 3507
678 Ga0496109_0059010 3300048912 Bacteria 3505
679 Ga0496109_0084186 3300048912 Bacteria 2933
680 Ga0496109_0359979 3300048912 Bacteria 1374
681 Ga0496109_0392953 3300048912 Bacteria 1310
682 Ga0496109_0404603 3300048912 Bacteria 1289
683 Ga0496109_0713515 3300048912 Unclassified 940
684 Ga0496109_1001923 3300048912 Bacteria 773
685 Ga0496110_0014221 3300048913 Bacteria 6603
686 Ga0496110_0023369 3300048913 Bacteria 5256
687 Ga0496110_0041979 3300048913 Bacteria 3992
688 Ga0496110_0043500 3300048913 Bacteria 3921
689 Ga0496110_0088919 3300048913 Bacteria 2760
690 Ga0496110_0131962 3300048913 Bacteria 2256
691 Ga0496110_0207126 3300048913 Bacteria 1782
692 Ga0496111_0005061 3300048914 Bacteria 8389
693 Ga0496111_0024764 3300048914 Bacteria 4232
694 Ga0496111_0029655 3300048914 Bacteria 3886
695 Ga0496111_0237391 3300048914 Bacteria 1354
696 Ga0496111_0502320 3300048914 Bacteria 892
697 Ga0496111_1284080 3300048914 Unclassified 516
698 Ga0496112_0017010 3300048915 Bacteria 6825
699 Ga0496112_0061374 3300048915 Bacteria 3705
700 Ga0496112_0101532 3300048915 Unclassified 2846
701 Ga0496112_0185398 3300048915 Bacteria 2044
702 Ga0496112_0186155 3300048915 Unclassified 2039
703 Ga0496112_0729109 3300048915 Unclassified 918
704 Ga0496112_0895506 3300048915 Bacteria 809
705 Ga0496113_0050802 3300048916 Bacteria 3092
706 Ga0496113_0063573 3300048916 Unclassified 2789
707 Ga0496113_0150341 3300048916 Bacteria 1836
708 Ga0496113_0204987 3300048916 Bacteria 1568
709 Ga0496113_0225737 3300048916 Bacteria 1493
710 Ga0496113_0273744 3300048916 Bacteria 1349
711 Ga0496113_0774390 3300048916 Bacteria 763
712 Ga0496114_0053828 3300048917 Bacteria 3355
713 Ga0496114_0092794 3300048917 Bacteria 2565
714 Ga0496114_0103366 3300048917 Bacteria 2435
715 Ga0496114_0399710 3300048917 Bacteria 1217
716 Ga0496114_0483648 3300048917 Bacteria 1095
717 Ga0496115_0003331 3300048918 Bacteria 11528
718 Ga0496115_0013780 3300048918 Bacteria 6122
719 Ga0496115_0300558 3300048918 Bacteria 1315
720 Ga0496115_0399424 3300048918 Bacteria 1115
721 Ga0496115_0518448 3300048918 Bacteria 956
722 Ga0495678_127153 3300049459 Bacteria 849
723 Ga0495678_130160 3300049459 Unclassified 835
724 Ga0501031_0432134 3300049568 Bacteria 851
725 Ga0501036_0639409 3300049572 Unclassified 881
726 Ga0501036_0823475 3300049572 Unclassified 764
727 Ga0501039_1084087 3300049575 Bacteria 621
728 Ga0501040_0324137 3300049576 Unclassified 1102
729 Ga0501041_0416146 3300049577 Bacteria 852
730 Ga0501041_0489046 3300049577 Bacteria 782
731 Ga0501042_0169170 3300049578 Bacteria 1577
732 Ga0501042_0371225 3300049578 Bacteria 1035
733 Ga0501043_0738719 3300049579 Unclassified 716
734 Ga0501048_0275536 3300049582 Bacteria 1196
735 Ga0501048_0848219 3300049582 Bacteria 657
736 Ga0501067_0351860 3300049583 Bacteria 821
737 Ga0501069_0225263 3300049585 Unclassified 1091
738 Ga0501071_0688983 3300049587 Unclassified 787
739 Ga0501072_0070451 3300049588 Bacteria 2762
740 Ga0501073_0077377 3300049589 Bacteria 2315
741 Ga0501075_0283169 3300049591 Unclassified 1263
742 Ga0501075_0698955 3300049591 Bacteria 772
743 Ga0501076_0238725 3300049592 Bacteria 1487
744 Ga0501077_0053295 3300049593 Bacteria 2568
745 Ga0501077_0174442 3300049593 Bacteria 1366
746 Ga0501079_0120330 3300049741 Bacteria 2042
747 Ga0501079_0209021 3300049741 Bacteria 1524
748 Ga0501079_0511444 3300049741 Unclassified 944
749 Ga0501081_0033583 3300049743 Bacteria 3487
750 Ga0501035_0408914 3300049822 Bacteria 1128
751 Ga0501045_0448393 3300049824 Bacteria 959
752 nmdc:mga03683_24211_c1 3300050489 Unclassified 2373
753 nmdc:mga0yw44_115357_c1 3300050492 Bacteria 1725
754 nmdc:mga0yw44_133375_c1 3300050492 Bacteria 1609
755 nmdc:mga0yw44_301527_c1 3300050492 Bacteria 1074
756 nmdc:mga0yw44_356496_c1 3300050492 Unclassified 985
757 nmdc:mga0yw44_376011_c1 3300050492 Bacteria 959
758 nmdc:mga0yw44_524840_c1 3300050492 Unclassified 804
759 nmdc:mga0yw44_5895_c1 3300050492 Bacteria 5857
760 nmdc:mga06z11_453727_c1 3300050494 Bacteria 775
761 nmdc:mga06z11_75976_c1 3300050494 Unclassified 1790
762 nmdc:mga04h51_125288_c1 3300050495 Bacteria 961
763 nmdc:mga05p37_106598_c1 3300050507 Bacteria 3448
764 nmdc:mga05p37_1217404_c1 3300050507 Unclassified 776
765 nmdc:mga05p37_17679_c1 3300050507 Bacteria 8602
766 nmdc:mga05p37_584980_c1 3300050507 Unclassified 1263
767 nmdc:mga05p37_620956_c1 3300050507 Unclassified 1216
768 nmdc:mga05p37_64591_c1 3300050507 Bacteria 4504
769 nmdc:mga09592_663331_c1 3300050508 Unclassified 890
770 nmdc:mga0qj67_23937_c1 3300050509 Bacteria 4703
771 nmdc:mga0qj67_441074_c1 3300050509 Bacteria 1049
772 nmdc:mga06r32_46443_c1 3300050510 Bacteria 4143
773 nmdc:mga06r32_98941_c1 3300050510 Bacteria 2860
774 nmdc:mga08y16_168639_c1 3300050511 Unclassified 2274
775 nmdc:mga08y16_292933_c1 3300050511 Bacteria 1678
776 nmdc:mga08y16_317064_c1 3300050511 Bacteria 1605
777 nmdc:mga08y16_563957_c1 3300050511 Bacteria 1151
778 nmdc:mga0n895_1242313_c1 3300050512 Bacteria 718
779 nmdc:mga0n895_56993_c1 3300050512 Bacteria 3851
780 nmdc:mga0n895_67029_c1 3300050512 Bacteria 3554
781 nmdc:mga0n895_94215_c1 3300050512 Bacteria 2998
782 nmdc:mga0n895_969895_c1 3300050512 Bacteria 833
783 nmdc:mga0rr50_325257_c1 3300050513 Bacteria 1290
784 nmdc:mga0rr50_440050_c1 3300050513 Unclassified 1104
785 nmdc:mga0rr50_722946_c1 3300050513 Unclassified 850
786 nmdc:mga08x19_202969_c1 3300050514 Bacteria 1359
787 nmdc:mga0a205_104910_c1 3300050515 Bacteria 2725
788 nmdc:mga0a205_134642_c1 3300050515 Bacteria 2371
789 nmdc:mga0a205_303399_c1 3300050515 Bacteria 1469
790 nmdc:mga0a205_528632_c1 3300050515 Bacteria 1035
791 Ga0495601_0000792 3300053077 Bacteria 17080
792 Ga0495601_0099724 3300053077 Bacteria 1875
793 Ga0495601_0108130 3300053077 Bacteria 1799
794 Ga0495601_0299295 3300053077 Bacteria 1048
795 Ga0495601_0540158 3300053077 Unclassified 750
796 Ga0495612_0061036 3300053078 Bacteria 1561
797 Ga0495612_0182658 3300053078 Unclassified 922
798 Ga0495612_0349423 3300053078 Bacteria 668
799 Ga0495655_0048684 3300053083 Unclassified 1113
800 Ga0495655_0315166 3300053083 Unclassified 540
801 Ga0495595_0018932 3300053084 Bacteria 2981
802 Ga0495595_0438150 3300053084 Unclassified 664
803 Ga0495595_0496293 3300053084 Bacteria 622
804 Ga0495619_0000405 3300053085 Bacteria 29348
805 Ga0495619_0041649 3300053085 Bacteria 3005
806 Ga0495619_0057003 3300053085 Bacteria 2592
807 Ga0495619_0064128 3300053085 Bacteria 2449
808 Ga0495619_0312045 3300053085 Unclassified 1089
809 Ga0501084_0203053 3300054114 Bacteria 1673
810 Ga0501084_0327155 3300054114 Bacteria 1294
811 Ga0587084_063887 3300059477 Bacteria 681
812 Ga0587084_135135 3300059477 Unclassified 530
813 Ga0587093_042231 3300059478 Bacteria 695
814 Ga0587066_045161 3300059490 Unclassified 846
815 Ga0587066_071908 3300059490 Unclassified 730
816 Ga0587066_118201 3300059490 Unclassified 623
817 Ga0587070_114170 3300059491 Unclassified 638
818 Ga0587073_0027664 3300059492 Unclassified 1146
819 Ga0587073_0094524 3300059492 Unclassified 766
820 Ga0587073_0095036 3300059492 Unclassified 764
821 Ga0587073_0096981 3300059492 Unclassified 760
822 Ga0587073_0119307 3300059492 Unclassified 710
823 Ga0587073_0122555 3300059492 Unclassified 704
824 Ga0587073_0131048 3300059492 Bacteria 688
825 Ga0587073_0146277 3300059492 Unclassified 664
826 Ga0587077_099027 3300059493 Bacteria 697
827 Ga0587077_118724 3300059493 Unclassified 657
828 Ga0587080_059595 3300059503 Unclassified 740
829 Ga0587080_070345 3300059503 Unclassified 699
830 Ga0587080_071007 3300059503 Unclassified 697
831 Ga0587080_086026 3300059503 Bacteria 653
832 Ga0587080_104183 3300059503 Bacteria 611
833 Ga0587082_045783 3300059504 Unclassified 818
834 Ga0587082_055749 3300059504 Unclassified 766
835 Ga0587082_066915 3300059504 Bacteria 722
836 Ga0587082_073293 3300059504 Unclassified 700
837 Ga0587082_085732 3300059504 Bacteria 664
838 Ga0587082_119109 3300059504 Unclassified 595
839 Ga0587083_0040197 3300059505 Bacteria 976
840 Ga0587083_0082067 3300059505 Unclassified 770
841 Ga0587083_0100120 3300059505 Unclassified 721
842 Ga0587083_0112535 3300059505 Unclassified 693
843 Ga0587083_0147156 3300059505 Bacteria 633
844 Ga0587083_0212882 3300059505 Unclassified 558
845 Ga0587085_065341 3300059506 Unclassified 698
846 Ga0587085_065646 3300059506 Bacteria 697
847 Ga0587085_072447 3300059506 Bacteria 677
848 Ga0587085_078592 3300059506 Unclassified 660
849 Ga0587086_074093 3300059507 Unclassified 590
850 Ga0587088_069343 3300059508 Unclassified 732
851 Ga0587088_084380 3300059508 Bacteria 685
852 Ga0587088_096521 3300059508 Unclassified 655
853 Ga0587089_053869 3300059509 Unclassified 651
854 Ga0587090_067994 3300059510 Bacteria 690
855 Ga0587090_069028 3300059510 Unclassified 687
856 Ga0587091_066134 3300059511 Unclassified 780
857 Ga0587091_074002 3300059511 Unclassified 751
858 Ga0587091_095834 3300059511 Bacteria 688
859 Ga0587091_112798 3300059511 Unclassified 651
860 Ga0587091_152892 3300059511 Unclassified 587
861 Ga0587092_055579 3300059512 Unclassified 728
862 Ga0587092_079488 3300059512 Unclassified 645
863 Ga0587094_042332 3300059513 Unclassified 746
864 Ga0587094_047003 3300059513 Unclassified 720
865 Ga0587094_051832 3300059513 Unclassified 697
866 Ga0587094_054221 3300059513 Bacteria 687
867 Ga0587095_019193 3300059514 Unclassified 646
868 Ga0587098_032470 3300059604 Unclassified 725
869 Ga0587098_045310 3300059604 Unclassified 652
870 Ga0587098_056538 3300059604 Bacteria 607
871 Ga0587106_060486 3300059605 Unclassified 694
872 Ga0587106_065357 3300059605 Bacteria 678
873 Ga0587125_023244 3300059607 Unclassified 747
874 Ga0587129_009713 3300059608 Unclassified 733
875 Ga0587131_013113 3300059609 Unclassified 619
876 Ga0587131_021110 3300059609 Unclassified 537
877 Ga0587101_061101 3300059623 Bacteria 673
878 Ga0587101_062525 3300059623 Unclassified 668
879 Ga0587109_044525 3300059624 Unclassified 891
880 Ga0587113_019286 3300059625 Unclassified 706
881 Ga0587115_032494 3300059626 Unclassified 782
882 Ga0587115_047051 3300059626 Unclassified 690
883 Ga0587122_016673 3300059628 Unclassified 762
884 Ga0587128_048247 3300059630 Unclassified 769
885 Ga0587128_062330 3300059630 Unclassified 707
886 Ga0587130_025283 3300059631 Unclassified 663
887 Ga0587062_056057 3300059639 Bacteria 680
888 Ga0587067_079066 3300059640 Unclassified 725
889 Ga0587067_095184 3300059640 Bacteria 681
890 Ga0587067_098131 3300059640 Unclassified 674
891 Ga0587068_062747 3300059641 Unclassified 718
892 Ga0587068_066955 3300059641 Unclassified 702
893 Ga0587068_105271 3300059641 Unclassified 597
894 Ga0587068_125275 3300059641 Bacteria 561
895 Ga0587072_091479 3300059643 Bacteria 671
896 Ga0587072_104243 3300059643 Unclassified 640
897 Ga0587075_018284 3300059644 Unclassified 1015
898 Ga0587075_029339 3300059644 Unclassified 867
899 Ga0587075_037316 3300059644 Unclassified 800
900 Ga0587075_038294 3300059644 Bacteria 793
901 Ga0587075_056287 3300059644 Unclassified 699
902 Ga0587076_030884 3300059645 Unclassified 949
903 Ga0587076_081366 3300059645 Bacteria 692
904 Ga0587076_130628 3300059645 Bacteria 591
905 Ga0587078_013177 3300059646 Bacteria 976
906 Ga0587078_031678 3300059646 Unclassified 715
907 Ga0587078_043727 3300059646 Unclassified 640
908 Ga0587078_069992 3300059646 Unclassified 546
909 Ga0587105_005867 3300059651 Unclassified 828
910 Ga0587105_011839 3300059651 Bacteria 678
911 Ga0587107_037964 3300059652 Unclassified 765
912 Ga0587107_043268 3300059652 Unclassified 736
913 Ga0587107_072131 3300059652 Unclassified 633
914 Ga0587107_133803 3300059652 Unclassified 523
915 Ga0587114_044982 3300059655 Unclassified 729
916 Ga0587114_052759 3300059655 Unclassified 693
917 Ga0587119_035082 3300059658 Unclassified 701
918 Ga0587119_040047 3300059658 Unclassified 669
919 Ga0587071_091300 3300060344 Unclassified 692
920 Ga0587071_098713 3300060344 Unclassified 673
921 Ga0587111_0110010 3300060346 Unclassified 697
922 Ga0501082_0657522 3300060353 Unclassified 917
923 Ga0530510_0154161 3300061734 Bacteria 1697
924 Ga0530510_0173502 3300061734 Bacteria 1597
925 Ga0530510_0366515 3300061734 Bacteria 1083

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048912 Ga0496109_0404603 Ga0496109_0404603_335_748 118
2 3300005467 Ga0070706_101976066 Ga0070706_1019760661 121
3 3300005471 Ga0070698_100462008 Ga0070698_1004620082 121
4 3300009148 Ga0105243_10772170 Ga0105243_107721701 121
5 3300025910 Ga0207684_10107883 Ga0207684_101078836 121
6 3300025928 Ga0207700_10816416 Ga0207700_108164162 121
7 3300025939 Ga0207665_10938475 Ga0207665_109384751 122
8 3300005543 Ga0070672_100606769 Ga0070672_1006067693 123
9 3300005578 Ga0068854_100495779 Ga0068854_1004957792 123
10 3300005840 Ga0068870_10326393 Ga0068870_103263933 123
11 3300026095 Ga0207676_10950511 Ga0207676_109505111 123
12 3300004798 Ga0058859_11832506 Ga0058859_118325061 125
13 3300005328 Ga0070676_10134024 Ga0070676_101340241 125
14 3300005337 Ga0070682_100546721 Ga0070682_1005467212 125
15 3300005345 Ga0070692_10719776 Ga0070692_107197761 125
16 3300005353 Ga0070669_100139195 Ga0070669_1001391955 125
17 3300005354 Ga0070675_100235398 Ga0070675_1002353982 125
18 3300005356 Ga0070674_100591146 Ga0070674_1005911462 125
19 3300005364 Ga0070673_100718001 Ga0070673_1007180011 125
20 3300005365 Ga0070688_100906394 Ga0070688_1009063941 125
21 3300005438 Ga0070701_10506565 Ga0070701_105065651 125
22 3300005441 Ga0070700_100140161 Ga0070700_1001401612 125
23 3300005455 Ga0070663_100074305 Ga0070663_1000743051 125
24 3300005459 Ga0068867_100505359 Ga0068867_1005053591 125
25 3300005466 Ga0070685_10564061 Ga0070685_105640611 125
26 3300005547 Ga0070693_100455422 Ga0070693_1004554222 125
27 3300005719 Ga0068861_100415278 Ga0068861_1004152781 125
28 3300005843 Ga0068860_100415553 Ga0068860_1004155533 125
29 3300009176 Ga0105242_12778776 Ga0105242_127787761 125
30 3300013296 Ga0157374_10402074 Ga0157374_104020741 125
31 3300013297 Ga0157378_10590715 Ga0157378_105907151 125
32 3300013308 Ga0157375_10184232 Ga0157375_101842321 125
33 3300014326 Ga0157380_10068098 Ga0157380_100680984 125
34 3300014745 Ga0157377_10084988 Ga0157377_100849884 125
35 3300014969 Ga0157376_10641105 Ga0157376_106411051 125
36 3300017792 Ga0163161_10261456 Ga0163161_102614562 125
37 3300025901 Ga0207688_10043206 Ga0207688_100432061 125
38 3300025904 Ga0207647_10080204 Ga0207647_100802042 125
39 3300025907 Ga0207645_10335667 Ga0207645_103356672 125
40 3300025927 Ga0207687_10695188 Ga0207687_106951881 125
41 3300025933 Ga0207706_10255294 Ga0207706_102552941 125
42 3300025936 Ga0207670_11421203 Ga0207670_114212031 125
43 3300025938 Ga0207704_10521424 Ga0207704_105214241 125
44 3300025940 Ga0207691_10079100 Ga0207691_100791004 125
45 3300025972 Ga0207668_10112818 Ga0207668_101128183 125
46 3300026067 Ga0207678_10139592 Ga0207678_101395921 125
47 3300026075 Ga0207708_10263372 Ga0207708_102633721 125
48 3300026089 Ga0207648_10037591 Ga0207648_100375913 125
49 3300026116 Ga0207674_10591420 Ga0207674_105914202 125
50 3300026118 Ga0207675_100046797 Ga0207675_1000467974 125
51 3300026121 Ga0207683_10169191 Ga0207683_101691913 125
52 3300026142 Ga0207698_10819419 Ga0207698_108194191 125
53 3300028379 Ga0268266_10603264 Ga0268266_106032641 125
54 3300028380 Ga0268265_10542824 Ga0268265_105428241 125
55 3300034819 Ga0373958_0106043 Ga0373958_0106043_40_474 125
56 3300035083 Ga0373926_0105224 Ga0373926_0105224_332_766 125
57 3300035089 Ga0373944_0028444 Ga0373944_0028444_203_637 125
58 3300035114 Ga0373939_0056791 Ga0373939_0056791_81_515 125
59 3300035121 Ga0373960_0128896 Ga0373960_0128896_314_748 125
60 3300035171 Ga0373946_0031188 Ga0373946_0031188_1133_1567 125
61 3300035172 Ga0373955_0073988 Ga0373955_0073988_418_852 125
62 3300035692 Ga0373935_0082821 Ga0373935_0082821_1251_1685 125
63 3300037068 Ga0373925_1500860 Ga0373925_1500860_79_513 125
64 3300041458 Ga0451798_0894894 Ga0451798_0894894_15_449 125
65 3300046452 Ga0495617_038478 Ga0495617_038478_1090_1524 125
66 3300046453 Ga0495627_125542 Ga0495627_125542_116_550 125
67 3300046455 Ga0495603_0066454 Ga0495603_0066454_565_999 125
68 3300046459 Ga0495629_0271400 Ga0495629_0271400_638_1072 125
69 3300046472 Ga0495580_0654799 Ga0495580_0654799_173_607 125
70 3300046491 Ga0495584_0186355 Ga0495584_0186355_194_628 125
71 3300046492 Ga0495585_0190493 Ga0495585_0190493_166_600 125
72 3300046499 Ga0495594_0102317 Ga0495594_0102317_214_648 125
73 3300046500 Ga0495596_0039117 Ga0495596_0039117_1309_1743 125
74 3300046501 Ga0495607_0395560 Ga0495607_0395560_145_579 125
75 3300046506 Ga0495583_0390121 Ga0495583_0390121_41_475 125
76 3300046513 Ga0495616_0026655 Ga0495616_0026655_1625_2059 125
77 3300046515 Ga0495620_0248352 Ga0495620_0248352_74_508 125
78 3300046518 Ga0495631_0118505 Ga0495631_0118505_73_507 125
79 3300046519 Ga0495632_0146783 Ga0495632_0146783_362_796 125
80 3300046520 Ga0495637_0241336 Ga0495637_0241336_103_537 125
81 3300046523 Ga0495644_0043123 Ga0495644_0043123_1098_1532 125
82 3300046528 Ga0495642_0476056 Ga0495642_0476056_106_540 125
83 3300046535 Ga0495586_0471821 Ga0495586_0471821_167_601 125
84 3300046537 Ga0495598_0010304 Ga0495598_0010304_1437_1871 125
85 3300046538 Ga0495609_0243053 Ga0495609_0243053_22_456 125
86 3300046558 Ga0495633_0058444 Ga0495633_0058444_405_839 125
87 3300046615 Ga0495656_0231333 Ga0495656_0231333_378_812 125
88 3300046616 Ga0495668_0164011 Ga0495668_0164011_247_681 125
89 3300046648 Ga0495611_0116533 Ga0495611_0116533_273_707 125
90 3300046660 Ga0495625_0242043 Ga0495625_0242043_285_719 125
91 3300046684 Ga0495669_0131197 Ga0495669_0131197_318_752 125
92 3300046689 Ga0495613_0774292 Ga0495613_0774292_132_566 125
93 3300046690 Ga0495624_0114140 Ga0495624_0114140_1150_1584 125
94 3300046691 Ga0495670_0184118 Ga0495670_0184118_234_668 125
95 3300046794 Ga0495589_0057749 Ga0495589_0057749_1097_1531 125
96 3300046810 Ga0495660_0098305 Ga0495660_0098305_590_1024 125
97 3300047315 Ga0495581_0241406 Ga0495581_0241406_233_667 125
98 3300047445 Ga0495677_0024394 Ga0495677_0024394_1475_1909 125
99 3300047446 Ga0495679_073765 Ga0495679_073765_57_491 125
100 3300047469 Ga0495673_0223815 Ga0495673_0223815_206_640 125
101 3300047472 Ga0495686_0516199 Ga0495686_0516199_16_450 125
102 3300048091 Ga0495626_0030220 Ga0495626_0030220_943_1377 125
103 3300048906 Ga0496103_0743595 Ga0496103_0743595_112_546 125
104 3300048908 Ga0496105_0226026 Ga0496105_0226026_793_1188 125
105 3300048910 Ga0496107_0350201 Ga0496107_0350201_511_945 125
106 3300048915 Ga0496112_0895506 Ga0496112_0895506_300_734 125
107 3300048916 Ga0496113_0774390 Ga0496113_0774390_37_471 125
108 3300048917 Ga0496114_0483648 Ga0496114_0483648_524_958 125
109 3300049459 Ga0495678_127153 Ga0495678_127153_179_613 125
110 3300053078 Ga0495612_0349423 Ga0495612_0349423_121_555 125
111 3300053083 Ga0495655_0048684 Ga0495655_0048684_245_679 125
112 3300053085 Ga0495619_0041649 Ga0495619_0041649_278_712 125
113 3300005331 Ga0070670_100018116 Ga0070670_1000181161 126
114 3300005334 Ga0068869_101838936 Ga0068869_1018389361 126
115 3300005355 Ga0070671_101337993 Ga0070671_1013379931 126
116 3300005367 Ga0070667_101023746 Ga0070667_1010237461 126
117 3300005535 Ga0070684_100387179 Ga0070684_1003871791 126
118 3300005981 Ga0081538_10017526 Ga0081538_100175264 126
119 3300006028 Ga0070717_10303427 Ga0070717_103034273 126
120 3300006038 Ga0075365_10228597 Ga0075365_102285973 126
121 3300006847 Ga0075431_100408046 Ga0075431_1004080462 126
122 3300006852 Ga0075433_10644391 Ga0075433_106443911 126
123 3300006871 Ga0075434_100105190 Ga0075434_1001051904 126
124 3300009094 Ga0111539_10085197 Ga0111539_100851972 126
125 3300009098 Ga0105245_11334946 Ga0105245_113349461 126
126 3300009101 Ga0105247_10230807 Ga0105247_102308072 126
127 3300009147 Ga0114129_10051640 Ga0114129_100516403 126
128 3300009553 Ga0105249_10378338 Ga0105249_103783382 126
129 3300010375 Ga0105239_10405762 Ga0105239_104057621 126
130 3300020069 Ga0197907_10378417 Ga0197907_103784172 126
131 3300020070 Ga0206356_10234046 Ga0206356_102340461 126
132 3300020075 Ga0206349_1200178 Ga0206349_12001781 126
133 3300020078 Ga0206352_10013594 Ga0206352_100135941 126
134 3300020080 Ga0206350_10444938 Ga0206350_104449381 126
135 3300020081 Ga0206354_10615845 Ga0206354_106158451 126
136 3300022467 Ga0224712_10179313 Ga0224712_101793131 126
137 3300025900 Ga0207710_10054606 Ga0207710_100546062 126
138 3300025925 Ga0207650_10272415 Ga0207650_102724151 126
139 3300025927 Ga0207687_10640293 Ga0207687_106402932 126
140 3300025931 Ga0207644_11390860 Ga0207644_113908601 126
141 3300025942 Ga0207689_10581826 Ga0207689_105818261 126
142 3300025961 Ga0207712_11368901 Ga0207712_113689011 126
143 3300025981 Ga0207640_10417989 Ga0207640_104179891 126
144 3300025986 Ga0207658_10733060 Ga0207658_107330602 126
145 3300026095 Ga0207676_10625800 Ga0207676_106258001 126
146 3300027907 Ga0207428_10450726 Ga0207428_104507261 126
147 3300035691 Ga0373931_0199159 Ga0373931_0199159_328_762 126
148 3300035725 Ga0373947_0139526 Ga0373947_0139526_1058_1492 126
149 3300046476 Ga0495662_0166335 Ga0495662_0166335_61_495 126
150 3300046512 Ga0495610_0249085 Ga0495610_0249085_111_545 126
151 3300046531 Ga0495665_0310028 Ga0495665_0310028_153_587 126
152 3300047319 Ga0495674_0177442 Ga0495674_0177442_238_672 126
153 3300048903 Ga0496100_0115981 Ga0496100_0115981_885_1319 126
154 3300048904 Ga0496101_0285117 Ga0496101_0285117_464_898 126
155 3300048905 Ga0496102_0318810 Ga0496102_0318810_450_884 126
156 3300048906 Ga0496103_0031270 Ga0496103_0031270_2177_2611 126
157 3300048907 Ga0496104_0021805 Ga0496104_0021805_3567_4001 126
158 3300048908 Ga0496105_0030976 Ga0496105_0030976_1056_1490 126
159 3300048911 Ga0496108_0017532 Ga0496108_0017532_1063_1497 126
160 3300048912 Ga0496109_0009939 Ga0496109_0009939_7092_7526 126
161 3300048913 Ga0496110_0043500 Ga0496110_0043500_670_1104 126
162 3300048914 Ga0496111_0005061 Ga0496111_0005061_448_882 126
163 3300048915 Ga0496112_0017010 Ga0496112_0017010_5258_5692 126
164 3300048916 Ga0496113_0050802 Ga0496113_0050802_423_857 126
165 3300048917 Ga0496114_0103366 Ga0496114_0103366_1618_2052 126
166 3300048918 Ga0496115_0013780 Ga0496115_0013780_4076_4510 126
167 3300050492 nmdc:mga0yw44_133375_c1 nmdc:mga0yw44_133375_c1_533_967 126
168 3300050507 nmdc:mga05p37_17679_c1 nmdc:mga05p37_17679_c1_5644_6078 126
169 3300050510 nmdc:mga06r32_46443_c1 nmdc:mga06r32_46443_c1_441_875 126
170 3300050511 nmdc:mga08y16_292933_c1 nmdc:mga08y16_292933_c1_1054_1488 126
171 3300050512 nmdc:mga0n895_67029_c1 nmdc:mga0n895_67029_c1_1931_2365 126
172 3300050515 nmdc:mga0a205_303399_c1 nmdc:mga0a205_303399_c1_596_1030 126
173 3300006038 Ga0075365_10045129 Ga0075365_100451291 127
174 3300006178 Ga0075367_10217031 Ga0075367_102170311 127
175 3300025905 Ga0207685_10640220 Ga0207685_106402201 127
176 3300035083 Ga0373926_0043233 Ga0373926_0043233_728_1162 127
177 3300035089 Ga0373944_0067261 Ga0373944_0067261_10_444 127
178 3300035111 Ga0373923_0198581 Ga0373923_0198581_151_585 127
179 3300035113 Ga0373936_0038713 Ga0373936_0038713_221_655 127
180 3300035116 Ga0373945_0174761 Ga0373945_0174761_426_860 127
181 3300035170 Ga0373943_0011464 Ga0373943_0011464_1894_2328 127
182 3300035171 Ga0373946_0064428 Ga0373946_0064428_839_1273 127
183 3300035695 Ga0373927_0084446 Ga0373927_0084446_1062_1496 127
184 3300035725 Ga0373947_0060402 Ga0373947_0060402_240_674 127
185 3300037068 Ga0373925_0032932 Ga0373925_0032932_92_526 127
186 3300046453 Ga0495627_059643 Ga0495627_059643_393_827 127
187 3300046455 Ga0495603_0167209 Ga0495603_0167209_819_1253 127
188 3300046459 Ga0495629_0043791 Ga0495629_0043791_1462_1896 127
189 3300046459 Ga0495629_0802591 Ga0495629_0802591_81_515 127
190 3300046475 Ga0495639_0054466 Ga0495639_0054466_803_1237 127
191 3300046491 Ga0495584_0124494 Ga0495584_0124494_311_745 127
192 3300046492 Ga0495585_0041635 Ga0495585_0041635_933_1367 127
193 3300046499 Ga0495594_0528553 Ga0495594_0528553_134_568 127
194 3300046517 Ga0495630_0104869 Ga0495630_0104869_885_1319 127
195 3300046525 Ga0495663_0205145 Ga0495663_0205145_85_519 127
196 3300046533 Ga0495640_0123472 Ga0495640_0123472_158_592 127
197 3300046537 Ga0495598_0017257 Ga0495598_0017257_821_1255 127
198 3300046538 Ga0495609_0095672 Ga0495609_0095672_85_519 127
199 3300046539 Ga0495621_0185335 Ga0495621_0185335_223_657 127
200 3300046558 Ga0495633_0211275 Ga0495633_0211275_168_602 127
201 3300046559 Ga0495667_1028887 Ga0495667_1028887_50_484 127
202 3300046615 Ga0495656_0119896 Ga0495656_0119896_497_931 127
203 3300046660 Ga0495625_0354669 Ga0495625_0354669_233_667 127
204 3300046663 Ga0495635_0559655 Ga0495635_0559655_157_591 127
205 3300046664 Ga0495659_0076163 Ga0495659_0076163_327_761 127
206 3300046681 Ga0495647_0008405 Ga0495647_0008405_1066_1500 127
207 3300046683 Ga0495658_0112460 Ga0495658_0112460_151_585 127
208 3300046689 Ga0495613_0102427 Ga0495613_0102427_1604_2038 127
209 3300046691 Ga0495670_0336396 Ga0495670_0336396_272_706 127
210 3300047315 Ga0495581_0111882 Ga0495581_0111882_851_1285 127
211 3300047321 Ga0495676_0073309 Ga0495676_0073309_1631_2065 127
212 3300047445 Ga0495677_0193927 Ga0495677_0193927_224_658 127
213 3300047470 Ga0495681_0195869 Ga0495681_0195869_267_701 127
214 3300047471 Ga0495684_0329125 Ga0495684_0329125_336_770 127
215 3300050492 nmdc:mga0yw44_524840_c1 nmdc:mga0yw44_524840_c1_332_766 127
216 3300050494 nmdc:mga06z11_75976_c1 nmdc:mga06z11_75976_c1_787_1221 127
217 3300053083 Ga0495655_0315166 Ga0495655_0315166_90_524 127
218 3300053085 Ga0495619_0057003 Ga0495619_0057003_227_661 127
219 3300059504 Ga0587082_045783 Ga0587082_045783_188_622 127
220 3300059644 Ga0587075_038294 Ga0587075_038294_182_616 127
221 3300059645 Ga0587076_030884 Ga0587076_030884_127_561 127
222 3300020082 Ga0206353_11470667 Ga0206353_114706671 128
223 3300039447 Ga0436361_0664153 Ga0436361_0664153_912_1328 128
224 3300060344 Ga0587071_091300 Ga0587071_091300_183_611 129
225 3300059493 Ga0587077_118724 Ga0587077_118724_49_477 131
226 3300005983 Ga0081540_1007072 Ga0081540_10070729 132
227 3300006852 Ga0075433_10602357 Ga0075433_106023572 132
228 3300007076 Ga0075435_100854686 Ga0075435_1008546862 132
229 3300009147 Ga0114129_10131074 Ga0114129_101310744 132
230 3300048907 Ga0496104_0010505 Ga0496104_0010505_1557_2018 132
231 3300048908 Ga0496105_0011037 Ga0496105_0011037_6451_6912 132
232 3300048909 Ga0496106_0400258 Ga0496106_0400258_596_1057 132
233 3300048916 Ga0496113_0204987 Ga0496113_0204987_556_1017 132
234 3300050507 nmdc:mga05p37_64591_c1 nmdc:mga05p37_64591_c1_956_1354 132
235 3300050512 nmdc:mga0n895_969895_c1 nmdc:mga0n895_969895_c1_377_775 132
236 3300046516 Ga0495628_1016061 Ga0495628_1016061_37_453 133
237 3300053077 Ga0495601_0108130 Ga0495601_0108130_357_773 133
238 3300053085 Ga0495619_0312045 Ga0495619_0312045_542_958 133
239 3300009147 Ga0114129_10343536 Ga0114129_103435362 134
240 3300035695 Ga0373927_0137977 Ga0373927_0137977_477_881 134
241 3300037068 Ga0373925_0339501 Ga0373925_0339501_329_733 134
242 3300046459 Ga0495629_0035675 Ga0495629_0035675_1380_1784 134
243 3300046514 Ga0495618_0025650 Ga0495618_0025650_3217_3621 134
244 3300046543 Ga0495645_0281890 Ga0495645_0281890_628_1032 134
245 3300046558 Ga0495633_0075711 Ga0495633_0075711_59_463 134
246 3300046663 Ga0495635_0122933 Ga0495635_0122933_686_1090 134
247 3300046678 Ga0495599_0095535 Ga0495599_0095535_988_1392 134
248 3300046684 Ga0495669_0167702 Ga0495669_0167702_79_483 134
249 3300047319 Ga0495674_0046376 Ga0495674_0046376_2273_2677 134
250 3300047322 Ga0495680_0112053 Ga0495680_0112053_323_727 134
251 3300049575 Ga0501039_1084087 Ga0501039_1084087_73_501 134
252 3300049577 Ga0501041_0416146 Ga0501041_0416146_38_466 134
253 3300049578 Ga0501042_0371225 Ga0501042_0371225_305_733 134
254 3300049589 Ga0501073_0077377 Ga0501073_0077377_443_871 134
255 3300049591 Ga0501075_0283169 Ga0501075_0283169_386_814 134
256 3300049592 Ga0501076_0238725 Ga0501076_0238725_588_1016 134
257 3300049593 Ga0501077_0174442 Ga0501077_0174442_261_689 134
258 3300049741 Ga0501079_0120330 Ga0501079_0120330_894_1322 134
259 3300050507 nmdc:mga05p37_620956_c1 nmdc:mga05p37_620956_c1_541_951 134
260 3300053077 Ga0495601_0000792 Ga0495601_0000792_14048_14452 134
261 3300053085 Ga0495619_0000405 Ga0495619_0000405_3890_4294 134
262 3300054114 Ga0501084_0327155 Ga0501084_0327155_797_1225 134
263 3300061734 Ga0530510_0366515 Ga0530510_0366515_276_704 134
264 3300005468 Ga0070707_100109187 Ga0070707_1001091871 135
265 3300007265 Ga0099794_10471596 Ga0099794_104715961 135
266 3300019161 Ga0184602_102655 Ga0184602_1026551 135
267 3300025910 Ga0207684_10267010 Ga0207684_102670102 135
268 3300035116 Ga0373945_0421712 Ga0373945_0421712_22_438 135
269 3300035691 Ga0373931_0213772 Ga0373931_0213772_597_1013 135
270 3300035725 Ga0373947_0163619 Ga0373947_0163619_656_1072 135
271 3300037068 Ga0373925_0262751 Ga0373925_0262751_840_1256 135
272 3300037068 Ga0373925_1456352 Ga0373925_1456352_101_535 135
273 3300038443 Ga0395901_0076997 Ga0395901_0076997_1377_1790 135
274 3300005436 Ga0070713_101547507 Ga0070713_1015475071 136
275 3300059609 Ga0587131_021110 Ga0587131_021110_24_476 136
276 3300005331 Ga0070670_100018448 Ga0070670_1000184482 137
277 3300005335 Ga0070666_10057607 Ga0070666_100576076 137
278 3300005336 Ga0070680_100812430 Ga0070680_1008124301 137
279 3300005341 Ga0070691_10597363 Ga0070691_105973632 137
280 3300005353 Ga0070669_100149900 Ga0070669_1001499002 137
281 3300005354 Ga0070675_100049189 Ga0070675_1000491894 137
282 3300005355 Ga0070671_100009476 Ga0070671_1000094769 137
283 3300005356 Ga0070674_101533903 Ga0070674_1015339031 137
284 3300005365 Ga0070688_100018344 Ga0070688_1000183445 137
285 3300005434 Ga0070709_10944450 Ga0070709_109444501 137
286 3300005435 Ga0070714_100020696 Ga0070714_1000206965 137
287 3300005436 Ga0070713_100962474 Ga0070713_1009624742 137
288 3300005437 Ga0070710_10428008 Ga0070710_104280081 137
289 3300005439 Ga0070711_100775950 Ga0070711_1007759502 137
290 3300005441 Ga0070700_100420429 Ga0070700_1004204291 137
291 3300005457 Ga0070662_100067984 Ga0070662_1000679845 137
292 3300005530 Ga0070679_100615437 Ga0070679_1006154372 137
293 3300005614 Ga0068856_100646029 Ga0068856_1006460293 137
294 3300005841 Ga0068863_100308785 Ga0068863_1003087852 137
295 3300005843 Ga0068860_100947404 Ga0068860_1009474042 137
296 3300005937 Ga0081455_10541644 Ga0081455_105416441 137
297 3300005983 Ga0081540_1001551 Ga0081540_10015513 137
298 3300006038 Ga0075365_10306378 Ga0075365_103063781 137
299 3300006880 Ga0075429_100344047 Ga0075429_1003440471 137
300 3300009148 Ga0105243_10194213 Ga0105243_101942131 137
301 3300009174 Ga0105241_11522126 Ga0105241_115221261 137
302 3300009177 Ga0105248_10534073 Ga0105248_105340732 137
303 3300013059 Ga0154012_140635 Ga0154012_1406351 137
304 3300013296 Ga0157374_10643125 Ga0157374_106431252 137
305 3300013297 Ga0157378_10942317 Ga0157378_109423173 137
306 3300013307 Ga0157372_11606258 Ga0157372_116062581 137
307 3300014325 Ga0163163_10040709 Ga0163163_100407094 137
308 3300020069 Ga0197907_10436085 Ga0197907_104360852 137
309 3300020078 Ga0206352_10517138 Ga0206352_105171381 137
310 3300020080 Ga0206350_11521557 Ga0206350_115215573 137
311 3300025903 Ga0207680_10117441 Ga0207680_101174412 137
312 3300025906 Ga0207699_10742264 Ga0207699_107422641 137
313 3300025921 Ga0207652_11317848 Ga0207652_113178481 137
314 3300025923 Ga0207681_10111477 Ga0207681_101114773 137
315 3300025925 Ga0207650_10011646 Ga0207650_100116469 137
316 3300025926 Ga0207659_10050312 Ga0207659_100503124 137
317 3300025928 Ga0207700_10057402 Ga0207700_100574022 137
318 3300025929 Ga0207664_10042402 Ga0207664_100424026 137
319 3300025931 Ga0207644_10037382 Ga0207644_100373821 137
320 3300025933 Ga0207706_10053851 Ga0207706_100538514 137
321 3300025936 Ga0207670_11713481 Ga0207670_117134811 137
322 3300025939 Ga0207665_10340854 Ga0207665_103408542 137
323 3300026075 Ga0207708_11474352 Ga0207708_114743521 137
324 3300026078 Ga0207702_10995276 Ga0207702_109952762 137
325 3300026088 Ga0207641_10277864 Ga0207641_102778642 137
326 3300030863 Ga0265766_1024928 Ga0265766_10249281 137
327 3300048903 Ga0496100_0310618 Ga0496100_0310618_77_499 137
328 3300048904 Ga0496101_0258627 Ga0496101_0258627_782_1204 137
329 3300048912 Ga0496109_0058956 Ga0496109_0058956_859_1281 137
330 3300048913 Ga0496110_0088919 Ga0496110_0088919_2173_2595 137
331 3300048914 Ga0496111_0237391 Ga0496111_0237391_162_584 137
332 3300048915 Ga0496112_0185398 Ga0496112_0185398_844_1266 137
333 3300048916 Ga0496113_0225737 Ga0496113_0225737_292_714 137
334 3300048918 Ga0496115_0300558 Ga0496115_0300558_638_1060 137
335 3300059641 Ga0587068_125275 Ga0587068_125275_35_457 137
336 3300004798 Ga0058859_11468875 Ga0058859_114688752 138
337 3300004801 Ga0058860_11971673 Ga0058860_119716731 138
338 3300006028 Ga0070717_10383847 Ga0070717_103838472 138
339 3300009147 Ga0114129_11497206 Ga0114129_114972061 138
340 3300024225 Ga0224572_1036098 Ga0224572_10360981 138
341 3300031090 Ga0265760_10062728 Ga0265760_100627281 138
342 3300035118 Ga0373954_0635367 Ga0373954_0635367_80_505 138
343 3300035119 Ga0373956_0217585 Ga0373956_0217585_14_439 138
344 3300035695 Ga0373927_0670210 Ga0373927_0670210_94_519 138
345 3300036401 Ga0373937_0502873 Ga0373937_0502873_113_544 138
346 3300046459 Ga0495629_0124602 Ga0495629_0124602_185_610 138
347 3300046463 Ga0495653_0161513 Ga0495653_0161513_1056_1487 138
348 3300046476 Ga0495662_0399627 Ga0495662_0399627_229_654 138
349 3300046499 Ga0495594_0691601 Ga0495594_0691601_49_474 138
350 3300046511 Ga0495608_0062828 Ga0495608_0062828_1123_1554 138
351 3300046516 Ga0495628_0571158 Ga0495628_0571158_32_511 138
352 3300046526 Ga0495666_0240630 Ga0495666_0240630_231_662 138
353 3300046529 Ga0495652_0762871 Ga0495652_0762871_62_487 138
354 3300046559 Ga0495667_0337257 Ga0495667_0337257_45_476 138
355 3300046679 Ga0495623_0255186 Ga0495623_0255186_313_744 138
356 3300046689 Ga0495613_0307028 Ga0495613_0307028_192_617 138
357 3300046690 Ga0495624_0804938 Ga0495624_0804938_56_487 138
358 3300047322 Ga0495680_0196768 Ga0495680_0196768_725_1156 138
359 3300048088 Ga0495602_0410245 Ga0495602_0410245_146_577 138
360 3300050507 nmdc:mga05p37_1217404_c1 nmdc:mga05p37_1217404_c1_207_635 138
361 3300053077 Ga0495601_0540158 Ga0495601_0540158_51_482 138
362 3300053078 Ga0495612_0182658 Ga0495612_0182658_111_542 138
363 3300053084 Ga0495595_0018932 Ga0495595_0018932_1585_2016 138
364 3300037853 Ga0436364_0455480 Ga0436364_0455480_180_608 139
365 3300037853 Ga0436364_1473917 Ga0436364_1473917_800_1228 139
366 3300005445 Ga0070708_100054827 Ga0070708_1000548271 140
367 3300005467 Ga0070706_100236050 Ga0070706_1002360503 140
368 3300005471 Ga0070698_100200879 Ga0070698_1002008793 140
369 3300005518 Ga0070699_100251049 Ga0070699_1002510493 140
370 3300005536 Ga0070697_100104226 Ga0070697_1001042263 140
371 3300006028 Ga0070717_10188478 Ga0070717_101884782 140
372 3300006175 Ga0070712_100589261 Ga0070712_1005892612 140
373 3300021388 Ga0213875_10613492 Ga0213875_106134921 140
374 3300025910 Ga0207684_10196637 Ga0207684_101966372 140
375 3300025915 Ga0207693_10163241 Ga0207693_101632412 140
376 3300035113 Ga0373936_0255210 Ga0373936_0255210_212_643 140
377 3300035692 Ga0373935_0118621 Ga0373935_0118621_164_595 140
378 3300035725 Ga0373947_0036818 Ga0373947_0036818_1684_2115 140
379 3300037853 Ga0436364_0130205 Ga0436364_0130205_68_499 140
380 3300039437 Ga0436365_0570744 Ga0436365_0570744_145_576 140
381 3300046459 Ga0495629_0081757 Ga0495629_0081757_1081_1512 140
382 3300046533 Ga0495640_0139880 Ga0495640_0139880_457_888 140
383 3300046683 Ga0495658_0282871 Ga0495658_0282871_520_951 140
384 3300047319 Ga0495674_0299228 Ga0495674_0299228_211_642 140
385 3300048907 Ga0496104_0134091 Ga0496104_0134091_565_996 140
386 3300048909 Ga0496106_0388893 Ga0496106_0388893_487_918 140
387 3300048910 Ga0496107_0620438 Ga0496107_0620438_16_447 140
388 3300048912 Ga0496109_0713515 Ga0496109_0713515_129_560 140
389 3300048913 Ga0496110_0131962 Ga0496110_0131962_447_878 140
390 3300048914 Ga0496111_1284080 Ga0496111_1284080_61_492 140
391 3300048917 Ga0496114_0053828 Ga0496114_0053828_542_973 140
392 3300050507 nmdc:mga05p37_584980_c1 nmdc:mga05p37_584980_c1_94_531 140
393 3300059505 Ga0587083_0212882 Ga0587083_0212882_72_503 140
394 3300059652 Ga0587107_133803 Ga0587107_133803_73_504 140
395 3300005467 Ga0070706_100122485 Ga0070706_1001224851 141
396 3300005467 Ga0070706_100331581 Ga0070706_1003315811 141
397 3300005471 Ga0070698_100341178 Ga0070698_1003411782 141
398 3300005518 Ga0070699_100534231 Ga0070699_1005342312 141
399 3300005536 Ga0070697_100126657 Ga0070697_1001266572 141
400 3300005536 Ga0070697_100639363 Ga0070697_1006393631 141
401 3300005546 Ga0070696_101427220 Ga0070696_1014272201 141
402 3300006028 Ga0070717_10469421 Ga0070717_104694212 141
403 3300006028 Ga0070717_10586378 Ga0070717_105863781 141
404 3300006038 Ga0075365_10253798 Ga0075365_102537981 141
405 3300006844 Ga0075428_100015732 Ga0075428_10001573211 141
406 3300006846 Ga0075430_100236502 Ga0075430_1002365023 141
407 3300006847 Ga0075431_100167687 Ga0075431_1001676872 141
408 3300006880 Ga0075429_100168341 Ga0075429_1001683413 141
409 3300006914 Ga0075436_100903018 Ga0075436_1009030181 141
410 3300009147 Ga0114129_10531829 Ga0114129_105318292 141
411 3300014325 Ga0163163_10535215 Ga0163163_105352152 141
412 3300020610 Ga0154015_1199851 Ga0154015_11998511 141
413 3300021361 Ga0213872_10210754 Ga0213872_102107541 141
414 3300025910 Ga0207684_10565391 Ga0207684_105653912 141
415 3300025922 Ga0207646_10269889 Ga0207646_102698892 141
416 3300025928 Ga0207700_10064917 Ga0207700_100649173 141
417 3300027671 Ga0209588_1042858 Ga0209588_10428581 141
418 3300037312 Ga0395899_0445565 Ga0395899_0445565_244_669 141
419 3300037418 Ga0395900_0033259 Ga0395900_0033259_2281_2706 141
420 3300037466 Ga0395898_0227433 Ga0395898_0227433_387_812 141
421 3300039447 Ga0436361_0393863 Ga0436361_0393863_1865_2296 141
422 3300046664 Ga0495659_0412984 Ga0495659_0412984_108_539 141
423 3300048907 Ga0496104_0001137 Ga0496104_0001137_19764_20216 141
424 3300048908 Ga0496105_0322248 Ga0496105_0322248_747_1199 141
425 3300048911 Ga0496108_0271517 Ga0496108_0271517_835_1287 141
426 3300048912 Ga0496109_0392953 Ga0496109_0392953_285_737 141
427 3300048912 Ga0496109_1001923 Ga0496109_1001923_37_468 141
428 3300049572 Ga0501036_0639409 Ga0501036_0639409_391_843 141
429 3300050492 nmdc:mga0yw44_356496_c1 nmdc:mga0yw44_356496_c1_490_921 141
430 3300050507 nmdc:mga05p37_106598_c1 nmdc:mga05p37_106598_c1_777_1202 141
431 3300050508 nmdc:mga09592_663331_c1 nmdc:mga09592_663331_c1_148_573 141
432 3300050509 nmdc:mga0qj67_441074_c1 nmdc:mga0qj67_441074_c1_418_843 141
433 3300003160 Ga0006779J45831_105002 Ga0006779J45831_1050021 142
434 3300003162 Ga0006778J45830_1025721 Ga0006778J45830_10257211 142
435 3300003544 Ga0007417J51691_1016276 Ga0007417J51691_10162762 142
436 3300003559 Ga0007427J51700_111823 Ga0007427J51700_1118231 142
437 3300003568 Ga0006781J51513_1011320 Ga0006781J51513_10113201 142
438 3300003574 Ga0007410J51695_1040494 Ga0007410J51695_10404942 142
439 3300003575 Ga0007409J51694_1084557 Ga0007409J51694_10845571 142
440 3300003577 Ga0007416J51690_1013219 Ga0007416J51690_10132192 142
441 3300003579 Ga0007429J51699_1024338 Ga0007429J51699_10243381 142
442 3300003579 Ga0007429J51699_1065486 Ga0007429J51699_10654861 142
443 3300003579 Ga0007429J51699_1074725 Ga0007429J51699_10747251 142
444 3300003693 Ga0032354_1017980 Ga0032354_10179801 142
445 3300003693 Ga0032354_1086103 Ga0032354_10861031 142
446 3300003911 JGI25405J52794_10069082 JGI25405J52794_100690821 142
447 3300004785 Ga0058858_1395822 Ga0058858_13958221 142
448 3300004801 Ga0058860_12096257 Ga0058860_120962571 142
449 3300004803 Ga0058862_12066838 Ga0058862_120668382 142
450 3300005434 Ga0070709_10082879 Ga0070709_100828793 142
451 3300005435 Ga0070714_100168281 Ga0070714_1001682812 142
452 3300005435 Ga0070714_100904232 Ga0070714_1009042321 142
453 3300005437 Ga0070710_10083071 Ga0070710_100830713 142
454 3300005437 Ga0070710_10149717 Ga0070710_101497171 142
455 3300005439 Ga0070711_100016144 Ga0070711_1000161441 142
456 3300005439 Ga0070711_100179263 Ga0070711_1001792631 142
457 3300005445 Ga0070708_100043659 Ga0070708_1000436593 142
458 3300005468 Ga0070707_100136149 Ga0070707_1001361495 142
459 3300005468 Ga0070707_100708605 Ga0070707_1007086052 142
460 3300005468 Ga0070707_101215129 Ga0070707_1012151292 142
461 3300005468 Ga0070707_101337567 Ga0070707_1013375671 142
462 3300005471 Ga0070698_100069880 Ga0070698_1000698805 142
463 3300005471 Ga0070698_100152669 Ga0070698_1001526694 142
464 3300005471 Ga0070698_100233903 Ga0070698_1002339033 142
465 3300005471 Ga0070698_100766110 Ga0070698_1007661102 142
466 3300005518 Ga0070699_100058152 Ga0070699_1000581521 142
467 3300005539 Ga0068853_101284691 Ga0068853_1012846911 142
468 3300005546 Ga0070696_100065176 Ga0070696_1000651761 142
469 3300005937 Ga0081455_10000369 Ga0081455_1000036938 142
470 3300005937 Ga0081455_10028989 Ga0081455_100289895 142
471 3300005937 Ga0081455_10057457 Ga0081455_100574574 142
472 3300005937 Ga0081455_10106478 Ga0081455_101064782 142
473 3300005937 Ga0081455_10151957 Ga0081455_101519571 142
474 3300005981 Ga0081538_10043091 Ga0081538_100430913 142
475 3300006028 Ga0070717_10081935 Ga0070717_100819351 142
476 3300006028 Ga0070717_10120438 Ga0070717_101204381 142
477 3300006028 Ga0070717_10191779 Ga0070717_101917791 142
478 3300006028 Ga0070717_10854552 Ga0070717_108545522 142
479 3300006028 Ga0070717_11059482 Ga0070717_110594821 142
480 3300006038 Ga0075365_10071606 Ga0075365_100716064 142
481 3300006051 Ga0075364_10050177 Ga0075364_100501775 142
482 3300006163 Ga0070715_10029214 Ga0070715_100292143 142
483 3300006163 Ga0070715_10868930 Ga0070715_108689301 142
484 3300006173 Ga0070716_100094027 Ga0070716_1000940273 142
485 3300006173 Ga0070716_101160769 Ga0070716_1011607692 142
486 3300006175 Ga0070712_100002439 Ga0070712_1000024396 142
487 3300006175 Ga0070712_100611300 Ga0070712_1006113002 142
488 3300006175 Ga0070712_100639843 Ga0070712_1006398431 142
489 3300006177 Ga0075362_10028304 Ga0075362_100283041 142
490 3300006844 Ga0075428_101774664 Ga0075428_1017746641 142
491 3300006846 Ga0075430_100034490 Ga0075430_1000344904 142
492 3300006847 Ga0075431_100656759 Ga0075431_1006567592 142
493 3300006852 Ga0075433_10250985 Ga0075433_102509852 142
494 3300006852 Ga0075433_10694826 Ga0075433_106948261 142
495 3300006871 Ga0075434_100145464 Ga0075434_1001454643 142
496 3300006871 Ga0075434_100975042 Ga0075434_1009750422 142
497 3300006881 Ga0068865_100991666 Ga0068865_1009916661 142
498 3300006914 Ga0075436_101278735 Ga0075436_1012787351 142
499 3300007076 Ga0075435_100355131 Ga0075435_1003551312 142
500 3300007076 Ga0075435_100909488 Ga0075435_1009094881 142
501 3300007265 Ga0099794_10070478 Ga0099794_100704783 142
502 3300007788 Ga0099795_10143175 Ga0099795_101431751 142
503 3300009094 Ga0111539_10289881 Ga0111539_102898812 142
504 3300009101 Ga0105247_10843521 Ga0105247_108435211 142
505 3300009147 Ga0114129_10289264 Ga0114129_102892643 142
506 3300009553 Ga0105249_12877806 Ga0105249_128778061 142
507 3300013297 Ga0157378_10438659 Ga0157378_104386592 142
508 3300013297 Ga0157378_11211075 Ga0157378_112110752 142
509 3300013306 Ga0163162_10333384 Ga0163162_103333841 142
510 3300014968 Ga0157379_11207434 Ga0157379_112074341 142
511 3300014969 Ga0157376_11168024 Ga0157376_111680242 142
512 3300020069 Ga0197907_10412332 Ga0197907_104123321 142
513 3300020069 Ga0197907_11123152 Ga0197907_111231521 142
514 3300020070 Ga0206356_10379118 Ga0206356_103791181 142
515 3300020070 Ga0206356_10790521 Ga0206356_107905211 142
516 3300020075 Ga0206349_1738978 Ga0206349_17389781 142
517 3300020076 Ga0206355_1492172 Ga0206355_14921721 142
518 3300020076 Ga0206355_1592198 Ga0206355_15921981 142
519 3300020077 Ga0206351_10277121 Ga0206351_102771211 142
520 3300020078 Ga0206352_11307728 Ga0206352_113077281 142
521 3300020080 Ga0206350_10243537 Ga0206350_102435371 142
522 3300020080 Ga0206350_11413227 Ga0206350_114132271 142
523 3300020080 Ga0206350_11522061 Ga0206350_115220611 142
524 3300020081 Ga0206354_10360926 Ga0206354_103609261 142
525 3300020081 Ga0206354_11704864 Ga0206354_117048641 142
526 3300020082 Ga0206353_11020452 Ga0206353_110204521 142
527 3300021361 Ga0213872_10010968 Ga0213872_100109686 142
528 3300022467 Ga0224712_10310290 Ga0224712_103102901 142
529 3300022467 Ga0224712_10313619 Ga0224712_103136191 142
530 3300022467 Ga0224712_10316245 Ga0224712_103162451 142
531 3300025885 Ga0207653_10078321 Ga0207653_100783212 142
532 3300025905 Ga0207685_10030385 Ga0207685_100303852 142
533 3300025906 Ga0207699_10501460 Ga0207699_105014602 142
534 3300025915 Ga0207693_10002798 Ga0207693_1000279811 142
535 3300025915 Ga0207693_10204105 Ga0207693_102041053 142
536 3300025915 Ga0207693_10334493 Ga0207693_103344932 142
537 3300025916 Ga0207663_10081200 Ga0207663_100812003 142
538 3300025916 Ga0207663_10311355 Ga0207663_103113552 142
539 3300025922 Ga0207646_10045133 Ga0207646_100451335 142
540 3300025928 Ga0207700_10018269 Ga0207700_100182695 142
541 3300025928 Ga0207700_10221903 Ga0207700_102219031 142
542 3300025929 Ga0207664_11314259 Ga0207664_113142591 142
543 3300025939 Ga0207665_10036946 Ga0207665_100369466 142
544 3300025939 Ga0207665_11396694 Ga0207665_113966941 142
545 3300026078 Ga0207702_10542294 Ga0207702_105422941 142
546 3300027907 Ga0207428_10938687 Ga0207428_109386871 142
547 3300035113 Ga0373936_0243616 Ga0373936_0243616_278_718 142
548 3300039447 Ga0436361_0136579 Ga0436361_0136579_748_1176 142
549 3300039450 Ga0436363_0534351 Ga0436363_0534351_97_525 142
550 3300039450 Ga0436363_1444669 Ga0436363_1444669_594_1022 142
551 3300039453 Ga0436362_0339453 Ga0436362_0339453_264_692 142
552 3300046457 Ga0495590_0429765 Ga0495590_0429765_55_489 142
553 3300046460 Ga0495638_0022603 Ga0495638_0022603_2668_3102 142
554 3300046491 Ga0495584_0009320 Ga0495584_0009320_2521_2955 142
555 3300046492 Ga0495585_0250009 Ga0495585_0250009_134_568 142
556 3300046520 Ga0495637_0174619 Ga0495637_0174619_175_609 142
557 3300046558 Ga0495633_0408322 Ga0495633_0408322_111_548 142
558 3300046648 Ga0495611_0252210 Ga0495611_0252210_189_623 142
559 3300046684 Ga0495669_0170172 Ga0495669_0170172_502_936 142
560 3300046694 Ga0495649_0140567 Ga0495649_0140567_608_1042 142
561 3300047320 Ga0495672_0086989 Ga0495672_0086989_1231_1668 142
562 3300048903 Ga0496100_0087223 Ga0496100_0087223_366_803 142
563 3300048903 Ga0496100_0160958 Ga0496100_0160958_334_762 142
564 3300048904 Ga0496101_0006724 Ga0496101_0006724_2652_3089 142
565 3300048904 Ga0496101_0228373 Ga0496101_0228373_338_766 142
566 3300048905 Ga0496102_0041461 Ga0496102_0041461_3089_3526 142
567 3300048905 Ga0496102_0544406 Ga0496102_0544406_454_882 142
568 3300048906 Ga0496103_0023086 Ga0496103_0023086_2460_2897 142
569 3300048907 Ga0496104_0064657 Ga0496104_0064657_206_643 142
570 3300048907 Ga0496104_0085402 Ga0496104_0085402_2273_2710 142
571 3300048908 Ga0496105_0122680 Ga0496105_0122680_393_830 142
572 3300048908 Ga0496105_0324484 Ga0496105_0324484_736_1173 142
573 3300048908 Ga0496105_0654795 Ga0496105_0654795_170_619 142
574 3300048909 Ga0496106_0001821 Ga0496106_0001821_3870_4307 142
575 3300048909 Ga0496106_0173654 Ga0496106_0173654_563_991 142
576 3300048910 Ga0496107_0000115 Ga0496107_0000115_38570_39007 142
577 3300048911 Ga0496108_0026124 Ga0496108_0026124_910_1347 142
578 3300048912 Ga0496109_0084186 Ga0496109_0084186_63_500 142
579 3300048912 Ga0496109_0359979 Ga0496109_0359979_875_1312 142
580 3300048913 Ga0496110_0014221 Ga0496110_0014221_117_554 142
581 3300048913 Ga0496110_0041979 Ga0496110_0041979_2740_3168 142
582 3300048913 Ga0496110_0207126 Ga0496110_0207126_35_472 142
583 3300048914 Ga0496111_0024764 Ga0496111_0024764_1662_2099 142
584 3300048914 Ga0496111_0029655 Ga0496111_0029655_1473_1910 142
585 3300048915 Ga0496112_0101532 Ga0496112_0101532_945_1382 142
586 3300048915 Ga0496112_0186155 Ga0496112_0186155_273_710 142
587 3300048915 Ga0496112_0729109 Ga0496112_0729109_247_675 142
588 3300048916 Ga0496113_0063573 Ga0496113_0063573_1927_2364 142
589 3300048916 Ga0496113_0150341 Ga0496113_0150341_63_500 142
590 3300048917 Ga0496114_0399710 Ga0496114_0399710_587_1015 142
591 3300048918 Ga0496115_0003331 Ga0496115_0003331_1459_1896 142
592 3300048918 Ga0496115_0518448 Ga0496115_0518448_479_907 142
593 3300049582 Ga0501048_0848219 Ga0501048_0848219_103_537 142
594 3300049583 Ga0501067_0351860 Ga0501067_0351860_205_642 142
595 3300049585 Ga0501069_0225263 Ga0501069_0225263_421_858 142
596 3300049591 Ga0501075_0698955 Ga0501075_0698955_110_544 142
597 3300049741 Ga0501079_0511444 Ga0501079_0511444_182_616 142
598 3300049743 Ga0501081_0033583 Ga0501081_0033583_2404_2838 142
599 3300049824 Ga0501045_0448393 Ga0501045_0448393_62_496 142
600 3300050489 nmdc:mga03683_24211_c1 nmdc:mga03683_24211_c1_1088_1522 142
601 3300050492 nmdc:mga0yw44_376011_c1 nmdc:mga0yw44_376011_c1_129_563 142
602 3300050492 nmdc:mga0yw44_5895_c1 nmdc:mga0yw44_5895_c1_3169_3603 142
603 3300050509 nmdc:mga0qj67_23937_c1 nmdc:mga0qj67_23937_c1_1969_2403 142
604 3300050510 nmdc:mga06r32_98941_c1 nmdc:mga06r32_98941_c1_2036_2470 142
605 3300050511 nmdc:mga08y16_317064_c1 nmdc:mga08y16_317064_c1_1025_1459 142
606 3300050511 nmdc:mga08y16_563957_c1 nmdc:mga08y16_563957_c1_638_1066 142
607 3300050512 nmdc:mga0n895_1242313_c1 nmdc:mga0n895_1242313_c1_103_540 142
608 3300050512 nmdc:mga0n895_56993_c1 nmdc:mga0n895_56993_c1_2960_3388 142
609 3300050512 nmdc:mga0n895_94215_c1 nmdc:mga0n895_94215_c1_2083_2511 142
610 3300050513 nmdc:mga0rr50_325257_c1 nmdc:mga0rr50_325257_c1_598_1026 142
611 3300050513 nmdc:mga0rr50_440050_c1 nmdc:mga0rr50_440050_c1_176_604 142
612 3300050513 nmdc:mga0rr50_722946_c1 nmdc:mga0rr50_722946_c1_190_618 142
613 3300050514 nmdc:mga08x19_202969_c1 nmdc:mga08x19_202969_c1_107_535 142
614 3300050515 nmdc:mga0a205_104910_c1 nmdc:mga0a205_104910_c1_1286_1714 142
615 3300050515 nmdc:mga0a205_134642_c1 nmdc:mga0a205_134642_c1_738_1166 142
616 3300050515 nmdc:mga0a205_528632_c1 nmdc:mga0a205_528632_c1_271_705 142
617 3300053077 Ga0495601_0299295 Ga0495601_0299295_302_742 142
618 3300053078 Ga0495612_0061036 Ga0495612_0061036_67_507 142
619 3300053084 Ga0495595_0438150 Ga0495595_0438150_33_473 142
620 3300059477 Ga0587084_063887 Ga0587084_063887_165_602 142
621 3300059477 Ga0587084_135135 Ga0587084_135135_91_519 142
622 3300059478 Ga0587093_042231 Ga0587093_042231_89_526 142
623 3300059490 Ga0587066_045161 Ga0587066_045161_134_571 142
624 3300059490 Ga0587066_071908 Ga0587066_071908_190_627 142
625 3300059490 Ga0587066_118201 Ga0587066_118201_82_510 142
626 3300059491 Ga0587070_114170 Ga0587070_114170_186_614 142
627 3300059492 Ga0587073_0027664 Ga0587073_0027664_633_1061 142
628 3300059492 Ga0587073_0094524 Ga0587073_0094524_193_630 142
629 3300059492 Ga0587073_0095036 Ga0587073_0095036_198_626 142
630 3300059492 Ga0587073_0119307 Ga0587073_0119307_24_470 142
631 3300059492 Ga0587073_0122555 Ga0587073_0122555_195_623 142
632 3300059492 Ga0587073_0131048 Ga0587073_0131048_172_609 142
633 3300059492 Ga0587073_0146277 Ga0587073_0146277_205_642 142
634 3300059493 Ga0587077_099027 Ga0587077_099027_89_526 142
635 3300059503 Ga0587080_059595 Ga0587080_059595_193_630 142
636 3300059503 Ga0587080_070345 Ga0587080_070345_190_618 142
637 3300059503 Ga0587080_086026 Ga0587080_086026_45_482 142
638 3300059503 Ga0587080_104183 Ga0587080_104183_90_518 142
639 3300059504 Ga0587082_055749 Ga0587082_055749_194_631 142
640 3300059504 Ga0587082_066915 Ga0587082_066915_112_549 142
641 3300059504 Ga0587082_073293 Ga0587082_073293_191_619 142
642 3300059504 Ga0587082_085732 Ga0587082_085732_34_462 142
643 3300059504 Ga0587082_119109 Ga0587082_119109_130_558 142
644 3300059505 Ga0587083_0040197 Ga0587083_0040197_366_803 142
645 3300059505 Ga0587083_0082067 Ga0587083_0082067_194_631 142
646 3300059505 Ga0587083_0112535 Ga0587083_0112535_184_612 142
647 3300059505 Ga0587083_0147156 Ga0587083_0147156_177_605 142
648 3300059506 Ga0587085_065646 Ga0587085_065646_89_526 142
649 3300059506 Ga0587085_072447 Ga0587085_072447_104_532 142
650 3300059506 Ga0587085_078592 Ga0587085_078592_123_560 142
651 3300059507 Ga0587086_074093 Ga0587086_074093_149_577 142
652 3300059508 Ga0587088_069343 Ga0587088_069343_143_580 142
653 3300059508 Ga0587088_084380 Ga0587088_084380_75_512 142
654 3300059509 Ga0587089_053869 Ga0587089_053869_32_460 142
655 3300059510 Ga0587090_067994 Ga0587090_067994_82_519 142
656 3300059510 Ga0587090_069028 Ga0587090_069028_150_587 142
657 3300059511 Ga0587091_066134 Ga0587091_066134_143_580 142
658 3300059511 Ga0587091_074002 Ga0587091_074002_197_625 142
659 3300059511 Ga0587091_095834 Ga0587091_095834_172_609 142
660 3300059511 Ga0587091_112798 Ga0587091_112798_32_460 142
661 3300059511 Ga0587091_152892 Ga0587091_152892_144_572 142
662 3300059512 Ga0587092_055579 Ga0587092_055579_157_594 142
663 3300059512 Ga0587092_079488 Ga0587092_079488_184_612 142
664 3300059513 Ga0587094_042332 Ga0587094_042332_140_577 142
665 3300059513 Ga0587094_047003 Ga0587094_047003_193_621 142
666 3300059513 Ga0587094_051832 Ga0587094_051832_186_614 142
667 3300059513 Ga0587094_054221 Ga0587094_054221_162_599 142
668 3300059514 Ga0587095_019193 Ga0587095_019193_32_460 142
669 3300059604 Ga0587098_032470 Ga0587098_032470_154_591 142
670 3300059604 Ga0587098_045310 Ga0587098_045310_34_462 142
671 3300059604 Ga0587098_056538 Ga0587098_056538_151_579 142
672 3300059605 Ga0587106_060486 Ga0587106_060486_102_539 142
673 3300059605 Ga0587106_065357 Ga0587106_065357_161_598 142
674 3300059607 Ga0587125_023244 Ga0587125_023244_181_609 142
675 3300059608 Ga0587129_009713 Ga0587129_009713_115_543 142
676 3300059609 Ga0587131_013113 Ga0587131_013113_158_586 142
677 3300059623 Ga0587101_061101 Ga0587101_061101_168_605 142
678 3300059623 Ga0587101_062525 Ga0587101_062525_42_470 142
679 3300059624 Ga0587109_044525 Ga0587109_044525_153_590 142
680 3300059625 Ga0587113_019286 Ga0587113_019286_197_625 142
681 3300059626 Ga0587115_032494 Ga0587115_032494_190_627 142
682 3300059626 Ga0587115_047051 Ga0587115_047051_181_609 142
683 3300059628 Ga0587122_016673 Ga0587122_016673_190_627 142
684 3300059630 Ga0587128_048247 Ga0587128_048247_195_632 142
685 3300059630 Ga0587128_062330 Ga0587128_062330_84_512 142
686 3300059631 Ga0587130_025283 Ga0587130_025283_42_470 142
687 3300059639 Ga0587062_056057 Ga0587062_056057_73_510 142
688 3300059640 Ga0587067_079066 Ga0587067_079066_194_622 142
689 3300059640 Ga0587067_095184 Ga0587067_095184_170_607 142
690 3300059640 Ga0587067_098131 Ga0587067_098131_95_532 142
691 3300059641 Ga0587068_062747 Ga0587068_062747_126_563 142
692 3300059641 Ga0587068_066955 Ga0587068_066955_94_531 142
693 3300059641 Ga0587068_105271 Ga0587068_105271_136_564 142
694 3300059643 Ga0587072_091479 Ga0587072_091479_75_512 142
695 3300059643 Ga0587072_104243 Ga0587072_104243_31_459 142
696 3300059644 Ga0587075_037316 Ga0587075_037316_284_721 142
697 3300059644 Ga0587075_056287 Ga0587075_056287_197_649 142
698 3300059645 Ga0587076_081366 Ga0587076_081366_84_521 142
699 3300059645 Ga0587076_130628 Ga0587076_130628_32_460 142
700 3300059646 Ga0587078_013177 Ga0587078_013177_366_803 142
701 3300059646 Ga0587078_043727 Ga0587078_043727_17_445 142
702 3300059646 Ga0587078_069992 Ga0587078_069992_17_445 142
703 3300059651 Ga0587105_011839 Ga0587105_011839_167_604 142
704 3300059652 Ga0587107_037964 Ga0587107_037964_193_630 142
705 3300059652 Ga0587107_043268 Ga0587107_043268_196_624 142
706 3300059652 Ga0587107_072131 Ga0587107_072131_19_447 142
707 3300059655 Ga0587114_044982 Ga0587114_044982_192_629 142
708 3300059655 Ga0587114_052759 Ga0587114_052759_184_612 142
709 3300059658 Ga0587119_035082 Ga0587119_035082_130_567 142
710 3300059658 Ga0587119_040047 Ga0587119_040047_60_488 142
711 3300060344 Ga0587071_098713 Ga0587071_098713_77_514 142
712 3300060346 Ga0587111_0110010 Ga0587111_0110010_188_616 142
713 3300061734 Ga0530510_0154161 Ga0530510_0154161_993_1427 142
714 3300049568 Ga0501031_0432134 Ga0501031_0432134_267_704 143
715 3300049572 Ga0501036_0823475 Ga0501036_0823475_186_623 143
716 3300049576 Ga0501040_0324137 Ga0501040_0324137_61_498 143
717 3300049577 Ga0501041_0489046 Ga0501041_0489046_61_498 143
718 3300049578 Ga0501042_0169170 Ga0501042_0169170_500_937 143
719 3300049579 Ga0501043_0738719 Ga0501043_0738719_214_651 143
720 3300049582 Ga0501048_0275536 Ga0501048_0275536_57_494 143
721 3300049587 Ga0501071_0688983 Ga0501071_0688983_248_685 143
722 3300049588 Ga0501072_0070451 Ga0501072_0070451_1078_1515 143
723 3300049593 Ga0501077_0053295 Ga0501077_0053295_540_977 143
724 3300049741 Ga0501079_0209021 Ga0501079_0209021_55_492 143
725 3300049822 Ga0501035_0408914 Ga0501035_0408914_465_902 143
726 3300054114 Ga0501084_0203053 Ga0501084_0203053_718_1155 143
727 3300060353 Ga0501082_0657522 Ga0501082_0657522_194_631 143
728 3300061734 Ga0530510_0173502 Ga0530510_0173502_548_985 143
729 3300002155 JGI24033J26618_1009174 JGI24033J26618_10091741 144
730 3300003544 Ga0007417J51691_1007401 Ga0007417J51691_10074012 144
731 3300003559 Ga0007427J51700_101877 Ga0007427J51700_1018771 144
732 3300003568 Ga0006781J51513_1002506 Ga0006781J51513_10025061 144
733 3300003577 Ga0007416J51690_1003489 Ga0007416J51690_10034892 144
734 3300003579 Ga0007429J51699_1001323 Ga0007429J51699_10013231 144
735 3300003693 Ga0032354_1000148 Ga0032354_10001481 144
736 3300003735 Ga0006780_1000018 Ga0006780_10000182 144
737 3300004785 Ga0058858_1018139 Ga0058858_10181392 144
738 3300004798 Ga0058859_10132773 Ga0058859_101327731 144
739 3300004800 Ga0058861_10078353 Ga0058861_100783532 144
740 3300004803 Ga0058862_10052381 Ga0058862_100523811 144
741 3300005329 Ga0070683_100359412 Ga0070683_1003594122 144
742 3300005330 Ga0070690_100026431 Ga0070690_1000264311 144
743 3300005335 Ga0070666_10044401 Ga0070666_100444013 144
744 3300005339 Ga0070660_100937673 Ga0070660_1009376732 144
745 3300005340 Ga0070689_100102269 Ga0070689_1001022693 144
746 3300005343 Ga0070687_100037005 Ga0070687_1000370053 144
747 3300005344 Ga0070661_100416323 Ga0070661_1004163232 144
748 3300005347 Ga0070668_100320190 Ga0070668_1003201902 144
749 3300005353 Ga0070669_100117314 Ga0070669_1001173142 144
750 3300005354 Ga0070675_100755168 Ga0070675_1007551681 144
751 3300005355 Ga0070671_100064152 Ga0070671_1000641523 144
752 3300005356 Ga0070674_100079286 Ga0070674_1000792861 144
753 3300005364 Ga0070673_100657716 Ga0070673_1006577161 144
754 3300005365 Ga0070688_100027605 Ga0070688_1000276056 144
755 3300005366 Ga0070659_100113034 Ga0070659_1001130343 144
756 3300005367 Ga0070667_101388972 Ga0070667_1013889721 144
757 3300005436 Ga0070713_100493046 Ga0070713_1004930461 144
758 3300005438 Ga0070701_10013534 Ga0070701_100135342 144
759 3300005439 Ga0070711_100207346 Ga0070711_1002073463 144
760 3300005441 Ga0070700_100014676 Ga0070700_1000146763 144
761 3300005444 Ga0070694_100412145 Ga0070694_1004121452 144
762 3300005455 Ga0070663_100035496 Ga0070663_1000354964 144
763 3300005456 Ga0070678_100139918 Ga0070678_1001399183 144
764 3300005457 Ga0070662_100278377 Ga0070662_1002783773 144
765 3300005459 Ga0068867_100104962 Ga0068867_1001049624 144
766 3300005466 Ga0070685_10369189 Ga0070685_103691891 144
767 3300005535 Ga0070684_100066380 Ga0070684_1000663803 144
768 3300005539 Ga0068853_100822949 Ga0068853_1008229491 144
769 3300005543 Ga0070672_100158598 Ga0070672_1001585981 144
770 3300005544 Ga0070686_100096914 Ga0070686_1000969144 144
771 3300005546 Ga0070696_101213112 Ga0070696_1012131121 144
772 3300005547 Ga0070693_101545512 Ga0070693_1015455121 144
773 3300005548 Ga0070665_100128607 Ga0070665_1001286073 144
774 3300005548 Ga0070665_102079851 Ga0070665_1020798511 144
775 3300005563 Ga0068855_100834263 Ga0068855_1008342632 144
776 3300005564 Ga0070664_100366081 Ga0070664_1003660813 144
777 3300005577 Ga0068857_100753197 Ga0068857_1007531971 144
778 3300005578 Ga0068854_100352165 Ga0068854_1003521651 144
779 3300005614 Ga0068856_100756512 Ga0068856_1007565121 144
780 3300005615 Ga0070702_100014870 Ga0070702_1000148703 144
781 3300005616 Ga0068852_100214320 Ga0068852_1002143201 144
782 3300005618 Ga0068864_100352638 Ga0068864_1003526381 144
783 3300005718 Ga0068866_10074827 Ga0068866_100748272 144
784 3300005719 Ga0068861_100593441 Ga0068861_1005934412 144
785 3300005719 Ga0068861_102063585 Ga0068861_1020635851 144
786 3300005840 Ga0068870_10004501 Ga0068870_100045018 144
787 3300005843 Ga0068860_100114443 Ga0068860_1001144435 144
788 3300006038 Ga0075365_10099783 Ga0075365_100997831 144
789 3300006042 Ga0075368_10146708 Ga0075368_101467082 144
790 3300006051 Ga0075364_10646212 Ga0075364_106462121 144
791 3300006173 Ga0070716_100159984 Ga0070716_1001599842 144
792 3300006177 Ga0075362_10161142 Ga0075362_101611422 144
793 3300006178 Ga0075367_10325693 Ga0075367_103256931 144
794 3300006237 Ga0097621_100236927 Ga0097621_1002369273 144
795 3300006847 Ga0075431_101444810 Ga0075431_1014448101 144
796 3300006881 Ga0068865_100049206 Ga0068865_1000492061 144
797 3300006914 Ga0075436_100507205 Ga0075436_1005072051 144
798 3300009094 Ga0111539_10293474 Ga0111539_102934741 144
799 3300009098 Ga0105245_10204641 Ga0105245_102046411 144
800 3300009101 Ga0105247_10015282 Ga0105247_100152822 144
801 3300009148 Ga0105243_10536808 Ga0105243_105368081 144
802 3300009148 Ga0105243_11241022 Ga0105243_112410221 144
803 3300009174 Ga0105241_10161373 Ga0105241_101613734 144
804 3300009177 Ga0105248_10407732 Ga0105248_104077321 144
805 3300009553 Ga0105249_10159072 Ga0105249_101590722 144
806 3300010375 Ga0105239_11025479 Ga0105239_110254791 144
807 3300013052 Ga0154014_150331 Ga0154014_1503311 144
808 3300013100 Ga0157373_10285172 Ga0157373_102851722 144
809 3300013296 Ga0157374_10270410 Ga0157374_102704103 144
810 3300013297 Ga0157378_10439831 Ga0157378_104398313 144
811 3300013306 Ga0163162_11485757 Ga0163162_114857571 144
812 3300013306 Ga0163162_11834814 Ga0163162_118348141 144
813 3300013307 Ga0157372_10807664 Ga0157372_108076641 144
814 3300014326 Ga0157380_10223193 Ga0157380_102231931 144
815 3300014745 Ga0157377_10097628 Ga0157377_100976282 144
816 3300014969 Ga0157376_10244502 Ga0157376_102445023 144
817 3300014969 Ga0157376_10452972 Ga0157376_104529721 144
818 3300020069 Ga0197907_10581883 Ga0197907_105818831 144
819 3300020069 Ga0197907_11475688 Ga0197907_114756881 144
820 3300020070 Ga0206356_10020745 Ga0206356_100207452 144
821 3300020075 Ga0206349_1199217 Ga0206349_11992171 144
822 3300020080 Ga0206350_11526535 Ga0206350_115265351 144
823 3300020610 Ga0154015_1542634 Ga0154015_15426341 144
824 3300022467 Ga0224712_10289323 Ga0224712_102893231 144
825 3300025315 Ga0207697_10156602 Ga0207697_101566021 144
826 3300025899 Ga0207642_10114573 Ga0207642_101145733 144
827 3300025900 Ga0207710_10019040 Ga0207710_100190401 144
828 3300025901 Ga0207688_10001492 Ga0207688_1000149215 144
829 3300025903 Ga0207680_10116578 Ga0207680_101165781 144
830 3300025904 Ga0207647_10064305 Ga0207647_100643052 144
831 3300025907 Ga0207645_10052747 Ga0207645_100527471 144
832 3300025908 Ga0207643_10018058 Ga0207643_100180583 144
833 3300025914 Ga0207671_11099007 Ga0207671_110990071 144
834 3300025916 Ga0207663_10349900 Ga0207663_103499001 144
835 3300025918 Ga0207662_10025767 Ga0207662_100257674 144
836 3300025919 Ga0207657_10079354 Ga0207657_100793545 144
837 3300025920 Ga0207649_10111499 Ga0207649_101114991 144
838 3300025923 Ga0207681_10845443 Ga0207681_108454432 144
839 3300025924 Ga0207694_10469753 Ga0207694_104697531 144
840 3300025925 Ga0207650_10521552 Ga0207650_105215521 144
841 3300025926 Ga0207659_10057568 Ga0207659_100575683 144
842 3300025931 Ga0207644_10148115 Ga0207644_101481151 144
843 3300025932 Ga0207690_10783564 Ga0207690_107835641 144
844 3300025933 Ga0207706_10019204 Ga0207706_100192047 144
845 3300025934 Ga0207686_10819032 Ga0207686_108190322 144
846 3300025935 Ga0207709_10285542 Ga0207709_102855422 144
847 3300025937 Ga0207669_10040790 Ga0207669_100407903 144
848 3300025938 Ga0207704_10476776 Ga0207704_104767761 144
849 3300025939 Ga0207665_11354262 Ga0207665_113542621 144
850 3300025940 Ga0207691_10066198 Ga0207691_100661981 144
851 3300025941 Ga0207711_10265841 Ga0207711_102658411 144
852 3300025942 Ga0207689_10007050 Ga0207689_100070505 144
853 3300025944 Ga0207661_10409730 Ga0207661_104097301 144
854 3300025972 Ga0207668_11078746 Ga0207668_110787461 144
855 3300025986 Ga0207658_10980433 Ga0207658_109804331 144
856 3300026023 Ga0207677_10026042 Ga0207677_100260421 144
857 3300026041 Ga0207639_10105939 Ga0207639_101059394 144
858 3300026067 Ga0207678_10031904 Ga0207678_100319044 144
859 3300026075 Ga0207708_10147770 Ga0207708_101477701 144
860 3300026078 Ga0207702_11280215 Ga0207702_112802151 144
861 3300026088 Ga0207641_10023833 Ga0207641_100238334 144
862 3300026089 Ga0207648_10009264 Ga0207648_1000926413 144
863 3300026118 Ga0207675_100013837 Ga0207675_1000138376 144
864 3300026121 Ga0207683_10100309 Ga0207683_101003094 144
865 3300026142 Ga0207698_10136964 Ga0207698_101369641 144
866 3300027866 Ga0209813_10106034 Ga0209813_101060341 144
867 3300027907 Ga0207428_10463291 Ga0207428_104632911 144
868 3300028380 Ga0268265_10188166 Ga0268265_101881661 144
869 3300035084 Ga0373928_0076374 Ga0373928_0076374_265_699 144
870 3300035115 Ga0373941_0208639 Ga0373941_0208639_18_452 144
871 3300035121 Ga0373960_0042344 Ga0373960_0042344_433_867 144
872 3300041458 Ga0451798_0335678 Ga0451798_0335678_304_738 144
873 3300041511 Ga0451855_1305352 Ga0451855_1305352_49_483 144
874 3300046458 Ga0495591_048624 Ga0495591_048624_697_1131 144
875 3300046507 Ga0495606_0283027 Ga0495606_0283027_375_809 144
876 3300046513 Ga0495616_0028735 Ga0495616_0028735_506_940 144
877 3300046516 Ga0495628_0594921 Ga0495628_0594921_235_669 144
878 3300046520 Ga0495637_0038718 Ga0495637_0038718_594_1028 144
879 3300046524 Ga0495648_0506372 Ga0495648_0506372_53_487 144
880 3300046528 Ga0495642_0400698 Ga0495642_0400698_95_529 144
881 3300046529 Ga0495652_0790651 Ga0495652_0790651_155_589 144
882 3300046542 Ga0495597_0143210 Ga0495597_0143210_274_708 144
883 3300046615 Ga0495656_0127217 Ga0495656_0127217_646_1080 144
884 3300046642 Ga0495634_0343018 Ga0495634_0343018_40_474 144
885 3300046678 Ga0495599_0210619 Ga0495599_0210619_49_483 144
886 3300046680 Ga0495646_0175699 Ga0495646_0175699_468_902 144
887 3300046684 Ga0495669_0053743 Ga0495669_0053743_383_817 144
888 3300046692 Ga0495671_0217896 Ga0495671_0217896_479_913 144
889 3300046694 Ga0495649_0179154 Ga0495649_0179154_181_615 144
890 3300047317 Ga0495604_0350610 Ga0495604_0350610_500_934 144
891 3300048090 Ga0495615_0075505 Ga0495615_0075505_338_772 144
892 3300048903 Ga0496100_0058339 Ga0496100_0058339_1910_2344 144
893 3300048904 Ga0496101_0090268 Ga0496101_0090268_1490_1924 144
894 3300048904 Ga0496101_1428651 Ga0496101_1428651_72_506 144
895 3300048905 Ga0496102_0038319 Ga0496102_0038319_3531_3965 144
896 3300048906 Ga0496103_0010647 Ga0496103_0010647_4123_4557 144
897 3300048907 Ga0496104_0064904 Ga0496104_0064904_2479_2913 144
898 3300048909 Ga0496106_0033337 Ga0496106_0033337_2633_3067 144
899 3300048910 Ga0496107_0016920 Ga0496107_0016920_4332_4766 144
900 3300048911 Ga0496108_0155991 Ga0496108_0155991_1526_1960 144
901 3300048912 Ga0496109_0059010 Ga0496109_0059010_1660_2094 144
902 3300048913 Ga0496110_0023369 Ga0496110_0023369_4049_4483 144
903 3300048914 Ga0496111_0502320 Ga0496111_0502320_65_499 144
904 3300048915 Ga0496112_0061374 Ga0496112_0061374_1916_2350 144
905 3300048916 Ga0496113_0273744 Ga0496113_0273744_845_1279 144
906 3300048917 Ga0496114_0092794 Ga0496114_0092794_1356_1790 144
907 3300048918 Ga0496115_0399424 Ga0496115_0399424_162_596 144
908 3300049459 Ga0495678_130160 Ga0495678_130160_157_591 144
909 3300050492 nmdc:mga0yw44_115357_c1 nmdc:mga0yw44_115357_c1_1147_1581 144
910 3300050492 nmdc:mga0yw44_301527_c1 nmdc:mga0yw44_301527_c1_366_800 144
911 3300050494 nmdc:mga06z11_453727_c1 nmdc:mga06z11_453727_c1_109_543 144
912 3300050495 nmdc:mga04h51_125288_c1 nmdc:mga04h51_125288_c1_351_785 144
913 3300050511 nmdc:mga08y16_168639_c1 nmdc:mga08y16_168639_c1_1181_1615 144
914 3300053077 Ga0495601_0099724 Ga0495601_0099724_302_736 144
915 3300053084 Ga0495595_0496293 Ga0495595_0496293_112_546 144
916 3300053085 Ga0495619_0064128 Ga0495619_0064128_1359_1793 144
917 3300059492 Ga0587073_0096981 Ga0587073_0096981_186_620 144
918 3300059503 Ga0587080_071007 Ga0587080_071007_178_618 144
919 3300059505 Ga0587083_0100120 Ga0587083_0100120_134_568 144
920 3300059506 Ga0587085_065341 Ga0587085_065341_176_616 144
921 3300059508 Ga0587088_096521 Ga0587088_096521_132_566 144
922 3300059644 Ga0587075_018284 Ga0587075_018284_186_620 144
923 3300059644 Ga0587075_029339 Ga0587075_029339_258_698 144
924 3300059646 Ga0587078_031678 Ga0587078_031678_89_523 144
925 3300059651 Ga0587105_005867 Ga0587105_005867_291_731 144

Structural Annotation

Top 5 Hits

ID Description Score Start End
2pvd-assembly1.cif.gz_B crystal srtucture of the reduced ferredoxin:thioredoxin reductase 0.5253 45 110
4wfb-assembly1.cif.gz_A the crystal structure of the large ribosomal subunit of staphylococcus aureus in complex with bc-3205 0.5193 14 119
1dj7-assembly1.cif.gz_B crystal structure of ferredoxin thioredoxin reductase 0.5144 45 110
2pvg-assembly1.cif.gz_B crystal srtucture of the binary complex between ferredoxin and ferredoxin:thioredoxin reductase 0.5102 45 110
2pvd-assembly1.cif.gz_B crystal srtucture of the reduced ferredoxin:thioredoxin reductase 0.4839 45 110
ID Description Score Start End Superfamily
2puoB00 Mainly Beta;Roll;SH3 type barrels.; 0.5123 45 110 2.30.30.50
af_Q8I4E2_1_66_2.30.30.40 Mainly Beta;Roll;SH3 type barrels.;SH3 Domains 0.4857 49 118 2.30.30.40
2puoB00 Mainly Beta;Roll;SH3 type barrels.; 0.4726 45 110 2.30.30.50
4r0kB01 Mainly Beta;Roll;SH3 type barrels.;SH3 Domains 0.4519 47 111 2.30.30.40
af_Q8I4E2_1_66_2.30.30.40 Mainly Beta;Roll;SH3 type barrels.;SH3 Domains 0.4431 49 118 2.30.30.40
ID Description Score Start End GO Terms
AF-A0A1M7GAU9-F1-model_v4 Uncharacterized protein 0.949 1 116
AF-A0A2W2AW69-F1-model_v4 Uncharacterized protein 0.914 1 126
AF-A0A537U2I6-F1-model_v4 Uncharacterized protein 0.9075 1 126
AF-A0A127EUM9-F1-model_v4 Uncharacterized protein 0.8938 1 130
AF-A0A2W2AW69-F1-model_v4 Uncharacterized protein 0.8874 1 126

Feature Viewer

pLDDT pTM Quality
77.1 0.69 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map