F485897
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 925 | 419 | 925 | 139 |
Family's Representative Sequence
| Representative Sequence | 3300046516|Ga0495628_0571158|Ga0495628_0571158_32_511 |
| Length | 159 |
| Sequence | MCDYSLHLVASRPAKVGDKLVATDFAKSITGGFAAVGEPDVAVCLLPGTELAFEENVQYQRAFSLFGRARVDHKVARFRQVNVNDPNLHHDALEFPSGQIVMVTRLVAGQRATVLQLPASTRDHGGAKESEQVSSTGRIEACRQYARVPCHVTWPDLGD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 2 | 3300003160 | Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_22 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 3 | 3300003162 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 4 | 3300003544 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 5 | 3300003559 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 6 | 3300003568 | Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_24 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 7 | 3300003574 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 8 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 9 | 3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 10 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 11 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 12 | 3300003735 | Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 13 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 14 | 3300004785 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-1 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 15 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 16 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 17 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 18 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 19 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 24 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 40 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 55 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 61 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 64 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 66 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 70 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 72 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 73 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 74 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 76 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 77 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 78 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 79 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 80 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 81 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 82 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 83 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 84 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 85 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 87 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 88 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 89 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 90 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 91 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 92 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 93 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 94 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 96 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 97 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 98 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 99 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 100 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 101 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 102 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 103 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 104 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 105 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 106 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300013052 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 117 | 3300013059 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 118 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300019161 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA2 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 131 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 132 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 133 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 134 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 135 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 136 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 137 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 138 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 139 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 140 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 141 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 142 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 143 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 144 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 145 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 203 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 204 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300030863 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 207 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 208 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 209 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 210 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 211 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 212 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 213 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 214 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 215 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 216 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 217 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 218 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 219 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 220 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 221 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 222 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 223 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 224 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 225 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 226 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 227 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 228 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 229 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 230 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 231 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 232 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 233 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 234 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 235 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 236 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 237 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 238 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 239 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 240 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 320 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 321 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 322 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 323 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 324 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 325 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 326 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 327 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 328 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 329 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 330 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 331 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 332 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 333 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 334 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 335 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 337 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 338 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 339 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 340 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 341 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 342 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 343 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 344 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 345 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 346 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 348 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 349 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 350 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 353 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 354 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 356 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 357 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 358 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 359 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 360 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 361 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 362 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 363 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 364 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 365 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 366 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 367 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 368 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 369 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 375 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 376 | 3300059478 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 377 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 378 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 379 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 380 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 381 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 382 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 383 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 384 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 385 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 386 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 387 | 3300059509 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 388 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 389 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 390 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 391 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 392 | 3300059514 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 393 | 3300059604 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 394 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 395 | 3300059607 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 396 | 3300059608 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 166R_SD_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 397 | 3300059609 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 227R_SD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 398 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 399 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 400 | 3300059625 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 401 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 402 | 3300059628 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 403 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 404 | 3300059631 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 405 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 406 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 407 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 408 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 409 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 410 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 411 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 412 | 3300059651 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 413 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 414 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 415 | 3300059658 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 416 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 417 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 418 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 419 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 80.22 |
| Metatranscriptomes | 19.78 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.7 |
| Nodule | 0 |
| Rhizoplane | 10.16 |
| Rhizosphere | 85.51 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.62 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24033J26618_1009174 | 3300002155 | Bacteria | 1148 |
| 2 | Ga0006779J45831_105002 | 3300003160 | Unclassified | 634 |
| 3 | Ga0006778J45830_1025721 | 3300003162 | Unclassified | 636 |
| 4 | Ga0007417J51691_1007401 | 3300003544 | Bacteria | 770 |
| 5 | Ga0007417J51691_1016276 | 3300003544 | Unclassified | 871 |
| 6 | Ga0007427J51700_101877 | 3300003559 | Bacteria | 638 |
| 7 | Ga0007427J51700_111823 | 3300003559 | Unclassified | 831 |
| 8 | Ga0006781J51513_1002506 | 3300003568 | Bacteria | 711 |
| 9 | Ga0006781J51513_1011320 | 3300003568 | Unclassified | 697 |
| 10 | Ga0007410J51695_1040494 | 3300003574 | Unclassified | 707 |
| 11 | Ga0007409J51694_1084557 | 3300003575 | Unclassified | 593 |
| 12 | Ga0007416J51690_1003489 | 3300003577 | Bacteria | 774 |
| 13 | Ga0007416J51690_1013219 | 3300003577 | Bacteria | 1275 |
| 14 | Ga0007429J51699_1001323 | 3300003579 | Bacteria | 696 |
| 15 | Ga0007429J51699_1024338 | 3300003579 | Unclassified | 674 |
| 16 | Ga0007429J51699_1065486 | 3300003579 | Bacteria | 667 |
| 17 | Ga0007429J51699_1074725 | 3300003579 | Unclassified | 637 |
| 18 | Ga0032354_1000148 | 3300003693 | Bacteria | 777 |
| 19 | Ga0032354_1017980 | 3300003693 | Unclassified | 673 |
| 20 | Ga0032354_1086103 | 3300003693 | Unclassified | 637 |
| 21 | Ga0006780_1000018 | 3300003735 | Bacteria | 775 |
| 22 | JGI25405J52794_10069082 | 3300003911 | Bacteria | 770 |
| 23 | Ga0058858_1018139 | 3300004785 | Bacteria | 646 |
| 24 | Ga0058858_1395822 | 3300004785 | Bacteria | 693 |
| 25 | Ga0058859_10132773 | 3300004798 | Bacteria | 964 |
| 26 | Ga0058859_11468875 | 3300004798 | Bacteria | 749 |
| 27 | Ga0058859_11832506 | 3300004798 | Unclassified | 515 |
| 28 | Ga0058861_10078353 | 3300004800 | Bacteria | 647 |
| 29 | Ga0058860_11971673 | 3300004801 | Bacteria | 729 |
| 30 | Ga0058860_12096257 | 3300004801 | Unclassified | 621 |
| 31 | Ga0058862_10052381 | 3300004803 | Unclassified | 549 |
| 32 | Ga0058862_12066838 | 3300004803 | Bacteria | 630 |
| 33 | Ga0070676_10134024 | 3300005328 | Bacteria | 1570 |
| 34 | Ga0070683_100359412 | 3300005329 | Bacteria | 1387 |
| 35 | Ga0070690_100026431 | 3300005330 | Bacteria | 3580 |
| 36 | Ga0070670_100018116 | 3300005331 | Bacteria | 6045 |
| 37 | Ga0070670_100018448 | 3300005331 | Bacteria | 5986 |
| 38 | Ga0068869_101838936 | 3300005334 | Bacteria | 542 |
| 39 | Ga0070666_10044401 | 3300005335 | Bacteria | 2977 |
| 40 | Ga0070666_10057607 | 3300005335 | Bacteria | 2626 |
| 41 | Ga0070680_100812430 | 3300005336 | Bacteria | 806 |
| 42 | Ga0070682_100546721 | 3300005337 | Bacteria | 905 |
| 43 | Ga0070660_100937673 | 3300005339 | Unclassified | 731 |
| 44 | Ga0070689_100102269 | 3300005340 | Unclassified | 2269 |
| 45 | Ga0070691_10597363 | 3300005341 | Bacteria | 651 |
| 46 | Ga0070687_100037005 | 3300005343 | Bacteria | 2436 |
| 47 | Ga0070661_100416323 | 3300005344 | Bacteria | 1064 |
| 48 | Ga0070692_10719776 | 3300005345 | Unclassified | 674 |
| 49 | Ga0070668_100320190 | 3300005347 | Unclassified | 1305 |
| 50 | Ga0070669_100117314 | 3300005353 | Bacteria | 2026 |
| 51 | Ga0070669_100139195 | 3300005353 | Bacteria | 1870 |
| 52 | Ga0070669_100149900 | 3300005353 | Bacteria | 1805 |
| 53 | Ga0070675_100049189 | 3300005354 | Bacteria | 3459 |
| 54 | Ga0070675_100235398 | 3300005354 | Bacteria | 1599 |
| 55 | Ga0070675_100755168 | 3300005354 | Bacteria | 888 |
| 56 | Ga0070671_100009476 | 3300005355 | Bacteria | 7817 |
| 57 | Ga0070671_100064152 | 3300005355 | Bacteria | 3060 |
| 58 | Ga0070671_101337993 | 3300005355 | Bacteria | 632 |
| 59 | Ga0070674_100079286 | 3300005356 | Bacteria | 2342 |
| 60 | Ga0070674_100591146 | 3300005356 | Bacteria | 937 |
| 61 | Ga0070674_101533903 | 3300005356 | Unclassified | 599 |
| 62 | Ga0070673_100657716 | 3300005364 | Bacteria | 960 |
| 63 | Ga0070673_100718001 | 3300005364 | Unclassified | 919 |
| 64 | Ga0070688_100018344 | 3300005365 | Bacteria | 4037 |
| 65 | Ga0070688_100027605 | 3300005365 | Bacteria | 3381 |
| 66 | Ga0070688_100906394 | 3300005365 | Unclassified | 696 |
| 67 | Ga0070659_100113034 | 3300005366 | Unclassified | 2193 |
| 68 | Ga0070667_101023746 | 3300005367 | Bacteria | 771 |
| 69 | Ga0070667_101388972 | 3300005367 | Unclassified | 659 |
| 70 | Ga0070709_10082879 | 3300005434 | Bacteria | 2096 |
| 71 | Ga0070709_10944450 | 3300005434 | Bacteria | 684 |
| 72 | Ga0070714_100020696 | 3300005435 | Bacteria | 5376 |
| 73 | Ga0070714_100168281 | 3300005435 | Bacteria | 1987 |
| 74 | Ga0070714_100904232 | 3300005435 | Unclassified | 857 |
| 75 | Ga0070713_100493046 | 3300005436 | Bacteria | 1155 |
| 76 | Ga0070713_100962474 | 3300005436 | Bacteria | 823 |
| 77 | Ga0070713_101547507 | 3300005436 | Unclassified | 644 |
| 78 | Ga0070710_10083071 | 3300005437 | Bacteria | 1873 |
| 79 | Ga0070710_10149717 | 3300005437 | Bacteria | 1438 |
| 80 | Ga0070710_10428008 | 3300005437 | Bacteria | 893 |
| 81 | Ga0070701_10013534 | 3300005438 | Bacteria | 3715 |
| 82 | Ga0070701_10506565 | 3300005438 | Unclassified | 785 |
| 83 | Ga0070711_100016144 | 3300005439 | Bacteria | 4737 |
| 84 | Ga0070711_100179263 | 3300005439 | Bacteria | 1621 |
| 85 | Ga0070711_100207346 | 3300005439 | Unclassified | 1516 |
| 86 | Ga0070711_100775950 | 3300005439 | Bacteria | 811 |
| 87 | Ga0070700_100014676 | 3300005441 | Bacteria | 4427 |
| 88 | Ga0070700_100140161 | 3300005441 | Bacteria | 1642 |
| 89 | Ga0070700_100420429 | 3300005441 | Bacteria | 1010 |
| 90 | Ga0070694_100412145 | 3300005444 | Unclassified | 1060 |
| 91 | Ga0070708_100043659 | 3300005445 | Bacteria | 3939 |
| 92 | Ga0070708_100054827 | 3300005445 | Bacteria | 3543 |
| 93 | Ga0070663_100035496 | 3300005455 | Bacteria | 3460 |
| 94 | Ga0070663_100074305 | 3300005455 | Bacteria | 2482 |
| 95 | Ga0070678_100139918 | 3300005456 | Bacteria | 1935 |
| 96 | Ga0070662_100067984 | 3300005457 | Bacteria | 2618 |
| 97 | Ga0070662_100278377 | 3300005457 | Bacteria | 1353 |
| 98 | Ga0068867_100104962 | 3300005459 | Bacteria | 2163 |
| 99 | Ga0068867_100505359 | 3300005459 | Unclassified | 1040 |
| 100 | Ga0070685_10369189 | 3300005466 | Bacteria | 986 |
| 101 | Ga0070685_10564061 | 3300005466 | Bacteria | 815 |
| 102 | Ga0070706_100122485 | 3300005467 | Bacteria | 2424 |
| 103 | Ga0070706_100236050 | 3300005467 | Bacteria | 1707 |
| 104 | Ga0070706_100331581 | 3300005467 | Bacteria | 1419 |
| 105 | Ga0070706_101976066 | 3300005467 | Unclassified | 528 |
| 106 | Ga0070707_100109187 | 3300005468 | Unclassified | 2683 |
| 107 | Ga0070707_100136149 | 3300005468 | Unclassified | 2389 |
| 108 | Ga0070707_100708605 | 3300005468 | Unclassified | 969 |
| 109 | Ga0070707_101215129 | 3300005468 | Unclassified | 720 |
| 110 | Ga0070707_101337567 | 3300005468 | Bacteria | 683 |
| 111 | Ga0070698_100069880 | 3300005471 | Bacteria | 3525 |
| 112 | Ga0070698_100152669 | 3300005471 | Bacteria | 2256 |
| 113 | Ga0070698_100200879 | 3300005471 | Bacteria | 1929 |
| 114 | Ga0070698_100233903 | 3300005471 | Bacteria | 1771 |
| 115 | Ga0070698_100341178 | 3300005471 | Unclassified | 1430 |
| 116 | Ga0070698_100462008 | 3300005471 | Bacteria | 1205 |
| 117 | Ga0070698_100766110 | 3300005471 | Unclassified | 908 |
| 118 | Ga0070699_100058152 | 3300005518 | Bacteria | 3349 |
| 119 | Ga0070699_100251049 | 3300005518 | Bacteria | 1580 |
| 120 | Ga0070699_100534231 | 3300005518 | Bacteria | 1067 |
| 121 | Ga0070679_100615437 | 3300005530 | Bacteria | 1029 |
| 122 | Ga0070684_100066380 | 3300005535 | Bacteria | 3167 |
| 123 | Ga0070684_100387179 | 3300005535 | Bacteria | 1288 |
| 124 | Ga0070697_100104226 | 3300005536 | Bacteria | 2358 |
| 125 | Ga0070697_100126657 | 3300005536 | Bacteria | 2140 |
| 126 | Ga0070697_100639363 | 3300005536 | Bacteria | 937 |
| 127 | Ga0068853_100822949 | 3300005539 | Unclassified | 890 |
| 128 | Ga0068853_101284691 | 3300005539 | Bacteria | 707 |
| 129 | Ga0070672_100158598 | 3300005543 | Bacteria | 1875 |
| 130 | Ga0070672_100606769 | 3300005543 | Bacteria | 953 |
| 131 | Ga0070686_100096914 | 3300005544 | Bacteria | 1984 |
| 132 | Ga0070696_100065176 | 3300005546 | Bacteria | 2553 |
| 133 | Ga0070696_101213112 | 3300005546 | Bacteria | 638 |
| 134 | Ga0070696_101427220 | 3300005546 | Unclassified | 591 |
| 135 | Ga0070693_100455422 | 3300005547 | Unclassified | 899 |
| 136 | Ga0070693_101545512 | 3300005547 | Bacteria | 520 |
| 137 | Ga0070665_100128607 | 3300005548 | Bacteria | 2535 |
| 138 | Ga0070665_102079851 | 3300005548 | Bacteria | 572 |
| 139 | Ga0068855_100834263 | 3300005563 | Bacteria | 978 |
| 140 | Ga0070664_100366081 | 3300005564 | Bacteria | 1313 |
| 141 | Ga0068857_100753197 | 3300005577 | Bacteria | 928 |
| 142 | Ga0068854_100352165 | 3300005578 | Bacteria | 1205 |
| 143 | Ga0068854_100495779 | 3300005578 | Bacteria | 1028 |
| 144 | Ga0068856_100646029 | 3300005614 | Bacteria | 1079 |
| 145 | Ga0068856_100756512 | 3300005614 | Bacteria | 992 |
| 146 | Ga0070702_100014870 | 3300005615 | Bacteria | 3960 |
| 147 | Ga0068852_100214320 | 3300005616 | Unclassified | 1828 |
| 148 | Ga0068864_100352638 | 3300005618 | Bacteria | 1388 |
| 149 | Ga0068866_10074827 | 3300005718 | Unclassified | 1801 |
| 150 | Ga0068861_100415278 | 3300005719 | Bacteria | 1198 |
| 151 | Ga0068861_100593441 | 3300005719 | Bacteria | 1015 |
| 152 | Ga0068861_102063585 | 3300005719 | Unclassified | 569 |
| 153 | Ga0068870_10004501 | 3300005840 | Bacteria | 6002 |
| 154 | Ga0068870_10326393 | 3300005840 | Bacteria | 977 |
| 155 | Ga0068863_100308785 | 3300005841 | Bacteria | 1535 |
| 156 | Ga0068860_100114443 | 3300005843 | Bacteria | 2579 |
| 157 | Ga0068860_100415553 | 3300005843 | Bacteria | 1333 |
| 158 | Ga0068860_100947404 | 3300005843 | Unclassified | 878 |
| 159 | Ga0081455_10000369 | 3300005937 | Bacteria | 59441 |
| 160 | Ga0081455_10028989 | 3300005937 | Bacteria | 5050 |
| 161 | Ga0081455_10057457 | 3300005937 | Bacteria | 3297 |
| 162 | Ga0081455_10106478 | 3300005937 | Bacteria | 2238 |
| 163 | Ga0081455_10151957 | 3300005937 | Bacteria | 1784 |
| 164 | Ga0081455_10541644 | 3300005937 | Unclassified | 772 |
| 165 | Ga0081538_10017526 | 3300005981 | Bacteria | 5432 |
| 166 | Ga0081538_10043091 | 3300005981 | Bacteria | 2839 |
| 167 | Ga0081540_1001551 | 3300005983 | Bacteria | 19695 |
| 168 | Ga0081540_1007072 | 3300005983 | Bacteria | 8064 |
| 169 | Ga0070717_10081935 | 3300006028 | Bacteria | 2710 |
| 170 | Ga0070717_10120438 | 3300006028 | Bacteria | 2248 |
| 171 | Ga0070717_10188478 | 3300006028 | Bacteria | 1801 |
| 172 | Ga0070717_10191779 | 3300006028 | Bacteria | 1786 |
| 173 | Ga0070717_10303427 | 3300006028 | Bacteria | 1420 |
| 174 | Ga0070717_10383847 | 3300006028 | Unclassified | 1260 |
| 175 | Ga0070717_10469421 | 3300006028 | Unclassified | 1136 |
| 176 | Ga0070717_10586378 | 3300006028 | Bacteria | 1011 |
| 177 | Ga0070717_10854552 | 3300006028 | Bacteria | 828 |
| 178 | Ga0070717_11059482 | 3300006028 | Bacteria | 738 |
| 179 | Ga0075365_10045129 | 3300006038 | Bacteria | 2890 |
| 180 | Ga0075365_10071606 | 3300006038 | Bacteria | 2334 |
| 181 | Ga0075365_10099783 | 3300006038 | Bacteria | 1987 |
| 182 | Ga0075365_10228597 | 3300006038 | Bacteria | 1306 |
| 183 | Ga0075365_10253798 | 3300006038 | Unclassified | 1236 |
| 184 | Ga0075365_10306378 | 3300006038 | Unclassified | 1118 |
| 185 | Ga0075368_10146708 | 3300006042 | Bacteria | 985 |
| 186 | Ga0075364_10050177 | 3300006051 | Bacteria | 2723 |
| 187 | Ga0075364_10646212 | 3300006051 | Bacteria | 722 |
| 188 | Ga0070715_10029214 | 3300006163 | Bacteria | 2219 |
| 189 | Ga0070715_10868930 | 3300006163 | Bacteria | 553 |
| 190 | Ga0070716_100094027 | 3300006173 | Bacteria | 1821 |
| 191 | Ga0070716_100159984 | 3300006173 | Bacteria | 1458 |
| 192 | Ga0070716_101160769 | 3300006173 | Unclassified | 618 |
| 193 | Ga0070712_100002439 | 3300006175 | Bacteria | 11462 |
| 194 | Ga0070712_100589261 | 3300006175 | Unclassified | 940 |
| 195 | Ga0070712_100611300 | 3300006175 | Unclassified | 923 |
| 196 | Ga0070712_100639843 | 3300006175 | Unclassified | 903 |
| 197 | Ga0075362_10028304 | 3300006177 | Bacteria | 2406 |
| 198 | Ga0075362_10161142 | 3300006177 | Bacteria | 1080 |
| 199 | Ga0075367_10217031 | 3300006178 | Bacteria | 1196 |
| 200 | Ga0075367_10325693 | 3300006178 | Bacteria | 968 |
| 201 | Ga0097621_100236927 | 3300006237 | Bacteria | 1594 |
| 202 | Ga0075428_100015732 | 3300006844 | Bacteria | 8383 |
| 203 | Ga0075428_101774664 | 3300006844 | Unclassified | 643 |
| 204 | Ga0075430_100034490 | 3300006846 | Bacteria | 4295 |
| 205 | Ga0075430_100236502 | 3300006846 | Unclassified | 1514 |
| 206 | Ga0075431_100167687 | 3300006847 | Bacteria | 2257 |
| 207 | Ga0075431_100408046 | 3300006847 | Bacteria | 1359 |
| 208 | Ga0075431_100656759 | 3300006847 | Bacteria | 1029 |
| 209 | Ga0075431_101444810 | 3300006847 | Bacteria | 647 |
| 210 | Ga0075433_10250985 | 3300006852 | Unclassified | 1570 |
| 211 | Ga0075433_10602357 | 3300006852 | Unclassified | 965 |
| 212 | Ga0075433_10644391 | 3300006852 | Bacteria | 929 |
| 213 | Ga0075433_10694826 | 3300006852 | Bacteria | 891 |
| 214 | Ga0075434_100105190 | 3300006871 | Bacteria | 2832 |
| 215 | Ga0075434_100145464 | 3300006871 | Bacteria | 2390 |
| 216 | Ga0075434_100975042 | 3300006871 | Bacteria | 862 |
| 217 | Ga0075429_100168341 | 3300006880 | Bacteria | 1920 |
| 218 | Ga0075429_100344047 | 3300006880 | Bacteria | 1305 |
| 219 | Ga0068865_100049206 | 3300006881 | Bacteria | 2904 |
| 220 | Ga0068865_100991666 | 3300006881 | Unclassified | 735 |
| 221 | Ga0075436_100507205 | 3300006914 | Bacteria | 883 |
| 222 | Ga0075436_100903018 | 3300006914 | Unclassified | 661 |
| 223 | Ga0075436_101278735 | 3300006914 | Bacteria | 555 |
| 224 | Ga0075435_100355131 | 3300007076 | Bacteria | 1257 |
| 225 | Ga0075435_100854686 | 3300007076 | Bacteria | 793 |
| 226 | Ga0075435_100909488 | 3300007076 | Bacteria | 767 |
| 227 | Ga0099794_10070478 | 3300007265 | Bacteria | 1711 |
| 228 | Ga0099794_10471596 | 3300007265 | Unclassified | 659 |
| 229 | Ga0099795_10143175 | 3300007788 | Bacteria | 974 |
| 230 | Ga0111539_10085197 | 3300009094 | Bacteria | 3715 |
| 231 | Ga0111539_10289881 | 3300009094 | Bacteria | 1905 |
| 232 | Ga0111539_10293474 | 3300009094 | Unclassified | 1892 |
| 233 | Ga0105245_10204641 | 3300009098 | Unclassified | 1897 |
| 234 | Ga0105245_11334946 | 3300009098 | Bacteria | 766 |
| 235 | Ga0105247_10015282 | 3300009101 | Bacteria | 4600 |
| 236 | Ga0105247_10230807 | 3300009101 | Bacteria | 1257 |
| 237 | Ga0105247_10843521 | 3300009101 | Unclassified | 703 |
| 238 | Ga0114129_10051640 | 3300009147 | Bacteria | 5771 |
| 239 | Ga0114129_10131074 | 3300009147 | Bacteria | 3443 |
| 240 | Ga0114129_10289264 | 3300009147 | Bacteria | 2187 |
| 241 | Ga0114129_10343536 | 3300009147 | Bacteria | 1979 |
| 242 | Ga0114129_10531829 | 3300009147 | Bacteria | 1531 |
| 243 | Ga0114129_11497206 | 3300009147 | Unclassified | 829 |
| 244 | Ga0105243_10194213 | 3300009148 | Bacteria | 1775 |
| 245 | Ga0105243_10536808 | 3300009148 | Unclassified | 1115 |
| 246 | Ga0105243_10772170 | 3300009148 | Bacteria | 944 |
| 247 | Ga0105243_11241022 | 3300009148 | Bacteria | 760 |
| 248 | Ga0105241_10161373 | 3300009174 | Bacteria | 1843 |
| 249 | Ga0105241_11522126 | 3300009174 | Bacteria | 644 |
| 250 | Ga0105242_12778776 | 3300009176 | Unclassified | 540 |
| 251 | Ga0105248_10407732 | 3300009177 | Bacteria | 1530 |
| 252 | Ga0105248_10534073 | 3300009177 | Bacteria | 1323 |
| 253 | Ga0105249_10159072 | 3300009553 | Bacteria | 2181 |
| 254 | Ga0105249_10378338 | 3300009553 | Bacteria | 1441 |
| 255 | Ga0105249_12877806 | 3300009553 | Unclassified | 552 |
| 256 | Ga0105239_10405762 | 3300010375 | Bacteria | 1542 |
| 257 | Ga0105239_11025479 | 3300010375 | Bacteria | 949 |
| 258 | Ga0154014_150331 | 3300013052 | Bacteria | 697 |
| 259 | Ga0154012_140635 | 3300013059 | Bacteria | 563 |
| 260 | Ga0157373_10285172 | 3300013100 | Bacteria | 1171 |
| 261 | Ga0157374_10270410 | 3300013296 | Bacteria | 1676 |
| 262 | Ga0157374_10402074 | 3300013296 | Bacteria | 1366 |
| 263 | Ga0157374_10643125 | 3300013296 | Bacteria | 1072 |
| 264 | Ga0157378_10438659 | 3300013297 | Unclassified | 1294 |
| 265 | Ga0157378_10439831 | 3300013297 | Bacteria | 1292 |
| 266 | Ga0157378_10590715 | 3300013297 | Unclassified | 1120 |
| 267 | Ga0157378_10942317 | 3300013297 | Bacteria | 896 |
| 268 | Ga0157378_11211075 | 3300013297 | Bacteria | 795 |
| 269 | Ga0163162_10333384 | 3300013306 | Bacteria | 1649 |
| 270 | Ga0163162_11485757 | 3300013306 | Unclassified | 772 |
| 271 | Ga0163162_11834814 | 3300013306 | Unclassified | 693 |
| 272 | Ga0157372_10807664 | 3300013307 | Bacteria | 1090 |
| 273 | Ga0157372_11606258 | 3300013307 | Bacteria | 748 |
| 274 | Ga0157375_10184232 | 3300013308 | Bacteria | 2240 |
| 275 | Ga0163163_10040709 | 3300014325 | Bacteria | 4539 |
| 276 | Ga0163163_10535215 | 3300014325 | Unclassified | 1234 |
| 277 | Ga0157380_10068098 | 3300014326 | Unclassified | 2868 |
| 278 | Ga0157380_10223193 | 3300014326 | Unclassified | 1687 |
| 279 | Ga0157377_10084988 | 3300014745 | Unclassified | 1857 |
| 280 | Ga0157377_10097628 | 3300014745 | Unclassified | 1745 |
| 281 | Ga0157379_11207434 | 3300014968 | Bacteria | 728 |
| 282 | Ga0157376_10244502 | 3300014969 | Bacteria | 1673 |
| 283 | Ga0157376_10452972 | 3300014969 | Bacteria | 1252 |
| 284 | Ga0157376_10641105 | 3300014969 | Unclassified | 1062 |
| 285 | Ga0157376_11168024 | 3300014969 | Unclassified | 797 |
| 286 | Ga0163161_10261456 | 3300017792 | Unclassified | 1352 |
| 287 | Ga0184602_102655 | 3300019161 | Unclassified | 933 |
| 288 | Ga0197907_10378417 | 3300020069 | Bacteria | 1021 |
| 289 | Ga0197907_10412332 | 3300020069 | Bacteria | 682 |
| 290 | Ga0197907_10436085 | 3300020069 | Bacteria | 583 |
| 291 | Ga0197907_10581883 | 3300020069 | Unclassified | 703 |
| 292 | Ga0197907_11123152 | 3300020069 | Unclassified | 528 |
| 293 | Ga0197907_11475688 | 3300020069 | Bacteria | 781 |
| 294 | Ga0206356_10020745 | 3300020070 | Unclassified | 884 |
| 295 | Ga0206356_10234046 | 3300020070 | Bacteria | 874 |
| 296 | Ga0206356_10379118 | 3300020070 | Unclassified | 641 |
| 297 | Ga0206356_10790521 | 3300020070 | Unclassified | 739 |
| 298 | Ga0206349_1199217 | 3300020075 | Unclassified | 722 |
| 299 | Ga0206349_1200178 | 3300020075 | Bacteria | 740 |
| 300 | Ga0206349_1738978 | 3300020075 | Bacteria | 730 |
| 301 | Ga0206355_1492172 | 3300020076 | Unclassified | 516 |
| 302 | Ga0206355_1592198 | 3300020076 | Bacteria | 681 |
| 303 | Ga0206351_10277121 | 3300020077 | Unclassified | 615 |
| 304 | Ga0206352_10013594 | 3300020078 | Bacteria | 752 |
| 305 | Ga0206352_10517138 | 3300020078 | Bacteria | 884 |
| 306 | Ga0206352_11307728 | 3300020078 | Bacteria | 694 |
| 307 | Ga0206350_10243537 | 3300020080 | Bacteria | 694 |
| 308 | Ga0206350_10444938 | 3300020080 | Bacteria | 1101 |
| 309 | Ga0206350_11413227 | 3300020080 | Unclassified | 730 |
| 310 | Ga0206350_11521557 | 3300020080 | Bacteria | 875 |
| 311 | Ga0206350_11522061 | 3300020080 | Unclassified | 694 |
| 312 | Ga0206350_11526535 | 3300020080 | Unclassified | 535 |
| 313 | Ga0206354_10360926 | 3300020081 | Unclassified | 744 |
| 314 | Ga0206354_10615845 | 3300020081 | Bacteria | 815 |
| 315 | Ga0206354_11704864 | 3300020081 | Bacteria | 804 |
| 316 | Ga0206353_11020452 | 3300020082 | Bacteria | 687 |
| 317 | Ga0206353_11470667 | 3300020082 | Bacteria | 850 |
| 318 | Ga0154015_1199851 | 3300020610 | Bacteria | 670 |
| 319 | Ga0154015_1542634 | 3300020610 | Unclassified | 769 |
| 320 | Ga0213872_10010968 | 3300021361 | Bacteria | 4299 |
| 321 | Ga0213872_10210754 | 3300021361 | Unclassified | 830 |
| 322 | Ga0213875_10613492 | 3300021388 | Unclassified | 526 |
| 323 | Ga0224712_10179313 | 3300022467 | Bacteria | 954 |
| 324 | Ga0224712_10289323 | 3300022467 | Unclassified | 764 |
| 325 | Ga0224712_10310290 | 3300022467 | Bacteria | 739 |
| 326 | Ga0224712_10313619 | 3300022467 | Unclassified | 736 |
| 327 | Ga0224712_10316245 | 3300022467 | Unclassified | 733 |
| 328 | Ga0224572_1036098 | 3300024225 | Unclassified | 936 |
| 329 | Ga0207697_10156602 | 3300025315 | Bacteria | 992 |
| 330 | Ga0207653_10078321 | 3300025885 | Bacteria | 1140 |
| 331 | Ga0207642_10114573 | 3300025899 | Bacteria | 1379 |
| 332 | Ga0207710_10019040 | 3300025900 | Bacteria | 2927 |
| 333 | Ga0207710_10054606 | 3300025900 | Bacteria | 1799 |
| 334 | Ga0207688_10001492 | 3300025901 | Bacteria | 12273 |
| 335 | Ga0207688_10043206 | 3300025901 | Bacteria | 2509 |
| 336 | Ga0207680_10116578 | 3300025903 | Bacteria | 1741 |
| 337 | Ga0207680_10117441 | 3300025903 | Bacteria | 1735 |
| 338 | Ga0207647_10064305 | 3300025904 | Bacteria | 2230 |
| 339 | Ga0207647_10080204 | 3300025904 | Bacteria | 1958 |
| 340 | Ga0207685_10030385 | 3300025905 | Bacteria | 1923 |
| 341 | Ga0207685_10640220 | 3300025905 | Unclassified | 574 |
| 342 | Ga0207699_10501460 | 3300025906 | Bacteria | 876 |
| 343 | Ga0207699_10742264 | 3300025906 | Bacteria | 720 |
| 344 | Ga0207645_10052747 | 3300025907 | Bacteria | 2598 |
| 345 | Ga0207645_10335667 | 3300025907 | Bacteria | 1010 |
| 346 | Ga0207643_10018058 | 3300025908 | Bacteria | 3864 |
| 347 | Ga0207684_10107883 | 3300025910 | Bacteria | 2382 |
| 348 | Ga0207684_10196637 | 3300025910 | Bacteria | 1739 |
| 349 | Ga0207684_10267010 | 3300025910 | Unclassified | 1476 |
| 350 | Ga0207684_10565391 | 3300025910 | Bacteria | 972 |
| 351 | Ga0207671_11099007 | 3300025914 | Bacteria | 625 |
| 352 | Ga0207693_10002798 | 3300025915 | Bacteria | 15117 |
| 353 | Ga0207693_10163241 | 3300025915 | Bacteria | 1753 |
| 354 | Ga0207693_10204105 | 3300025915 | Bacteria | 1554 |
| 355 | Ga0207693_10334493 | 3300025915 | Bacteria | 1185 |
| 356 | Ga0207663_10081200 | 3300025916 | Bacteria | 2122 |
| 357 | Ga0207663_10311355 | 3300025916 | Bacteria | 1180 |
| 358 | Ga0207663_10349900 | 3300025916 | Bacteria | 1118 |
| 359 | Ga0207662_10025767 | 3300025918 | Bacteria | 3388 |
| 360 | Ga0207657_10079354 | 3300025919 | Bacteria | 2761 |
| 361 | Ga0207649_10111499 | 3300025920 | Unclassified | 1828 |
| 362 | Ga0207652_11317848 | 3300025921 | Bacteria | 625 |
| 363 | Ga0207646_10045133 | 3300025922 | Bacteria | 3956 |
| 364 | Ga0207646_10269889 | 3300025922 | Bacteria | 1538 |
| 365 | Ga0207681_10111477 | 3300025923 | Bacteria | 1991 |
| 366 | Ga0207681_10845443 | 3300025923 | Bacteria | 765 |
| 367 | Ga0207694_10469753 | 3300025924 | Bacteria | 1051 |
| 368 | Ga0207650_10011646 | 3300025925 | Bacteria | 6059 |
| 369 | Ga0207650_10272415 | 3300025925 | Bacteria | 1376 |
| 370 | Ga0207650_10521552 | 3300025925 | Bacteria | 994 |
| 371 | Ga0207659_10050312 | 3300025926 | Bacteria | 2960 |
| 372 | Ga0207659_10057568 | 3300025926 | Bacteria | 2787 |
| 373 | Ga0207687_10640293 | 3300025927 | Bacteria | 899 |
| 374 | Ga0207687_10695188 | 3300025927 | Bacteria | 863 |
| 375 | Ga0207700_10018269 | 3300025928 | Bacteria | 4707 |
| 376 | Ga0207700_10057402 | 3300025928 | Bacteria | 2935 |
| 377 | Ga0207700_10064917 | 3300025928 | Bacteria | 2783 |
| 378 | Ga0207700_10221903 | 3300025928 | Bacteria | 1603 |
| 379 | Ga0207700_10816416 | 3300025928 | Unclassified | 834 |
| 380 | Ga0207664_10042402 | 3300025929 | Bacteria | 3552 |
| 381 | Ga0207664_11314259 | 3300025929 | Unclassified | 643 |
| 382 | Ga0207644_10037382 | 3300025931 | Bacteria | 3415 |
| 383 | Ga0207644_10148115 | 3300025931 | Bacteria | 1814 |
| 384 | Ga0207644_11390860 | 3300025931 | Bacteria | 589 |
| 385 | Ga0207690_10783564 | 3300025932 | Bacteria | 787 |
| 386 | Ga0207706_10019204 | 3300025933 | Bacteria | 6146 |
| 387 | Ga0207706_10053851 | 3300025933 | Bacteria | 3552 |
| 388 | Ga0207706_10255294 | 3300025933 | Bacteria | 1531 |
| 389 | Ga0207686_10819032 | 3300025934 | Bacteria | 747 |
| 390 | Ga0207709_10285542 | 3300025935 | Bacteria | 1221 |
| 391 | Ga0207670_11421203 | 3300025936 | Unclassified | 589 |
| 392 | Ga0207670_11713481 | 3300025936 | Bacteria | 535 |
| 393 | Ga0207669_10040790 | 3300025937 | Bacteria | 2696 |
| 394 | Ga0207704_10476776 | 3300025938 | Bacteria | 1001 |
| 395 | Ga0207704_10521424 | 3300025938 | Unclassified | 961 |
| 396 | Ga0207665_10036946 | 3300025939 | Bacteria | 3249 |
| 397 | Ga0207665_10340854 | 3300025939 | Bacteria | 1129 |
| 398 | Ga0207665_10938475 | 3300025939 | Bacteria | 687 |
| 399 | Ga0207665_11354262 | 3300025939 | Bacteria | 567 |
| 400 | Ga0207665_11396694 | 3300025939 | Bacteria | 557 |
| 401 | Ga0207691_10066198 | 3300025940 | Bacteria | 3269 |
| 402 | Ga0207691_10079100 | 3300025940 | Unclassified | 2959 |
| 403 | Ga0207711_10265841 | 3300025941 | Bacteria | 1577 |
| 404 | Ga0207689_10007050 | 3300025942 | Bacteria | 9880 |
| 405 | Ga0207689_10581826 | 3300025942 | Bacteria | 941 |
| 406 | Ga0207661_10409730 | 3300025944 | Bacteria | 1230 |
| 407 | Ga0207712_11368901 | 3300025961 | Bacteria | 633 |
| 408 | Ga0207668_10112818 | 3300025972 | Unclassified | 2043 |
| 409 | Ga0207668_11078746 | 3300025972 | Bacteria | 719 |
| 410 | Ga0207640_10417989 | 3300025981 | Bacteria | 1096 |
| 411 | Ga0207658_10733060 | 3300025986 | Bacteria | 894 |
| 412 | Ga0207658_10980433 | 3300025986 | Unclassified | 771 |
| 413 | Ga0207677_10026042 | 3300026023 | Bacteria | 3661 |
| 414 | Ga0207639_10105939 | 3300026041 | Bacteria | 2282 |
| 415 | Ga0207678_10031904 | 3300026067 | Bacteria | 4593 |
| 416 | Ga0207678_10139592 | 3300026067 | Bacteria | 2068 |
| 417 | Ga0207708_10147770 | 3300026075 | Bacteria | 1848 |
| 418 | Ga0207708_10263372 | 3300026075 | Bacteria | 1392 |
| 419 | Ga0207708_11474352 | 3300026075 | Bacteria | 598 |
| 420 | Ga0207702_10542294 | 3300026078 | Unclassified | 1137 |
| 421 | Ga0207702_10995276 | 3300026078 | Bacteria | 832 |
| 422 | Ga0207702_11280215 | 3300026078 | Bacteria | 727 |
| 423 | Ga0207641_10023833 | 3300026088 | Bacteria | 5044 |
| 424 | Ga0207641_10277864 | 3300026088 | Bacteria | 1574 |
| 425 | Ga0207648_10009264 | 3300026089 | Bacteria | 9460 |
| 426 | Ga0207648_10037591 | 3300026089 | Bacteria | 4265 |
| 427 | Ga0207676_10625800 | 3300026095 | Bacteria | 1036 |
| 428 | Ga0207676_10950511 | 3300026095 | Bacteria | 845 |
| 429 | Ga0207674_10591420 | 3300026116 | Unclassified | 1072 |
| 430 | Ga0207675_100013837 | 3300026118 | Bacteria | 7524 |
| 431 | Ga0207675_100046797 | 3300026118 | Bacteria | 4041 |
| 432 | Ga0207683_10100309 | 3300026121 | Bacteria | 2585 |
| 433 | Ga0207683_10169191 | 3300026121 | Bacteria | 1978 |
| 434 | Ga0207698_10136964 | 3300026142 | Bacteria | 2102 |
| 435 | Ga0207698_10819419 | 3300026142 | Unclassified | 934 |
| 436 | Ga0209588_1042858 | 3300027671 | Bacteria | 1462 |
| 437 | Ga0209813_10106034 | 3300027866 | Bacteria | 962 |
| 438 | Ga0207428_10450726 | 3300027907 | Bacteria | 938 |
| 439 | Ga0207428_10463291 | 3300027907 | Bacteria | 923 |
| 440 | Ga0207428_10938687 | 3300027907 | Bacteria | 610 |
| 441 | Ga0268266_10603264 | 3300028379 | Unclassified | 1055 |
| 442 | Ga0268265_10188166 | 3300028380 | Bacteria | 1780 |
| 443 | Ga0268265_10542824 | 3300028380 | Unclassified | 1102 |
| 444 | Ga0265766_1024928 | 3300030863 | Unclassified | 510 |
| 445 | Ga0265760_10062728 | 3300031090 | Unclassified | 1131 |
| 446 | Ga0373958_0106043 | 3300034819 | Unclassified | 665 |
| 447 | Ga0373926_0043233 | 3300035083 | Bacteria | 1612 |
| 448 | Ga0373926_0105224 | 3300035083 | Bacteria | 1057 |
| 449 | Ga0373928_0076374 | 3300035084 | Unclassified | 838 |
| 450 | Ga0373944_0028444 | 3300035089 | Bacteria | 1663 |
| 451 | Ga0373944_0067261 | 3300035089 | Bacteria | 1160 |
| 452 | Ga0373923_0198581 | 3300035111 | Unclassified | 927 |
| 453 | Ga0373936_0038713 | 3300035113 | Bacteria | 1907 |
| 454 | Ga0373936_0243616 | 3300035113 | Unclassified | 802 |
| 455 | Ga0373936_0255210 | 3300035113 | Unclassified | 784 |
| 456 | Ga0373939_0056791 | 3300035114 | Unclassified | 1233 |
| 457 | Ga0373941_0208639 | 3300035115 | Bacteria | 746 |
| 458 | Ga0373945_0174761 | 3300035116 | Unclassified | 881 |
| 459 | Ga0373945_0421712 | 3300035116 | Unclassified | 587 |
| 460 | Ga0373954_0635367 | 3300035118 | Unclassified | 529 |
| 461 | Ga0373956_0217585 | 3300035119 | Unclassified | 907 |
| 462 | Ga0373960_0042344 | 3300035121 | Bacteria | 1322 |
| 463 | Ga0373960_0128896 | 3300035121 | Unclassified | 847 |
| 464 | Ga0373943_0011464 | 3300035170 | Bacteria | 3989 |
| 465 | Ga0373946_0031188 | 3300035171 | Bacteria | 2132 |
| 466 | Ga0373946_0064428 | 3300035171 | Bacteria | 1567 |
| 467 | Ga0373955_0073988 | 3300035172 | Bacteria | 1911 |
| 468 | Ga0373931_0199159 | 3300035691 | Bacteria | 1195 |
| 469 | Ga0373931_0213772 | 3300035691 | Bacteria | 1158 |
| 470 | Ga0373935_0082821 | 3300035692 | Bacteria | 2087 |
| 471 | Ga0373935_0118621 | 3300035692 | Bacteria | 1765 |
| 472 | Ga0373927_0084446 | 3300035695 | Bacteria | 2059 |
| 473 | Ga0373927_0137977 | 3300035695 | Bacteria | 1594 |
| 474 | Ga0373927_0670210 | 3300035695 | Unclassified | 685 |
| 475 | Ga0373947_0036818 | 3300035725 | Bacteria | 2902 |
| 476 | Ga0373947_0060402 | 3300035725 | Bacteria | 2301 |
| 477 | Ga0373947_0139526 | 3300035725 | Bacteria | 1554 |
| 478 | Ga0373947_0163619 | 3300035725 | Bacteria | 1440 |
| 479 | Ga0373937_0502873 | 3300036401 | Bacteria | 1151 |
| 480 | Ga0373925_0032932 | 3300037068 | Bacteria | 3817 |
| 481 | Ga0373925_0262751 | 3300037068 | Bacteria | 1387 |
| 482 | Ga0373925_0339501 | 3300037068 | Bacteria | 1218 |
| 483 | Ga0373925_1456352 | 3300037068 | Bacteria | 561 |
| 484 | Ga0373925_1500860 | 3300037068 | Bacteria | 551 |
| 485 | Ga0395899_0445565 | 3300037312 | Bacteria | 849 |
| 486 | Ga0395900_0033259 | 3300037418 | Bacteria | 5308 |
| 487 | Ga0395898_0227433 | 3300037466 | Bacteria | 1779 |
| 488 | Ga0436364_0130205 | 3300037853 | Unclassified | 706 |
| 489 | Ga0436364_0455480 | 3300037853 | Bacteria | 1218 |
| 490 | Ga0436364_1473917 | 3300037853 | Bacteria | 1585 |
| 491 | Ga0395901_0076997 | 3300038443 | Bacteria | 3481 |
| 492 | Ga0436365_0570744 | 3300039437 | Bacteria | 1352 |
| 493 | Ga0436361_0136579 | 3300039447 | Bacteria | 1423 |
| 494 | Ga0436361_0393863 | 3300039447 | Bacteria | 3169 |
| 495 | Ga0436361_0664153 | 3300039447 | Bacteria | 1781 |
| 496 | Ga0436363_0534351 | 3300039450 | Unclassified | 544 |
| 497 | Ga0436363_1444669 | 3300039450 | Bacteria | 1990 |
| 498 | Ga0436362_0339453 | 3300039453 | Bacteria | 729 |
| 499 | Ga0451798_0335678 | 3300041458 | Bacteria | 1009 |
| 500 | Ga0451798_0894894 | 3300041458 | Bacteria | 686 |
| 501 | Ga0451855_1305352 | 3300041511 | Unclassified | 512 |
| 502 | Ga0495617_038478 | 3300046452 | Bacteria | 1600 |
| 503 | Ga0495627_059643 | 3300046453 | Unclassified | 1132 |
| 504 | Ga0495627_125542 | 3300046453 | Unclassified | 723 |
| 505 | Ga0495603_0066454 | 3300046455 | Bacteria | 2123 |
| 506 | Ga0495603_0167209 | 3300046455 | Bacteria | 1274 |
| 507 | Ga0495590_0429765 | 3300046457 | Unclassified | 509 |
| 508 | Ga0495591_048624 | 3300046458 | Unclassified | 1169 |
| 509 | Ga0495629_0035675 | 3300046459 | Bacteria | 3514 |
| 510 | Ga0495629_0043791 | 3300046459 | Bacteria | 3143 |
| 511 | Ga0495629_0081757 | 3300046459 | Bacteria | 2255 |
| 512 | Ga0495629_0124602 | 3300046459 | Bacteria | 1795 |
| 513 | Ga0495629_0271400 | 3300046459 | Unclassified | 1165 |
| 514 | Ga0495629_0802591 | 3300046459 | Unclassified | 621 |
| 515 | Ga0495638_0022603 | 3300046460 | Bacteria | 4127 |
| 516 | Ga0495653_0161513 | 3300046463 | Bacteria | 1555 |
| 517 | Ga0495580_0654799 | 3300046472 | Unclassified | 690 |
| 518 | Ga0495639_0054466 | 3300046475 | Unclassified | 1823 |
| 519 | Ga0495662_0166335 | 3300046476 | Bacteria | 1087 |
| 520 | Ga0495662_0399627 | 3300046476 | Unclassified | 675 |
| 521 | Ga0495584_0009320 | 3300046491 | Bacteria | 5057 |
| 522 | Ga0495584_0124494 | 3300046491 | Unclassified | 1306 |
| 523 | Ga0495584_0186355 | 3300046491 | Unclassified | 1054 |
| 524 | Ga0495585_0041635 | 3300046492 | Bacteria | 2576 |
| 525 | Ga0495585_0190493 | 3300046492 | Bacteria | 1049 |
| 526 | Ga0495585_0250009 | 3300046492 | Unclassified | 885 |
| 527 | Ga0495594_0102317 | 3300046499 | Bacteria | 1611 |
| 528 | Ga0495594_0528553 | 3300046499 | Unclassified | 669 |
| 529 | Ga0495594_0691601 | 3300046499 | Unclassified | 577 |
| 530 | Ga0495596_0039117 | 3300046500 | Bacteria | 1874 |
| 531 | Ga0495607_0395560 | 3300046501 | Unclassified | 629 |
| 532 | Ga0495583_0390121 | 3300046506 | Unclassified | 547 |
| 533 | Ga0495606_0283027 | 3300046507 | Unclassified | 906 |
| 534 | Ga0495608_0062828 | 3300046511 | Bacteria | 2439 |
| 535 | Ga0495610_0249085 | 3300046512 | Bacteria | 705 |
| 536 | Ga0495616_0026655 | 3300046513 | Bacteria | 3073 |
| 537 | Ga0495616_0028735 | 3300046513 | Bacteria | 2941 |
| 538 | Ga0495618_0025650 | 3300046514 | Bacteria | 3659 |
| 539 | Ga0495620_0248352 | 3300046515 | Unclassified | 678 |
| 540 | Ga0495628_0571158 | 3300046516 | Unclassified | 810 |
| 541 | Ga0495628_0594921 | 3300046516 | Bacteria | 790 |
| 542 | Ga0495628_1016061 | 3300046516 | Unclassified | 570 |
| 543 | Ga0495630_0104869 | 3300046517 | Bacteria | 2140 |
| 544 | Ga0495631_0118505 | 3300046518 | Bacteria | 1138 |
| 545 | Ga0495632_0146783 | 3300046519 | Bacteria | 1092 |
| 546 | Ga0495637_0038718 | 3300046520 | Bacteria | 2063 |
| 547 | Ga0495637_0174619 | 3300046520 | Unclassified | 800 |
| 548 | Ga0495637_0241336 | 3300046520 | Unclassified | 652 |
| 549 | Ga0495644_0043123 | 3300046523 | Bacteria | 1698 |
| 550 | Ga0495648_0506372 | 3300046524 | Unclassified | 517 |
| 551 | Ga0495663_0205145 | 3300046525 | Unclassified | 689 |
| 552 | Ga0495666_0240630 | 3300046526 | Unclassified | 826 |
| 553 | Ga0495642_0400698 | 3300046528 | Unclassified | 605 |
| 554 | Ga0495642_0476056 | 3300046528 | Unclassified | 552 |
| 555 | Ga0495652_0762871 | 3300046529 | Unclassified | 646 |
| 556 | Ga0495652_0790651 | 3300046529 | Bacteria | 632 |
| 557 | Ga0495665_0310028 | 3300046531 | Bacteria | 807 |
| 558 | Ga0495640_0123472 | 3300046533 | Bacteria | 1681 |
| 559 | Ga0495640_0139880 | 3300046533 | Bacteria | 1561 |
| 560 | Ga0495586_0471821 | 3300046535 | Unclassified | 724 |
| 561 | Ga0495598_0010304 | 3300046537 | Bacteria | 2236 |
| 562 | Ga0495598_0017257 | 3300046537 | Unclassified | 1858 |
| 563 | Ga0495609_0095672 | 3300046538 | Bacteria | 1289 |
| 564 | Ga0495609_0243053 | 3300046538 | Unclassified | 742 |
| 565 | Ga0495621_0185335 | 3300046539 | Unclassified | 832 |
| 566 | Ga0495597_0143210 | 3300046542 | Unclassified | 985 |
| 567 | Ga0495645_0281890 | 3300046543 | Bacteria | 1092 |
| 568 | Ga0495633_0058444 | 3300046558 | Bacteria | 1810 |
| 569 | Ga0495633_0075711 | 3300046558 | Bacteria | 1567 |
| 570 | Ga0495633_0211275 | 3300046558 | Unclassified | 889 |
| 571 | Ga0495633_0408322 | 3300046558 | Bacteria | 614 |
| 572 | Ga0495667_0337257 | 3300046559 | Unclassified | 953 |
| 573 | Ga0495667_1028887 | 3300046559 | Unclassified | 502 |
| 574 | Ga0495656_0119896 | 3300046615 | Unclassified | 1240 |
| 575 | Ga0495656_0127217 | 3300046615 | Bacteria | 1209 |
| 576 | Ga0495656_0231333 | 3300046615 | Bacteria | 927 |
| 577 | Ga0495668_0164011 | 3300046616 | Bacteria | 1217 |
| 578 | Ga0495634_0343018 | 3300046642 | Bacteria | 896 |
| 579 | Ga0495611_0116533 | 3300046648 | Unclassified | 1245 |
| 580 | Ga0495611_0252210 | 3300046648 | Unclassified | 818 |
| 581 | Ga0495625_0242043 | 3300046660 | Unclassified | 1174 |
| 582 | Ga0495625_0354669 | 3300046660 | Unclassified | 926 |
| 583 | Ga0495635_0122933 | 3300046663 | Unclassified | 1770 |
| 584 | Ga0495635_0559655 | 3300046663 | Unclassified | 749 |
| 585 | Ga0495659_0076163 | 3300046664 | Unclassified | 1265 |
| 586 | Ga0495659_0412984 | 3300046664 | Unclassified | 584 |
| 587 | Ga0495599_0095535 | 3300046678 | Bacteria | 1854 |
| 588 | Ga0495599_0210619 | 3300046678 | Unclassified | 1192 |
| 589 | Ga0495623_0255186 | 3300046679 | Unclassified | 984 |
| 590 | Ga0495646_0175699 | 3300046680 | Unclassified | 1178 |
| 591 | Ga0495647_0008405 | 3300046681 | Bacteria | 3470 |
| 592 | Ga0495658_0112460 | 3300046683 | Bacteria | 1638 |
| 593 | Ga0495658_0282871 | 3300046683 | Unclassified | 1047 |
| 594 | Ga0495669_0053743 | 3300046684 | Bacteria | 1812 |
| 595 | Ga0495669_0131197 | 3300046684 | Unclassified | 1179 |
| 596 | Ga0495669_0167702 | 3300046684 | Bacteria | 1044 |
| 597 | Ga0495669_0170172 | 3300046684 | Unclassified | 1036 |
| 598 | Ga0495613_0102427 | 3300046689 | Bacteria | 2067 |
| 599 | Ga0495613_0307028 | 3300046689 | Unclassified | 1097 |
| 600 | Ga0495613_0774292 | 3300046689 | Unclassified | 627 |
| 601 | Ga0495624_0114140 | 3300046690 | Bacteria | 1660 |
| 602 | Ga0495624_0804938 | 3300046690 | Unclassified | 555 |
| 603 | Ga0495670_0184118 | 3300046691 | Bacteria | 1103 |
| 604 | Ga0495670_0336396 | 3300046691 | Unclassified | 811 |
| 605 | Ga0495671_0217896 | 3300046692 | Bacteria | 924 |
| 606 | Ga0495649_0140567 | 3300046694 | Unclassified | 1271 |
| 607 | Ga0495649_0179154 | 3300046694 | Unclassified | 1106 |
| 608 | Ga0495589_0057749 | 3300046794 | Bacteria | 1908 |
| 609 | Ga0495660_0098305 | 3300046810 | Unclassified | 1510 |
| 610 | Ga0495581_0111882 | 3300047315 | Unclassified | 1588 |
| 611 | Ga0495581_0241406 | 3300047315 | Bacteria | 1056 |
| 612 | Ga0495604_0350610 | 3300047317 | Unclassified | 981 |
| 613 | Ga0495674_0046376 | 3300047319 | Bacteria | 3857 |
| 614 | Ga0495674_0177442 | 3300047319 | Bacteria | 1775 |
| 615 | Ga0495674_0299228 | 3300047319 | Bacteria | 1314 |
| 616 | Ga0495672_0086989 | 3300047320 | Bacteria | 1727 |
| 617 | Ga0495676_0073309 | 3300047321 | Bacteria | 2625 |
| 618 | Ga0495680_0112053 | 3300047322 | Bacteria | 2021 |
| 619 | Ga0495680_0196768 | 3300047322 | Bacteria | 1448 |
| 620 | Ga0495677_0024394 | 3300047445 | Bacteria | 2193 |
| 621 | Ga0495677_0193927 | 3300047445 | Unclassified | 789 |
| 622 | Ga0495679_073765 | 3300047446 | Bacteria | 978 |
| 623 | Ga0495673_0223815 | 3300047469 | Unclassified | 695 |
| 624 | Ga0495681_0195869 | 3300047470 | Unclassified | 822 |
| 625 | Ga0495684_0329125 | 3300047471 | Unclassified | 1090 |
| 626 | Ga0495686_0516199 | 3300047472 | Unclassified | 627 |
| 627 | Ga0495602_0410245 | 3300048088 | Bacteria | 964 |
| 628 | Ga0495615_0075505 | 3300048090 | Unclassified | 916 |
| 629 | Ga0495626_0030220 | 3300048091 | Bacteria | 2614 |
| 630 | Ga0496100_0058339 | 3300048903 | Bacteria | 2532 |
| 631 | Ga0496100_0087223 | 3300048903 | Unclassified | 2121 |
| 632 | Ga0496100_0115981 | 3300048903 | Bacteria | 1868 |
| 633 | Ga0496100_0160958 | 3300048903 | Bacteria | 1609 |
| 634 | Ga0496100_0310618 | 3300048903 | Bacteria | 1182 |
| 635 | Ga0496101_0006724 | 3300048904 | Bacteria | 7417 |
| 636 | Ga0496101_0090268 | 3300048904 | Bacteria | 2278 |
| 637 | Ga0496101_0228373 | 3300048904 | Bacteria | 1446 |
| 638 | Ga0496101_0258627 | 3300048904 | Bacteria | 1357 |
| 639 | Ga0496101_0285117 | 3300048904 | Bacteria | 1291 |
| 640 | Ga0496101_1428651 | 3300048904 | Unclassified | 539 |
| 641 | Ga0496102_0038319 | 3300048905 | Bacteria | 4325 |
| 642 | Ga0496102_0041461 | 3300048905 | Bacteria | 4168 |
| 643 | Ga0496102_0318810 | 3300048905 | Bacteria | 1464 |
| 644 | Ga0496102_0544406 | 3300048905 | Unclassified | 1083 |
| 645 | Ga0496103_0010647 | 3300048906 | Bacteria | 5441 |
| 646 | Ga0496103_0023086 | 3300048906 | Bacteria | 3750 |
| 647 | Ga0496103_0031270 | 3300048906 | Bacteria | 3242 |
| 648 | Ga0496103_0743595 | 3300048906 | Unclassified | 620 |
| 649 | Ga0496104_0001137 | 3300048907 | Bacteria | 22780 |
| 650 | Ga0496104_0010505 | 3300048907 | Bacteria | 8271 |
| 651 | Ga0496104_0021805 | 3300048907 | Bacteria | 5884 |
| 652 | Ga0496104_0064657 | 3300048907 | Bacteria | 3470 |
| 653 | Ga0496104_0064904 | 3300048907 | Bacteria | 3463 |
| 654 | Ga0496104_0085402 | 3300048907 | Bacteria | 3012 |
| 655 | Ga0496104_0134091 | 3300048907 | Unclassified | 2379 |
| 656 | Ga0496105_0011037 | 3300048908 | Bacteria | 7121 |
| 657 | Ga0496105_0030976 | 3300048908 | Bacteria | 4385 |
| 658 | Ga0496105_0122680 | 3300048908 | Unclassified | 2142 |
| 659 | Ga0496105_0226026 | 3300048908 | Bacteria | 1522 |
| 660 | Ga0496105_0322248 | 3300048908 | Bacteria | 1238 |
| 661 | Ga0496105_0324484 | 3300048908 | Bacteria | 1233 |
| 662 | Ga0496105_0654795 | 3300048908 | Unclassified | 810 |
| 663 | Ga0496106_0001821 | 3300048909 | Bacteria | 15941 |
| 664 | Ga0496106_0033337 | 3300048909 | Bacteria | 3842 |
| 665 | Ga0496106_0173654 | 3300048909 | Bacteria | 1709 |
| 666 | Ga0496106_0388893 | 3300048909 | Unclassified | 1121 |
| 667 | Ga0496106_0400258 | 3300048909 | Unclassified | 1103 |
| 668 | Ga0496107_0000115 | 3300048910 | Bacteria | 39165 |
| 669 | Ga0496107_0016920 | 3300048910 | Bacteria | 5126 |
| 670 | Ga0496107_0350201 | 3300048910 | Bacteria | 1099 |
| 671 | Ga0496107_0620438 | 3300048910 | Unclassified | 798 |
| 672 | Ga0496108_0017532 | 3300048911 | Bacteria | 5859 |
| 673 | Ga0496108_0026124 | 3300048911 | Bacteria | 4816 |
| 674 | Ga0496108_0155991 | 3300048911 | Bacteria | 1971 |
| 675 | Ga0496108_0271517 | 3300048911 | Bacteria | 1476 |
| 676 | Ga0496109_0009939 | 3300048912 | Bacteria | 8125 |
| 677 | Ga0496109_0058956 | 3300048912 | Bacteria | 3507 |
| 678 | Ga0496109_0059010 | 3300048912 | Bacteria | 3505 |
| 679 | Ga0496109_0084186 | 3300048912 | Bacteria | 2933 |
| 680 | Ga0496109_0359979 | 3300048912 | Bacteria | 1374 |
| 681 | Ga0496109_0392953 | 3300048912 | Bacteria | 1310 |
| 682 | Ga0496109_0404603 | 3300048912 | Bacteria | 1289 |
| 683 | Ga0496109_0713515 | 3300048912 | Unclassified | 940 |
| 684 | Ga0496109_1001923 | 3300048912 | Bacteria | 773 |
| 685 | Ga0496110_0014221 | 3300048913 | Bacteria | 6603 |
| 686 | Ga0496110_0023369 | 3300048913 | Bacteria | 5256 |
| 687 | Ga0496110_0041979 | 3300048913 | Bacteria | 3992 |
| 688 | Ga0496110_0043500 | 3300048913 | Bacteria | 3921 |
| 689 | Ga0496110_0088919 | 3300048913 | Bacteria | 2760 |
| 690 | Ga0496110_0131962 | 3300048913 | Bacteria | 2256 |
| 691 | Ga0496110_0207126 | 3300048913 | Bacteria | 1782 |
| 692 | Ga0496111_0005061 | 3300048914 | Bacteria | 8389 |
| 693 | Ga0496111_0024764 | 3300048914 | Bacteria | 4232 |
| 694 | Ga0496111_0029655 | 3300048914 | Bacteria | 3886 |
| 695 | Ga0496111_0237391 | 3300048914 | Bacteria | 1354 |
| 696 | Ga0496111_0502320 | 3300048914 | Bacteria | 892 |
| 697 | Ga0496111_1284080 | 3300048914 | Unclassified | 516 |
| 698 | Ga0496112_0017010 | 3300048915 | Bacteria | 6825 |
| 699 | Ga0496112_0061374 | 3300048915 | Bacteria | 3705 |
| 700 | Ga0496112_0101532 | 3300048915 | Unclassified | 2846 |
| 701 | Ga0496112_0185398 | 3300048915 | Bacteria | 2044 |
| 702 | Ga0496112_0186155 | 3300048915 | Unclassified | 2039 |
| 703 | Ga0496112_0729109 | 3300048915 | Unclassified | 918 |
| 704 | Ga0496112_0895506 | 3300048915 | Bacteria | 809 |
| 705 | Ga0496113_0050802 | 3300048916 | Bacteria | 3092 |
| 706 | Ga0496113_0063573 | 3300048916 | Unclassified | 2789 |
| 707 | Ga0496113_0150341 | 3300048916 | Bacteria | 1836 |
| 708 | Ga0496113_0204987 | 3300048916 | Bacteria | 1568 |
| 709 | Ga0496113_0225737 | 3300048916 | Bacteria | 1493 |
| 710 | Ga0496113_0273744 | 3300048916 | Bacteria | 1349 |
| 711 | Ga0496113_0774390 | 3300048916 | Bacteria | 763 |
| 712 | Ga0496114_0053828 | 3300048917 | Bacteria | 3355 |
| 713 | Ga0496114_0092794 | 3300048917 | Bacteria | 2565 |
| 714 | Ga0496114_0103366 | 3300048917 | Bacteria | 2435 |
| 715 | Ga0496114_0399710 | 3300048917 | Bacteria | 1217 |
| 716 | Ga0496114_0483648 | 3300048917 | Bacteria | 1095 |
| 717 | Ga0496115_0003331 | 3300048918 | Bacteria | 11528 |
| 718 | Ga0496115_0013780 | 3300048918 | Bacteria | 6122 |
| 719 | Ga0496115_0300558 | 3300048918 | Bacteria | 1315 |
| 720 | Ga0496115_0399424 | 3300048918 | Bacteria | 1115 |
| 721 | Ga0496115_0518448 | 3300048918 | Bacteria | 956 |
| 722 | Ga0495678_127153 | 3300049459 | Bacteria | 849 |
| 723 | Ga0495678_130160 | 3300049459 | Unclassified | 835 |
| 724 | Ga0501031_0432134 | 3300049568 | Bacteria | 851 |
| 725 | Ga0501036_0639409 | 3300049572 | Unclassified | 881 |
| 726 | Ga0501036_0823475 | 3300049572 | Unclassified | 764 |
| 727 | Ga0501039_1084087 | 3300049575 | Bacteria | 621 |
| 728 | Ga0501040_0324137 | 3300049576 | Unclassified | 1102 |
| 729 | Ga0501041_0416146 | 3300049577 | Bacteria | 852 |
| 730 | Ga0501041_0489046 | 3300049577 | Bacteria | 782 |
| 731 | Ga0501042_0169170 | 3300049578 | Bacteria | 1577 |
| 732 | Ga0501042_0371225 | 3300049578 | Bacteria | 1035 |
| 733 | Ga0501043_0738719 | 3300049579 | Unclassified | 716 |
| 734 | Ga0501048_0275536 | 3300049582 | Bacteria | 1196 |
| 735 | Ga0501048_0848219 | 3300049582 | Bacteria | 657 |
| 736 | Ga0501067_0351860 | 3300049583 | Bacteria | 821 |
| 737 | Ga0501069_0225263 | 3300049585 | Unclassified | 1091 |
| 738 | Ga0501071_0688983 | 3300049587 | Unclassified | 787 |
| 739 | Ga0501072_0070451 | 3300049588 | Bacteria | 2762 |
| 740 | Ga0501073_0077377 | 3300049589 | Bacteria | 2315 |
| 741 | Ga0501075_0283169 | 3300049591 | Unclassified | 1263 |
| 742 | Ga0501075_0698955 | 3300049591 | Bacteria | 772 |
| 743 | Ga0501076_0238725 | 3300049592 | Bacteria | 1487 |
| 744 | Ga0501077_0053295 | 3300049593 | Bacteria | 2568 |
| 745 | Ga0501077_0174442 | 3300049593 | Bacteria | 1366 |
| 746 | Ga0501079_0120330 | 3300049741 | Bacteria | 2042 |
| 747 | Ga0501079_0209021 | 3300049741 | Bacteria | 1524 |
| 748 | Ga0501079_0511444 | 3300049741 | Unclassified | 944 |
| 749 | Ga0501081_0033583 | 3300049743 | Bacteria | 3487 |
| 750 | Ga0501035_0408914 | 3300049822 | Bacteria | 1128 |
| 751 | Ga0501045_0448393 | 3300049824 | Bacteria | 959 |
| 752 | nmdc:mga03683_24211_c1 | 3300050489 | Unclassified | 2373 |
| 753 | nmdc:mga0yw44_115357_c1 | 3300050492 | Bacteria | 1725 |
| 754 | nmdc:mga0yw44_133375_c1 | 3300050492 | Bacteria | 1609 |
| 755 | nmdc:mga0yw44_301527_c1 | 3300050492 | Bacteria | 1074 |
| 756 | nmdc:mga0yw44_356496_c1 | 3300050492 | Unclassified | 985 |
| 757 | nmdc:mga0yw44_376011_c1 | 3300050492 | Bacteria | 959 |
| 758 | nmdc:mga0yw44_524840_c1 | 3300050492 | Unclassified | 804 |
| 759 | nmdc:mga0yw44_5895_c1 | 3300050492 | Bacteria | 5857 |
| 760 | nmdc:mga06z11_453727_c1 | 3300050494 | Bacteria | 775 |
| 761 | nmdc:mga06z11_75976_c1 | 3300050494 | Unclassified | 1790 |
| 762 | nmdc:mga04h51_125288_c1 | 3300050495 | Bacteria | 961 |
| 763 | nmdc:mga05p37_106598_c1 | 3300050507 | Bacteria | 3448 |
| 764 | nmdc:mga05p37_1217404_c1 | 3300050507 | Unclassified | 776 |
| 765 | nmdc:mga05p37_17679_c1 | 3300050507 | Bacteria | 8602 |
| 766 | nmdc:mga05p37_584980_c1 | 3300050507 | Unclassified | 1263 |
| 767 | nmdc:mga05p37_620956_c1 | 3300050507 | Unclassified | 1216 |
| 768 | nmdc:mga05p37_64591_c1 | 3300050507 | Bacteria | 4504 |
| 769 | nmdc:mga09592_663331_c1 | 3300050508 | Unclassified | 890 |
| 770 | nmdc:mga0qj67_23937_c1 | 3300050509 | Bacteria | 4703 |
| 771 | nmdc:mga0qj67_441074_c1 | 3300050509 | Bacteria | 1049 |
| 772 | nmdc:mga06r32_46443_c1 | 3300050510 | Bacteria | 4143 |
| 773 | nmdc:mga06r32_98941_c1 | 3300050510 | Bacteria | 2860 |
| 774 | nmdc:mga08y16_168639_c1 | 3300050511 | Unclassified | 2274 |
| 775 | nmdc:mga08y16_292933_c1 | 3300050511 | Bacteria | 1678 |
| 776 | nmdc:mga08y16_317064_c1 | 3300050511 | Bacteria | 1605 |
| 777 | nmdc:mga08y16_563957_c1 | 3300050511 | Bacteria | 1151 |
| 778 | nmdc:mga0n895_1242313_c1 | 3300050512 | Bacteria | 718 |
| 779 | nmdc:mga0n895_56993_c1 | 3300050512 | Bacteria | 3851 |
| 780 | nmdc:mga0n895_67029_c1 | 3300050512 | Bacteria | 3554 |
| 781 | nmdc:mga0n895_94215_c1 | 3300050512 | Bacteria | 2998 |
| 782 | nmdc:mga0n895_969895_c1 | 3300050512 | Bacteria | 833 |
| 783 | nmdc:mga0rr50_325257_c1 | 3300050513 | Bacteria | 1290 |
| 784 | nmdc:mga0rr50_440050_c1 | 3300050513 | Unclassified | 1104 |
| 785 | nmdc:mga0rr50_722946_c1 | 3300050513 | Unclassified | 850 |
| 786 | nmdc:mga08x19_202969_c1 | 3300050514 | Bacteria | 1359 |
| 787 | nmdc:mga0a205_104910_c1 | 3300050515 | Bacteria | 2725 |
| 788 | nmdc:mga0a205_134642_c1 | 3300050515 | Bacteria | 2371 |
| 789 | nmdc:mga0a205_303399_c1 | 3300050515 | Bacteria | 1469 |
| 790 | nmdc:mga0a205_528632_c1 | 3300050515 | Bacteria | 1035 |
| 791 | Ga0495601_0000792 | 3300053077 | Bacteria | 17080 |
| 792 | Ga0495601_0099724 | 3300053077 | Bacteria | 1875 |
| 793 | Ga0495601_0108130 | 3300053077 | Bacteria | 1799 |
| 794 | Ga0495601_0299295 | 3300053077 | Bacteria | 1048 |
| 795 | Ga0495601_0540158 | 3300053077 | Unclassified | 750 |
| 796 | Ga0495612_0061036 | 3300053078 | Bacteria | 1561 |
| 797 | Ga0495612_0182658 | 3300053078 | Unclassified | 922 |
| 798 | Ga0495612_0349423 | 3300053078 | Bacteria | 668 |
| 799 | Ga0495655_0048684 | 3300053083 | Unclassified | 1113 |
| 800 | Ga0495655_0315166 | 3300053083 | Unclassified | 540 |
| 801 | Ga0495595_0018932 | 3300053084 | Bacteria | 2981 |
| 802 | Ga0495595_0438150 | 3300053084 | Unclassified | 664 |
| 803 | Ga0495595_0496293 | 3300053084 | Bacteria | 622 |
| 804 | Ga0495619_0000405 | 3300053085 | Bacteria | 29348 |
| 805 | Ga0495619_0041649 | 3300053085 | Bacteria | 3005 |
| 806 | Ga0495619_0057003 | 3300053085 | Bacteria | 2592 |
| 807 | Ga0495619_0064128 | 3300053085 | Bacteria | 2449 |
| 808 | Ga0495619_0312045 | 3300053085 | Unclassified | 1089 |
| 809 | Ga0501084_0203053 | 3300054114 | Bacteria | 1673 |
| 810 | Ga0501084_0327155 | 3300054114 | Bacteria | 1294 |
| 811 | Ga0587084_063887 | 3300059477 | Bacteria | 681 |
| 812 | Ga0587084_135135 | 3300059477 | Unclassified | 530 |
| 813 | Ga0587093_042231 | 3300059478 | Bacteria | 695 |
| 814 | Ga0587066_045161 | 3300059490 | Unclassified | 846 |
| 815 | Ga0587066_071908 | 3300059490 | Unclassified | 730 |
| 816 | Ga0587066_118201 | 3300059490 | Unclassified | 623 |
| 817 | Ga0587070_114170 | 3300059491 | Unclassified | 638 |
| 818 | Ga0587073_0027664 | 3300059492 | Unclassified | 1146 |
| 819 | Ga0587073_0094524 | 3300059492 | Unclassified | 766 |
| 820 | Ga0587073_0095036 | 3300059492 | Unclassified | 764 |
| 821 | Ga0587073_0096981 | 3300059492 | Unclassified | 760 |
| 822 | Ga0587073_0119307 | 3300059492 | Unclassified | 710 |
| 823 | Ga0587073_0122555 | 3300059492 | Unclassified | 704 |
| 824 | Ga0587073_0131048 | 3300059492 | Bacteria | 688 |
| 825 | Ga0587073_0146277 | 3300059492 | Unclassified | 664 |
| 826 | Ga0587077_099027 | 3300059493 | Bacteria | 697 |
| 827 | Ga0587077_118724 | 3300059493 | Unclassified | 657 |
| 828 | Ga0587080_059595 | 3300059503 | Unclassified | 740 |
| 829 | Ga0587080_070345 | 3300059503 | Unclassified | 699 |
| 830 | Ga0587080_071007 | 3300059503 | Unclassified | 697 |
| 831 | Ga0587080_086026 | 3300059503 | Bacteria | 653 |
| 832 | Ga0587080_104183 | 3300059503 | Bacteria | 611 |
| 833 | Ga0587082_045783 | 3300059504 | Unclassified | 818 |
| 834 | Ga0587082_055749 | 3300059504 | Unclassified | 766 |
| 835 | Ga0587082_066915 | 3300059504 | Bacteria | 722 |
| 836 | Ga0587082_073293 | 3300059504 | Unclassified | 700 |
| 837 | Ga0587082_085732 | 3300059504 | Bacteria | 664 |
| 838 | Ga0587082_119109 | 3300059504 | Unclassified | 595 |
| 839 | Ga0587083_0040197 | 3300059505 | Bacteria | 976 |
| 840 | Ga0587083_0082067 | 3300059505 | Unclassified | 770 |
| 841 | Ga0587083_0100120 | 3300059505 | Unclassified | 721 |
| 842 | Ga0587083_0112535 | 3300059505 | Unclassified | 693 |
| 843 | Ga0587083_0147156 | 3300059505 | Bacteria | 633 |
| 844 | Ga0587083_0212882 | 3300059505 | Unclassified | 558 |
| 845 | Ga0587085_065341 | 3300059506 | Unclassified | 698 |
| 846 | Ga0587085_065646 | 3300059506 | Bacteria | 697 |
| 847 | Ga0587085_072447 | 3300059506 | Bacteria | 677 |
| 848 | Ga0587085_078592 | 3300059506 | Unclassified | 660 |
| 849 | Ga0587086_074093 | 3300059507 | Unclassified | 590 |
| 850 | Ga0587088_069343 | 3300059508 | Unclassified | 732 |
| 851 | Ga0587088_084380 | 3300059508 | Bacteria | 685 |
| 852 | Ga0587088_096521 | 3300059508 | Unclassified | 655 |
| 853 | Ga0587089_053869 | 3300059509 | Unclassified | 651 |
| 854 | Ga0587090_067994 | 3300059510 | Bacteria | 690 |
| 855 | Ga0587090_069028 | 3300059510 | Unclassified | 687 |
| 856 | Ga0587091_066134 | 3300059511 | Unclassified | 780 |
| 857 | Ga0587091_074002 | 3300059511 | Unclassified | 751 |
| 858 | Ga0587091_095834 | 3300059511 | Bacteria | 688 |
| 859 | Ga0587091_112798 | 3300059511 | Unclassified | 651 |
| 860 | Ga0587091_152892 | 3300059511 | Unclassified | 587 |
| 861 | Ga0587092_055579 | 3300059512 | Unclassified | 728 |
| 862 | Ga0587092_079488 | 3300059512 | Unclassified | 645 |
| 863 | Ga0587094_042332 | 3300059513 | Unclassified | 746 |
| 864 | Ga0587094_047003 | 3300059513 | Unclassified | 720 |
| 865 | Ga0587094_051832 | 3300059513 | Unclassified | 697 |
| 866 | Ga0587094_054221 | 3300059513 | Bacteria | 687 |
| 867 | Ga0587095_019193 | 3300059514 | Unclassified | 646 |
| 868 | Ga0587098_032470 | 3300059604 | Unclassified | 725 |
| 869 | Ga0587098_045310 | 3300059604 | Unclassified | 652 |
| 870 | Ga0587098_056538 | 3300059604 | Bacteria | 607 |
| 871 | Ga0587106_060486 | 3300059605 | Unclassified | 694 |
| 872 | Ga0587106_065357 | 3300059605 | Bacteria | 678 |
| 873 | Ga0587125_023244 | 3300059607 | Unclassified | 747 |
| 874 | Ga0587129_009713 | 3300059608 | Unclassified | 733 |
| 875 | Ga0587131_013113 | 3300059609 | Unclassified | 619 |
| 876 | Ga0587131_021110 | 3300059609 | Unclassified | 537 |
| 877 | Ga0587101_061101 | 3300059623 | Bacteria | 673 |
| 878 | Ga0587101_062525 | 3300059623 | Unclassified | 668 |
| 879 | Ga0587109_044525 | 3300059624 | Unclassified | 891 |
| 880 | Ga0587113_019286 | 3300059625 | Unclassified | 706 |
| 881 | Ga0587115_032494 | 3300059626 | Unclassified | 782 |
| 882 | Ga0587115_047051 | 3300059626 | Unclassified | 690 |
| 883 | Ga0587122_016673 | 3300059628 | Unclassified | 762 |
| 884 | Ga0587128_048247 | 3300059630 | Unclassified | 769 |
| 885 | Ga0587128_062330 | 3300059630 | Unclassified | 707 |
| 886 | Ga0587130_025283 | 3300059631 | Unclassified | 663 |
| 887 | Ga0587062_056057 | 3300059639 | Bacteria | 680 |
| 888 | Ga0587067_079066 | 3300059640 | Unclassified | 725 |
| 889 | Ga0587067_095184 | 3300059640 | Bacteria | 681 |
| 890 | Ga0587067_098131 | 3300059640 | Unclassified | 674 |
| 891 | Ga0587068_062747 | 3300059641 | Unclassified | 718 |
| 892 | Ga0587068_066955 | 3300059641 | Unclassified | 702 |
| 893 | Ga0587068_105271 | 3300059641 | Unclassified | 597 |
| 894 | Ga0587068_125275 | 3300059641 | Bacteria | 561 |
| 895 | Ga0587072_091479 | 3300059643 | Bacteria | 671 |
| 896 | Ga0587072_104243 | 3300059643 | Unclassified | 640 |
| 897 | Ga0587075_018284 | 3300059644 | Unclassified | 1015 |
| 898 | Ga0587075_029339 | 3300059644 | Unclassified | 867 |
| 899 | Ga0587075_037316 | 3300059644 | Unclassified | 800 |
| 900 | Ga0587075_038294 | 3300059644 | Bacteria | 793 |
| 901 | Ga0587075_056287 | 3300059644 | Unclassified | 699 |
| 902 | Ga0587076_030884 | 3300059645 | Unclassified | 949 |
| 903 | Ga0587076_081366 | 3300059645 | Bacteria | 692 |
| 904 | Ga0587076_130628 | 3300059645 | Bacteria | 591 |
| 905 | Ga0587078_013177 | 3300059646 | Bacteria | 976 |
| 906 | Ga0587078_031678 | 3300059646 | Unclassified | 715 |
| 907 | Ga0587078_043727 | 3300059646 | Unclassified | 640 |
| 908 | Ga0587078_069992 | 3300059646 | Unclassified | 546 |
| 909 | Ga0587105_005867 | 3300059651 | Unclassified | 828 |
| 910 | Ga0587105_011839 | 3300059651 | Bacteria | 678 |
| 911 | Ga0587107_037964 | 3300059652 | Unclassified | 765 |
| 912 | Ga0587107_043268 | 3300059652 | Unclassified | 736 |
| 913 | Ga0587107_072131 | 3300059652 | Unclassified | 633 |
| 914 | Ga0587107_133803 | 3300059652 | Unclassified | 523 |
| 915 | Ga0587114_044982 | 3300059655 | Unclassified | 729 |
| 916 | Ga0587114_052759 | 3300059655 | Unclassified | 693 |
| 917 | Ga0587119_035082 | 3300059658 | Unclassified | 701 |
| 918 | Ga0587119_040047 | 3300059658 | Unclassified | 669 |
| 919 | Ga0587071_091300 | 3300060344 | Unclassified | 692 |
| 920 | Ga0587071_098713 | 3300060344 | Unclassified | 673 |
| 921 | Ga0587111_0110010 | 3300060346 | Unclassified | 697 |
| 922 | Ga0501082_0657522 | 3300060353 | Unclassified | 917 |
| 923 | Ga0530510_0154161 | 3300061734 | Bacteria | 1697 |
| 924 | Ga0530510_0173502 | 3300061734 | Bacteria | 1597 |
| 925 | Ga0530510_0366515 | 3300061734 | Bacteria | 1083 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048912 | Ga0496109_0404603 | Ga0496109_0404603_335_748 | 118 |
| 2 | 3300005467 | Ga0070706_101976066 | Ga0070706_1019760661 | 121 |
| 3 | 3300005471 | Ga0070698_100462008 | Ga0070698_1004620082 | 121 |
| 4 | 3300009148 | Ga0105243_10772170 | Ga0105243_107721701 | 121 |
| 5 | 3300025910 | Ga0207684_10107883 | Ga0207684_101078836 | 121 |
| 6 | 3300025928 | Ga0207700_10816416 | Ga0207700_108164162 | 121 |
| 7 | 3300025939 | Ga0207665_10938475 | Ga0207665_109384751 | 122 |
| 8 | 3300005543 | Ga0070672_100606769 | Ga0070672_1006067693 | 123 |
| 9 | 3300005578 | Ga0068854_100495779 | Ga0068854_1004957792 | 123 |
| 10 | 3300005840 | Ga0068870_10326393 | Ga0068870_103263933 | 123 |
| 11 | 3300026095 | Ga0207676_10950511 | Ga0207676_109505111 | 123 |
| 12 | 3300004798 | Ga0058859_11832506 | Ga0058859_118325061 | 125 |
| 13 | 3300005328 | Ga0070676_10134024 | Ga0070676_101340241 | 125 |
| 14 | 3300005337 | Ga0070682_100546721 | Ga0070682_1005467212 | 125 |
| 15 | 3300005345 | Ga0070692_10719776 | Ga0070692_107197761 | 125 |
| 16 | 3300005353 | Ga0070669_100139195 | Ga0070669_1001391955 | 125 |
| 17 | 3300005354 | Ga0070675_100235398 | Ga0070675_1002353982 | 125 |
| 18 | 3300005356 | Ga0070674_100591146 | Ga0070674_1005911462 | 125 |
| 19 | 3300005364 | Ga0070673_100718001 | Ga0070673_1007180011 | 125 |
| 20 | 3300005365 | Ga0070688_100906394 | Ga0070688_1009063941 | 125 |
| 21 | 3300005438 | Ga0070701_10506565 | Ga0070701_105065651 | 125 |
| 22 | 3300005441 | Ga0070700_100140161 | Ga0070700_1001401612 | 125 |
| 23 | 3300005455 | Ga0070663_100074305 | Ga0070663_1000743051 | 125 |
| 24 | 3300005459 | Ga0068867_100505359 | Ga0068867_1005053591 | 125 |
| 25 | 3300005466 | Ga0070685_10564061 | Ga0070685_105640611 | 125 |
| 26 | 3300005547 | Ga0070693_100455422 | Ga0070693_1004554222 | 125 |
| 27 | 3300005719 | Ga0068861_100415278 | Ga0068861_1004152781 | 125 |
| 28 | 3300005843 | Ga0068860_100415553 | Ga0068860_1004155533 | 125 |
| 29 | 3300009176 | Ga0105242_12778776 | Ga0105242_127787761 | 125 |
| 30 | 3300013296 | Ga0157374_10402074 | Ga0157374_104020741 | 125 |
| 31 | 3300013297 | Ga0157378_10590715 | Ga0157378_105907151 | 125 |
| 32 | 3300013308 | Ga0157375_10184232 | Ga0157375_101842321 | 125 |
| 33 | 3300014326 | Ga0157380_10068098 | Ga0157380_100680984 | 125 |
| 34 | 3300014745 | Ga0157377_10084988 | Ga0157377_100849884 | 125 |
| 35 | 3300014969 | Ga0157376_10641105 | Ga0157376_106411051 | 125 |
| 36 | 3300017792 | Ga0163161_10261456 | Ga0163161_102614562 | 125 |
| 37 | 3300025901 | Ga0207688_10043206 | Ga0207688_100432061 | 125 |
| 38 | 3300025904 | Ga0207647_10080204 | Ga0207647_100802042 | 125 |
| 39 | 3300025907 | Ga0207645_10335667 | Ga0207645_103356672 | 125 |
| 40 | 3300025927 | Ga0207687_10695188 | Ga0207687_106951881 | 125 |
| 41 | 3300025933 | Ga0207706_10255294 | Ga0207706_102552941 | 125 |
| 42 | 3300025936 | Ga0207670_11421203 | Ga0207670_114212031 | 125 |
| 43 | 3300025938 | Ga0207704_10521424 | Ga0207704_105214241 | 125 |
| 44 | 3300025940 | Ga0207691_10079100 | Ga0207691_100791004 | 125 |
| 45 | 3300025972 | Ga0207668_10112818 | Ga0207668_101128183 | 125 |
| 46 | 3300026067 | Ga0207678_10139592 | Ga0207678_101395921 | 125 |
| 47 | 3300026075 | Ga0207708_10263372 | Ga0207708_102633721 | 125 |
| 48 | 3300026089 | Ga0207648_10037591 | Ga0207648_100375913 | 125 |
| 49 | 3300026116 | Ga0207674_10591420 | Ga0207674_105914202 | 125 |
| 50 | 3300026118 | Ga0207675_100046797 | Ga0207675_1000467974 | 125 |
| 51 | 3300026121 | Ga0207683_10169191 | Ga0207683_101691913 | 125 |
| 52 | 3300026142 | Ga0207698_10819419 | Ga0207698_108194191 | 125 |
| 53 | 3300028379 | Ga0268266_10603264 | Ga0268266_106032641 | 125 |
| 54 | 3300028380 | Ga0268265_10542824 | Ga0268265_105428241 | 125 |
| 55 | 3300034819 | Ga0373958_0106043 | Ga0373958_0106043_40_474 | 125 |
| 56 | 3300035083 | Ga0373926_0105224 | Ga0373926_0105224_332_766 | 125 |
| 57 | 3300035089 | Ga0373944_0028444 | Ga0373944_0028444_203_637 | 125 |
| 58 | 3300035114 | Ga0373939_0056791 | Ga0373939_0056791_81_515 | 125 |
| 59 | 3300035121 | Ga0373960_0128896 | Ga0373960_0128896_314_748 | 125 |
| 60 | 3300035171 | Ga0373946_0031188 | Ga0373946_0031188_1133_1567 | 125 |
| 61 | 3300035172 | Ga0373955_0073988 | Ga0373955_0073988_418_852 | 125 |
| 62 | 3300035692 | Ga0373935_0082821 | Ga0373935_0082821_1251_1685 | 125 |
| 63 | 3300037068 | Ga0373925_1500860 | Ga0373925_1500860_79_513 | 125 |
| 64 | 3300041458 | Ga0451798_0894894 | Ga0451798_0894894_15_449 | 125 |
| 65 | 3300046452 | Ga0495617_038478 | Ga0495617_038478_1090_1524 | 125 |
| 66 | 3300046453 | Ga0495627_125542 | Ga0495627_125542_116_550 | 125 |
| 67 | 3300046455 | Ga0495603_0066454 | Ga0495603_0066454_565_999 | 125 |
| 68 | 3300046459 | Ga0495629_0271400 | Ga0495629_0271400_638_1072 | 125 |
| 69 | 3300046472 | Ga0495580_0654799 | Ga0495580_0654799_173_607 | 125 |
| 70 | 3300046491 | Ga0495584_0186355 | Ga0495584_0186355_194_628 | 125 |
| 71 | 3300046492 | Ga0495585_0190493 | Ga0495585_0190493_166_600 | 125 |
| 72 | 3300046499 | Ga0495594_0102317 | Ga0495594_0102317_214_648 | 125 |
| 73 | 3300046500 | Ga0495596_0039117 | Ga0495596_0039117_1309_1743 | 125 |
| 74 | 3300046501 | Ga0495607_0395560 | Ga0495607_0395560_145_579 | 125 |
| 75 | 3300046506 | Ga0495583_0390121 | Ga0495583_0390121_41_475 | 125 |
| 76 | 3300046513 | Ga0495616_0026655 | Ga0495616_0026655_1625_2059 | 125 |
| 77 | 3300046515 | Ga0495620_0248352 | Ga0495620_0248352_74_508 | 125 |
| 78 | 3300046518 | Ga0495631_0118505 | Ga0495631_0118505_73_507 | 125 |
| 79 | 3300046519 | Ga0495632_0146783 | Ga0495632_0146783_362_796 | 125 |
| 80 | 3300046520 | Ga0495637_0241336 | Ga0495637_0241336_103_537 | 125 |
| 81 | 3300046523 | Ga0495644_0043123 | Ga0495644_0043123_1098_1532 | 125 |
| 82 | 3300046528 | Ga0495642_0476056 | Ga0495642_0476056_106_540 | 125 |
| 83 | 3300046535 | Ga0495586_0471821 | Ga0495586_0471821_167_601 | 125 |
| 84 | 3300046537 | Ga0495598_0010304 | Ga0495598_0010304_1437_1871 | 125 |
| 85 | 3300046538 | Ga0495609_0243053 | Ga0495609_0243053_22_456 | 125 |
| 86 | 3300046558 | Ga0495633_0058444 | Ga0495633_0058444_405_839 | 125 |
| 87 | 3300046615 | Ga0495656_0231333 | Ga0495656_0231333_378_812 | 125 |
| 88 | 3300046616 | Ga0495668_0164011 | Ga0495668_0164011_247_681 | 125 |
| 89 | 3300046648 | Ga0495611_0116533 | Ga0495611_0116533_273_707 | 125 |
| 90 | 3300046660 | Ga0495625_0242043 | Ga0495625_0242043_285_719 | 125 |
| 91 | 3300046684 | Ga0495669_0131197 | Ga0495669_0131197_318_752 | 125 |
| 92 | 3300046689 | Ga0495613_0774292 | Ga0495613_0774292_132_566 | 125 |
| 93 | 3300046690 | Ga0495624_0114140 | Ga0495624_0114140_1150_1584 | 125 |
| 94 | 3300046691 | Ga0495670_0184118 | Ga0495670_0184118_234_668 | 125 |
| 95 | 3300046794 | Ga0495589_0057749 | Ga0495589_0057749_1097_1531 | 125 |
| 96 | 3300046810 | Ga0495660_0098305 | Ga0495660_0098305_590_1024 | 125 |
| 97 | 3300047315 | Ga0495581_0241406 | Ga0495581_0241406_233_667 | 125 |
| 98 | 3300047445 | Ga0495677_0024394 | Ga0495677_0024394_1475_1909 | 125 |
| 99 | 3300047446 | Ga0495679_073765 | Ga0495679_073765_57_491 | 125 |
| 100 | 3300047469 | Ga0495673_0223815 | Ga0495673_0223815_206_640 | 125 |
| 101 | 3300047472 | Ga0495686_0516199 | Ga0495686_0516199_16_450 | 125 |
| 102 | 3300048091 | Ga0495626_0030220 | Ga0495626_0030220_943_1377 | 125 |
| 103 | 3300048906 | Ga0496103_0743595 | Ga0496103_0743595_112_546 | 125 |
| 104 | 3300048908 | Ga0496105_0226026 | Ga0496105_0226026_793_1188 | 125 |
| 105 | 3300048910 | Ga0496107_0350201 | Ga0496107_0350201_511_945 | 125 |
| 106 | 3300048915 | Ga0496112_0895506 | Ga0496112_0895506_300_734 | 125 |
| 107 | 3300048916 | Ga0496113_0774390 | Ga0496113_0774390_37_471 | 125 |
| 108 | 3300048917 | Ga0496114_0483648 | Ga0496114_0483648_524_958 | 125 |
| 109 | 3300049459 | Ga0495678_127153 | Ga0495678_127153_179_613 | 125 |
| 110 | 3300053078 | Ga0495612_0349423 | Ga0495612_0349423_121_555 | 125 |
| 111 | 3300053083 | Ga0495655_0048684 | Ga0495655_0048684_245_679 | 125 |
| 112 | 3300053085 | Ga0495619_0041649 | Ga0495619_0041649_278_712 | 125 |
| 113 | 3300005331 | Ga0070670_100018116 | Ga0070670_1000181161 | 126 |
| 114 | 3300005334 | Ga0068869_101838936 | Ga0068869_1018389361 | 126 |
| 115 | 3300005355 | Ga0070671_101337993 | Ga0070671_1013379931 | 126 |
| 116 | 3300005367 | Ga0070667_101023746 | Ga0070667_1010237461 | 126 |
| 117 | 3300005535 | Ga0070684_100387179 | Ga0070684_1003871791 | 126 |
| 118 | 3300005981 | Ga0081538_10017526 | Ga0081538_100175264 | 126 |
| 119 | 3300006028 | Ga0070717_10303427 | Ga0070717_103034273 | 126 |
| 120 | 3300006038 | Ga0075365_10228597 | Ga0075365_102285973 | 126 |
| 121 | 3300006847 | Ga0075431_100408046 | Ga0075431_1004080462 | 126 |
| 122 | 3300006852 | Ga0075433_10644391 | Ga0075433_106443911 | 126 |
| 123 | 3300006871 | Ga0075434_100105190 | Ga0075434_1001051904 | 126 |
| 124 | 3300009094 | Ga0111539_10085197 | Ga0111539_100851972 | 126 |
| 125 | 3300009098 | Ga0105245_11334946 | Ga0105245_113349461 | 126 |
| 126 | 3300009101 | Ga0105247_10230807 | Ga0105247_102308072 | 126 |
| 127 | 3300009147 | Ga0114129_10051640 | Ga0114129_100516403 | 126 |
| 128 | 3300009553 | Ga0105249_10378338 | Ga0105249_103783382 | 126 |
| 129 | 3300010375 | Ga0105239_10405762 | Ga0105239_104057621 | 126 |
| 130 | 3300020069 | Ga0197907_10378417 | Ga0197907_103784172 | 126 |
| 131 | 3300020070 | Ga0206356_10234046 | Ga0206356_102340461 | 126 |
| 132 | 3300020075 | Ga0206349_1200178 | Ga0206349_12001781 | 126 |
| 133 | 3300020078 | Ga0206352_10013594 | Ga0206352_100135941 | 126 |
| 134 | 3300020080 | Ga0206350_10444938 | Ga0206350_104449381 | 126 |
| 135 | 3300020081 | Ga0206354_10615845 | Ga0206354_106158451 | 126 |
| 136 | 3300022467 | Ga0224712_10179313 | Ga0224712_101793131 | 126 |
| 137 | 3300025900 | Ga0207710_10054606 | Ga0207710_100546062 | 126 |
| 138 | 3300025925 | Ga0207650_10272415 | Ga0207650_102724151 | 126 |
| 139 | 3300025927 | Ga0207687_10640293 | Ga0207687_106402932 | 126 |
| 140 | 3300025931 | Ga0207644_11390860 | Ga0207644_113908601 | 126 |
| 141 | 3300025942 | Ga0207689_10581826 | Ga0207689_105818261 | 126 |
| 142 | 3300025961 | Ga0207712_11368901 | Ga0207712_113689011 | 126 |
| 143 | 3300025981 | Ga0207640_10417989 | Ga0207640_104179891 | 126 |
| 144 | 3300025986 | Ga0207658_10733060 | Ga0207658_107330602 | 126 |
| 145 | 3300026095 | Ga0207676_10625800 | Ga0207676_106258001 | 126 |
| 146 | 3300027907 | Ga0207428_10450726 | Ga0207428_104507261 | 126 |
| 147 | 3300035691 | Ga0373931_0199159 | Ga0373931_0199159_328_762 | 126 |
| 148 | 3300035725 | Ga0373947_0139526 | Ga0373947_0139526_1058_1492 | 126 |
| 149 | 3300046476 | Ga0495662_0166335 | Ga0495662_0166335_61_495 | 126 |
| 150 | 3300046512 | Ga0495610_0249085 | Ga0495610_0249085_111_545 | 126 |
| 151 | 3300046531 | Ga0495665_0310028 | Ga0495665_0310028_153_587 | 126 |
| 152 | 3300047319 | Ga0495674_0177442 | Ga0495674_0177442_238_672 | 126 |
| 153 | 3300048903 | Ga0496100_0115981 | Ga0496100_0115981_885_1319 | 126 |
| 154 | 3300048904 | Ga0496101_0285117 | Ga0496101_0285117_464_898 | 126 |
| 155 | 3300048905 | Ga0496102_0318810 | Ga0496102_0318810_450_884 | 126 |
| 156 | 3300048906 | Ga0496103_0031270 | Ga0496103_0031270_2177_2611 | 126 |
| 157 | 3300048907 | Ga0496104_0021805 | Ga0496104_0021805_3567_4001 | 126 |
| 158 | 3300048908 | Ga0496105_0030976 | Ga0496105_0030976_1056_1490 | 126 |
| 159 | 3300048911 | Ga0496108_0017532 | Ga0496108_0017532_1063_1497 | 126 |
| 160 | 3300048912 | Ga0496109_0009939 | Ga0496109_0009939_7092_7526 | 126 |
| 161 | 3300048913 | Ga0496110_0043500 | Ga0496110_0043500_670_1104 | 126 |
| 162 | 3300048914 | Ga0496111_0005061 | Ga0496111_0005061_448_882 | 126 |
| 163 | 3300048915 | Ga0496112_0017010 | Ga0496112_0017010_5258_5692 | 126 |
| 164 | 3300048916 | Ga0496113_0050802 | Ga0496113_0050802_423_857 | 126 |
| 165 | 3300048917 | Ga0496114_0103366 | Ga0496114_0103366_1618_2052 | 126 |
| 166 | 3300048918 | Ga0496115_0013780 | Ga0496115_0013780_4076_4510 | 126 |
| 167 | 3300050492 | nmdc:mga0yw44_133375_c1 | nmdc:mga0yw44_133375_c1_533_967 | 126 |
| 168 | 3300050507 | nmdc:mga05p37_17679_c1 | nmdc:mga05p37_17679_c1_5644_6078 | 126 |
| 169 | 3300050510 | nmdc:mga06r32_46443_c1 | nmdc:mga06r32_46443_c1_441_875 | 126 |
| 170 | 3300050511 | nmdc:mga08y16_292933_c1 | nmdc:mga08y16_292933_c1_1054_1488 | 126 |
| 171 | 3300050512 | nmdc:mga0n895_67029_c1 | nmdc:mga0n895_67029_c1_1931_2365 | 126 |
| 172 | 3300050515 | nmdc:mga0a205_303399_c1 | nmdc:mga0a205_303399_c1_596_1030 | 126 |
| 173 | 3300006038 | Ga0075365_10045129 | Ga0075365_100451291 | 127 |
| 174 | 3300006178 | Ga0075367_10217031 | Ga0075367_102170311 | 127 |
| 175 | 3300025905 | Ga0207685_10640220 | Ga0207685_106402201 | 127 |
| 176 | 3300035083 | Ga0373926_0043233 | Ga0373926_0043233_728_1162 | 127 |
| 177 | 3300035089 | Ga0373944_0067261 | Ga0373944_0067261_10_444 | 127 |
| 178 | 3300035111 | Ga0373923_0198581 | Ga0373923_0198581_151_585 | 127 |
| 179 | 3300035113 | Ga0373936_0038713 | Ga0373936_0038713_221_655 | 127 |
| 180 | 3300035116 | Ga0373945_0174761 | Ga0373945_0174761_426_860 | 127 |
| 181 | 3300035170 | Ga0373943_0011464 | Ga0373943_0011464_1894_2328 | 127 |
| 182 | 3300035171 | Ga0373946_0064428 | Ga0373946_0064428_839_1273 | 127 |
| 183 | 3300035695 | Ga0373927_0084446 | Ga0373927_0084446_1062_1496 | 127 |
| 184 | 3300035725 | Ga0373947_0060402 | Ga0373947_0060402_240_674 | 127 |
| 185 | 3300037068 | Ga0373925_0032932 | Ga0373925_0032932_92_526 | 127 |
| 186 | 3300046453 | Ga0495627_059643 | Ga0495627_059643_393_827 | 127 |
| 187 | 3300046455 | Ga0495603_0167209 | Ga0495603_0167209_819_1253 | 127 |
| 188 | 3300046459 | Ga0495629_0043791 | Ga0495629_0043791_1462_1896 | 127 |
| 189 | 3300046459 | Ga0495629_0802591 | Ga0495629_0802591_81_515 | 127 |
| 190 | 3300046475 | Ga0495639_0054466 | Ga0495639_0054466_803_1237 | 127 |
| 191 | 3300046491 | Ga0495584_0124494 | Ga0495584_0124494_311_745 | 127 |
| 192 | 3300046492 | Ga0495585_0041635 | Ga0495585_0041635_933_1367 | 127 |
| 193 | 3300046499 | Ga0495594_0528553 | Ga0495594_0528553_134_568 | 127 |
| 194 | 3300046517 | Ga0495630_0104869 | Ga0495630_0104869_885_1319 | 127 |
| 195 | 3300046525 | Ga0495663_0205145 | Ga0495663_0205145_85_519 | 127 |
| 196 | 3300046533 | Ga0495640_0123472 | Ga0495640_0123472_158_592 | 127 |
| 197 | 3300046537 | Ga0495598_0017257 | Ga0495598_0017257_821_1255 | 127 |
| 198 | 3300046538 | Ga0495609_0095672 | Ga0495609_0095672_85_519 | 127 |
| 199 | 3300046539 | Ga0495621_0185335 | Ga0495621_0185335_223_657 | 127 |
| 200 | 3300046558 | Ga0495633_0211275 | Ga0495633_0211275_168_602 | 127 |
| 201 | 3300046559 | Ga0495667_1028887 | Ga0495667_1028887_50_484 | 127 |
| 202 | 3300046615 | Ga0495656_0119896 | Ga0495656_0119896_497_931 | 127 |
| 203 | 3300046660 | Ga0495625_0354669 | Ga0495625_0354669_233_667 | 127 |
| 204 | 3300046663 | Ga0495635_0559655 | Ga0495635_0559655_157_591 | 127 |
| 205 | 3300046664 | Ga0495659_0076163 | Ga0495659_0076163_327_761 | 127 |
| 206 | 3300046681 | Ga0495647_0008405 | Ga0495647_0008405_1066_1500 | 127 |
| 207 | 3300046683 | Ga0495658_0112460 | Ga0495658_0112460_151_585 | 127 |
| 208 | 3300046689 | Ga0495613_0102427 | Ga0495613_0102427_1604_2038 | 127 |
| 209 | 3300046691 | Ga0495670_0336396 | Ga0495670_0336396_272_706 | 127 |
| 210 | 3300047315 | Ga0495581_0111882 | Ga0495581_0111882_851_1285 | 127 |
| 211 | 3300047321 | Ga0495676_0073309 | Ga0495676_0073309_1631_2065 | 127 |
| 212 | 3300047445 | Ga0495677_0193927 | Ga0495677_0193927_224_658 | 127 |
| 213 | 3300047470 | Ga0495681_0195869 | Ga0495681_0195869_267_701 | 127 |
| 214 | 3300047471 | Ga0495684_0329125 | Ga0495684_0329125_336_770 | 127 |
| 215 | 3300050492 | nmdc:mga0yw44_524840_c1 | nmdc:mga0yw44_524840_c1_332_766 | 127 |
| 216 | 3300050494 | nmdc:mga06z11_75976_c1 | nmdc:mga06z11_75976_c1_787_1221 | 127 |
| 217 | 3300053083 | Ga0495655_0315166 | Ga0495655_0315166_90_524 | 127 |
| 218 | 3300053085 | Ga0495619_0057003 | Ga0495619_0057003_227_661 | 127 |
| 219 | 3300059504 | Ga0587082_045783 | Ga0587082_045783_188_622 | 127 |
| 220 | 3300059644 | Ga0587075_038294 | Ga0587075_038294_182_616 | 127 |
| 221 | 3300059645 | Ga0587076_030884 | Ga0587076_030884_127_561 | 127 |
| 222 | 3300020082 | Ga0206353_11470667 | Ga0206353_114706671 | 128 |
| 223 | 3300039447 | Ga0436361_0664153 | Ga0436361_0664153_912_1328 | 128 |
| 224 | 3300060344 | Ga0587071_091300 | Ga0587071_091300_183_611 | 129 |
| 225 | 3300059493 | Ga0587077_118724 | Ga0587077_118724_49_477 | 131 |
| 226 | 3300005983 | Ga0081540_1007072 | Ga0081540_10070729 | 132 |
| 227 | 3300006852 | Ga0075433_10602357 | Ga0075433_106023572 | 132 |
| 228 | 3300007076 | Ga0075435_100854686 | Ga0075435_1008546862 | 132 |
| 229 | 3300009147 | Ga0114129_10131074 | Ga0114129_101310744 | 132 |
| 230 | 3300048907 | Ga0496104_0010505 | Ga0496104_0010505_1557_2018 | 132 |
| 231 | 3300048908 | Ga0496105_0011037 | Ga0496105_0011037_6451_6912 | 132 |
| 232 | 3300048909 | Ga0496106_0400258 | Ga0496106_0400258_596_1057 | 132 |
| 233 | 3300048916 | Ga0496113_0204987 | Ga0496113_0204987_556_1017 | 132 |
| 234 | 3300050507 | nmdc:mga05p37_64591_c1 | nmdc:mga05p37_64591_c1_956_1354 | 132 |
| 235 | 3300050512 | nmdc:mga0n895_969895_c1 | nmdc:mga0n895_969895_c1_377_775 | 132 |
| 236 | 3300046516 | Ga0495628_1016061 | Ga0495628_1016061_37_453 | 133 |
| 237 | 3300053077 | Ga0495601_0108130 | Ga0495601_0108130_357_773 | 133 |
| 238 | 3300053085 | Ga0495619_0312045 | Ga0495619_0312045_542_958 | 133 |
| 239 | 3300009147 | Ga0114129_10343536 | Ga0114129_103435362 | 134 |
| 240 | 3300035695 | Ga0373927_0137977 | Ga0373927_0137977_477_881 | 134 |
| 241 | 3300037068 | Ga0373925_0339501 | Ga0373925_0339501_329_733 | 134 |
| 242 | 3300046459 | Ga0495629_0035675 | Ga0495629_0035675_1380_1784 | 134 |
| 243 | 3300046514 | Ga0495618_0025650 | Ga0495618_0025650_3217_3621 | 134 |
| 244 | 3300046543 | Ga0495645_0281890 | Ga0495645_0281890_628_1032 | 134 |
| 245 | 3300046558 | Ga0495633_0075711 | Ga0495633_0075711_59_463 | 134 |
| 246 | 3300046663 | Ga0495635_0122933 | Ga0495635_0122933_686_1090 | 134 |
| 247 | 3300046678 | Ga0495599_0095535 | Ga0495599_0095535_988_1392 | 134 |
| 248 | 3300046684 | Ga0495669_0167702 | Ga0495669_0167702_79_483 | 134 |
| 249 | 3300047319 | Ga0495674_0046376 | Ga0495674_0046376_2273_2677 | 134 |
| 250 | 3300047322 | Ga0495680_0112053 | Ga0495680_0112053_323_727 | 134 |
| 251 | 3300049575 | Ga0501039_1084087 | Ga0501039_1084087_73_501 | 134 |
| 252 | 3300049577 | Ga0501041_0416146 | Ga0501041_0416146_38_466 | 134 |
| 253 | 3300049578 | Ga0501042_0371225 | Ga0501042_0371225_305_733 | 134 |
| 254 | 3300049589 | Ga0501073_0077377 | Ga0501073_0077377_443_871 | 134 |
| 255 | 3300049591 | Ga0501075_0283169 | Ga0501075_0283169_386_814 | 134 |
| 256 | 3300049592 | Ga0501076_0238725 | Ga0501076_0238725_588_1016 | 134 |
| 257 | 3300049593 | Ga0501077_0174442 | Ga0501077_0174442_261_689 | 134 |
| 258 | 3300049741 | Ga0501079_0120330 | Ga0501079_0120330_894_1322 | 134 |
| 259 | 3300050507 | nmdc:mga05p37_620956_c1 | nmdc:mga05p37_620956_c1_541_951 | 134 |
| 260 | 3300053077 | Ga0495601_0000792 | Ga0495601_0000792_14048_14452 | 134 |
| 261 | 3300053085 | Ga0495619_0000405 | Ga0495619_0000405_3890_4294 | 134 |
| 262 | 3300054114 | Ga0501084_0327155 | Ga0501084_0327155_797_1225 | 134 |
| 263 | 3300061734 | Ga0530510_0366515 | Ga0530510_0366515_276_704 | 134 |
| 264 | 3300005468 | Ga0070707_100109187 | Ga0070707_1001091871 | 135 |
| 265 | 3300007265 | Ga0099794_10471596 | Ga0099794_104715961 | 135 |
| 266 | 3300019161 | Ga0184602_102655 | Ga0184602_1026551 | 135 |
| 267 | 3300025910 | Ga0207684_10267010 | Ga0207684_102670102 | 135 |
| 268 | 3300035116 | Ga0373945_0421712 | Ga0373945_0421712_22_438 | 135 |
| 269 | 3300035691 | Ga0373931_0213772 | Ga0373931_0213772_597_1013 | 135 |
| 270 | 3300035725 | Ga0373947_0163619 | Ga0373947_0163619_656_1072 | 135 |
| 271 | 3300037068 | Ga0373925_0262751 | Ga0373925_0262751_840_1256 | 135 |
| 272 | 3300037068 | Ga0373925_1456352 | Ga0373925_1456352_101_535 | 135 |
| 273 | 3300038443 | Ga0395901_0076997 | Ga0395901_0076997_1377_1790 | 135 |
| 274 | 3300005436 | Ga0070713_101547507 | Ga0070713_1015475071 | 136 |
| 275 | 3300059609 | Ga0587131_021110 | Ga0587131_021110_24_476 | 136 |
| 276 | 3300005331 | Ga0070670_100018448 | Ga0070670_1000184482 | 137 |
| 277 | 3300005335 | Ga0070666_10057607 | Ga0070666_100576076 | 137 |
| 278 | 3300005336 | Ga0070680_100812430 | Ga0070680_1008124301 | 137 |
| 279 | 3300005341 | Ga0070691_10597363 | Ga0070691_105973632 | 137 |
| 280 | 3300005353 | Ga0070669_100149900 | Ga0070669_1001499002 | 137 |
| 281 | 3300005354 | Ga0070675_100049189 | Ga0070675_1000491894 | 137 |
| 282 | 3300005355 | Ga0070671_100009476 | Ga0070671_1000094769 | 137 |
| 283 | 3300005356 | Ga0070674_101533903 | Ga0070674_1015339031 | 137 |
| 284 | 3300005365 | Ga0070688_100018344 | Ga0070688_1000183445 | 137 |
| 285 | 3300005434 | Ga0070709_10944450 | Ga0070709_109444501 | 137 |
| 286 | 3300005435 | Ga0070714_100020696 | Ga0070714_1000206965 | 137 |
| 287 | 3300005436 | Ga0070713_100962474 | Ga0070713_1009624742 | 137 |
| 288 | 3300005437 | Ga0070710_10428008 | Ga0070710_104280081 | 137 |
| 289 | 3300005439 | Ga0070711_100775950 | Ga0070711_1007759502 | 137 |
| 290 | 3300005441 | Ga0070700_100420429 | Ga0070700_1004204291 | 137 |
| 291 | 3300005457 | Ga0070662_100067984 | Ga0070662_1000679845 | 137 |
| 292 | 3300005530 | Ga0070679_100615437 | Ga0070679_1006154372 | 137 |
| 293 | 3300005614 | Ga0068856_100646029 | Ga0068856_1006460293 | 137 |
| 294 | 3300005841 | Ga0068863_100308785 | Ga0068863_1003087852 | 137 |
| 295 | 3300005843 | Ga0068860_100947404 | Ga0068860_1009474042 | 137 |
| 296 | 3300005937 | Ga0081455_10541644 | Ga0081455_105416441 | 137 |
| 297 | 3300005983 | Ga0081540_1001551 | Ga0081540_10015513 | 137 |
| 298 | 3300006038 | Ga0075365_10306378 | Ga0075365_103063781 | 137 |
| 299 | 3300006880 | Ga0075429_100344047 | Ga0075429_1003440471 | 137 |
| 300 | 3300009148 | Ga0105243_10194213 | Ga0105243_101942131 | 137 |
| 301 | 3300009174 | Ga0105241_11522126 | Ga0105241_115221261 | 137 |
| 302 | 3300009177 | Ga0105248_10534073 | Ga0105248_105340732 | 137 |
| 303 | 3300013059 | Ga0154012_140635 | Ga0154012_1406351 | 137 |
| 304 | 3300013296 | Ga0157374_10643125 | Ga0157374_106431252 | 137 |
| 305 | 3300013297 | Ga0157378_10942317 | Ga0157378_109423173 | 137 |
| 306 | 3300013307 | Ga0157372_11606258 | Ga0157372_116062581 | 137 |
| 307 | 3300014325 | Ga0163163_10040709 | Ga0163163_100407094 | 137 |
| 308 | 3300020069 | Ga0197907_10436085 | Ga0197907_104360852 | 137 |
| 309 | 3300020078 | Ga0206352_10517138 | Ga0206352_105171381 | 137 |
| 310 | 3300020080 | Ga0206350_11521557 | Ga0206350_115215573 | 137 |
| 311 | 3300025903 | Ga0207680_10117441 | Ga0207680_101174412 | 137 |
| 312 | 3300025906 | Ga0207699_10742264 | Ga0207699_107422641 | 137 |
| 313 | 3300025921 | Ga0207652_11317848 | Ga0207652_113178481 | 137 |
| 314 | 3300025923 | Ga0207681_10111477 | Ga0207681_101114773 | 137 |
| 315 | 3300025925 | Ga0207650_10011646 | Ga0207650_100116469 | 137 |
| 316 | 3300025926 | Ga0207659_10050312 | Ga0207659_100503124 | 137 |
| 317 | 3300025928 | Ga0207700_10057402 | Ga0207700_100574022 | 137 |
| 318 | 3300025929 | Ga0207664_10042402 | Ga0207664_100424026 | 137 |
| 319 | 3300025931 | Ga0207644_10037382 | Ga0207644_100373821 | 137 |
| 320 | 3300025933 | Ga0207706_10053851 | Ga0207706_100538514 | 137 |
| 321 | 3300025936 | Ga0207670_11713481 | Ga0207670_117134811 | 137 |
| 322 | 3300025939 | Ga0207665_10340854 | Ga0207665_103408542 | 137 |
| 323 | 3300026075 | Ga0207708_11474352 | Ga0207708_114743521 | 137 |
| 324 | 3300026078 | Ga0207702_10995276 | Ga0207702_109952762 | 137 |
| 325 | 3300026088 | Ga0207641_10277864 | Ga0207641_102778642 | 137 |
| 326 | 3300030863 | Ga0265766_1024928 | Ga0265766_10249281 | 137 |
| 327 | 3300048903 | Ga0496100_0310618 | Ga0496100_0310618_77_499 | 137 |
| 328 | 3300048904 | Ga0496101_0258627 | Ga0496101_0258627_782_1204 | 137 |
| 329 | 3300048912 | Ga0496109_0058956 | Ga0496109_0058956_859_1281 | 137 |
| 330 | 3300048913 | Ga0496110_0088919 | Ga0496110_0088919_2173_2595 | 137 |
| 331 | 3300048914 | Ga0496111_0237391 | Ga0496111_0237391_162_584 | 137 |
| 332 | 3300048915 | Ga0496112_0185398 | Ga0496112_0185398_844_1266 | 137 |
| 333 | 3300048916 | Ga0496113_0225737 | Ga0496113_0225737_292_714 | 137 |
| 334 | 3300048918 | Ga0496115_0300558 | Ga0496115_0300558_638_1060 | 137 |
| 335 | 3300059641 | Ga0587068_125275 | Ga0587068_125275_35_457 | 137 |
| 336 | 3300004798 | Ga0058859_11468875 | Ga0058859_114688752 | 138 |
| 337 | 3300004801 | Ga0058860_11971673 | Ga0058860_119716731 | 138 |
| 338 | 3300006028 | Ga0070717_10383847 | Ga0070717_103838472 | 138 |
| 339 | 3300009147 | Ga0114129_11497206 | Ga0114129_114972061 | 138 |
| 340 | 3300024225 | Ga0224572_1036098 | Ga0224572_10360981 | 138 |
| 341 | 3300031090 | Ga0265760_10062728 | Ga0265760_100627281 | 138 |
| 342 | 3300035118 | Ga0373954_0635367 | Ga0373954_0635367_80_505 | 138 |
| 343 | 3300035119 | Ga0373956_0217585 | Ga0373956_0217585_14_439 | 138 |
| 344 | 3300035695 | Ga0373927_0670210 | Ga0373927_0670210_94_519 | 138 |
| 345 | 3300036401 | Ga0373937_0502873 | Ga0373937_0502873_113_544 | 138 |
| 346 | 3300046459 | Ga0495629_0124602 | Ga0495629_0124602_185_610 | 138 |
| 347 | 3300046463 | Ga0495653_0161513 | Ga0495653_0161513_1056_1487 | 138 |
| 348 | 3300046476 | Ga0495662_0399627 | Ga0495662_0399627_229_654 | 138 |
| 349 | 3300046499 | Ga0495594_0691601 | Ga0495594_0691601_49_474 | 138 |
| 350 | 3300046511 | Ga0495608_0062828 | Ga0495608_0062828_1123_1554 | 138 |
| 351 | 3300046516 | Ga0495628_0571158 | Ga0495628_0571158_32_511 | 138 |
| 352 | 3300046526 | Ga0495666_0240630 | Ga0495666_0240630_231_662 | 138 |
| 353 | 3300046529 | Ga0495652_0762871 | Ga0495652_0762871_62_487 | 138 |
| 354 | 3300046559 | Ga0495667_0337257 | Ga0495667_0337257_45_476 | 138 |
| 355 | 3300046679 | Ga0495623_0255186 | Ga0495623_0255186_313_744 | 138 |
| 356 | 3300046689 | Ga0495613_0307028 | Ga0495613_0307028_192_617 | 138 |
| 357 | 3300046690 | Ga0495624_0804938 | Ga0495624_0804938_56_487 | 138 |
| 358 | 3300047322 | Ga0495680_0196768 | Ga0495680_0196768_725_1156 | 138 |
| 359 | 3300048088 | Ga0495602_0410245 | Ga0495602_0410245_146_577 | 138 |
| 360 | 3300050507 | nmdc:mga05p37_1217404_c1 | nmdc:mga05p37_1217404_c1_207_635 | 138 |
| 361 | 3300053077 | Ga0495601_0540158 | Ga0495601_0540158_51_482 | 138 |
| 362 | 3300053078 | Ga0495612_0182658 | Ga0495612_0182658_111_542 | 138 |
| 363 | 3300053084 | Ga0495595_0018932 | Ga0495595_0018932_1585_2016 | 138 |
| 364 | 3300037853 | Ga0436364_0455480 | Ga0436364_0455480_180_608 | 139 |
| 365 | 3300037853 | Ga0436364_1473917 | Ga0436364_1473917_800_1228 | 139 |
| 366 | 3300005445 | Ga0070708_100054827 | Ga0070708_1000548271 | 140 |
| 367 | 3300005467 | Ga0070706_100236050 | Ga0070706_1002360503 | 140 |
| 368 | 3300005471 | Ga0070698_100200879 | Ga0070698_1002008793 | 140 |
| 369 | 3300005518 | Ga0070699_100251049 | Ga0070699_1002510493 | 140 |
| 370 | 3300005536 | Ga0070697_100104226 | Ga0070697_1001042263 | 140 |
| 371 | 3300006028 | Ga0070717_10188478 | Ga0070717_101884782 | 140 |
| 372 | 3300006175 | Ga0070712_100589261 | Ga0070712_1005892612 | 140 |
| 373 | 3300021388 | Ga0213875_10613492 | Ga0213875_106134921 | 140 |
| 374 | 3300025910 | Ga0207684_10196637 | Ga0207684_101966372 | 140 |
| 375 | 3300025915 | Ga0207693_10163241 | Ga0207693_101632412 | 140 |
| 376 | 3300035113 | Ga0373936_0255210 | Ga0373936_0255210_212_643 | 140 |
| 377 | 3300035692 | Ga0373935_0118621 | Ga0373935_0118621_164_595 | 140 |
| 378 | 3300035725 | Ga0373947_0036818 | Ga0373947_0036818_1684_2115 | 140 |
| 379 | 3300037853 | Ga0436364_0130205 | Ga0436364_0130205_68_499 | 140 |
| 380 | 3300039437 | Ga0436365_0570744 | Ga0436365_0570744_145_576 | 140 |
| 381 | 3300046459 | Ga0495629_0081757 | Ga0495629_0081757_1081_1512 | 140 |
| 382 | 3300046533 | Ga0495640_0139880 | Ga0495640_0139880_457_888 | 140 |
| 383 | 3300046683 | Ga0495658_0282871 | Ga0495658_0282871_520_951 | 140 |
| 384 | 3300047319 | Ga0495674_0299228 | Ga0495674_0299228_211_642 | 140 |
| 385 | 3300048907 | Ga0496104_0134091 | Ga0496104_0134091_565_996 | 140 |
| 386 | 3300048909 | Ga0496106_0388893 | Ga0496106_0388893_487_918 | 140 |
| 387 | 3300048910 | Ga0496107_0620438 | Ga0496107_0620438_16_447 | 140 |
| 388 | 3300048912 | Ga0496109_0713515 | Ga0496109_0713515_129_560 | 140 |
| 389 | 3300048913 | Ga0496110_0131962 | Ga0496110_0131962_447_878 | 140 |
| 390 | 3300048914 | Ga0496111_1284080 | Ga0496111_1284080_61_492 | 140 |
| 391 | 3300048917 | Ga0496114_0053828 | Ga0496114_0053828_542_973 | 140 |
| 392 | 3300050507 | nmdc:mga05p37_584980_c1 | nmdc:mga05p37_584980_c1_94_531 | 140 |
| 393 | 3300059505 | Ga0587083_0212882 | Ga0587083_0212882_72_503 | 140 |
| 394 | 3300059652 | Ga0587107_133803 | Ga0587107_133803_73_504 | 140 |
| 395 | 3300005467 | Ga0070706_100122485 | Ga0070706_1001224851 | 141 |
| 396 | 3300005467 | Ga0070706_100331581 | Ga0070706_1003315811 | 141 |
| 397 | 3300005471 | Ga0070698_100341178 | Ga0070698_1003411782 | 141 |
| 398 | 3300005518 | Ga0070699_100534231 | Ga0070699_1005342312 | 141 |
| 399 | 3300005536 | Ga0070697_100126657 | Ga0070697_1001266572 | 141 |
| 400 | 3300005536 | Ga0070697_100639363 | Ga0070697_1006393631 | 141 |
| 401 | 3300005546 | Ga0070696_101427220 | Ga0070696_1014272201 | 141 |
| 402 | 3300006028 | Ga0070717_10469421 | Ga0070717_104694212 | 141 |
| 403 | 3300006028 | Ga0070717_10586378 | Ga0070717_105863781 | 141 |
| 404 | 3300006038 | Ga0075365_10253798 | Ga0075365_102537981 | 141 |
| 405 | 3300006844 | Ga0075428_100015732 | Ga0075428_10001573211 | 141 |
| 406 | 3300006846 | Ga0075430_100236502 | Ga0075430_1002365023 | 141 |
| 407 | 3300006847 | Ga0075431_100167687 | Ga0075431_1001676872 | 141 |
| 408 | 3300006880 | Ga0075429_100168341 | Ga0075429_1001683413 | 141 |
| 409 | 3300006914 | Ga0075436_100903018 | Ga0075436_1009030181 | 141 |
| 410 | 3300009147 | Ga0114129_10531829 | Ga0114129_105318292 | 141 |
| 411 | 3300014325 | Ga0163163_10535215 | Ga0163163_105352152 | 141 |
| 412 | 3300020610 | Ga0154015_1199851 | Ga0154015_11998511 | 141 |
| 413 | 3300021361 | Ga0213872_10210754 | Ga0213872_102107541 | 141 |
| 414 | 3300025910 | Ga0207684_10565391 | Ga0207684_105653912 | 141 |
| 415 | 3300025922 | Ga0207646_10269889 | Ga0207646_102698892 | 141 |
| 416 | 3300025928 | Ga0207700_10064917 | Ga0207700_100649173 | 141 |
| 417 | 3300027671 | Ga0209588_1042858 | Ga0209588_10428581 | 141 |
| 418 | 3300037312 | Ga0395899_0445565 | Ga0395899_0445565_244_669 | 141 |
| 419 | 3300037418 | Ga0395900_0033259 | Ga0395900_0033259_2281_2706 | 141 |
| 420 | 3300037466 | Ga0395898_0227433 | Ga0395898_0227433_387_812 | 141 |
| 421 | 3300039447 | Ga0436361_0393863 | Ga0436361_0393863_1865_2296 | 141 |
| 422 | 3300046664 | Ga0495659_0412984 | Ga0495659_0412984_108_539 | 141 |
| 423 | 3300048907 | Ga0496104_0001137 | Ga0496104_0001137_19764_20216 | 141 |
| 424 | 3300048908 | Ga0496105_0322248 | Ga0496105_0322248_747_1199 | 141 |
| 425 | 3300048911 | Ga0496108_0271517 | Ga0496108_0271517_835_1287 | 141 |
| 426 | 3300048912 | Ga0496109_0392953 | Ga0496109_0392953_285_737 | 141 |
| 427 | 3300048912 | Ga0496109_1001923 | Ga0496109_1001923_37_468 | 141 |
| 428 | 3300049572 | Ga0501036_0639409 | Ga0501036_0639409_391_843 | 141 |
| 429 | 3300050492 | nmdc:mga0yw44_356496_c1 | nmdc:mga0yw44_356496_c1_490_921 | 141 |
| 430 | 3300050507 | nmdc:mga05p37_106598_c1 | nmdc:mga05p37_106598_c1_777_1202 | 141 |
| 431 | 3300050508 | nmdc:mga09592_663331_c1 | nmdc:mga09592_663331_c1_148_573 | 141 |
| 432 | 3300050509 | nmdc:mga0qj67_441074_c1 | nmdc:mga0qj67_441074_c1_418_843 | 141 |
| 433 | 3300003160 | Ga0006779J45831_105002 | Ga0006779J45831_1050021 | 142 |
| 434 | 3300003162 | Ga0006778J45830_1025721 | Ga0006778J45830_10257211 | 142 |
| 435 | 3300003544 | Ga0007417J51691_1016276 | Ga0007417J51691_10162762 | 142 |
| 436 | 3300003559 | Ga0007427J51700_111823 | Ga0007427J51700_1118231 | 142 |
| 437 | 3300003568 | Ga0006781J51513_1011320 | Ga0006781J51513_10113201 | 142 |
| 438 | 3300003574 | Ga0007410J51695_1040494 | Ga0007410J51695_10404942 | 142 |
| 439 | 3300003575 | Ga0007409J51694_1084557 | Ga0007409J51694_10845571 | 142 |
| 440 | 3300003577 | Ga0007416J51690_1013219 | Ga0007416J51690_10132192 | 142 |
| 441 | 3300003579 | Ga0007429J51699_1024338 | Ga0007429J51699_10243381 | 142 |
| 442 | 3300003579 | Ga0007429J51699_1065486 | Ga0007429J51699_10654861 | 142 |
| 443 | 3300003579 | Ga0007429J51699_1074725 | Ga0007429J51699_10747251 | 142 |
| 444 | 3300003693 | Ga0032354_1017980 | Ga0032354_10179801 | 142 |
| 445 | 3300003693 | Ga0032354_1086103 | Ga0032354_10861031 | 142 |
| 446 | 3300003911 | JGI25405J52794_10069082 | JGI25405J52794_100690821 | 142 |
| 447 | 3300004785 | Ga0058858_1395822 | Ga0058858_13958221 | 142 |
| 448 | 3300004801 | Ga0058860_12096257 | Ga0058860_120962571 | 142 |
| 449 | 3300004803 | Ga0058862_12066838 | Ga0058862_120668382 | 142 |
| 450 | 3300005434 | Ga0070709_10082879 | Ga0070709_100828793 | 142 |
| 451 | 3300005435 | Ga0070714_100168281 | Ga0070714_1001682812 | 142 |
| 452 | 3300005435 | Ga0070714_100904232 | Ga0070714_1009042321 | 142 |
| 453 | 3300005437 | Ga0070710_10083071 | Ga0070710_100830713 | 142 |
| 454 | 3300005437 | Ga0070710_10149717 | Ga0070710_101497171 | 142 |
| 455 | 3300005439 | Ga0070711_100016144 | Ga0070711_1000161441 | 142 |
| 456 | 3300005439 | Ga0070711_100179263 | Ga0070711_1001792631 | 142 |
| 457 | 3300005445 | Ga0070708_100043659 | Ga0070708_1000436593 | 142 |
| 458 | 3300005468 | Ga0070707_100136149 | Ga0070707_1001361495 | 142 |
| 459 | 3300005468 | Ga0070707_100708605 | Ga0070707_1007086052 | 142 |
| 460 | 3300005468 | Ga0070707_101215129 | Ga0070707_1012151292 | 142 |
| 461 | 3300005468 | Ga0070707_101337567 | Ga0070707_1013375671 | 142 |
| 462 | 3300005471 | Ga0070698_100069880 | Ga0070698_1000698805 | 142 |
| 463 | 3300005471 | Ga0070698_100152669 | Ga0070698_1001526694 | 142 |
| 464 | 3300005471 | Ga0070698_100233903 | Ga0070698_1002339033 | 142 |
| 465 | 3300005471 | Ga0070698_100766110 | Ga0070698_1007661102 | 142 |
| 466 | 3300005518 | Ga0070699_100058152 | Ga0070699_1000581521 | 142 |
| 467 | 3300005539 | Ga0068853_101284691 | Ga0068853_1012846911 | 142 |
| 468 | 3300005546 | Ga0070696_100065176 | Ga0070696_1000651761 | 142 |
| 469 | 3300005937 | Ga0081455_10000369 | Ga0081455_1000036938 | 142 |
| 470 | 3300005937 | Ga0081455_10028989 | Ga0081455_100289895 | 142 |
| 471 | 3300005937 | Ga0081455_10057457 | Ga0081455_100574574 | 142 |
| 472 | 3300005937 | Ga0081455_10106478 | Ga0081455_101064782 | 142 |
| 473 | 3300005937 | Ga0081455_10151957 | Ga0081455_101519571 | 142 |
| 474 | 3300005981 | Ga0081538_10043091 | Ga0081538_100430913 | 142 |
| 475 | 3300006028 | Ga0070717_10081935 | Ga0070717_100819351 | 142 |
| 476 | 3300006028 | Ga0070717_10120438 | Ga0070717_101204381 | 142 |
| 477 | 3300006028 | Ga0070717_10191779 | Ga0070717_101917791 | 142 |
| 478 | 3300006028 | Ga0070717_10854552 | Ga0070717_108545522 | 142 |
| 479 | 3300006028 | Ga0070717_11059482 | Ga0070717_110594821 | 142 |
| 480 | 3300006038 | Ga0075365_10071606 | Ga0075365_100716064 | 142 |
| 481 | 3300006051 | Ga0075364_10050177 | Ga0075364_100501775 | 142 |
| 482 | 3300006163 | Ga0070715_10029214 | Ga0070715_100292143 | 142 |
| 483 | 3300006163 | Ga0070715_10868930 | Ga0070715_108689301 | 142 |
| 484 | 3300006173 | Ga0070716_100094027 | Ga0070716_1000940273 | 142 |
| 485 | 3300006173 | Ga0070716_101160769 | Ga0070716_1011607692 | 142 |
| 486 | 3300006175 | Ga0070712_100002439 | Ga0070712_1000024396 | 142 |
| 487 | 3300006175 | Ga0070712_100611300 | Ga0070712_1006113002 | 142 |
| 488 | 3300006175 | Ga0070712_100639843 | Ga0070712_1006398431 | 142 |
| 489 | 3300006177 | Ga0075362_10028304 | Ga0075362_100283041 | 142 |
| 490 | 3300006844 | Ga0075428_101774664 | Ga0075428_1017746641 | 142 |
| 491 | 3300006846 | Ga0075430_100034490 | Ga0075430_1000344904 | 142 |
| 492 | 3300006847 | Ga0075431_100656759 | Ga0075431_1006567592 | 142 |
| 493 | 3300006852 | Ga0075433_10250985 | Ga0075433_102509852 | 142 |
| 494 | 3300006852 | Ga0075433_10694826 | Ga0075433_106948261 | 142 |
| 495 | 3300006871 | Ga0075434_100145464 | Ga0075434_1001454643 | 142 |
| 496 | 3300006871 | Ga0075434_100975042 | Ga0075434_1009750422 | 142 |
| 497 | 3300006881 | Ga0068865_100991666 | Ga0068865_1009916661 | 142 |
| 498 | 3300006914 | Ga0075436_101278735 | Ga0075436_1012787351 | 142 |
| 499 | 3300007076 | Ga0075435_100355131 | Ga0075435_1003551312 | 142 |
| 500 | 3300007076 | Ga0075435_100909488 | Ga0075435_1009094881 | 142 |
| 501 | 3300007265 | Ga0099794_10070478 | Ga0099794_100704783 | 142 |
| 502 | 3300007788 | Ga0099795_10143175 | Ga0099795_101431751 | 142 |
| 503 | 3300009094 | Ga0111539_10289881 | Ga0111539_102898812 | 142 |
| 504 | 3300009101 | Ga0105247_10843521 | Ga0105247_108435211 | 142 |
| 505 | 3300009147 | Ga0114129_10289264 | Ga0114129_102892643 | 142 |
| 506 | 3300009553 | Ga0105249_12877806 | Ga0105249_128778061 | 142 |
| 507 | 3300013297 | Ga0157378_10438659 | Ga0157378_104386592 | 142 |
| 508 | 3300013297 | Ga0157378_11211075 | Ga0157378_112110752 | 142 |
| 509 | 3300013306 | Ga0163162_10333384 | Ga0163162_103333841 | 142 |
| 510 | 3300014968 | Ga0157379_11207434 | Ga0157379_112074341 | 142 |
| 511 | 3300014969 | Ga0157376_11168024 | Ga0157376_111680242 | 142 |
| 512 | 3300020069 | Ga0197907_10412332 | Ga0197907_104123321 | 142 |
| 513 | 3300020069 | Ga0197907_11123152 | Ga0197907_111231521 | 142 |
| 514 | 3300020070 | Ga0206356_10379118 | Ga0206356_103791181 | 142 |
| 515 | 3300020070 | Ga0206356_10790521 | Ga0206356_107905211 | 142 |
| 516 | 3300020075 | Ga0206349_1738978 | Ga0206349_17389781 | 142 |
| 517 | 3300020076 | Ga0206355_1492172 | Ga0206355_14921721 | 142 |
| 518 | 3300020076 | Ga0206355_1592198 | Ga0206355_15921981 | 142 |
| 519 | 3300020077 | Ga0206351_10277121 | Ga0206351_102771211 | 142 |
| 520 | 3300020078 | Ga0206352_11307728 | Ga0206352_113077281 | 142 |
| 521 | 3300020080 | Ga0206350_10243537 | Ga0206350_102435371 | 142 |
| 522 | 3300020080 | Ga0206350_11413227 | Ga0206350_114132271 | 142 |
| 523 | 3300020080 | Ga0206350_11522061 | Ga0206350_115220611 | 142 |
| 524 | 3300020081 | Ga0206354_10360926 | Ga0206354_103609261 | 142 |
| 525 | 3300020081 | Ga0206354_11704864 | Ga0206354_117048641 | 142 |
| 526 | 3300020082 | Ga0206353_11020452 | Ga0206353_110204521 | 142 |
| 527 | 3300021361 | Ga0213872_10010968 | Ga0213872_100109686 | 142 |
| 528 | 3300022467 | Ga0224712_10310290 | Ga0224712_103102901 | 142 |
| 529 | 3300022467 | Ga0224712_10313619 | Ga0224712_103136191 | 142 |
| 530 | 3300022467 | Ga0224712_10316245 | Ga0224712_103162451 | 142 |
| 531 | 3300025885 | Ga0207653_10078321 | Ga0207653_100783212 | 142 |
| 532 | 3300025905 | Ga0207685_10030385 | Ga0207685_100303852 | 142 |
| 533 | 3300025906 | Ga0207699_10501460 | Ga0207699_105014602 | 142 |
| 534 | 3300025915 | Ga0207693_10002798 | Ga0207693_1000279811 | 142 |
| 535 | 3300025915 | Ga0207693_10204105 | Ga0207693_102041053 | 142 |
| 536 | 3300025915 | Ga0207693_10334493 | Ga0207693_103344932 | 142 |
| 537 | 3300025916 | Ga0207663_10081200 | Ga0207663_100812003 | 142 |
| 538 | 3300025916 | Ga0207663_10311355 | Ga0207663_103113552 | 142 |
| 539 | 3300025922 | Ga0207646_10045133 | Ga0207646_100451335 | 142 |
| 540 | 3300025928 | Ga0207700_10018269 | Ga0207700_100182695 | 142 |
| 541 | 3300025928 | Ga0207700_10221903 | Ga0207700_102219031 | 142 |
| 542 | 3300025929 | Ga0207664_11314259 | Ga0207664_113142591 | 142 |
| 543 | 3300025939 | Ga0207665_10036946 | Ga0207665_100369466 | 142 |
| 544 | 3300025939 | Ga0207665_11396694 | Ga0207665_113966941 | 142 |
| 545 | 3300026078 | Ga0207702_10542294 | Ga0207702_105422941 | 142 |
| 546 | 3300027907 | Ga0207428_10938687 | Ga0207428_109386871 | 142 |
| 547 | 3300035113 | Ga0373936_0243616 | Ga0373936_0243616_278_718 | 142 |
| 548 | 3300039447 | Ga0436361_0136579 | Ga0436361_0136579_748_1176 | 142 |
| 549 | 3300039450 | Ga0436363_0534351 | Ga0436363_0534351_97_525 | 142 |
| 550 | 3300039450 | Ga0436363_1444669 | Ga0436363_1444669_594_1022 | 142 |
| 551 | 3300039453 | Ga0436362_0339453 | Ga0436362_0339453_264_692 | 142 |
| 552 | 3300046457 | Ga0495590_0429765 | Ga0495590_0429765_55_489 | 142 |
| 553 | 3300046460 | Ga0495638_0022603 | Ga0495638_0022603_2668_3102 | 142 |
| 554 | 3300046491 | Ga0495584_0009320 | Ga0495584_0009320_2521_2955 | 142 |
| 555 | 3300046492 | Ga0495585_0250009 | Ga0495585_0250009_134_568 | 142 |
| 556 | 3300046520 | Ga0495637_0174619 | Ga0495637_0174619_175_609 | 142 |
| 557 | 3300046558 | Ga0495633_0408322 | Ga0495633_0408322_111_548 | 142 |
| 558 | 3300046648 | Ga0495611_0252210 | Ga0495611_0252210_189_623 | 142 |
| 559 | 3300046684 | Ga0495669_0170172 | Ga0495669_0170172_502_936 | 142 |
| 560 | 3300046694 | Ga0495649_0140567 | Ga0495649_0140567_608_1042 | 142 |
| 561 | 3300047320 | Ga0495672_0086989 | Ga0495672_0086989_1231_1668 | 142 |
| 562 | 3300048903 | Ga0496100_0087223 | Ga0496100_0087223_366_803 | 142 |
| 563 | 3300048903 | Ga0496100_0160958 | Ga0496100_0160958_334_762 | 142 |
| 564 | 3300048904 | Ga0496101_0006724 | Ga0496101_0006724_2652_3089 | 142 |
| 565 | 3300048904 | Ga0496101_0228373 | Ga0496101_0228373_338_766 | 142 |
| 566 | 3300048905 | Ga0496102_0041461 | Ga0496102_0041461_3089_3526 | 142 |
| 567 | 3300048905 | Ga0496102_0544406 | Ga0496102_0544406_454_882 | 142 |
| 568 | 3300048906 | Ga0496103_0023086 | Ga0496103_0023086_2460_2897 | 142 |
| 569 | 3300048907 | Ga0496104_0064657 | Ga0496104_0064657_206_643 | 142 |
| 570 | 3300048907 | Ga0496104_0085402 | Ga0496104_0085402_2273_2710 | 142 |
| 571 | 3300048908 | Ga0496105_0122680 | Ga0496105_0122680_393_830 | 142 |
| 572 | 3300048908 | Ga0496105_0324484 | Ga0496105_0324484_736_1173 | 142 |
| 573 | 3300048908 | Ga0496105_0654795 | Ga0496105_0654795_170_619 | 142 |
| 574 | 3300048909 | Ga0496106_0001821 | Ga0496106_0001821_3870_4307 | 142 |
| 575 | 3300048909 | Ga0496106_0173654 | Ga0496106_0173654_563_991 | 142 |
| 576 | 3300048910 | Ga0496107_0000115 | Ga0496107_0000115_38570_39007 | 142 |
| 577 | 3300048911 | Ga0496108_0026124 | Ga0496108_0026124_910_1347 | 142 |
| 578 | 3300048912 | Ga0496109_0084186 | Ga0496109_0084186_63_500 | 142 |
| 579 | 3300048912 | Ga0496109_0359979 | Ga0496109_0359979_875_1312 | 142 |
| 580 | 3300048913 | Ga0496110_0014221 | Ga0496110_0014221_117_554 | 142 |
| 581 | 3300048913 | Ga0496110_0041979 | Ga0496110_0041979_2740_3168 | 142 |
| 582 | 3300048913 | Ga0496110_0207126 | Ga0496110_0207126_35_472 | 142 |
| 583 | 3300048914 | Ga0496111_0024764 | Ga0496111_0024764_1662_2099 | 142 |
| 584 | 3300048914 | Ga0496111_0029655 | Ga0496111_0029655_1473_1910 | 142 |
| 585 | 3300048915 | Ga0496112_0101532 | Ga0496112_0101532_945_1382 | 142 |
| 586 | 3300048915 | Ga0496112_0186155 | Ga0496112_0186155_273_710 | 142 |
| 587 | 3300048915 | Ga0496112_0729109 | Ga0496112_0729109_247_675 | 142 |
| 588 | 3300048916 | Ga0496113_0063573 | Ga0496113_0063573_1927_2364 | 142 |
| 589 | 3300048916 | Ga0496113_0150341 | Ga0496113_0150341_63_500 | 142 |
| 590 | 3300048917 | Ga0496114_0399710 | Ga0496114_0399710_587_1015 | 142 |
| 591 | 3300048918 | Ga0496115_0003331 | Ga0496115_0003331_1459_1896 | 142 |
| 592 | 3300048918 | Ga0496115_0518448 | Ga0496115_0518448_479_907 | 142 |
| 593 | 3300049582 | Ga0501048_0848219 | Ga0501048_0848219_103_537 | 142 |
| 594 | 3300049583 | Ga0501067_0351860 | Ga0501067_0351860_205_642 | 142 |
| 595 | 3300049585 | Ga0501069_0225263 | Ga0501069_0225263_421_858 | 142 |
| 596 | 3300049591 | Ga0501075_0698955 | Ga0501075_0698955_110_544 | 142 |
| 597 | 3300049741 | Ga0501079_0511444 | Ga0501079_0511444_182_616 | 142 |
| 598 | 3300049743 | Ga0501081_0033583 | Ga0501081_0033583_2404_2838 | 142 |
| 599 | 3300049824 | Ga0501045_0448393 | Ga0501045_0448393_62_496 | 142 |
| 600 | 3300050489 | nmdc:mga03683_24211_c1 | nmdc:mga03683_24211_c1_1088_1522 | 142 |
| 601 | 3300050492 | nmdc:mga0yw44_376011_c1 | nmdc:mga0yw44_376011_c1_129_563 | 142 |
| 602 | 3300050492 | nmdc:mga0yw44_5895_c1 | nmdc:mga0yw44_5895_c1_3169_3603 | 142 |
| 603 | 3300050509 | nmdc:mga0qj67_23937_c1 | nmdc:mga0qj67_23937_c1_1969_2403 | 142 |
| 604 | 3300050510 | nmdc:mga06r32_98941_c1 | nmdc:mga06r32_98941_c1_2036_2470 | 142 |
| 605 | 3300050511 | nmdc:mga08y16_317064_c1 | nmdc:mga08y16_317064_c1_1025_1459 | 142 |
| 606 | 3300050511 | nmdc:mga08y16_563957_c1 | nmdc:mga08y16_563957_c1_638_1066 | 142 |
| 607 | 3300050512 | nmdc:mga0n895_1242313_c1 | nmdc:mga0n895_1242313_c1_103_540 | 142 |
| 608 | 3300050512 | nmdc:mga0n895_56993_c1 | nmdc:mga0n895_56993_c1_2960_3388 | 142 |
| 609 | 3300050512 | nmdc:mga0n895_94215_c1 | nmdc:mga0n895_94215_c1_2083_2511 | 142 |
| 610 | 3300050513 | nmdc:mga0rr50_325257_c1 | nmdc:mga0rr50_325257_c1_598_1026 | 142 |
| 611 | 3300050513 | nmdc:mga0rr50_440050_c1 | nmdc:mga0rr50_440050_c1_176_604 | 142 |
| 612 | 3300050513 | nmdc:mga0rr50_722946_c1 | nmdc:mga0rr50_722946_c1_190_618 | 142 |
| 613 | 3300050514 | nmdc:mga08x19_202969_c1 | nmdc:mga08x19_202969_c1_107_535 | 142 |
| 614 | 3300050515 | nmdc:mga0a205_104910_c1 | nmdc:mga0a205_104910_c1_1286_1714 | 142 |
| 615 | 3300050515 | nmdc:mga0a205_134642_c1 | nmdc:mga0a205_134642_c1_738_1166 | 142 |
| 616 | 3300050515 | nmdc:mga0a205_528632_c1 | nmdc:mga0a205_528632_c1_271_705 | 142 |
| 617 | 3300053077 | Ga0495601_0299295 | Ga0495601_0299295_302_742 | 142 |
| 618 | 3300053078 | Ga0495612_0061036 | Ga0495612_0061036_67_507 | 142 |
| 619 | 3300053084 | Ga0495595_0438150 | Ga0495595_0438150_33_473 | 142 |
| 620 | 3300059477 | Ga0587084_063887 | Ga0587084_063887_165_602 | 142 |
| 621 | 3300059477 | Ga0587084_135135 | Ga0587084_135135_91_519 | 142 |
| 622 | 3300059478 | Ga0587093_042231 | Ga0587093_042231_89_526 | 142 |
| 623 | 3300059490 | Ga0587066_045161 | Ga0587066_045161_134_571 | 142 |
| 624 | 3300059490 | Ga0587066_071908 | Ga0587066_071908_190_627 | 142 |
| 625 | 3300059490 | Ga0587066_118201 | Ga0587066_118201_82_510 | 142 |
| 626 | 3300059491 | Ga0587070_114170 | Ga0587070_114170_186_614 | 142 |
| 627 | 3300059492 | Ga0587073_0027664 | Ga0587073_0027664_633_1061 | 142 |
| 628 | 3300059492 | Ga0587073_0094524 | Ga0587073_0094524_193_630 | 142 |
| 629 | 3300059492 | Ga0587073_0095036 | Ga0587073_0095036_198_626 | 142 |
| 630 | 3300059492 | Ga0587073_0119307 | Ga0587073_0119307_24_470 | 142 |
| 631 | 3300059492 | Ga0587073_0122555 | Ga0587073_0122555_195_623 | 142 |
| 632 | 3300059492 | Ga0587073_0131048 | Ga0587073_0131048_172_609 | 142 |
| 633 | 3300059492 | Ga0587073_0146277 | Ga0587073_0146277_205_642 | 142 |
| 634 | 3300059493 | Ga0587077_099027 | Ga0587077_099027_89_526 | 142 |
| 635 | 3300059503 | Ga0587080_059595 | Ga0587080_059595_193_630 | 142 |
| 636 | 3300059503 | Ga0587080_070345 | Ga0587080_070345_190_618 | 142 |
| 637 | 3300059503 | Ga0587080_086026 | Ga0587080_086026_45_482 | 142 |
| 638 | 3300059503 | Ga0587080_104183 | Ga0587080_104183_90_518 | 142 |
| 639 | 3300059504 | Ga0587082_055749 | Ga0587082_055749_194_631 | 142 |
| 640 | 3300059504 | Ga0587082_066915 | Ga0587082_066915_112_549 | 142 |
| 641 | 3300059504 | Ga0587082_073293 | Ga0587082_073293_191_619 | 142 |
| 642 | 3300059504 | Ga0587082_085732 | Ga0587082_085732_34_462 | 142 |
| 643 | 3300059504 | Ga0587082_119109 | Ga0587082_119109_130_558 | 142 |
| 644 | 3300059505 | Ga0587083_0040197 | Ga0587083_0040197_366_803 | 142 |
| 645 | 3300059505 | Ga0587083_0082067 | Ga0587083_0082067_194_631 | 142 |
| 646 | 3300059505 | Ga0587083_0112535 | Ga0587083_0112535_184_612 | 142 |
| 647 | 3300059505 | Ga0587083_0147156 | Ga0587083_0147156_177_605 | 142 |
| 648 | 3300059506 | Ga0587085_065646 | Ga0587085_065646_89_526 | 142 |
| 649 | 3300059506 | Ga0587085_072447 | Ga0587085_072447_104_532 | 142 |
| 650 | 3300059506 | Ga0587085_078592 | Ga0587085_078592_123_560 | 142 |
| 651 | 3300059507 | Ga0587086_074093 | Ga0587086_074093_149_577 | 142 |
| 652 | 3300059508 | Ga0587088_069343 | Ga0587088_069343_143_580 | 142 |
| 653 | 3300059508 | Ga0587088_084380 | Ga0587088_084380_75_512 | 142 |
| 654 | 3300059509 | Ga0587089_053869 | Ga0587089_053869_32_460 | 142 |
| 655 | 3300059510 | Ga0587090_067994 | Ga0587090_067994_82_519 | 142 |
| 656 | 3300059510 | Ga0587090_069028 | Ga0587090_069028_150_587 | 142 |
| 657 | 3300059511 | Ga0587091_066134 | Ga0587091_066134_143_580 | 142 |
| 658 | 3300059511 | Ga0587091_074002 | Ga0587091_074002_197_625 | 142 |
| 659 | 3300059511 | Ga0587091_095834 | Ga0587091_095834_172_609 | 142 |
| 660 | 3300059511 | Ga0587091_112798 | Ga0587091_112798_32_460 | 142 |
| 661 | 3300059511 | Ga0587091_152892 | Ga0587091_152892_144_572 | 142 |
| 662 | 3300059512 | Ga0587092_055579 | Ga0587092_055579_157_594 | 142 |
| 663 | 3300059512 | Ga0587092_079488 | Ga0587092_079488_184_612 | 142 |
| 664 | 3300059513 | Ga0587094_042332 | Ga0587094_042332_140_577 | 142 |
| 665 | 3300059513 | Ga0587094_047003 | Ga0587094_047003_193_621 | 142 |
| 666 | 3300059513 | Ga0587094_051832 | Ga0587094_051832_186_614 | 142 |
| 667 | 3300059513 | Ga0587094_054221 | Ga0587094_054221_162_599 | 142 |
| 668 | 3300059514 | Ga0587095_019193 | Ga0587095_019193_32_460 | 142 |
| 669 | 3300059604 | Ga0587098_032470 | Ga0587098_032470_154_591 | 142 |
| 670 | 3300059604 | Ga0587098_045310 | Ga0587098_045310_34_462 | 142 |
| 671 | 3300059604 | Ga0587098_056538 | Ga0587098_056538_151_579 | 142 |
| 672 | 3300059605 | Ga0587106_060486 | Ga0587106_060486_102_539 | 142 |
| 673 | 3300059605 | Ga0587106_065357 | Ga0587106_065357_161_598 | 142 |
| 674 | 3300059607 | Ga0587125_023244 | Ga0587125_023244_181_609 | 142 |
| 675 | 3300059608 | Ga0587129_009713 | Ga0587129_009713_115_543 | 142 |
| 676 | 3300059609 | Ga0587131_013113 | Ga0587131_013113_158_586 | 142 |
| 677 | 3300059623 | Ga0587101_061101 | Ga0587101_061101_168_605 | 142 |
| 678 | 3300059623 | Ga0587101_062525 | Ga0587101_062525_42_470 | 142 |
| 679 | 3300059624 | Ga0587109_044525 | Ga0587109_044525_153_590 | 142 |
| 680 | 3300059625 | Ga0587113_019286 | Ga0587113_019286_197_625 | 142 |
| 681 | 3300059626 | Ga0587115_032494 | Ga0587115_032494_190_627 | 142 |
| 682 | 3300059626 | Ga0587115_047051 | Ga0587115_047051_181_609 | 142 |
| 683 | 3300059628 | Ga0587122_016673 | Ga0587122_016673_190_627 | 142 |
| 684 | 3300059630 | Ga0587128_048247 | Ga0587128_048247_195_632 | 142 |
| 685 | 3300059630 | Ga0587128_062330 | Ga0587128_062330_84_512 | 142 |
| 686 | 3300059631 | Ga0587130_025283 | Ga0587130_025283_42_470 | 142 |
| 687 | 3300059639 | Ga0587062_056057 | Ga0587062_056057_73_510 | 142 |
| 688 | 3300059640 | Ga0587067_079066 | Ga0587067_079066_194_622 | 142 |
| 689 | 3300059640 | Ga0587067_095184 | Ga0587067_095184_170_607 | 142 |
| 690 | 3300059640 | Ga0587067_098131 | Ga0587067_098131_95_532 | 142 |
| 691 | 3300059641 | Ga0587068_062747 | Ga0587068_062747_126_563 | 142 |
| 692 | 3300059641 | Ga0587068_066955 | Ga0587068_066955_94_531 | 142 |
| 693 | 3300059641 | Ga0587068_105271 | Ga0587068_105271_136_564 | 142 |
| 694 | 3300059643 | Ga0587072_091479 | Ga0587072_091479_75_512 | 142 |
| 695 | 3300059643 | Ga0587072_104243 | Ga0587072_104243_31_459 | 142 |
| 696 | 3300059644 | Ga0587075_037316 | Ga0587075_037316_284_721 | 142 |
| 697 | 3300059644 | Ga0587075_056287 | Ga0587075_056287_197_649 | 142 |
| 698 | 3300059645 | Ga0587076_081366 | Ga0587076_081366_84_521 | 142 |
| 699 | 3300059645 | Ga0587076_130628 | Ga0587076_130628_32_460 | 142 |
| 700 | 3300059646 | Ga0587078_013177 | Ga0587078_013177_366_803 | 142 |
| 701 | 3300059646 | Ga0587078_043727 | Ga0587078_043727_17_445 | 142 |
| 702 | 3300059646 | Ga0587078_069992 | Ga0587078_069992_17_445 | 142 |
| 703 | 3300059651 | Ga0587105_011839 | Ga0587105_011839_167_604 | 142 |
| 704 | 3300059652 | Ga0587107_037964 | Ga0587107_037964_193_630 | 142 |
| 705 | 3300059652 | Ga0587107_043268 | Ga0587107_043268_196_624 | 142 |
| 706 | 3300059652 | Ga0587107_072131 | Ga0587107_072131_19_447 | 142 |
| 707 | 3300059655 | Ga0587114_044982 | Ga0587114_044982_192_629 | 142 |
| 708 | 3300059655 | Ga0587114_052759 | Ga0587114_052759_184_612 | 142 |
| 709 | 3300059658 | Ga0587119_035082 | Ga0587119_035082_130_567 | 142 |
| 710 | 3300059658 | Ga0587119_040047 | Ga0587119_040047_60_488 | 142 |
| 711 | 3300060344 | Ga0587071_098713 | Ga0587071_098713_77_514 | 142 |
| 712 | 3300060346 | Ga0587111_0110010 | Ga0587111_0110010_188_616 | 142 |
| 713 | 3300061734 | Ga0530510_0154161 | Ga0530510_0154161_993_1427 | 142 |
| 714 | 3300049568 | Ga0501031_0432134 | Ga0501031_0432134_267_704 | 143 |
| 715 | 3300049572 | Ga0501036_0823475 | Ga0501036_0823475_186_623 | 143 |
| 716 | 3300049576 | Ga0501040_0324137 | Ga0501040_0324137_61_498 | 143 |
| 717 | 3300049577 | Ga0501041_0489046 | Ga0501041_0489046_61_498 | 143 |
| 718 | 3300049578 | Ga0501042_0169170 | Ga0501042_0169170_500_937 | 143 |
| 719 | 3300049579 | Ga0501043_0738719 | Ga0501043_0738719_214_651 | 143 |
| 720 | 3300049582 | Ga0501048_0275536 | Ga0501048_0275536_57_494 | 143 |
| 721 | 3300049587 | Ga0501071_0688983 | Ga0501071_0688983_248_685 | 143 |
| 722 | 3300049588 | Ga0501072_0070451 | Ga0501072_0070451_1078_1515 | 143 |
| 723 | 3300049593 | Ga0501077_0053295 | Ga0501077_0053295_540_977 | 143 |
| 724 | 3300049741 | Ga0501079_0209021 | Ga0501079_0209021_55_492 | 143 |
| 725 | 3300049822 | Ga0501035_0408914 | Ga0501035_0408914_465_902 | 143 |
| 726 | 3300054114 | Ga0501084_0203053 | Ga0501084_0203053_718_1155 | 143 |
| 727 | 3300060353 | Ga0501082_0657522 | Ga0501082_0657522_194_631 | 143 |
| 728 | 3300061734 | Ga0530510_0173502 | Ga0530510_0173502_548_985 | 143 |
| 729 | 3300002155 | JGI24033J26618_1009174 | JGI24033J26618_10091741 | 144 |
| 730 | 3300003544 | Ga0007417J51691_1007401 | Ga0007417J51691_10074012 | 144 |
| 731 | 3300003559 | Ga0007427J51700_101877 | Ga0007427J51700_1018771 | 144 |
| 732 | 3300003568 | Ga0006781J51513_1002506 | Ga0006781J51513_10025061 | 144 |
| 733 | 3300003577 | Ga0007416J51690_1003489 | Ga0007416J51690_10034892 | 144 |
| 734 | 3300003579 | Ga0007429J51699_1001323 | Ga0007429J51699_10013231 | 144 |
| 735 | 3300003693 | Ga0032354_1000148 | Ga0032354_10001481 | 144 |
| 736 | 3300003735 | Ga0006780_1000018 | Ga0006780_10000182 | 144 |
| 737 | 3300004785 | Ga0058858_1018139 | Ga0058858_10181392 | 144 |
| 738 | 3300004798 | Ga0058859_10132773 | Ga0058859_101327731 | 144 |
| 739 | 3300004800 | Ga0058861_10078353 | Ga0058861_100783532 | 144 |
| 740 | 3300004803 | Ga0058862_10052381 | Ga0058862_100523811 | 144 |
| 741 | 3300005329 | Ga0070683_100359412 | Ga0070683_1003594122 | 144 |
| 742 | 3300005330 | Ga0070690_100026431 | Ga0070690_1000264311 | 144 |
| 743 | 3300005335 | Ga0070666_10044401 | Ga0070666_100444013 | 144 |
| 744 | 3300005339 | Ga0070660_100937673 | Ga0070660_1009376732 | 144 |
| 745 | 3300005340 | Ga0070689_100102269 | Ga0070689_1001022693 | 144 |
| 746 | 3300005343 | Ga0070687_100037005 | Ga0070687_1000370053 | 144 |
| 747 | 3300005344 | Ga0070661_100416323 | Ga0070661_1004163232 | 144 |
| 748 | 3300005347 | Ga0070668_100320190 | Ga0070668_1003201902 | 144 |
| 749 | 3300005353 | Ga0070669_100117314 | Ga0070669_1001173142 | 144 |
| 750 | 3300005354 | Ga0070675_100755168 | Ga0070675_1007551681 | 144 |
| 751 | 3300005355 | Ga0070671_100064152 | Ga0070671_1000641523 | 144 |
| 752 | 3300005356 | Ga0070674_100079286 | Ga0070674_1000792861 | 144 |
| 753 | 3300005364 | Ga0070673_100657716 | Ga0070673_1006577161 | 144 |
| 754 | 3300005365 | Ga0070688_100027605 | Ga0070688_1000276056 | 144 |
| 755 | 3300005366 | Ga0070659_100113034 | Ga0070659_1001130343 | 144 |
| 756 | 3300005367 | Ga0070667_101388972 | Ga0070667_1013889721 | 144 |
| 757 | 3300005436 | Ga0070713_100493046 | Ga0070713_1004930461 | 144 |
| 758 | 3300005438 | Ga0070701_10013534 | Ga0070701_100135342 | 144 |
| 759 | 3300005439 | Ga0070711_100207346 | Ga0070711_1002073463 | 144 |
| 760 | 3300005441 | Ga0070700_100014676 | Ga0070700_1000146763 | 144 |
| 761 | 3300005444 | Ga0070694_100412145 | Ga0070694_1004121452 | 144 |
| 762 | 3300005455 | Ga0070663_100035496 | Ga0070663_1000354964 | 144 |
| 763 | 3300005456 | Ga0070678_100139918 | Ga0070678_1001399183 | 144 |
| 764 | 3300005457 | Ga0070662_100278377 | Ga0070662_1002783773 | 144 |
| 765 | 3300005459 | Ga0068867_100104962 | Ga0068867_1001049624 | 144 |
| 766 | 3300005466 | Ga0070685_10369189 | Ga0070685_103691891 | 144 |
| 767 | 3300005535 | Ga0070684_100066380 | Ga0070684_1000663803 | 144 |
| 768 | 3300005539 | Ga0068853_100822949 | Ga0068853_1008229491 | 144 |
| 769 | 3300005543 | Ga0070672_100158598 | Ga0070672_1001585981 | 144 |
| 770 | 3300005544 | Ga0070686_100096914 | Ga0070686_1000969144 | 144 |
| 771 | 3300005546 | Ga0070696_101213112 | Ga0070696_1012131121 | 144 |
| 772 | 3300005547 | Ga0070693_101545512 | Ga0070693_1015455121 | 144 |
| 773 | 3300005548 | Ga0070665_100128607 | Ga0070665_1001286073 | 144 |
| 774 | 3300005548 | Ga0070665_102079851 | Ga0070665_1020798511 | 144 |
| 775 | 3300005563 | Ga0068855_100834263 | Ga0068855_1008342632 | 144 |
| 776 | 3300005564 | Ga0070664_100366081 | Ga0070664_1003660813 | 144 |
| 777 | 3300005577 | Ga0068857_100753197 | Ga0068857_1007531971 | 144 |
| 778 | 3300005578 | Ga0068854_100352165 | Ga0068854_1003521651 | 144 |
| 779 | 3300005614 | Ga0068856_100756512 | Ga0068856_1007565121 | 144 |
| 780 | 3300005615 | Ga0070702_100014870 | Ga0070702_1000148703 | 144 |
| 781 | 3300005616 | Ga0068852_100214320 | Ga0068852_1002143201 | 144 |
| 782 | 3300005618 | Ga0068864_100352638 | Ga0068864_1003526381 | 144 |
| 783 | 3300005718 | Ga0068866_10074827 | Ga0068866_100748272 | 144 |
| 784 | 3300005719 | Ga0068861_100593441 | Ga0068861_1005934412 | 144 |
| 785 | 3300005719 | Ga0068861_102063585 | Ga0068861_1020635851 | 144 |
| 786 | 3300005840 | Ga0068870_10004501 | Ga0068870_100045018 | 144 |
| 787 | 3300005843 | Ga0068860_100114443 | Ga0068860_1001144435 | 144 |
| 788 | 3300006038 | Ga0075365_10099783 | Ga0075365_100997831 | 144 |
| 789 | 3300006042 | Ga0075368_10146708 | Ga0075368_101467082 | 144 |
| 790 | 3300006051 | Ga0075364_10646212 | Ga0075364_106462121 | 144 |
| 791 | 3300006173 | Ga0070716_100159984 | Ga0070716_1001599842 | 144 |
| 792 | 3300006177 | Ga0075362_10161142 | Ga0075362_101611422 | 144 |
| 793 | 3300006178 | Ga0075367_10325693 | Ga0075367_103256931 | 144 |
| 794 | 3300006237 | Ga0097621_100236927 | Ga0097621_1002369273 | 144 |
| 795 | 3300006847 | Ga0075431_101444810 | Ga0075431_1014448101 | 144 |
| 796 | 3300006881 | Ga0068865_100049206 | Ga0068865_1000492061 | 144 |
| 797 | 3300006914 | Ga0075436_100507205 | Ga0075436_1005072051 | 144 |
| 798 | 3300009094 | Ga0111539_10293474 | Ga0111539_102934741 | 144 |
| 799 | 3300009098 | Ga0105245_10204641 | Ga0105245_102046411 | 144 |
| 800 | 3300009101 | Ga0105247_10015282 | Ga0105247_100152822 | 144 |
| 801 | 3300009148 | Ga0105243_10536808 | Ga0105243_105368081 | 144 |
| 802 | 3300009148 | Ga0105243_11241022 | Ga0105243_112410221 | 144 |
| 803 | 3300009174 | Ga0105241_10161373 | Ga0105241_101613734 | 144 |
| 804 | 3300009177 | Ga0105248_10407732 | Ga0105248_104077321 | 144 |
| 805 | 3300009553 | Ga0105249_10159072 | Ga0105249_101590722 | 144 |
| 806 | 3300010375 | Ga0105239_11025479 | Ga0105239_110254791 | 144 |
| 807 | 3300013052 | Ga0154014_150331 | Ga0154014_1503311 | 144 |
| 808 | 3300013100 | Ga0157373_10285172 | Ga0157373_102851722 | 144 |
| 809 | 3300013296 | Ga0157374_10270410 | Ga0157374_102704103 | 144 |
| 810 | 3300013297 | Ga0157378_10439831 | Ga0157378_104398313 | 144 |
| 811 | 3300013306 | Ga0163162_11485757 | Ga0163162_114857571 | 144 |
| 812 | 3300013306 | Ga0163162_11834814 | Ga0163162_118348141 | 144 |
| 813 | 3300013307 | Ga0157372_10807664 | Ga0157372_108076641 | 144 |
| 814 | 3300014326 | Ga0157380_10223193 | Ga0157380_102231931 | 144 |
| 815 | 3300014745 | Ga0157377_10097628 | Ga0157377_100976282 | 144 |
| 816 | 3300014969 | Ga0157376_10244502 | Ga0157376_102445023 | 144 |
| 817 | 3300014969 | Ga0157376_10452972 | Ga0157376_104529721 | 144 |
| 818 | 3300020069 | Ga0197907_10581883 | Ga0197907_105818831 | 144 |
| 819 | 3300020069 | Ga0197907_11475688 | Ga0197907_114756881 | 144 |
| 820 | 3300020070 | Ga0206356_10020745 | Ga0206356_100207452 | 144 |
| 821 | 3300020075 | Ga0206349_1199217 | Ga0206349_11992171 | 144 |
| 822 | 3300020080 | Ga0206350_11526535 | Ga0206350_115265351 | 144 |
| 823 | 3300020610 | Ga0154015_1542634 | Ga0154015_15426341 | 144 |
| 824 | 3300022467 | Ga0224712_10289323 | Ga0224712_102893231 | 144 |
| 825 | 3300025315 | Ga0207697_10156602 | Ga0207697_101566021 | 144 |
| 826 | 3300025899 | Ga0207642_10114573 | Ga0207642_101145733 | 144 |
| 827 | 3300025900 | Ga0207710_10019040 | Ga0207710_100190401 | 144 |
| 828 | 3300025901 | Ga0207688_10001492 | Ga0207688_1000149215 | 144 |
| 829 | 3300025903 | Ga0207680_10116578 | Ga0207680_101165781 | 144 |
| 830 | 3300025904 | Ga0207647_10064305 | Ga0207647_100643052 | 144 |
| 831 | 3300025907 | Ga0207645_10052747 | Ga0207645_100527471 | 144 |
| 832 | 3300025908 | Ga0207643_10018058 | Ga0207643_100180583 | 144 |
| 833 | 3300025914 | Ga0207671_11099007 | Ga0207671_110990071 | 144 |
| 834 | 3300025916 | Ga0207663_10349900 | Ga0207663_103499001 | 144 |
| 835 | 3300025918 | Ga0207662_10025767 | Ga0207662_100257674 | 144 |
| 836 | 3300025919 | Ga0207657_10079354 | Ga0207657_100793545 | 144 |
| 837 | 3300025920 | Ga0207649_10111499 | Ga0207649_101114991 | 144 |
| 838 | 3300025923 | Ga0207681_10845443 | Ga0207681_108454432 | 144 |
| 839 | 3300025924 | Ga0207694_10469753 | Ga0207694_104697531 | 144 |
| 840 | 3300025925 | Ga0207650_10521552 | Ga0207650_105215521 | 144 |
| 841 | 3300025926 | Ga0207659_10057568 | Ga0207659_100575683 | 144 |
| 842 | 3300025931 | Ga0207644_10148115 | Ga0207644_101481151 | 144 |
| 843 | 3300025932 | Ga0207690_10783564 | Ga0207690_107835641 | 144 |
| 844 | 3300025933 | Ga0207706_10019204 | Ga0207706_100192047 | 144 |
| 845 | 3300025934 | Ga0207686_10819032 | Ga0207686_108190322 | 144 |
| 846 | 3300025935 | Ga0207709_10285542 | Ga0207709_102855422 | 144 |
| 847 | 3300025937 | Ga0207669_10040790 | Ga0207669_100407903 | 144 |
| 848 | 3300025938 | Ga0207704_10476776 | Ga0207704_104767761 | 144 |
| 849 | 3300025939 | Ga0207665_11354262 | Ga0207665_113542621 | 144 |
| 850 | 3300025940 | Ga0207691_10066198 | Ga0207691_100661981 | 144 |
| 851 | 3300025941 | Ga0207711_10265841 | Ga0207711_102658411 | 144 |
| 852 | 3300025942 | Ga0207689_10007050 | Ga0207689_100070505 | 144 |
| 853 | 3300025944 | Ga0207661_10409730 | Ga0207661_104097301 | 144 |
| 854 | 3300025972 | Ga0207668_11078746 | Ga0207668_110787461 | 144 |
| 855 | 3300025986 | Ga0207658_10980433 | Ga0207658_109804331 | 144 |
| 856 | 3300026023 | Ga0207677_10026042 | Ga0207677_100260421 | 144 |
| 857 | 3300026041 | Ga0207639_10105939 | Ga0207639_101059394 | 144 |
| 858 | 3300026067 | Ga0207678_10031904 | Ga0207678_100319044 | 144 |
| 859 | 3300026075 | Ga0207708_10147770 | Ga0207708_101477701 | 144 |
| 860 | 3300026078 | Ga0207702_11280215 | Ga0207702_112802151 | 144 |
| 861 | 3300026088 | Ga0207641_10023833 | Ga0207641_100238334 | 144 |
| 862 | 3300026089 | Ga0207648_10009264 | Ga0207648_1000926413 | 144 |
| 863 | 3300026118 | Ga0207675_100013837 | Ga0207675_1000138376 | 144 |
| 864 | 3300026121 | Ga0207683_10100309 | Ga0207683_101003094 | 144 |
| 865 | 3300026142 | Ga0207698_10136964 | Ga0207698_101369641 | 144 |
| 866 | 3300027866 | Ga0209813_10106034 | Ga0209813_101060341 | 144 |
| 867 | 3300027907 | Ga0207428_10463291 | Ga0207428_104632911 | 144 |
| 868 | 3300028380 | Ga0268265_10188166 | Ga0268265_101881661 | 144 |
| 869 | 3300035084 | Ga0373928_0076374 | Ga0373928_0076374_265_699 | 144 |
| 870 | 3300035115 | Ga0373941_0208639 | Ga0373941_0208639_18_452 | 144 |
| 871 | 3300035121 | Ga0373960_0042344 | Ga0373960_0042344_433_867 | 144 |
| 872 | 3300041458 | Ga0451798_0335678 | Ga0451798_0335678_304_738 | 144 |
| 873 | 3300041511 | Ga0451855_1305352 | Ga0451855_1305352_49_483 | 144 |
| 874 | 3300046458 | Ga0495591_048624 | Ga0495591_048624_697_1131 | 144 |
| 875 | 3300046507 | Ga0495606_0283027 | Ga0495606_0283027_375_809 | 144 |
| 876 | 3300046513 | Ga0495616_0028735 | Ga0495616_0028735_506_940 | 144 |
| 877 | 3300046516 | Ga0495628_0594921 | Ga0495628_0594921_235_669 | 144 |
| 878 | 3300046520 | Ga0495637_0038718 | Ga0495637_0038718_594_1028 | 144 |
| 879 | 3300046524 | Ga0495648_0506372 | Ga0495648_0506372_53_487 | 144 |
| 880 | 3300046528 | Ga0495642_0400698 | Ga0495642_0400698_95_529 | 144 |
| 881 | 3300046529 | Ga0495652_0790651 | Ga0495652_0790651_155_589 | 144 |
| 882 | 3300046542 | Ga0495597_0143210 | Ga0495597_0143210_274_708 | 144 |
| 883 | 3300046615 | Ga0495656_0127217 | Ga0495656_0127217_646_1080 | 144 |
| 884 | 3300046642 | Ga0495634_0343018 | Ga0495634_0343018_40_474 | 144 |
| 885 | 3300046678 | Ga0495599_0210619 | Ga0495599_0210619_49_483 | 144 |
| 886 | 3300046680 | Ga0495646_0175699 | Ga0495646_0175699_468_902 | 144 |
| 887 | 3300046684 | Ga0495669_0053743 | Ga0495669_0053743_383_817 | 144 |
| 888 | 3300046692 | Ga0495671_0217896 | Ga0495671_0217896_479_913 | 144 |
| 889 | 3300046694 | Ga0495649_0179154 | Ga0495649_0179154_181_615 | 144 |
| 890 | 3300047317 | Ga0495604_0350610 | Ga0495604_0350610_500_934 | 144 |
| 891 | 3300048090 | Ga0495615_0075505 | Ga0495615_0075505_338_772 | 144 |
| 892 | 3300048903 | Ga0496100_0058339 | Ga0496100_0058339_1910_2344 | 144 |
| 893 | 3300048904 | Ga0496101_0090268 | Ga0496101_0090268_1490_1924 | 144 |
| 894 | 3300048904 | Ga0496101_1428651 | Ga0496101_1428651_72_506 | 144 |
| 895 | 3300048905 | Ga0496102_0038319 | Ga0496102_0038319_3531_3965 | 144 |
| 896 | 3300048906 | Ga0496103_0010647 | Ga0496103_0010647_4123_4557 | 144 |
| 897 | 3300048907 | Ga0496104_0064904 | Ga0496104_0064904_2479_2913 | 144 |
| 898 | 3300048909 | Ga0496106_0033337 | Ga0496106_0033337_2633_3067 | 144 |
| 899 | 3300048910 | Ga0496107_0016920 | Ga0496107_0016920_4332_4766 | 144 |
| 900 | 3300048911 | Ga0496108_0155991 | Ga0496108_0155991_1526_1960 | 144 |
| 901 | 3300048912 | Ga0496109_0059010 | Ga0496109_0059010_1660_2094 | 144 |
| 902 | 3300048913 | Ga0496110_0023369 | Ga0496110_0023369_4049_4483 | 144 |
| 903 | 3300048914 | Ga0496111_0502320 | Ga0496111_0502320_65_499 | 144 |
| 904 | 3300048915 | Ga0496112_0061374 | Ga0496112_0061374_1916_2350 | 144 |
| 905 | 3300048916 | Ga0496113_0273744 | Ga0496113_0273744_845_1279 | 144 |
| 906 | 3300048917 | Ga0496114_0092794 | Ga0496114_0092794_1356_1790 | 144 |
| 907 | 3300048918 | Ga0496115_0399424 | Ga0496115_0399424_162_596 | 144 |
| 908 | 3300049459 | Ga0495678_130160 | Ga0495678_130160_157_591 | 144 |
| 909 | 3300050492 | nmdc:mga0yw44_115357_c1 | nmdc:mga0yw44_115357_c1_1147_1581 | 144 |
| 910 | 3300050492 | nmdc:mga0yw44_301527_c1 | nmdc:mga0yw44_301527_c1_366_800 | 144 |
| 911 | 3300050494 | nmdc:mga06z11_453727_c1 | nmdc:mga06z11_453727_c1_109_543 | 144 |
| 912 | 3300050495 | nmdc:mga04h51_125288_c1 | nmdc:mga04h51_125288_c1_351_785 | 144 |
| 913 | 3300050511 | nmdc:mga08y16_168639_c1 | nmdc:mga08y16_168639_c1_1181_1615 | 144 |
| 914 | 3300053077 | Ga0495601_0099724 | Ga0495601_0099724_302_736 | 144 |
| 915 | 3300053084 | Ga0495595_0496293 | Ga0495595_0496293_112_546 | 144 |
| 916 | 3300053085 | Ga0495619_0064128 | Ga0495619_0064128_1359_1793 | 144 |
| 917 | 3300059492 | Ga0587073_0096981 | Ga0587073_0096981_186_620 | 144 |
| 918 | 3300059503 | Ga0587080_071007 | Ga0587080_071007_178_618 | 144 |
| 919 | 3300059505 | Ga0587083_0100120 | Ga0587083_0100120_134_568 | 144 |
| 920 | 3300059506 | Ga0587085_065341 | Ga0587085_065341_176_616 | 144 |
| 921 | 3300059508 | Ga0587088_096521 | Ga0587088_096521_132_566 | 144 |
| 922 | 3300059644 | Ga0587075_018284 | Ga0587075_018284_186_620 | 144 |
| 923 | 3300059644 | Ga0587075_029339 | Ga0587075_029339_258_698 | 144 |
| 924 | 3300059646 | Ga0587078_031678 | Ga0587078_031678_89_523 | 144 |
| 925 | 3300059651 | Ga0587105_005867 | Ga0587105_005867_291_731 | 144 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2pvd-assembly1.cif.gz_B | crystal srtucture of the reduced ferredoxin:thioredoxin reductase | 0.5253 | 45 | 110 |
| 4wfb-assembly1.cif.gz_A | the crystal structure of the large ribosomal subunit of staphylococcus aureus in complex with bc-3205 | 0.5193 | 14 | 119 |
| 1dj7-assembly1.cif.gz_B | crystal structure of ferredoxin thioredoxin reductase | 0.5144 | 45 | 110 |
| 2pvg-assembly1.cif.gz_B | crystal srtucture of the binary complex between ferredoxin and ferredoxin:thioredoxin reductase | 0.5102 | 45 | 110 |
| 2pvd-assembly1.cif.gz_B | crystal srtucture of the reduced ferredoxin:thioredoxin reductase | 0.4839 | 45 | 110 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2puoB00 | Mainly Beta;Roll;SH3 type barrels.; | 0.5123 | 45 | 110 | 2.30.30.50 |
| af_Q8I4E2_1_66_2.30.30.40 | Mainly Beta;Roll;SH3 type barrels.;SH3 Domains | 0.4857 | 49 | 118 | 2.30.30.40 |
| 2puoB00 | Mainly Beta;Roll;SH3 type barrels.; | 0.4726 | 45 | 110 | 2.30.30.50 |
| 4r0kB01 | Mainly Beta;Roll;SH3 type barrels.;SH3 Domains | 0.4519 | 47 | 111 | 2.30.30.40 |
| af_Q8I4E2_1_66_2.30.30.40 | Mainly Beta;Roll;SH3 type barrels.;SH3 Domains | 0.4431 | 49 | 118 | 2.30.30.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1M7GAU9-F1-model_v4 | Uncharacterized protein | 0.949 | 1 | 116 |
|
| AF-A0A2W2AW69-F1-model_v4 | Uncharacterized protein | 0.914 | 1 | 126 |
|
| AF-A0A537U2I6-F1-model_v4 | Uncharacterized protein | 0.9075 | 1 | 126 |
|
| AF-A0A127EUM9-F1-model_v4 | Uncharacterized protein | 0.8938 | 1 | 130 |
|
| AF-A0A2W2AW69-F1-model_v4 | Uncharacterized protein | 0.8874 | 1 | 126 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar