F485758
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 921 | 298 | 921 | 228 |
Family's Representative Sequence
| Representative Sequence | 3300009101|Ga0105247_10327849|Ga0105247_103278492 |
| Length | 225 |
| Sequence | MAKKGKKYRAALEKIEPNKKYTLDEGLAKVKEISFAKFDETVELTMWLGVDPRKADQLVRGTIVLPHGLGGAAKKVVVIAQGDKIREAQEAGADIVDRIKGGWLEFDALIATPDMMGKVGQLGKVLGPRGLMPNPKTGTVTMDVAKAIQETKAGKVEYRVDKTGVIHSPVGKVSFDGAKLKENASVLINAVMRAKPATAKGRYLKKINLAPTMGPGVLLDELAYV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000531 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB_Illumina_Assembled | Metagenome | Rhizosphere |
| 2 | 3300000532 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300001426 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 | Metagenome | Rhizosphere |
| 4 | 3300001432 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 5 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 6 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 7 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 8 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 9 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 10 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 11 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 14 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 21 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 25 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 38 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 51 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 57 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 60 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 67 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 69 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 70 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 72 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 73 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 74 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 75 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 76 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 77 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 78 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 79 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 80 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 81 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 82 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 83 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 84 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 85 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 86 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 88 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 89 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 90 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 91 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 92 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 93 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 94 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 95 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 96 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 98 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 99 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 128 | 3300025223 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 186 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300030877 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 189 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 190 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 191 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 192 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 193 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 194 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 195 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 196 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 197 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 198 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 199 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 200 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 201 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 202 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 203 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 204 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 205 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 206 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 207 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 208 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 209 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 210 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 211 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 212 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 213 | 3300038699 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 | Metagenome | Rhizosphere |
| 214 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 215 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 216 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 217 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 218 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 219 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 220 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 221 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 222 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 236 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 237 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 238 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 239 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 240 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 241 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 242 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 243 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 244 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 245 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 246 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 247 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 248 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 249 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 251 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 252 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 253 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 254 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 255 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 256 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 257 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 258 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 259 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 260 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 261 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 262 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 263 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 264 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 265 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 266 | 3300049680 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought | Metagenome | Rhizosphere |
| 267 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 268 | 3300049689 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought | Metagenome | Rhizosphere |
| 269 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 270 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 271 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 272 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 273 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 274 | 3300049764 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control | Metagenome | Rhizosphere |
| 275 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 276 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 277 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 278 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 279 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 280 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 281 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 282 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 283 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 284 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 285 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 286 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 287 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 288 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 289 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 292 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 293 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 294 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 295 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 296 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 297 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 298 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.7 |
| Metatranscriptomes | 1.3 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.11 |
| Nodule | 0 |
| Rhizoplane | 1.74 |
| Rhizosphere | 96.96 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.19 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | CNBas_1000372 | 3300000531 | Bacteria | 1893 |
| 2 | CNAas_1001813 | 3300000532 | Bacteria | 1666 |
| 3 | JGI24030J14995_100433 | 3300001426 | Bacteria | 1327 |
| 4 | JGI24034J14986_100801 | 3300001432 | Bacteria | 1873 |
| 5 | JGI24748J21848_1000014 | 3300002074 | Bacteria | 147126 |
| 6 | JGI24034J26672_10000012 | 3300002239 | Bacteria | 146139 |
| 7 | JGI24751J29686_10000074 | 3300002459 | Bacteria | 56035 |
| 8 | JGI25406J46586_10011912 | 3300003203 | Bacteria | 3794 |
| 9 | JGI25406J46586_10014740 | 3300003203 | Bacteria | 3318 |
| 10 | JGI25406J46586_10026245 | 3300003203 | Bacteria | 2249 |
| 11 | Ga0058863_10009163 | 3300004799 | Bacteria | 2201 |
| 12 | Ga0058861_11955377 | 3300004800 | Bacteria | 1646 |
| 13 | Ga0058861_12040784 | 3300004800 | Bacteria | 1089 |
| 14 | Ga0065714_10064450 | 3300005288 | Bacteria | 77548 |
| 15 | Ga0065704_10002971 | 3300005289 | Bacteria | 6761 |
| 16 | Ga0065704_10093725 | 3300005289 | Bacteria | 2581 |
| 17 | Ga0065704_10097529 | 3300005289 | Bacteria | 2390 |
| 18 | Ga0065704_10173484 | 3300005289 | Bacteria | 1277 |
| 19 | Ga0065704_10187416 | 3300005289 | Bacteria | 1206 |
| 20 | Ga0065712_10001740 | 3300005290 | Bacteria | 6000 |
| 21 | Ga0065712_10004552 | 3300005290 | Bacteria | 6010 |
| 22 | Ga0065712_10015500 | 3300005290 | Bacteria | 3002 |
| 23 | Ga0065712_10018916 | 3300005290 | Bacteria | 2374 |
| 24 | Ga0065712_10022326 | 3300005290 | Bacteria | 2083 |
| 25 | Ga0065712_10072502 | 3300005290 | Bacteria | 4727 |
| 26 | Ga0065712_10159279 | 3300005290 | Bacteria | 1308 |
| 27 | Ga0065715_10005007 | 3300005293 | Bacteria | 3558 |
| 28 | Ga0065715_10027997 | 3300005293 | Bacteria | 1266 |
| 29 | Ga0065715_10094215 | 3300005293 | Bacteria | 4402 |
| 30 | Ga0065715_10095075 | 3300005293 | Bacteria | 4174 |
| 31 | Ga0065715_10097309 | 3300005293 | Bacteria | 3683 |
| 32 | Ga0065715_10166863 | 3300005293 | Bacteria | 1574 |
| 33 | Ga0065715_10170832 | 3300005293 | Bacteria | 1537 |
| 34 | Ga0065715_10187026 | 3300005293 | Bacteria | 1391 |
| 35 | Ga0065707_10005254 | 3300005295 | Bacteria | 2904 |
| 36 | Ga0065707_10008773 | 3300005295 | Bacteria | 2186 |
| 37 | Ga0065707_10043579 | 3300005295 | Bacteria | 965 |
| 38 | Ga0065707_10091832 | 3300005295 | Bacteria | 3865 |
| 39 | Ga0065707_10269917 | 3300005295 | Unclassified | 1043 |
| 40 | Ga0070658_10209182 | 3300005327 | Bacteria | 1648 |
| 41 | Ga0070676_10429273 | 3300005328 | Bacteria | 925 |
| 42 | Ga0070676_10455928 | 3300005328 | Bacteria | 900 |
| 43 | Ga0070690_100004097 | 3300005330 | Bacteria | 8069 |
| 44 | Ga0070690_100014199 | 3300005330 | Bacteria | 4722 |
| 45 | Ga0070690_100027424 | 3300005330 | Bacteria | 3521 |
| 46 | Ga0070690_100148584 | 3300005330 | Bacteria | 1597 |
| 47 | Ga0070690_100252469 | 3300005330 | Bacteria | 1248 |
| 48 | Ga0070670_100005027 | 3300005331 | Bacteria | 11126 |
| 49 | Ga0070670_100013886 | 3300005331 | Bacteria | 6907 |
| 50 | Ga0070670_100039282 | 3300005331 | Bacteria | 4070 |
| 51 | Ga0070670_100129699 | 3300005331 | Bacteria | 2177 |
| 52 | Ga0070670_100228883 | 3300005331 | Bacteria | 1618 |
| 53 | Ga0070670_100416906 | 3300005331 | Bacteria | 1187 |
| 54 | Ga0070670_100666608 | 3300005331 | Unclassified | 934 |
| 55 | Ga0068869_100010725 | 3300005334 | Bacteria | 5983 |
| 56 | Ga0068869_100050225 | 3300005334 | Bacteria | 3022 |
| 57 | Ga0070666_10018717 | 3300005335 | Bacteria | 4459 |
| 58 | Ga0070666_10088219 | 3300005335 | Bacteria | 2128 |
| 59 | Ga0070680_100000103 | 3300005336 | Bacteria | 48805 |
| 60 | Ga0070680_100134655 | 3300005336 | Bacteria | 2069 |
| 61 | Ga0070680_100137262 | 3300005336 | Bacteria | 2049 |
| 62 | Ga0070680_100317539 | 3300005336 | Bacteria | 1322 |
| 63 | Ga0070680_100641303 | 3300005336 | Bacteria | 913 |
| 64 | Ga0070682_100005522 | 3300005337 | Bacteria | 7038 |
| 65 | Ga0070682_100019793 | 3300005337 | Bacteria | 3953 |
| 66 | Ga0070682_100602823 | 3300005337 | Bacteria | 867 |
| 67 | Ga0068868_100362253 | 3300005338 | Bacteria | 1244 |
| 68 | Ga0068868_100401032 | 3300005338 | Bacteria | 1184 |
| 69 | Ga0070660_100011939 | 3300005339 | Bacteria | 6198 |
| 70 | Ga0070689_100020570 | 3300005340 | Bacteria | 4899 |
| 71 | Ga0070689_100038497 | 3300005340 | Bacteria | 3659 |
| 72 | Ga0070689_100057269 | 3300005340 | Bacteria | 3025 |
| 73 | Ga0070689_100227946 | 3300005340 | Bacteria | 1531 |
| 74 | Ga0070689_100258063 | 3300005340 | Bacteria | 1440 |
| 75 | Ga0070689_100381665 | 3300005340 | Bacteria | 1188 |
| 76 | Ga0070689_100479284 | 3300005340 | Bacteria | 1063 |
| 77 | Ga0070691_10204574 | 3300005341 | Bacteria | 1039 |
| 78 | Ga0070687_100002413 | 3300005343 | Bacteria | 6986 |
| 79 | Ga0070687_100019756 | 3300005343 | Bacteria | 3140 |
| 80 | Ga0070687_100045207 | 3300005343 | Bacteria | 2247 |
| 81 | Ga0070687_100186574 | 3300005343 | Bacteria | 1246 |
| 82 | Ga0070687_100300670 | 3300005343 | Bacteria | 1018 |
| 83 | Ga0070661_100033024 | 3300005344 | Bacteria | 3748 |
| 84 | Ga0070661_100265816 | 3300005344 | Bacteria | 1327 |
| 85 | Ga0070692_10007532 | 3300005345 | Bacteria | 4800 |
| 86 | Ga0070692_10088217 | 3300005345 | Bacteria | 1682 |
| 87 | Ga0070668_100048014 | 3300005347 | Bacteria | 3283 |
| 88 | Ga0070669_100018533 | 3300005353 | Bacteria | 4973 |
| 89 | Ga0070669_100053168 | 3300005353 | Bacteria | 2964 |
| 90 | Ga0070669_100055779 | 3300005353 | Bacteria | 2895 |
| 91 | Ga0070669_100095460 | 3300005353 | Bacteria | 2236 |
| 92 | Ga0070669_100123593 | 3300005353 | Bacteria | 1978 |
| 93 | Ga0070675_100116074 | 3300005354 | Bacteria | 2270 |
| 94 | Ga0070675_100187501 | 3300005354 | Unclassified | 1791 |
| 95 | Ga0070675_100657886 | 3300005354 | Bacteria | 952 |
| 96 | Ga0070671_100007852 | 3300005355 | Bacteria | 8529 |
| 97 | Ga0070671_100168905 | 3300005355 | Bacteria | 1850 |
| 98 | Ga0070671_100471292 | 3300005355 | Unclassified | 1078 |
| 99 | Ga0070674_100855836 | 3300005356 | Bacteria | 789 |
| 100 | Ga0070673_100028099 | 3300005364 | Bacteria | 4179 |
| 101 | Ga0070673_100077535 | 3300005364 | Bacteria | 2686 |
| 102 | Ga0070673_100095069 | 3300005364 | Bacteria | 2444 |
| 103 | Ga0070673_100176116 | 3300005364 | Bacteria | 1828 |
| 104 | Ga0070673_100264116 | 3300005364 | Unclassified | 1505 |
| 105 | Ga0070673_100498068 | 3300005364 | Bacteria | 1102 |
| 106 | Ga0070688_100003329 | 3300005365 | Bacteria | 8238 |
| 107 | Ga0070688_100517022 | 3300005365 | Bacteria | 903 |
| 108 | Ga0070659_100107817 | 3300005366 | Bacteria | 2246 |
| 109 | Ga0070667_100036777 | 3300005367 | Bacteria | 4105 |
| 110 | Ga0070703_10000193 | 3300005406 | Bacteria | 29596 |
| 111 | Ga0070703_10006781 | 3300005406 | Bacteria | 3214 |
| 112 | Ga0070703_10032886 | 3300005406 | Bacteria | 1577 |
| 113 | Ga0070703_10044631 | 3300005406 | Bacteria | 1394 |
| 114 | Ga0070701_10013118 | 3300005438 | Bacteria | 3760 |
| 115 | Ga0070701_10049658 | 3300005438 | Bacteria | 2170 |
| 116 | Ga0070711_100077619 | 3300005439 | Bacteria | 2358 |
| 117 | Ga0070705_100000982 | 3300005440 | Bacteria | 15936 |
| 118 | Ga0070705_100062699 | 3300005440 | Bacteria | 2214 |
| 119 | Ga0070705_100176546 | 3300005440 | Bacteria | 1443 |
| 120 | Ga0070705_100178306 | 3300005440 | Bacteria | 1437 |
| 121 | Ga0070705_100349490 | 3300005440 | Bacteria | 1077 |
| 122 | Ga0070700_100005796 | 3300005441 | Bacteria | 6556 |
| 123 | Ga0070700_100010746 | 3300005441 | Bacteria | 5058 |
| 124 | Ga0070700_100041257 | 3300005441 | Bacteria | 2829 |
| 125 | Ga0070700_100055987 | 3300005441 | Bacteria | 2470 |
| 126 | Ga0070700_100233304 | 3300005441 | Bacteria | 1311 |
| 127 | Ga0070694_100008189 | 3300005444 | Bacteria | 6387 |
| 128 | Ga0070694_100015866 | 3300005444 | Bacteria | 4739 |
| 129 | Ga0070694_100021679 | 3300005444 | Bacteria | 4110 |
| 130 | Ga0070694_100032476 | 3300005444 | Bacteria | 3428 |
| 131 | Ga0070694_100044559 | 3300005444 | Bacteria | 2969 |
| 132 | Ga0070694_100055794 | 3300005444 | Bacteria | 2680 |
| 133 | Ga0070694_100068041 | 3300005444 | Bacteria | 2446 |
| 134 | Ga0070694_100079786 | 3300005444 | Bacteria | 2273 |
| 135 | Ga0070694_100082443 | 3300005444 | Bacteria | 2240 |
| 136 | Ga0070694_100090985 | 3300005444 | Bacteria | 2140 |
| 137 | Ga0070694_100242083 | 3300005444 | Unclassified | 1361 |
| 138 | Ga0070708_100001743 | 3300005445 | Bacteria | 16700 |
| 139 | Ga0070708_100050740 | 3300005445 | Bacteria | 3674 |
| 140 | Ga0070708_100280955 | 3300005445 | Bacteria | 1567 |
| 141 | Ga0070708_100311833 | 3300005445 | Bacteria | 1482 |
| 142 | Ga0070678_100567328 | 3300005456 | Bacteria | 1009 |
| 143 | Ga0070662_100029069 | 3300005457 | Bacteria | 3855 |
| 144 | Ga0070662_100289628 | 3300005457 | Bacteria | 1327 |
| 145 | Ga0070662_100447912 | 3300005457 | Bacteria | 1071 |
| 146 | Ga0070662_100653125 | 3300005457 | Bacteria | 887 |
| 147 | Ga0070681_10000095 | 3300005458 | Bacteria | 65410 |
| 148 | Ga0070681_10006380 | 3300005458 | Bacteria | 11465 |
| 149 | Ga0070681_10027357 | 3300005458 | Bacteria | 5733 |
| 150 | Ga0070681_10150615 | 3300005458 | Bacteria | 2253 |
| 151 | Ga0068867_100027874 | 3300005459 | Bacteria | 4063 |
| 152 | Ga0068867_100139144 | 3300005459 | Bacteria | 1896 |
| 153 | Ga0068867_100175345 | 3300005459 | Bacteria | 1701 |
| 154 | Ga0068867_100432215 | 3300005459 | Bacteria | 1118 |
| 155 | Ga0068867_100563000 | 3300005459 | Bacteria | 989 |
| 156 | Ga0070685_10061109 | 3300005466 | Bacteria | 2205 |
| 157 | Ga0070685_10447502 | 3300005466 | Bacteria | 904 |
| 158 | Ga0070706_100000920 | 3300005467 | Bacteria | 32204 |
| 159 | Ga0070706_100005925 | 3300005467 | Bacteria | 11570 |
| 160 | Ga0070706_100020710 | 3300005467 | Bacteria | 6058 |
| 161 | Ga0070706_100131556 | 3300005467 | Bacteria | 2335 |
| 162 | Ga0070706_100150458 | 3300005467 | Unclassified | 2173 |
| 163 | Ga0070706_100152848 | 3300005467 | Bacteria | 2155 |
| 164 | Ga0070706_100346629 | 3300005467 | Bacteria | 1385 |
| 165 | Ga0070707_100003296 | 3300005468 | Bacteria | 15256 |
| 166 | Ga0070707_100014408 | 3300005468 | Bacteria | 7412 |
| 167 | Ga0070707_100028004 | 3300005468 | Bacteria | 5360 |
| 168 | Ga0070707_100068181 | 3300005468 | Bacteria | 3423 |
| 169 | Ga0070707_100148635 | 3300005468 | Bacteria | 2281 |
| 170 | Ga0070707_100208109 | 3300005468 | Unclassified | 1907 |
| 171 | Ga0070698_100000374 | 3300005471 | Bacteria | 46633 |
| 172 | Ga0070698_100005496 | 3300005471 | Bacteria | 13834 |
| 173 | Ga0070698_100005600 | 3300005471 | Bacteria | 13738 |
| 174 | Ga0070698_100016601 | 3300005471 | Bacteria | 7770 |
| 175 | Ga0070698_100035264 | 3300005471 | Bacteria | 5174 |
| 176 | Ga0070698_100035463 | 3300005471 | Bacteria | 5159 |
| 177 | Ga0070698_100066401 | 3300005471 | Bacteria | 3631 |
| 178 | Ga0070698_100074362 | 3300005471 | Bacteria | 3403 |
| 179 | Ga0070698_100076608 | 3300005471 | Bacteria | 3346 |
| 180 | Ga0070698_100204080 | 3300005471 | Bacteria | 1912 |
| 181 | Ga0070699_100019115 | 3300005518 | Bacteria | 5894 |
| 182 | Ga0070699_100026662 | 3300005518 | Bacteria | 4984 |
| 183 | Ga0070699_100038208 | 3300005518 | Bacteria | 4156 |
| 184 | Ga0070699_100059963 | 3300005518 | Bacteria | 3296 |
| 185 | Ga0070699_100062651 | 3300005518 | Bacteria | 3224 |
| 186 | Ga0070699_100114649 | 3300005518 | Bacteria | 2367 |
| 187 | Ga0070699_100195455 | 3300005518 | Unclassified | 1798 |
| 188 | Ga0070699_100302535 | 3300005518 | Bacteria | 1435 |
| 189 | Ga0070699_100643203 | 3300005518 | Bacteria | 968 |
| 190 | Ga0070699_100740242 | 3300005518 | Bacteria | 899 |
| 191 | Ga0070679_100000661 | 3300005530 | Bacteria | 29364 |
| 192 | Ga0070684_100371671 | 3300005535 | Bacteria | 1316 |
| 193 | Ga0070697_100002791 | 3300005536 | Bacteria | 13453 |
| 194 | Ga0070697_100006646 | 3300005536 | Bacteria | 8965 |
| 195 | Ga0070697_100072663 | 3300005536 | Bacteria | 2822 |
| 196 | Ga0070697_100137242 | 3300005536 | Bacteria | 2054 |
| 197 | Ga0070697_100195414 | 3300005536 | Unclassified | 1718 |
| 198 | Ga0068853_100067207 | 3300005539 | Bacteria | 3113 |
| 199 | Ga0068853_100101661 | 3300005539 | Bacteria | 2542 |
| 200 | Ga0068853_100163176 | 3300005539 | Bacteria | 2012 |
| 201 | Ga0068853_100181150 | 3300005539 | Unclassified | 1911 |
| 202 | Ga0068853_100403852 | 3300005539 | Bacteria | 1279 |
| 203 | Ga0070672_100026540 | 3300005543 | Bacteria | 4312 |
| 204 | Ga0070686_100005785 | 3300005544 | Bacteria | 6854 |
| 205 | Ga0070686_100013995 | 3300005544 | Bacteria | 4610 |
| 206 | Ga0070686_100028009 | 3300005544 | Bacteria | 3413 |
| 207 | Ga0070686_100028019 | 3300005544 | Bacteria | 3413 |
| 208 | Ga0070686_100046653 | 3300005544 | Bacteria | 2735 |
| 209 | Ga0070686_100122582 | 3300005544 | Bacteria | 1787 |
| 210 | Ga0070686_100196518 | 3300005544 | Bacteria | 1443 |
| 211 | Ga0070695_100018991 | 3300005545 | Bacteria | 4179 |
| 212 | Ga0070695_100033900 | 3300005545 | Bacteria | 3196 |
| 213 | Ga0070695_100083578 | 3300005545 | Bacteria | 2116 |
| 214 | Ga0070695_100219637 | 3300005545 | Bacteria | 1369 |
| 215 | Ga0070695_100266016 | 3300005545 | Bacteria | 1254 |
| 216 | Ga0070695_100283761 | 3300005545 | Unclassified | 1218 |
| 217 | Ga0070695_100306856 | 3300005545 | Bacteria | 1175 |
| 218 | Ga0070695_100411713 | 3300005545 | Bacteria | 1027 |
| 219 | Ga0070696_100013482 | 3300005546 | Bacteria | 5484 |
| 220 | Ga0070696_100042662 | 3300005546 | Bacteria | 3135 |
| 221 | Ga0070696_100047947 | 3300005546 | Bacteria | 2965 |
| 222 | Ga0070696_100053664 | 3300005546 | Bacteria | 2807 |
| 223 | Ga0070696_100133532 | 3300005546 | Bacteria | 1808 |
| 224 | Ga0070696_100182939 | 3300005546 | Unclassified | 1556 |
| 225 | Ga0070696_100308375 | 3300005546 | Bacteria | 1214 |
| 226 | Ga0070696_100614770 | 3300005546 | Bacteria | 877 |
| 227 | Ga0070696_100865886 | 3300005546 | Bacteria | 747 |
| 228 | Ga0070693_100003410 | 3300005547 | Bacteria | 7407 |
| 229 | Ga0070693_100021759 | 3300005547 | Bacteria | 3401 |
| 230 | Ga0070693_100067661 | 3300005547 | Bacteria | 2094 |
| 231 | Ga0070693_100093271 | 3300005547 | Bacteria | 1819 |
| 232 | Ga0070693_100117588 | 3300005547 | Bacteria | 1645 |
| 233 | Ga0070693_100171887 | 3300005547 | Bacteria | 1389 |
| 234 | Ga0070704_100013577 | 3300005549 | Bacteria | 5060 |
| 235 | Ga0070704_100013963 | 3300005549 | Bacteria | 5004 |
| 236 | Ga0070704_100018581 | 3300005549 | Bacteria | 4449 |
| 237 | Ga0070704_100028182 | 3300005549 | Bacteria | 3733 |
| 238 | Ga0070704_100034482 | 3300005549 | Bacteria | 3433 |
| 239 | Ga0070704_100078833 | 3300005549 | Bacteria | 2418 |
| 240 | Ga0070704_100165307 | 3300005549 | Bacteria | 1754 |
| 241 | Ga0070704_100169561 | 3300005549 | Bacteria | 1734 |
| 242 | Ga0070704_100222718 | 3300005549 | Bacteria | 1534 |
| 243 | Ga0070704_100388833 | 3300005549 | Bacteria | 1187 |
| 244 | Ga0070704_100655696 | 3300005549 | Bacteria | 927 |
| 245 | Ga0068855_100261345 | 3300005563 | Bacteria | 1928 |
| 246 | Ga0068855_100653339 | 3300005563 | Bacteria | 1129 |
| 247 | Ga0068855_100749166 | 3300005563 | Bacteria | 1042 |
| 248 | Ga0070664_100003167 | 3300005564 | Bacteria | 13297 |
| 249 | Ga0068857_100256564 | 3300005577 | Bacteria | 1604 |
| 250 | Ga0068857_100422995 | 3300005577 | Bacteria | 1242 |
| 251 | Ga0068857_100472240 | 3300005577 | Bacteria | 1175 |
| 252 | Ga0068854_100020758 | 3300005578 | Bacteria | 4451 |
| 253 | Ga0068854_100274091 | 3300005578 | Bacteria | 1356 |
| 254 | Ga0070702_100015413 | 3300005615 | Bacteria | 3903 |
| 255 | Ga0070702_100015955 | 3300005615 | Bacteria | 3846 |
| 256 | Ga0070702_100036883 | 3300005615 | Bacteria | 2712 |
| 257 | Ga0070702_100039137 | 3300005615 | Bacteria | 2644 |
| 258 | Ga0070702_100174622 | 3300005615 | Bacteria | 1401 |
| 259 | Ga0070702_100330610 | 3300005615 | Bacteria | 1066 |
| 260 | Ga0070702_100494786 | 3300005615 | Bacteria | 896 |
| 261 | Ga0068852_100087406 | 3300005616 | Bacteria | 2781 |
| 262 | Ga0068852_100537314 | 3300005616 | Bacteria | 1168 |
| 263 | Ga0068852_100627698 | 3300005616 | Bacteria | 1080 |
| 264 | Ga0068859_100005985 | 3300005617 | Bacteria | 12354 |
| 265 | Ga0068859_100056053 | 3300005617 | Bacteria | 3966 |
| 266 | Ga0068859_100067591 | 3300005617 | Bacteria | 3608 |
| 267 | Ga0068859_100102551 | 3300005617 | Bacteria | 2919 |
| 268 | Ga0068859_100109843 | 3300005617 | Bacteria | 2819 |
| 269 | Ga0068859_100129114 | 3300005617 | Bacteria | 2598 |
| 270 | Ga0068859_100156767 | 3300005617 | Bacteria | 2354 |
| 271 | Ga0068859_100237255 | 3300005617 | Bacteria | 1912 |
| 272 | Ga0068859_100296389 | 3300005617 | Bacteria | 1710 |
| 273 | Ga0068859_100496219 | 3300005617 | Bacteria | 1316 |
| 274 | Ga0068859_100522944 | 3300005617 | Bacteria | 1281 |
| 275 | Ga0068859_100816687 | 3300005617 | Bacteria | 1019 |
| 276 | Ga0068864_100021548 | 3300005618 | Bacteria | 5398 |
| 277 | Ga0068864_100041104 | 3300005618 | Bacteria | 3955 |
| 278 | Ga0068864_100049121 | 3300005618 | Bacteria | 3629 |
| 279 | Ga0068864_100051844 | 3300005618 | Bacteria | 3536 |
| 280 | Ga0068864_100056009 | 3300005618 | Bacteria | 3406 |
| 281 | Ga0068864_100063202 | 3300005618 | Bacteria | 3208 |
| 282 | Ga0068864_100154460 | 3300005618 | Bacteria | 2082 |
| 283 | Ga0068864_100556228 | 3300005618 | Bacteria | 1109 |
| 284 | Ga0068864_101039464 | 3300005618 | Unclassified | 813 |
| 285 | Ga0068866_10012501 | 3300005718 | Bacteria | 3700 |
| 286 | Ga0068861_100015822 | 3300005719 | Bacteria | 5326 |
| 287 | Ga0068861_100048837 | 3300005719 | Bacteria | 3201 |
| 288 | Ga0068861_100056288 | 3300005719 | Bacteria | 3001 |
| 289 | Ga0068861_100077905 | 3300005719 | Bacteria | 2587 |
| 290 | Ga0068861_100168921 | 3300005719 | Bacteria | 1811 |
| 291 | Ga0068861_100212775 | 3300005719 | Bacteria | 1629 |
| 292 | Ga0068861_100355548 | 3300005719 | Bacteria | 1286 |
| 293 | Ga0068861_100553071 | 3300005719 | Bacteria | 1049 |
| 294 | Ga0068861_100725438 | 3300005719 | Unclassified | 926 |
| 295 | Ga0068851_10036164 | 3300005834 | Bacteria | 2472 |
| 296 | Ga0068870_10009612 | 3300005840 | Bacteria | 4406 |
| 297 | Ga0068870_10024974 | 3300005840 | Bacteria | 2962 |
| 298 | Ga0068870_10063049 | 3300005840 | Bacteria | 1998 |
| 299 | Ga0068863_100042226 | 3300005841 | Bacteria | 4333 |
| 300 | Ga0068863_100082290 | 3300005841 | Bacteria | 3050 |
| 301 | Ga0068863_100116302 | 3300005841 | Bacteria | 2548 |
| 302 | Ga0068863_100537209 | 3300005841 | Bacteria | 1154 |
| 303 | Ga0068863_100588034 | 3300005841 | Bacteria | 1101 |
| 304 | Ga0068863_100593222 | 3300005841 | Bacteria | 1096 |
| 305 | Ga0068863_100764867 | 3300005841 | Bacteria | 962 |
| 306 | Ga0068858_100008879 | 3300005842 | Bacteria | 9636 |
| 307 | Ga0068858_100105533 | 3300005842 | Bacteria | 2629 |
| 308 | Ga0068858_100110403 | 3300005842 | Bacteria | 2568 |
| 309 | Ga0068858_100136860 | 3300005842 | Bacteria | 2298 |
| 310 | Ga0068858_100292735 | 3300005842 | Bacteria | 1552 |
| 311 | Ga0068858_100428199 | 3300005842 | Unclassified | 1273 |
| 312 | Ga0068858_100672416 | 3300005842 | Bacteria | 1007 |
| 313 | Ga0068858_100749463 | 3300005842 | Bacteria | 951 |
| 314 | Ga0068858_101164130 | 3300005842 | Bacteria | 758 |
| 315 | Ga0068860_100057451 | 3300005843 | Bacteria | 3699 |
| 316 | Ga0068860_100102558 | 3300005843 | Bacteria | 2730 |
| 317 | Ga0068860_100136406 | 3300005843 | Bacteria | 2356 |
| 318 | Ga0068860_100171331 | 3300005843 | Bacteria | 2097 |
| 319 | Ga0068860_100320613 | 3300005843 | Bacteria | 1521 |
| 320 | Ga0068860_100337596 | 3300005843 | Bacteria | 1481 |
| 321 | Ga0068860_100669072 | 3300005843 | Bacteria | 1047 |
| 322 | Ga0068862_100009823 | 3300005844 | Bacteria | 7905 |
| 323 | Ga0068862_100022289 | 3300005844 | Bacteria | 5297 |
| 324 | Ga0068862_100039853 | 3300005844 | Bacteria | 3991 |
| 325 | Ga0068862_100040779 | 3300005844 | Bacteria | 3947 |
| 326 | Ga0068862_100447220 | 3300005844 | Bacteria | 1217 |
| 327 | Ga0081540_1142299 | 3300005983 | Unclassified | 960 |
| 328 | Ga0081539_10000976 | 3300005985 | Bacteria | 53364 |
| 329 | Ga0081539_10003361 | 3300005985 | Bacteria | 19802 |
| 330 | Ga0081539_10005422 | 3300005985 | Bacteria | 13033 |
| 331 | Ga0070715_10000039 | 3300006163 | Bacteria | 66918 |
| 332 | Ga0070716_100113914 | 3300006173 | Bacteria | 1681 |
| 333 | Ga0097621_100061660 | 3300006237 | Bacteria | 3076 |
| 334 | Ga0097621_100389719 | 3300006237 | Bacteria | 1245 |
| 335 | Ga0097621_100552084 | 3300006237 | Bacteria | 1048 |
| 336 | Ga0068871_100005005 | 3300006358 | Bacteria | 9259 |
| 337 | Ga0068871_100059136 | 3300006358 | Bacteria | 3122 |
| 338 | Ga0075428_100081117 | 3300006844 | Bacteria | 3541 |
| 339 | Ga0075430_100058059 | 3300006846 | Bacteria | 3253 |
| 340 | Ga0075430_100148436 | 3300006846 | Bacteria | 1952 |
| 341 | Ga0075430_100189610 | 3300006846 | Bacteria | 1709 |
| 342 | Ga0075431_100126819 | 3300006847 | Bacteria | 2633 |
| 343 | Ga0075431_100530951 | 3300006847 | Unclassified | 1165 |
| 344 | Ga0075433_10032041 | 3300006852 | Bacteria | 4499 |
| 345 | Ga0075433_10036894 | 3300006852 | Bacteria | 4213 |
| 346 | Ga0075433_10080731 | 3300006852 | Bacteria | 2867 |
| 347 | Ga0075433_10113009 | 3300006852 | Bacteria | 2409 |
| 348 | Ga0075433_10315016 | 3300006852 | Bacteria | 1384 |
| 349 | Ga0075434_100017958 | 3300006871 | Bacteria | 6825 |
| 350 | Ga0075434_100034935 | 3300006871 | Bacteria | 4968 |
| 351 | Ga0075434_100093178 | 3300006871 | Bacteria | 3015 |
| 352 | Ga0075434_100171056 | 3300006871 | Bacteria | 2193 |
| 353 | Ga0075434_100238187 | 3300006871 | Bacteria | 1840 |
| 354 | Ga0075429_100029946 | 3300006880 | Bacteria | 4728 |
| 355 | Ga0075429_100049604 | 3300006880 | Bacteria | 3650 |
| 356 | Ga0075429_100128517 | 3300006880 | Bacteria | 2216 |
| 357 | Ga0075429_100248821 | 3300006880 | Bacteria | 1556 |
| 358 | Ga0075429_100353225 | 3300006880 | Bacteria | 1287 |
| 359 | Ga0068865_100012683 | 3300006881 | Bacteria | 5311 |
| 360 | Ga0068865_100166495 | 3300006881 | Bacteria | 1686 |
| 361 | Ga0068865_100269210 | 3300006881 | Bacteria | 1352 |
| 362 | Ga0075436_100015347 | 3300006914 | Bacteria | 5247 |
| 363 | Ga0075436_100152989 | 3300006914 | Bacteria | 1624 |
| 364 | Ga0075436_100519687 | 3300006914 | Unclassified | 872 |
| 365 | Ga0097620_100005985 | 3300006931 | Bacteria | 12354 |
| 366 | Ga0097620_100056054 | 3300006931 | Bacteria | 3966 |
| 367 | Ga0097620_100067591 | 3300006931 | Bacteria | 3608 |
| 368 | Ga0097620_100102553 | 3300006931 | Bacteria | 2919 |
| 369 | Ga0097620_100109848 | 3300006931 | Bacteria | 2819 |
| 370 | Ga0097620_100129107 | 3300006931 | Bacteria | 2598 |
| 371 | Ga0097620_100156772 | 3300006931 | Bacteria | 2354 |
| 372 | Ga0097620_100237249 | 3300006931 | Bacteria | 1912 |
| 373 | Ga0097620_100296397 | 3300006931 | Bacteria | 1710 |
| 374 | Ga0097620_100496266 | 3300006931 | Bacteria | 1316 |
| 375 | Ga0097620_100522942 | 3300006931 | Bacteria | 1281 |
| 376 | Ga0097620_100816681 | 3300006931 | Bacteria | 1019 |
| 377 | Ga0075435_100020792 | 3300007076 | Bacteria | 5037 |
| 378 | Ga0099794_10040454 | 3300007265 | Bacteria | 2216 |
| 379 | Ga0105251_10039112 | 3300009011 | Bacteria | 2319 |
| 380 | Ga0105240_10171414 | 3300009093 | Bacteria | 2570 |
| 381 | Ga0105240_10332740 | 3300009093 | Bacteria | 1727 |
| 382 | Ga0105240_11074102 | 3300009093 | Bacteria | 858 |
| 383 | Ga0111539_10005598 | 3300009094 | Bacteria | 16251 |
| 384 | Ga0111539_10022660 | 3300009094 | Bacteria | 7715 |
| 385 | Ga0111539_10111096 | 3300009094 | Bacteria | 3216 |
| 386 | Ga0111539_10155362 | 3300009094 | Bacteria | 2677 |
| 387 | Ga0111539_10442820 | 3300009094 | Bacteria | 1513 |
| 388 | Ga0105245_10018594 | 3300009098 | Bacteria | 6078 |
| 389 | Ga0105245_10349965 | 3300009098 | Bacteria | 1464 |
| 390 | Ga0105245_10754080 | 3300009098 | Bacteria | 1009 |
| 391 | Ga0105247_10000050 | 3300009101 | Bacteria | 146183 |
| 392 | Ga0105247_10057749 | 3300009101 | Bacteria | 2399 |
| 393 | Ga0105247_10125804 | 3300009101 | Bacteria | 1666 |
| 394 | Ga0105247_10312562 | 3300009101 | Bacteria | 1094 |
| 395 | Ga0105247_10327849 | 3300009101 | Bacteria | 1070 |
| 396 | Ga0114129_10033278 | 3300009147 | Bacteria | 7285 |
| 397 | Ga0114129_10051383 | 3300009147 | Bacteria | 5787 |
| 398 | Ga0114129_10134336 | 3300009147 | Bacteria | 3396 |
| 399 | Ga0114129_10152363 | 3300009147 | Bacteria | 3163 |
| 400 | Ga0114129_10165342 | 3300009147 | Bacteria | 3020 |
| 401 | Ga0114129_10253970 | 3300009147 | Bacteria | 2359 |
| 402 | Ga0114129_10468658 | 3300009147 | Bacteria | 1650 |
| 403 | Ga0114129_10605425 | 3300009147 | Bacteria | 1419 |
| 404 | Ga0105243_10001520 | 3300009148 | Bacteria | 20276 |
| 405 | Ga0105243_10007055 | 3300009148 | Bacteria | 8639 |
| 406 | Ga0105243_10031915 | 3300009148 | Bacteria | 4064 |
| 407 | Ga0105243_10038543 | 3300009148 | Bacteria | 3722 |
| 408 | Ga0105243_10291002 | 3300009148 | Unclassified | 1476 |
| 409 | Ga0105243_10516701 | 3300009148 | Bacteria | 1135 |
| 410 | Ga0105243_11331636 | 3300009148 | Bacteria | 736 |
| 411 | Ga0105241_10091628 | 3300009174 | Bacteria | 2399 |
| 412 | Ga0105241_10142240 | 3300009174 | Bacteria | 1955 |
| 413 | Ga0105241_10203148 | 3300009174 | Bacteria | 1656 |
| 414 | Ga0105241_10331343 | 3300009174 | Bacteria | 1316 |
| 415 | Ga0105241_10602845 | 3300009174 | Bacteria | 992 |
| 416 | Ga0105241_10854187 | 3300009174 | Bacteria | 842 |
| 417 | Ga0105242_10001223 | 3300009176 | Bacteria | 20281 |
| 418 | Ga0105242_10034629 | 3300009176 | Bacteria | 4049 |
| 419 | Ga0105242_10045777 | 3300009176 | Bacteria | 3547 |
| 420 | Ga0105242_10159698 | 3300009176 | Bacteria | 1972 |
| 421 | Ga0105242_10342883 | 3300009176 | Bacteria | 1377 |
| 422 | Ga0105242_10405198 | 3300009176 | Bacteria | 1274 |
| 423 | Ga0105242_10667596 | 3300009176 | Bacteria | 1013 |
| 424 | Ga0105242_11026118 | 3300009176 | Bacteria | 834 |
| 425 | Ga0105248_10015006 | 3300009177 | Bacteria | 8528 |
| 426 | Ga0105248_10043401 | 3300009177 | Bacteria | 5041 |
| 427 | Ga0105248_10053458 | 3300009177 | Bacteria | 4532 |
| 428 | Ga0105248_10108633 | 3300009177 | Bacteria | 3128 |
| 429 | Ga0105248_10129394 | 3300009177 | Bacteria | 2848 |
| 430 | Ga0105248_10168767 | 3300009177 | Bacteria | 2466 |
| 431 | Ga0105248_10247200 | 3300009177 | Bacteria | 2008 |
| 432 | Ga0105248_10257463 | 3300009177 | Bacteria | 1965 |
| 433 | Ga0105248_11083496 | 3300009177 | Bacteria | 905 |
| 434 | Ga0105248_11228796 | 3300009177 | Bacteria | 847 |
| 435 | Ga0105248_11269653 | 3300009177 | Bacteria | 833 |
| 436 | Ga0105237_10007174 | 3300009545 | Bacteria | 12244 |
| 437 | Ga0105237_10053364 | 3300009545 | Bacteria | 4054 |
| 438 | Ga0105237_10062079 | 3300009545 | Bacteria | 3735 |
| 439 | Ga0105237_10220127 | 3300009545 | Bacteria | 1898 |
| 440 | Ga0105237_10674263 | 3300009545 | Bacteria | 1041 |
| 441 | Ga0105238_10036920 | 3300009551 | Bacteria | 4969 |
| 442 | Ga0105238_10124612 | 3300009551 | Bacteria | 2556 |
| 443 | Ga0105238_10533444 | 3300009551 | Bacteria | 1177 |
| 444 | Ga0105249_10013119 | 3300009553 | Bacteria | 7312 |
| 445 | Ga0105249_10025118 | 3300009553 | Bacteria | 5362 |
| 446 | Ga0105249_10026857 | 3300009553 | Bacteria | 5191 |
| 447 | Ga0105249_10100720 | 3300009553 | Bacteria | 2717 |
| 448 | Ga0105249_10613873 | 3300009553 | Bacteria | 1143 |
| 449 | Ga0105239_10201039 | 3300010375 | Bacteria | 2232 |
| 450 | Ga0105239_10287476 | 3300010375 | Bacteria | 1851 |
| 451 | Ga0105246_10015588 | 3300011119 | Bacteria | 4802 |
| 452 | Ga0105246_10184623 | 3300011119 | Bacteria | 1609 |
| 453 | Ga0105246_10223515 | 3300011119 | Bacteria | 1477 |
| 454 | Ga0105246_10315615 | 3300011119 | Bacteria | 1268 |
| 455 | Ga0105246_10701331 | 3300011119 | Unclassified | 887 |
| 456 | Ga0105246_10704992 | 3300011119 | Bacteria | 885 |
| 457 | Ga0157373_10021532 | 3300013100 | Bacteria | 4682 |
| 458 | Ga0157373_10041447 | 3300013100 | Bacteria | 3294 |
| 459 | Ga0157373_10052446 | 3300013100 | Bacteria | 2902 |
| 460 | Ga0157373_10257455 | 3300013100 | Bacteria | 1235 |
| 461 | Ga0157373_10393453 | 3300013100 | Bacteria | 993 |
| 462 | Ga0157373_10437356 | 3300013100 | Bacteria | 940 |
| 463 | Ga0157371_10326027 | 3300013102 | Bacteria | 1115 |
| 464 | Ga0157374_10050453 | 3300013296 | Bacteria | 3868 |
| 465 | Ga0157374_10104758 | 3300013296 | Bacteria | 2716 |
| 466 | Ga0157378_10026642 | 3300013297 | Bacteria | 5095 |
| 467 | Ga0157378_10061204 | 3300013297 | Bacteria | 3359 |
| 468 | Ga0157378_10095561 | 3300013297 | Bacteria | 2707 |
| 469 | Ga0157378_10118185 | 3300013297 | Bacteria | 2440 |
| 470 | Ga0157378_10129961 | 3300013297 | Bacteria | 2331 |
| 471 | Ga0157378_10150111 | 3300013297 | Bacteria | 2171 |
| 472 | Ga0157378_10182405 | 3300013297 | Bacteria | 1975 |
| 473 | Ga0157378_10459996 | 3300013297 | Bacteria | 1264 |
| 474 | Ga0157378_10527306 | 3300013297 | Bacteria | 1183 |
| 475 | Ga0157378_10724135 | 3300013297 | Bacteria | 1016 |
| 476 | Ga0157378_11099146 | 3300013297 | Bacteria | 832 |
| 477 | Ga0163162_10000784 | 3300013306 | Bacteria | 29548 |
| 478 | Ga0163162_10004596 | 3300013306 | Bacteria | 13298 |
| 479 | Ga0163162_10006687 | 3300013306 | Bacteria | 11182 |
| 480 | Ga0163162_10041843 | 3300013306 | Bacteria | 4584 |
| 481 | Ga0163162_10051628 | 3300013306 | Bacteria | 4126 |
| 482 | Ga0163162_10112004 | 3300013306 | Bacteria | 2827 |
| 483 | Ga0163162_10337071 | 3300013306 | Bacteria | 1640 |
| 484 | Ga0163162_10366884 | 3300013306 | Unclassified | 1573 |
| 485 | Ga0157372_10095280 | 3300013307 | Bacteria | 3391 |
| 486 | Ga0157372_10107622 | 3300013307 | Bacteria | 3190 |
| 487 | Ga0157372_10194152 | 3300013307 | Unclassified | 2352 |
| 488 | Ga0157372_10204237 | 3300013307 | Bacteria | 2289 |
| 489 | Ga0157375_10045126 | 3300013308 | Bacteria | 4289 |
| 490 | Ga0157375_10094256 | 3300013308 | Bacteria | 3062 |
| 491 | Ga0157375_10094340 | 3300013308 | Bacteria | 3061 |
| 492 | Ga0157375_10302145 | 3300013308 | Bacteria | 1764 |
| 493 | Ga0157375_10531190 | 3300013308 | Bacteria | 1339 |
| 494 | Ga0157375_10561574 | 3300013308 | Bacteria | 1302 |
| 495 | Ga0157375_10972718 | 3300013308 | Bacteria | 990 |
| 496 | Ga0157375_11293573 | 3300013308 | Bacteria | 857 |
| 497 | Ga0163163_10006543 | 3300014325 | Bacteria | 10202 |
| 498 | Ga0163163_10011579 | 3300014325 | Bacteria | 8011 |
| 499 | Ga0163163_10037229 | 3300014325 | Bacteria | 4732 |
| 500 | Ga0163163_10058422 | 3300014325 | Bacteria | 3814 |
| 501 | Ga0163163_10061741 | 3300014325 | Bacteria | 3713 |
| 502 | Ga0163163_10134020 | 3300014325 | Bacteria | 2518 |
| 503 | Ga0163163_10277204 | 3300014325 | Bacteria | 1728 |
| 504 | Ga0163163_10300848 | 3300014325 | Bacteria | 1657 |
| 505 | Ga0163163_10356018 | 3300014325 | Bacteria | 1520 |
| 506 | Ga0163163_10416433 | 3300014325 | Bacteria | 1402 |
| 507 | Ga0163163_10450424 | 3300014325 | Bacteria | 1347 |
| 508 | Ga0157380_10005145 | 3300014326 | Bacteria | 9138 |
| 509 | Ga0157380_10006345 | 3300014326 | Bacteria | 8316 |
| 510 | Ga0157380_10019969 | 3300014326 | Bacteria | 5001 |
| 511 | Ga0157380_10027759 | 3300014326 | Bacteria | 4307 |
| 512 | Ga0157380_10073876 | 3300014326 | Bacteria | 2766 |
| 513 | Ga0157380_10102702 | 3300014326 | Bacteria | 2384 |
| 514 | Ga0157380_10259179 | 3300014326 | Bacteria | 1578 |
| 515 | Ga0157380_10339091 | 3300014326 | Bacteria | 1401 |
| 516 | Ga0157377_10051456 | 3300014745 | Bacteria | 2323 |
| 517 | Ga0157377_10285994 | 3300014745 | Bacteria | 1083 |
| 518 | Ga0157379_10037517 | 3300014968 | Bacteria | 4322 |
| 519 | Ga0157379_10229529 | 3300014968 | Bacteria | 1682 |
| 520 | Ga0157376_10009083 | 3300014969 | Bacteria | 7202 |
| 521 | Ga0157376_10087182 | 3300014969 | Bacteria | 2693 |
| 522 | Ga0157376_11164402 | 3300014969 | Unclassified | 798 |
| 523 | Ga0163161_10011008 | 3300017792 | Bacteria | 6268 |
| 524 | Ga0163161_10023268 | 3300017792 | Bacteria | 4370 |
| 525 | Ga0163161_10183133 | 3300017792 | Bacteria | 1607 |
| 526 | Ga0213876_10000189 | 3300021384 | Bacteria | 64122 |
| 527 | Ga0213876_10012169 | 3300021384 | Bacteria | 4582 |
| 528 | Ga0213876_10043703 | 3300021384 | Bacteria | 2368 |
| 529 | Ga0207672_1000149 | 3300025223 | Bacteria | 9525 |
| 530 | Ga0207653_10000289 | 3300025885 | Bacteria | 29336 |
| 531 | Ga0207653_10023644 | 3300025885 | Bacteria | 1958 |
| 532 | Ga0207653_10084115 | 3300025885 | Bacteria | 1106 |
| 533 | Ga0207653_10125349 | 3300025885 | Bacteria | 928 |
| 534 | Ga0207710_10000003 | 3300025900 | Bacteria | 1071597 |
| 535 | Ga0207710_10008744 | 3300025900 | Bacteria | 4267 |
| 536 | Ga0207710_10166752 | 3300025900 | Bacteria | 1075 |
| 537 | Ga0207710_10248278 | 3300025900 | Bacteria | 889 |
| 538 | Ga0207688_10229092 | 3300025901 | Bacteria | 1121 |
| 539 | Ga0207680_10023352 | 3300025903 | Bacteria | 3376 |
| 540 | Ga0207647_10102056 | 3300025904 | Bacteria | 1701 |
| 541 | Ga0207647_10119899 | 3300025904 | Unclassified | 1551 |
| 542 | Ga0207647_10156058 | 3300025904 | Bacteria | 1333 |
| 543 | Ga0207685_10000024 | 3300025905 | Bacteria | 113741 |
| 544 | Ga0207645_10063229 | 3300025907 | Bacteria | 2365 |
| 545 | Ga0207645_10339849 | 3300025907 | Bacteria | 1003 |
| 546 | Ga0207643_10020369 | 3300025908 | Bacteria | 3640 |
| 547 | Ga0207643_10087555 | 3300025908 | Bacteria | 1811 |
| 548 | Ga0207643_10122340 | 3300025908 | Bacteria | 1542 |
| 549 | Ga0207684_10000085 | 3300025910 | Bacteria | 175922 |
| 550 | Ga0207684_10003150 | 3300025910 | Bacteria | 16233 |
| 551 | Ga0207684_10085853 | 3300025910 | Bacteria | 2680 |
| 552 | Ga0207684_10152505 | 3300025910 | Bacteria | 1988 |
| 553 | Ga0207684_10329167 | 3300025910 | Bacteria | 1316 |
| 554 | Ga0207654_10013384 | 3300025911 | Bacteria | 4221 |
| 555 | Ga0207654_10110300 | 3300025911 | Bacteria | 1711 |
| 556 | Ga0207654_10438647 | 3300025911 | Unclassified | 914 |
| 557 | Ga0207654_10647373 | 3300025911 | Bacteria | 757 |
| 558 | Ga0207707_10000503 | 3300025912 | Bacteria | 40256 |
| 559 | Ga0207707_10050582 | 3300025912 | Bacteria | 3619 |
| 560 | Ga0207707_10168562 | 3300025912 | Bacteria | 1913 |
| 561 | Ga0207695_10081076 | 3300025913 | Bacteria | 3285 |
| 562 | Ga0207695_10250144 | 3300025913 | Unclassified | 1672 |
| 563 | Ga0207671_10004181 | 3300025914 | Bacteria | 13939 |
| 564 | Ga0207671_10266569 | 3300025914 | Bacteria | 1349 |
| 565 | Ga0207671_10275488 | 3300025914 | Bacteria | 1326 |
| 566 | Ga0207660_10001058 | 3300025917 | Bacteria | 18239 |
| 567 | Ga0207660_10122254 | 3300025917 | Bacteria | 1972 |
| 568 | Ga0207662_10005060 | 3300025918 | Bacteria | 6986 |
| 569 | Ga0207662_10040549 | 3300025918 | Bacteria | 2738 |
| 570 | Ga0207662_10059769 | 3300025918 | Bacteria | 2285 |
| 571 | Ga0207662_10071042 | 3300025918 | Bacteria | 2107 |
| 572 | Ga0207662_10460748 | 3300025918 | Bacteria | 871 |
| 573 | Ga0207657_10084649 | 3300025919 | Bacteria | 2657 |
| 574 | Ga0207649_10024546 | 3300025920 | Bacteria | 3506 |
| 575 | Ga0207652_10000427 | 3300025921 | Bacteria | 43779 |
| 576 | Ga0207652_10123680 | 3300025921 | Bacteria | 2303 |
| 577 | Ga0207646_10005737 | 3300025922 | Bacteria | 13012 |
| 578 | Ga0207646_10005747 | 3300025922 | Bacteria | 13005 |
| 579 | Ga0207646_10011116 | 3300025922 | Bacteria | 8741 |
| 580 | Ga0207646_10032750 | 3300025922 | Bacteria | 4702 |
| 581 | Ga0207646_10124327 | 3300025922 | Bacteria | 2319 |
| 582 | Ga0207646_10125665 | 3300025922 | Bacteria | 2306 |
| 583 | Ga0207646_10734902 | 3300025922 | Bacteria | 881 |
| 584 | Ga0207681_10004264 | 3300025923 | Bacteria | 8825 |
| 585 | Ga0207681_10005504 | 3300025923 | Bacteria | 7776 |
| 586 | Ga0207681_10150053 | 3300025923 | Bacteria | 1746 |
| 587 | Ga0207681_10469556 | 3300025923 | Bacteria | 1026 |
| 588 | Ga0207681_10679801 | 3300025923 | Bacteria | 855 |
| 589 | Ga0207694_10004209 | 3300025924 | Bacteria | 11267 |
| 590 | Ga0207694_10070744 | 3300025924 | Bacteria | 2726 |
| 591 | Ga0207650_10000028 | 3300025925 | Bacteria | 236867 |
| 592 | Ga0207650_10002078 | 3300025925 | Bacteria | 14001 |
| 593 | Ga0207650_10103447 | 3300025925 | Bacteria | 2196 |
| 594 | Ga0207650_10194481 | 3300025925 | Bacteria | 1622 |
| 595 | Ga0207650_10215666 | 3300025925 | Bacteria | 1543 |
| 596 | Ga0207650_10304601 | 3300025925 | Bacteria | 1302 |
| 597 | Ga0207650_10480823 | 3300025925 | Bacteria | 1036 |
| 598 | Ga0207659_10049731 | 3300025926 | Bacteria | 2975 |
| 599 | Ga0207659_10293103 | 3300025926 | Bacteria | 1334 |
| 600 | Ga0207687_10053920 | 3300025927 | Bacteria | 2811 |
| 601 | Ga0207687_10315948 | 3300025927 | Bacteria | 1263 |
| 602 | Ga0207644_10001958 | 3300025931 | Bacteria | 13331 |
| 603 | Ga0207644_10003226 | 3300025931 | Bacteria | 10516 |
| 604 | Ga0207644_10034752 | 3300025931 | Bacteria | 3528 |
| 605 | Ga0207644_10650219 | 3300025931 | Bacteria | 878 |
| 606 | Ga0207690_10003154 | 3300025932 | Bacteria | 9900 |
| 607 | Ga0207690_10930261 | 3300025932 | Bacteria | 722 |
| 608 | Ga0207706_10050740 | 3300025933 | Bacteria | 3666 |
| 609 | Ga0207706_10352273 | 3300025933 | Unclassified | 1280 |
| 610 | Ga0207706_10388538 | 3300025933 | Bacteria | 1210 |
| 611 | Ga0207706_10408407 | 3300025933 | Bacteria | 1177 |
| 612 | Ga0207686_10000392 | 3300025934 | Bacteria | 30379 |
| 613 | Ga0207686_10000659 | 3300025934 | Bacteria | 21331 |
| 614 | Ga0207686_10010563 | 3300025934 | Bacteria | 5030 |
| 615 | Ga0207686_10098042 | 3300025934 | Bacteria | 1951 |
| 616 | Ga0207686_10121904 | 3300025934 | Bacteria | 1776 |
| 617 | Ga0207686_10327456 | 3300025934 | Bacteria | 1147 |
| 618 | Ga0207709_10000037 | 3300025935 | Bacteria | 279771 |
| 619 | Ga0207709_10034818 | 3300025935 | Bacteria | 2972 |
| 620 | Ga0207709_10045264 | 3300025935 | Bacteria | 2664 |
| 621 | Ga0207709_10053093 | 3300025935 | Bacteria | 2493 |
| 622 | Ga0207709_10101498 | 3300025935 | Bacteria | 1903 |
| 623 | Ga0207709_10163669 | 3300025935 | Bacteria | 1554 |
| 624 | Ga0207709_10875139 | 3300025935 | Bacteria | 729 |
| 625 | Ga0207670_10002963 | 3300025936 | Bacteria | 8965 |
| 626 | Ga0207670_10046086 | 3300025936 | Bacteria | 2894 |
| 627 | Ga0207670_10182241 | 3300025936 | Bacteria | 1583 |
| 628 | Ga0207669_10141252 | 3300025937 | Bacteria | 1672 |
| 629 | Ga0207704_10010523 | 3300025938 | Bacteria | 4518 |
| 630 | Ga0207704_10566315 | 3300025938 | Bacteria | 925 |
| 631 | Ga0207665_10011629 | 3300025939 | Bacteria | 5783 |
| 632 | Ga0207665_10160343 | 3300025939 | Bacteria | 1617 |
| 633 | Ga0207691_10002381 | 3300025940 | Bacteria | 18401 |
| 634 | Ga0207691_10032538 | 3300025940 | Bacteria | 4862 |
| 635 | Ga0207691_10201269 | 3300025940 | Bacteria | 1733 |
| 636 | Ga0207711_10087939 | 3300025941 | Bacteria | 2727 |
| 637 | Ga0207711_10208116 | 3300025941 | Bacteria | 1787 |
| 638 | Ga0207711_10217021 | 3300025941 | Bacteria | 1748 |
| 639 | Ga0207711_10230622 | 3300025941 | Bacteria | 1696 |
| 640 | Ga0207711_10536294 | 3300025941 | Bacteria | 1091 |
| 641 | Ga0207689_10013420 | 3300025942 | Bacteria | 6995 |
| 642 | Ga0207689_10028316 | 3300025942 | Bacteria | 4687 |
| 643 | Ga0207689_10037371 | 3300025942 | Bacteria | 4027 |
| 644 | Ga0207689_10042361 | 3300025942 | Bacteria | 3767 |
| 645 | Ga0207689_10080358 | 3300025942 | Bacteria | 2680 |
| 646 | Ga0207689_10110965 | 3300025942 | Bacteria | 2254 |
| 647 | Ga0207689_10131493 | 3300025942 | Bacteria | 2060 |
| 648 | Ga0207689_10645341 | 3300025942 | Bacteria | 892 |
| 649 | Ga0207689_10756769 | 3300025942 | Bacteria | 820 |
| 650 | Ga0207679_10057001 | 3300025945 | Bacteria | 2888 |
| 651 | Ga0207679_10397717 | 3300025945 | Bacteria | 1211 |
| 652 | Ga0207679_10444615 | 3300025945 | Bacteria | 1149 |
| 653 | Ga0207679_10961693 | 3300025945 | Bacteria | 782 |
| 654 | Ga0207667_10281602 | 3300025949 | Bacteria | 1699 |
| 655 | Ga0207667_10909858 | 3300025949 | Bacteria | 871 |
| 656 | Ga0207651_10026556 | 3300025960 | Bacteria | 3620 |
| 657 | Ga0207651_10042074 | 3300025960 | Bacteria | 3038 |
| 658 | Ga0207712_10000586 | 3300025961 | Bacteria | 29417 |
| 659 | Ga0207712_10020659 | 3300025961 | Bacteria | 4316 |
| 660 | Ga0207712_10064063 | 3300025961 | Bacteria | 2619 |
| 661 | Ga0207668_10009419 | 3300025972 | Bacteria | 5854 |
| 662 | Ga0207640_10088859 | 3300025981 | Bacteria | 2134 |
| 663 | Ga0207640_10451175 | 3300025981 | Unclassified | 1060 |
| 664 | Ga0207658_10133133 | 3300025986 | Bacteria | 2000 |
| 665 | Ga0207658_10613166 | 3300025986 | Bacteria | 978 |
| 666 | Ga0207677_10038376 | 3300026023 | Bacteria | 3140 |
| 667 | Ga0207677_10273050 | 3300026023 | Bacteria | 1384 |
| 668 | Ga0207703_10000355 | 3300026035 | Bacteria | 49221 |
| 669 | Ga0207703_10080321 | 3300026035 | Bacteria | 2715 |
| 670 | Ga0207703_10086633 | 3300026035 | Bacteria | 2624 |
| 671 | Ga0207703_10088339 | 3300026035 | Bacteria | 2601 |
| 672 | Ga0207703_10411899 | 3300026035 | Bacteria | 1256 |
| 673 | Ga0207639_10013858 | 3300026041 | Bacteria | 5654 |
| 674 | Ga0207639_10071514 | 3300026041 | Bacteria | 2713 |
| 675 | Ga0207639_10132216 | 3300026041 | Bacteria | 2067 |
| 676 | Ga0207639_10798569 | 3300026041 | Unclassified | 879 |
| 677 | Ga0207708_10008557 | 3300026075 | Bacteria | 7571 |
| 678 | Ga0207708_10011438 | 3300026075 | Bacteria | 6610 |
| 679 | Ga0207708_10020009 | 3300026075 | Bacteria | 5047 |
| 680 | Ga0207708_10054210 | 3300026075 | Bacteria | 3057 |
| 681 | Ga0207708_10174764 | 3300026075 | Bacteria | 1703 |
| 682 | Ga0207708_10185355 | 3300026075 | Bacteria | 1653 |
| 683 | Ga0207708_10309400 | 3300026075 | Bacteria | 1287 |
| 684 | Ga0207708_10459200 | 3300026075 | Bacteria | 1062 |
| 685 | Ga0207702_10003231 | 3300026078 | Bacteria | 15058 |
| 686 | Ga0207641_10060418 | 3300026088 | Bacteria | 3231 |
| 687 | Ga0207641_10239501 | 3300026088 | Unclassified | 1690 |
| 688 | Ga0207641_10280753 | 3300026088 | Bacteria | 1566 |
| 689 | Ga0207641_10538699 | 3300026088 | Bacteria | 1137 |
| 690 | Ga0207641_10865173 | 3300026088 | Bacteria | 896 |
| 691 | Ga0207648_10050189 | 3300026089 | Bacteria | 3649 |
| 692 | Ga0207648_10052615 | 3300026089 | Bacteria | 3561 |
| 693 | Ga0207648_10079277 | 3300026089 | Bacteria | 2865 |
| 694 | Ga0207648_10204062 | 3300026089 | Bacteria | 1754 |
| 695 | Ga0207648_10260934 | 3300026089 | Bacteria | 1546 |
| 696 | Ga0207648_10453890 | 3300026089 | Bacteria | 1167 |
| 697 | Ga0207648_10565020 | 3300026089 | Unclassified | 1046 |
| 698 | Ga0207648_10705433 | 3300026089 | Bacteria | 935 |
| 699 | Ga0207676_10029900 | 3300026095 | Bacteria | 4082 |
| 700 | Ga0207676_10040297 | 3300026095 | Bacteria | 3579 |
| 701 | Ga0207676_10044163 | 3300026095 | Bacteria | 3436 |
| 702 | Ga0207676_10104838 | 3300026095 | Bacteria | 2353 |
| 703 | Ga0207676_10128702 | 3300026095 | Bacteria | 2149 |
| 704 | Ga0207676_10226274 | 3300026095 | Bacteria | 1669 |
| 705 | Ga0207676_10748236 | 3300026095 | Bacteria | 950 |
| 706 | Ga0207674_10006877 | 3300026116 | Bacteria | 13328 |
| 707 | Ga0207674_10215525 | 3300026116 | Bacteria | 1868 |
| 708 | Ga0207674_10301940 | 3300026116 | Bacteria | 1550 |
| 709 | Ga0207674_10781764 | 3300026116 | Bacteria | 921 |
| 710 | Ga0207675_100014977 | 3300026118 | Bacteria | 7238 |
| 711 | Ga0207675_100017801 | 3300026118 | Bacteria | 6629 |
| 712 | Ga0207675_100021754 | 3300026118 | Bacteria | 5970 |
| 713 | Ga0207675_100047591 | 3300026118 | Bacteria | 4003 |
| 714 | Ga0207675_100057101 | 3300026118 | Bacteria | 3642 |
| 715 | Ga0207675_100116020 | 3300026118 | Bacteria | 2530 |
| 716 | Ga0207675_100215370 | 3300026118 | Bacteria | 1849 |
| 717 | Ga0207675_100232587 | 3300026118 | Bacteria | 1778 |
| 718 | Ga0207675_100284789 | 3300026118 | Bacteria | 1606 |
| 719 | Ga0207683_10025820 | 3300026121 | Bacteria | 5068 |
| 720 | Ga0207698_10267356 | 3300026142 | Bacteria | 1574 |
| 721 | Ga0207698_10425608 | 3300026142 | Bacteria | 1275 |
| 722 | Ga0207698_10500083 | 3300026142 | Bacteria | 1183 |
| 723 | Ga0207698_10741452 | 3300026142 | Bacteria | 980 |
| 724 | Ga0209588_1005410 | 3300027671 | Bacteria | 3660 |
| 725 | Ga0207428_10008641 | 3300027907 | Bacteria | 9197 |
| 726 | Ga0207428_10029137 | 3300027907 | Bacteria | 4579 |
| 727 | Ga0207428_10057402 | 3300027907 | Bacteria | 3090 |
| 728 | Ga0207428_10291965 | 3300027907 | Bacteria | 1208 |
| 729 | Ga0268265_10016285 | 3300028380 | Bacteria | 5103 |
| 730 | Ga0268265_10035479 | 3300028380 | Bacteria | 3644 |
| 731 | Ga0268265_10428950 | 3300028380 | Bacteria | 1229 |
| 732 | Ga0268265_11026802 | 3300028380 | Bacteria | 815 |
| 733 | Ga0268264_10067613 | 3300028381 | Bacteria | 3016 |
| 734 | Ga0268264_10073195 | 3300028381 | Bacteria | 2907 |
| 735 | Ga0268264_10073340 | 3300028381 | Bacteria | 2905 |
| 736 | Ga0268264_10094740 | 3300028381 | Bacteria | 2582 |
| 737 | Ga0268264_10221688 | 3300028381 | Bacteria | 1741 |
| 738 | Ga0268264_10305727 | 3300028381 | Bacteria | 1499 |
| 739 | Ga0265777_104945 | 3300030877 | Bacteria | 867 |
| 740 | Ga0265339_10062413 | 3300031249 | Bacteria | 2003 |
| 741 | Ga0307513_10006106 | 3300031456 | Bacteria | 15813 |
| 742 | Ga0307513_10535520 | 3300031456 | Unclassified | 885 |
| 743 | Ga0307408_100097520 | 3300031548 | Bacteria | 2233 |
| 744 | Ga0307408_100218128 | 3300031548 | Bacteria | 1555 |
| 745 | Ga0307514_10050235 | 3300031649 | Bacteria | 3239 |
| 746 | Ga0307514_10132139 | 3300031649 | Bacteria | 1716 |
| 747 | Ga0307405_10016948 | 3300031731 | Bacteria | 3987 |
| 748 | Ga0307405_10664672 | 3300031731 | Bacteria | 858 |
| 749 | Ga0307410_10460867 | 3300031852 | Bacteria | 1039 |
| 750 | Ga0307407_10092030 | 3300031903 | Bacteria | 1861 |
| 751 | Ga0307412_10010192 | 3300031911 | Bacteria | 5408 |
| 752 | Ga0307412_10094052 | 3300031911 | Bacteria | 2104 |
| 753 | Ga0307412_10162625 | 3300031911 | Bacteria | 1660 |
| 754 | Ga0307409_100421071 | 3300031995 | Bacteria | 1281 |
| 755 | Ga0307409_100541704 | 3300031995 | Bacteria | 1141 |
| 756 | Ga0307416_100030319 | 3300032002 | Bacteria | 4056 |
| 757 | Ga0307416_100169744 | 3300032002 | Bacteria | 2029 |
| 758 | Ga0307416_100303153 | 3300032002 | Bacteria | 1589 |
| 759 | Ga0307414_10264523 | 3300032004 | Bacteria | 1437 |
| 760 | Ga0307411_10220409 | 3300032005 | Bacteria | 1471 |
| 761 | Ga0307415_100016722 | 3300032126 | Bacteria | 4379 |
| 762 | Ga0307415_100061990 | 3300032126 | Bacteria | 2591 |
| 763 | Ga0307415_100076589 | 3300032126 | Bacteria | 2372 |
| 764 | Ga0307415_100103517 | 3300032126 | Bacteria | 2095 |
| 765 | Ga0316593_10051094 | 3300032168 | Bacteria | 1397 |
| 766 | Ga0316588_1049462 | 3300033528 | Bacteria | 1018 |
| 767 | Ga0373951_0003684 | 3300035091 | Bacteria | 3697 |
| 768 | Ga0373941_0014628 | 3300035115 | Bacteria | 2100 |
| 769 | Ga0373961_0015753 | 3300035241 | Bacteria | 1938 |
| 770 | Ga0395899_0366668 | 3300037312 | Bacteria | 960 |
| 771 | Ga0395900_0449590 | 3300037418 | Bacteria | 1245 |
| 772 | Ga0395900_0456029 | 3300037418 | Bacteria | 1234 |
| 773 | Ga0395900_0701935 | 3300037418 | Bacteria | 945 |
| 774 | Ga0395898_0243037 | 3300037466 | Bacteria | 1717 |
| 775 | Ga0395898_0536086 | 3300037466 | Bacteria | 1112 |
| 776 | Ga0395898_0647476 | 3300037466 | Unclassified | 999 |
| 777 | Ga0395905_0008542 | 3300037471 | Bacteria | 10098 |
| 778 | Ga0395905_0010746 | 3300037471 | Bacteria | 8876 |
| 779 | Ga0395905_0030677 | 3300037471 | Bacteria | 5063 |
| 780 | Ga0395905_0056292 | 3300037471 | Bacteria | 3679 |
| 781 | Ga0395905_0090677 | 3300037471 | Bacteria | 2866 |
| 782 | Ga0395905_0144217 | 3300037471 | Bacteria | 2241 |
| 783 | Ga0395905_0181892 | 3300037471 | Unclassified | 1974 |
| 784 | Ga0395905_0532956 | 3300037471 | Bacteria | 1075 |
| 785 | Ga0436364_0946147 | 3300037853 | Unclassified | 1725 |
| 786 | Ga0395901_0079524 | 3300038443 | Bacteria | 3424 |
| 787 | Ga0395901_0307224 | 3300038443 | Bacteria | 1643 |
| 788 | Ga0395901_0451249 | 3300038443 | Bacteria | 1315 |
| 789 | Ga0242422_00217 | 3300038699 | Bacteria | 3314 |
| 790 | Ga0242420_018381 | 3300038996 | Bacteria | 1230 |
| 791 | Ga0436365_0668830 | 3300039437 | Bacteria | 6208 |
| 792 | Ga0436365_1052004 | 3300039437 | Bacteria | 3676 |
| 793 | Ga0436365_1324789 | 3300039437 | Bacteria | 7439 |
| 794 | Ga0436362_0610441 | 3300039453 | Bacteria | 745 |
| 795 | Ga0439437_004698 | 3300042000 | Bacteria | 1494 |
| 796 | Ga0439455_0024392 | 3300042012 | Bacteria | 1463 |
| 797 | Ga0439462_0018632 | 3300042015 | Bacteria | 1803 |
| 798 | Ga0453684_0135319 | 3300044712 | Bacteria | 2952 |
| 799 | Ga0453684_0298665 | 3300044712 | Bacteria | 1831 |
| 800 | Ga0451576_0042679 | 3300045051 | Bacteria | 4787 |
| 801 | Ga0451576_0123757 | 3300045051 | Bacteria | 2694 |
| 802 | Ga0451576_0467571 | 3300045051 | Bacteria | 1324 |
| 803 | Ga0495662_0049709 | 3300046476 | Bacteria | 2024 |
| 804 | Ga0495610_0044352 | 3300046512 | Bacteria | 2207 |
| 805 | Ga0495620_0062541 | 3300046515 | Bacteria | 1546 |
| 806 | Ga0495631_0123360 | 3300046518 | Bacteria | 1114 |
| 807 | Ga0495663_0000620 | 3300046525 | Bacteria | 12368 |
| 808 | Ga0495598_0001218 | 3300046537 | Bacteria | 4984 |
| 809 | Ga0495621_0002543 | 3300046539 | Bacteria | 4921 |
| 810 | Ga0495621_0035293 | 3300046539 | Bacteria | 1732 |
| 811 | Ga0495656_0154167 | 3300046615 | Bacteria | 1112 |
| 812 | Ga0495647_0244132 | 3300046681 | Unclassified | 798 |
| 813 | Ga0495669_0209013 | 3300046684 | Bacteria | 934 |
| 814 | Ga0495624_0279216 | 3300046690 | Bacteria | 1009 |
| 815 | Ga0495604_0171370 | 3300047317 | Bacteria | 1526 |
| 816 | Ga0495672_0108240 | 3300047320 | Bacteria | 1496 |
| 817 | Ga0495672_0195447 | 3300047320 | Bacteria | 1014 |
| 818 | Ga0496100_0337786 | 3300048903 | Bacteria | 1135 |
| 819 | Ga0496102_0219944 | 3300048905 | Unclassified | 1790 |
| 820 | Ga0496102_0544190 | 3300048905 | Bacteria | 1084 |
| 821 | Ga0496103_0102110 | 3300048906 | Bacteria | 1816 |
| 822 | Ga0496104_0128970 | 3300048907 | Bacteria | 2429 |
| 823 | Ga0496104_0606617 | 3300048907 | Unclassified | 1005 |
| 824 | Ga0496106_0123767 | 3300048909 | Bacteria | 2023 |
| 825 | Ga0496108_0047160 | 3300048911 | Bacteria | 3602 |
| 826 | Ga0496108_0108888 | 3300048911 | Bacteria | 2367 |
| 827 | Ga0496108_0220303 | 3300048911 | Bacteria | 1649 |
| 828 | Ga0496109_0450319 | 3300048912 | Bacteria | 1216 |
| 829 | Ga0496110_0277632 | 3300048913 | Bacteria | 1526 |
| 830 | Ga0496112_0427076 | 3300048915 | Bacteria | 1264 |
| 831 | Ga0496112_0706399 | 3300048915 | Bacteria | 936 |
| 832 | Ga0496113_0069556 | 3300048916 | Bacteria | 2674 |
| 833 | Ga0496113_0620813 | 3300048916 | Bacteria | 865 |
| 834 | Ga0501291_002976 | 3300049514 | Bacteria | 2081 |
| 835 | Ga0501292_008452 | 3300049515 | Bacteria | 1506 |
| 836 | Ga0501298_000210 | 3300049521 | Bacteria | 7431 |
| 837 | Ga0501298_002295 | 3300049521 | Bacteria | 2885 |
| 838 | Ga0501031_0491202 | 3300049568 | Bacteria | 792 |
| 839 | Ga0501032_0241454 | 3300049569 | Bacteria | 1173 |
| 840 | Ga0501036_0609701 | 3300049572 | Bacteria | 905 |
| 841 | Ga0501038_0039911 | 3300049574 | Bacteria | 4103 |
| 842 | Ga0501039_0306734 | 3300049575 | Unclassified | 1248 |
| 843 | Ga0501046_0523599 | 3300049580 | Bacteria | 847 |
| 844 | Ga0501048_0172078 | 3300049582 | Bacteria | 1534 |
| 845 | Ga0501067_0194417 | 3300049583 | Bacteria | 1130 |
| 846 | Ga0501198_004864 | 3300049649 | Bacteria | 1877 |
| 847 | Ga0501198_012550 | 3300049649 | Bacteria | 1275 |
| 848 | Ga0501216_008119 | 3300049660 | Bacteria | 1646 |
| 849 | Ga0501217_001526 | 3300049661 | Bacteria | 4361 |
| 850 | Ga0501217_042366 | 3300049661 | Bacteria | 1162 |
| 851 | Ga0501223_004673 | 3300049663 | Bacteria | 2913 |
| 852 | Ga0501227_000676 | 3300049665 | Bacteria | 7475 |
| 853 | Ga0501227_013089 | 3300049665 | Bacteria | 1823 |
| 854 | Ga0501233_001251 | 3300049668 | Bacteria | 4328 |
| 855 | Ga0501233_082490 | 3300049668 | Bacteria | 829 |
| 856 | Ga0501235_027812 | 3300049669 | Bacteria | 1269 |
| 857 | Ga0501240_007538 | 3300049673 | Bacteria | 1371 |
| 858 | Ga0501243_004136 | 3300049675 | Bacteria | 2169 |
| 859 | Ga0501249_029095 | 3300049679 | Bacteria | 1228 |
| 860 | Ga0501250_005082 | 3300049680 | Bacteria | 1338 |
| 861 | Ga0501257_048050 | 3300049686 | Unclassified | 1060 |
| 862 | Ga0501260_005348 | 3300049689 | Bacteria | 1207 |
| 863 | Ga0501221_029838 | 3300049704 | Bacteria | 1130 |
| 864 | Ga0501225_0005103 | 3300049705 | Bacteria | 3869 |
| 865 | Ga0501225_0008807 | 3300049705 | Bacteria | 2889 |
| 866 | Ga0501225_0043454 | 3300049705 | Bacteria | 1242 |
| 867 | Ga0501229_005706 | 3300049706 | Bacteria | 1531 |
| 868 | Ga0501234_005684 | 3300049707 | Bacteria | 1949 |
| 869 | Ga0501081_0217249 | 3300049743 | Bacteria | 1389 |
| 870 | Ga0501267_004623 | 3300049764 | Bacteria | 1286 |
| 871 | Ga0501268_002066 | 3300049765 | Bacteria | 2598 |
| 872 | Ga0501273_002856 | 3300049770 | Bacteria | 1793 |
| 873 | Ga0501283_000878 | 3300049779 | Bacteria | 3970 |
| 874 | Ga0501045_0137018 | 3300049824 | Bacteria | 1820 |
| 875 | Ga0501212_005060 | 3300049851 | Bacteria | 1727 |
| 876 | Ga0501212_009563 | 3300049851 | Bacteria | 1368 |
| 877 | nmdc:mga05p37_1016194_c1 | 3300050507 | Bacteria | 879 |
| 878 | nmdc:mga05p37_128116_c1 | 3300050507 | Bacteria | 3116 |
| 879 | nmdc:mga05p37_240436_c1 | 3300050507 | Bacteria | 2177 |
| 880 | nmdc:mga05p37_24636_c1 | 3300050507 | Bacteria | 7314 |
| 881 | nmdc:mga05p37_400677_c1 | 3300050507 | Bacteria | 1602 |
| 882 | nmdc:mga05p37_62370_c1 | 3300050507 | Bacteria | 4587 |
| 883 | nmdc:mga05p37_9408_c1 | 3300050507 | Bacteria | 11567 |
| 884 | nmdc:mga09592_290034_c1 | 3300050508 | Bacteria | 1419 |
| 885 | nmdc:mga09592_490396_c1 | 3300050508 | Bacteria | 1058 |
| 886 | nmdc:mga0qj67_19355_c1 | 3300050509 | Bacteria | 5200 |
| 887 | nmdc:mga0qj67_40806_c1 | 3300050509 | Bacteria | 3648 |
| 888 | nmdc:mga06r32_1057685_c1 | 3300050510 | Bacteria | 762 |
| 889 | nmdc:mga06r32_119210_c1 | 3300050510 | Bacteria | 2602 |
| 890 | nmdc:mga06r32_34611_c1 | 3300050510 | Bacteria | 4764 |
| 891 | nmdc:mga06r32_400396_c1 | 3300050510 | Bacteria | 1355 |
| 892 | nmdc:mga08y16_257168_c1 | 3300050511 | Bacteria | 1804 |
| 893 | nmdc:mga08y16_512728_c1 | 3300050511 | Bacteria | 1217 |
| 894 | nmdc:mga08y16_55017_c1 | 3300050511 | Bacteria | 4159 |
| 895 | nmdc:mga0n895_173908_c1 | 3300050512 | Bacteria | 2185 |
| 896 | nmdc:mga0n895_218271_c1 | 3300050512 | Bacteria | 1936 |
| 897 | nmdc:mga0n895_236290_c1 | 3300050512 | Bacteria | 1855 |
| 898 | nmdc:mga0n895_237760_c1 | 3300050512 | Bacteria | 1848 |
| 899 | nmdc:mga0n895_534629_c1 | 3300050512 | Bacteria | 1179 |
| 900 | nmdc:mga0n895_94842_c1 | 3300050512 | Bacteria | 2988 |
| 901 | nmdc:mga0rr50_432_c1 | 3300050513 | Bacteria | 22538 |
| 902 | nmdc:mga0rr50_66420_c1 | 3300050513 | Bacteria | 2736 |
| 903 | nmdc:mga0rr50_8964_c1 | 3300050513 | Bacteria | 6256 |
| 904 | nmdc:mga08x19_27_c1 | 3300050514 | Bacteria | 226652 |
| 905 | nmdc:mga08x19_383877_c1 | 3300050514 | Bacteria | 984 |
| 906 | nmdc:mga0a205_149264_c1 | 3300050515 | Bacteria | 2238 |
| 907 | nmdc:mga0a205_22736_c1 | 3300050515 | Bacteria | 5944 |
| 908 | nmdc:mga0a205_323544_c1 | 3300050515 | Bacteria | 1413 |
| 909 | nmdc:mga0a205_32992_c2 | 3300050515 | Bacteria | 1867 |
| 910 | nmdc:mga0a205_55769_c1 | 3300050515 | Bacteria | 3816 |
| 911 | Ga0495612_0021140 | 3300053078 | Bacteria | 2611 |
| 912 | Ga0495655_0004445 | 3300053083 | Bacteria | 2396 |
| 913 | Ga0500616_0003846 | 3300053153 | Bacteria | 11091 |
| 914 | Ga0501084_0139680 | 3300054114 | Bacteria | 2040 |
| 915 | Ga0587083_0022585 | 3300059505 | Bacteria | 1180 |
| 916 | Ga0587085_001894 | 3300059506 | Bacteria | 2045 |
| 917 | Ga0587085_045285 | 3300059506 | Bacteria | 782 |
| 918 | Ga0587091_033311 | 3300059511 | Bacteria | 979 |
| 919 | Ga0587094_020417 | 3300059513 | Bacteria | 958 |
| 920 | Ga0587062_002810 | 3300059639 | Bacteria | 1700 |
| 921 | Ga0530510_0109649 | 3300061734 | Bacteria | 2021 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300039453 | Ga0436362_0610441 | Ga0436362_0610441_106_732 | 198 |
| 2 | 3300047317 | Ga0495604_0171370 | Ga0495604_0171370_865_1500 | 201 |
| 3 | 3300005335 | Ga0070666_10088219 | Ga0070666_100882193 | 203 |
| 4 | 3300025923 | Ga0207681_10469556 | Ga0207681_104695561 | 203 |
| 5 | 3300025935 | Ga0207709_10163669 | Ga0207709_101636692 | 203 |
| 6 | 3300025986 | Ga0207658_10613166 | Ga0207658_106131661 | 203 |
| 7 | 3300049569 | Ga0501032_0241454 | Ga0501032_0241454_520_1149 | 203 |
| 8 | 3300009098 | Ga0105245_10349965 | Ga0105245_103499652 | 204 |
| 9 | 3300025911 | Ga0207654_10647373 | Ga0207654_106473731 | 206 |
| 10 | 3300047320 | Ga0495672_0195447 | Ga0495672_0195447_237_932 | 208 |
| 11 | 3300005289 | Ga0065704_10187416 | Ga0065704_101874162 | 213 |
| 12 | 3300005295 | Ga0065707_10269917 | Ga0065707_102699171 | 213 |
| 13 | 3300005331 | Ga0070670_100005027 | Ga0070670_1000050272 | 213 |
| 14 | 3300005334 | Ga0068869_100010725 | Ga0068869_1000107252 | 213 |
| 15 | 3300005334 | Ga0068869_100050225 | Ga0068869_1000502253 | 213 |
| 16 | 3300005338 | Ga0068868_100401032 | Ga0068868_1004010321 | 213 |
| 17 | 3300005340 | Ga0070689_100057269 | Ga0070689_1000572693 | 213 |
| 18 | 3300005347 | Ga0070668_100048014 | Ga0070668_1000480143 | 213 |
| 19 | 3300005353 | Ga0070669_100053168 | Ga0070669_1000531682 | 213 |
| 20 | 3300005353 | Ga0070669_100095460 | Ga0070669_1000954603 | 213 |
| 21 | 3300005364 | Ga0070673_100028099 | Ga0070673_1000280993 | 213 |
| 22 | 3300005364 | Ga0070673_100498068 | Ga0070673_1004980682 | 213 |
| 23 | 3300005440 | Ga0070705_100349490 | Ga0070705_1003494902 | 213 |
| 24 | 3300005441 | Ga0070700_100233304 | Ga0070700_1002333041 | 213 |
| 25 | 3300005444 | Ga0070694_100242083 | Ga0070694_1002420831 | 213 |
| 26 | 3300005445 | Ga0070708_100050740 | Ga0070708_1000507404 | 213 |
| 27 | 3300005467 | Ga0070706_100020710 | Ga0070706_1000207104 | 213 |
| 28 | 3300005471 | Ga0070698_100066401 | Ga0070698_1000664013 | 213 |
| 29 | 3300005471 | Ga0070698_100074362 | Ga0070698_1000743622 | 213 |
| 30 | 3300005471 | Ga0070698_100204080 | Ga0070698_1002040802 | 213 |
| 31 | 3300005518 | Ga0070699_100019115 | Ga0070699_1000191156 | 213 |
| 32 | 3300005518 | Ga0070699_100195455 | Ga0070699_1001954552 | 213 |
| 33 | 3300005518 | Ga0070699_100302535 | Ga0070699_1003025352 | 213 |
| 34 | 3300005518 | Ga0070699_100740242 | Ga0070699_1007402421 | 213 |
| 35 | 3300005536 | Ga0070697_100006646 | Ga0070697_1000066466 | 213 |
| 36 | 3300005545 | Ga0070695_100219637 | Ga0070695_1002196372 | 213 |
| 37 | 3300005546 | Ga0070696_100614770 | Ga0070696_1006147701 | 213 |
| 38 | 3300005549 | Ga0070704_100169561 | Ga0070704_1001695612 | 213 |
| 39 | 3300005719 | Ga0068861_100015822 | Ga0068861_1000158226 | 213 |
| 40 | 3300005719 | Ga0068861_100553071 | Ga0068861_1005530711 | 213 |
| 41 | 3300005841 | Ga0068863_100588034 | Ga0068863_1005880341 | 213 |
| 42 | 3300006163 | Ga0070715_10000039 | Ga0070715_1000003959 | 213 |
| 43 | 3300007265 | Ga0099794_10040454 | Ga0099794_100404544 | 213 |
| 44 | 3300009148 | Ga0105243_10031915 | Ga0105243_100319154 | 213 |
| 45 | 3300009148 | Ga0105243_10291002 | Ga0105243_102910022 | 213 |
| 46 | 3300009174 | Ga0105241_10854187 | Ga0105241_108541871 | 213 |
| 47 | 3300009176 | Ga0105242_10405198 | Ga0105242_104051981 | 213 |
| 48 | 3300009553 | Ga0105249_10013119 | Ga0105249_100131197 | 213 |
| 49 | 3300013100 | Ga0157373_10437356 | Ga0157373_104373562 | 213 |
| 50 | 3300013297 | Ga0157378_10095561 | Ga0157378_100955614 | 213 |
| 51 | 3300013306 | Ga0163162_10000784 | Ga0163162_100007847 | 213 |
| 52 | 3300013308 | Ga0157375_10972718 | Ga0157375_109727182 | 213 |
| 53 | 3300014325 | Ga0163163_10058422 | Ga0163163_100584227 | 213 |
| 54 | 3300014325 | Ga0163163_10356018 | Ga0163163_103560183 | 213 |
| 55 | 3300025905 | Ga0207685_10000024 | Ga0207685_1000002457 | 213 |
| 56 | 3300025910 | Ga0207684_10003150 | Ga0207684_1000315015 | 213 |
| 57 | 3300025923 | Ga0207681_10004264 | Ga0207681_100042646 | 213 |
| 58 | 3300025923 | Ga0207681_10150053 | Ga0207681_101500533 | 213 |
| 59 | 3300025925 | Ga0207650_10002078 | Ga0207650_1000207815 | 213 |
| 60 | 3300025925 | Ga0207650_10215666 | Ga0207650_102156662 | 213 |
| 61 | 3300025934 | Ga0207686_10327456 | Ga0207686_103274561 | 213 |
| 62 | 3300025936 | Ga0207670_10046086 | Ga0207670_100460862 | 213 |
| 63 | 3300025942 | Ga0207689_10028316 | Ga0207689_100283163 | 213 |
| 64 | 3300025942 | Ga0207689_10110965 | Ga0207689_101109653 | 213 |
| 65 | 3300025942 | Ga0207689_10645341 | Ga0207689_106453411 | 213 |
| 66 | 3300025945 | Ga0207679_10444615 | Ga0207679_104446152 | 213 |
| 67 | 3300025960 | Ga0207651_10026556 | Ga0207651_100265563 | 213 |
| 68 | 3300025961 | Ga0207712_10000586 | Ga0207712_1000058620 | 213 |
| 69 | 3300025972 | Ga0207668_10009419 | Ga0207668_100094193 | 213 |
| 70 | 3300026075 | Ga0207708_10174764 | Ga0207708_101747642 | 213 |
| 71 | 3300026088 | Ga0207641_10280753 | Ga0207641_102807531 | 213 |
| 72 | 3300026118 | Ga0207675_100021754 | Ga0207675_1000217545 | 213 |
| 73 | 3300027671 | Ga0209588_1005410 | Ga0209588_10054104 | 213 |
| 74 | 3300031456 | Ga0307513_10535520 | Ga0307513_105355202 | 213 |
| 75 | 3300049583 | Ga0501067_0194417 | Ga0501067_0194417_333_1028 | 213 |
| 76 | 3300005549 | Ga0070704_100388833 | Ga0070704_1003888332 | 214 |
| 77 | 3300032126 | Ga0307415_100076589 | Ga0307415_1000765895 | 214 |
| 78 | 3300005337 | Ga0070682_100005522 | Ga0070682_1000055227 | 215 |
| 79 | 3300005340 | Ga0070689_100381665 | Ga0070689_1003816652 | 215 |
| 80 | 3300005438 | Ga0070701_10049658 | Ga0070701_100496582 | 215 |
| 81 | 3300005544 | Ga0070686_100028019 | Ga0070686_1000280196 | 215 |
| 82 | 3300005843 | Ga0068860_100171331 | Ga0068860_1001713312 | 215 |
| 83 | 3300009093 | Ga0105240_10332740 | Ga0105240_103327403 | 215 |
| 84 | 3300013297 | Ga0157378_10118185 | Ga0157378_101181854 | 215 |
| 85 | 3300013297 | Ga0157378_10129961 | Ga0157378_101299613 | 215 |
| 86 | 3300014326 | Ga0157380_10259179 | Ga0157380_102591792 | 215 |
| 87 | 3300021384 | Ga0213876_10043703 | Ga0213876_100437033 | 215 |
| 88 | 3300025936 | Ga0207670_10182241 | Ga0207670_101822412 | 215 |
| 89 | 3300025960 | Ga0207651_10042074 | Ga0207651_100420745 | 215 |
| 90 | 3300026116 | Ga0207674_10301940 | Ga0207674_103019402 | 215 |
| 91 | 3300039437 | Ga0436365_1052004 | Ga0436365_1052004_2732_3427 | 215 |
| 92 | 3300046512 | Ga0495610_0044352 | Ga0495610_0044352_799_1494 | 215 |
| 93 | 3300046515 | Ga0495620_0062541 | Ga0495620_0062541_722_1417 | 215 |
| 94 | 3300046518 | Ga0495631_0123360 | Ga0495631_0123360_36_731 | 215 |
| 95 | 3300046525 | Ga0495663_0000620 | Ga0495663_0000620_4153_4848 | 215 |
| 96 | 3300046537 | Ga0495598_0001218 | Ga0495598_0001218_4012_4707 | 215 |
| 97 | 3300046539 | Ga0495621_0002543 | Ga0495621_0002543_2259_2954 | 215 |
| 98 | 3300046615 | Ga0495656_0154167 | Ga0495656_0154167_29_724 | 215 |
| 99 | 3300005330 | Ga0070690_100014199 | Ga0070690_1000141995 | 216 |
| 100 | 3300005336 | Ga0070680_100134655 | Ga0070680_1001346553 | 216 |
| 101 | 3300005343 | Ga0070687_100300670 | Ga0070687_1003006701 | 216 |
| 102 | 3300005406 | Ga0070703_10044631 | Ga0070703_100446311 | 216 |
| 103 | 3300005440 | Ga0070705_100176546 | Ga0070705_1001765462 | 216 |
| 104 | 3300005467 | Ga0070706_100131556 | Ga0070706_1001315561 | 216 |
| 105 | 3300005545 | Ga0070695_100266016 | Ga0070695_1002660162 | 216 |
| 106 | 3300005549 | Ga0070704_100013577 | Ga0070704_1000135776 | 216 |
| 107 | 3300005719 | Ga0068861_100077905 | Ga0068861_1000779054 | 216 |
| 108 | 3300005843 | Ga0068860_100337596 | Ga0068860_1003375962 | 216 |
| 109 | 3300005844 | Ga0068862_100009823 | Ga0068862_10000982310 | 216 |
| 110 | 3300005983 | Ga0081540_1142299 | Ga0081540_11422992 | 216 |
| 111 | 3300006173 | Ga0070716_100113914 | Ga0070716_1001139142 | 216 |
| 112 | 3300006914 | Ga0075436_100015347 | Ga0075436_1000153474 | 216 |
| 113 | 3300007076 | Ga0075435_100020792 | Ga0075435_1000207923 | 216 |
| 114 | 3300013297 | Ga0157378_10527306 | Ga0157378_105273062 | 216 |
| 115 | 3300014326 | Ga0157380_10006345 | Ga0157380_100063456 | 216 |
| 116 | 3300025885 | Ga0207653_10023644 | Ga0207653_100236443 | 216 |
| 117 | 3300025922 | Ga0207646_10734902 | Ga0207646_107349021 | 216 |
| 118 | 3300025939 | Ga0207665_10011629 | Ga0207665_100116296 | 216 |
| 119 | 3300028380 | Ga0268265_10035479 | Ga0268265_100354793 | 216 |
| 120 | 3300028381 | Ga0268264_10305727 | Ga0268264_103057272 | 216 |
| 121 | 3300050513 | nmdc:mga0rr50_432_c1 | nmdc:mga0rr50_432_c1_813_1508 | 216 |
| 122 | 3300050514 | nmdc:mga08x19_27_c1 | nmdc:mga08x19_27_c1_223181_223876 | 216 |
| 123 | 3300005536 | Ga0070697_100002791 | Ga0070697_1000027915 | 217 |
| 124 | 3300026095 | Ga0207676_10104838 | Ga0207676_101048383 | 217 |
| 125 | 3300005340 | Ga0070689_100258063 | Ga0070689_1002580632 | 218 |
| 126 | 3300005444 | Ga0070694_100032476 | Ga0070694_1000324766 | 218 |
| 127 | 3300005468 | Ga0070707_100003296 | Ga0070707_10000329610 | 218 |
| 128 | 3300005471 | Ga0070698_100035264 | Ga0070698_1000352645 | 218 |
| 129 | 3300005518 | Ga0070699_100062651 | Ga0070699_1000626512 | 218 |
| 130 | 3300005549 | Ga0070704_100013963 | Ga0070704_1000139637 | 218 |
| 131 | 3300025922 | Ga0207646_10005747 | Ga0207646_100057474 | 218 |
| 132 | 3300005354 | Ga0070675_100187501 | Ga0070675_1001875012 | 219 |
| 133 | 3300005330 | Ga0070690_100027424 | Ga0070690_1000274243 | 220 |
| 134 | 3300005544 | Ga0070686_100196518 | Ga0070686_1001965182 | 220 |
| 135 | 3300005719 | Ga0068861_100168921 | Ga0068861_1001689211 | 220 |
| 136 | 3300005842 | Ga0068858_100672416 | Ga0068858_1006724162 | 220 |
| 137 | 3300009176 | Ga0105242_10045777 | Ga0105242_100457778 | 220 |
| 138 | 3300009176 | Ga0105242_10667596 | Ga0105242_106675962 | 220 |
| 139 | 3300017792 | Ga0163161_10011008 | Ga0163161_100110084 | 220 |
| 140 | 3300025934 | Ga0207686_10000392 | Ga0207686_1000039212 | 220 |
| 141 | 3300026089 | Ga0207648_10260934 | Ga0207648_102609342 | 220 |
| 142 | 3300005471 | Ga0070698_100000374 | Ga0070698_1000003747 | 221 |
| 143 | 3300001426 | JGI24030J14995_100433 | JGI24030J14995_1004332 | 224 |
| 144 | 3300001432 | JGI24034J14986_100801 | JGI24034J14986_1008011 | 224 |
| 145 | 3300002074 | JGI24748J21848_1000014 | JGI24748J21848_1000014117 | 224 |
| 146 | 3300002239 | JGI24034J26672_10000012 | JGI24034J26672_100000127 | 224 |
| 147 | 3300004799 | Ga0058863_10009163 | Ga0058863_100091632 | 224 |
| 148 | 3300005330 | Ga0070690_100252469 | Ga0070690_1002524692 | 224 |
| 149 | 3300005340 | Ga0070689_100227946 | Ga0070689_1002279462 | 224 |
| 150 | 3300005355 | Ga0070671_100471292 | Ga0070671_1004712922 | 224 |
| 151 | 3300005459 | Ga0068867_100432215 | Ga0068867_1004322152 | 224 |
| 152 | 3300005518 | Ga0070699_100114649 | Ga0070699_1001146495 | 224 |
| 153 | 3300005544 | Ga0070686_100028009 | Ga0070686_1000280097 | 224 |
| 154 | 3300005549 | Ga0070704_100165307 | Ga0070704_1001653072 | 224 |
| 155 | 3300005615 | Ga0070702_100036883 | Ga0070702_1000368832 | 224 |
| 156 | 3300005615 | Ga0070702_100174622 | Ga0070702_1001746221 | 224 |
| 157 | 3300005617 | Ga0068859_100109843 | Ga0068859_1001098435 | 224 |
| 158 | 3300005618 | Ga0068864_100021548 | Ga0068864_1000215485 | 224 |
| 159 | 3300005719 | Ga0068861_100056288 | Ga0068861_1000562888 | 224 |
| 160 | 3300005842 | Ga0068858_100008879 | Ga0068858_1000088795 | 224 |
| 161 | 3300006852 | Ga0075433_10036894 | Ga0075433_100368943 | 224 |
| 162 | 3300006871 | Ga0075434_100093178 | Ga0075434_1000931787 | 224 |
| 163 | 3300006931 | Ga0097620_100109848 | Ga0097620_1001098485 | 224 |
| 164 | 3300009101 | Ga0105247_10000050 | Ga0105247_10000050116 | 224 |
| 165 | 3300009101 | Ga0105247_10312562 | Ga0105247_103125622 | 224 |
| 166 | 3300009101 | Ga0105247_10327849 | Ga0105247_103278492 | 224 |
| 167 | 3300009177 | Ga0105248_10053458 | Ga0105248_100534584 | 224 |
| 168 | 3300013297 | Ga0157378_10061204 | Ga0157378_100612042 | 224 |
| 169 | 3300013306 | Ga0163162_10041843 | Ga0163162_100418437 | 224 |
| 170 | 3300013306 | Ga0163162_10337071 | Ga0163162_103370712 | 224 |
| 171 | 3300014968 | Ga0157379_10037517 | Ga0157379_100375177 | 224 |
| 172 | 3300025223 | Ga0207672_1000149 | Ga0207672_10001496 | 224 |
| 173 | 3300025900 | Ga0207710_10000003 | Ga0207710_10000003906 | 224 |
| 174 | 3300025900 | Ga0207710_10166752 | Ga0207710_101667521 | 224 |
| 175 | 3300025931 | Ga0207644_10001958 | Ga0207644_100019586 | 224 |
| 176 | 3300025942 | Ga0207689_10013420 | Ga0207689_100134204 | 224 |
| 177 | 3300026023 | Ga0207677_10038376 | Ga0207677_100383764 | 224 |
| 178 | 3300026035 | Ga0207703_10000355 | Ga0207703_1000035510 | 224 |
| 179 | 3300026089 | Ga0207648_10204062 | Ga0207648_102040623 | 224 |
| 180 | 3300026118 | Ga0207675_100047591 | Ga0207675_1000475912 | 224 |
| 181 | 3300038996 | Ga0242420_018381 | Ga0242420_018381_474_1169 | 224 |
| 182 | 3300050512 | nmdc:mga0n895_173908_c1 | nmdc:mga0n895_173908_c1_463_1158 | 224 |
| 183 | 3300005356 | Ga0070674_100855836 | Ga0070674_1008558361 | 225 |
| 184 | 3300005444 | Ga0070694_100008189 | Ga0070694_1000081897 | 225 |
| 185 | 3300009148 | Ga0105243_10001520 | Ga0105243_100015208 | 225 |
| 186 | 3300009176 | Ga0105242_10001223 | Ga0105242_1000122313 | 225 |
| 187 | 3300014969 | Ga0157376_11164402 | Ga0157376_111644021 | 225 |
| 188 | 3300025934 | Ga0207686_10000659 | Ga0207686_1000065913 | 225 |
| 189 | 3300025935 | Ga0207709_10000037 | Ga0207709_100000377 | 225 |
| 190 | 3300026089 | Ga0207648_10453890 | Ga0207648_104538902 | 225 |
| 191 | 3300005364 | Ga0070673_100264116 | Ga0070673_1002641162 | 226 |
| 192 | 3300005467 | Ga0070706_100346629 | Ga0070706_1003466292 | 226 |
| 193 | 3300005468 | Ga0070707_100028004 | Ga0070707_10002800411 | 226 |
| 194 | 3300005471 | Ga0070698_100016601 | Ga0070698_1000166016 | 226 |
| 195 | 3300005471 | Ga0070698_100076608 | Ga0070698_1000766082 | 226 |
| 196 | 3300005536 | Ga0070697_100195414 | Ga0070697_1001954142 | 226 |
| 197 | 3300005546 | Ga0070696_100013482 | Ga0070696_1000134823 | 226 |
| 198 | 3300005618 | Ga0068864_101039464 | Ga0068864_1010394641 | 226 |
| 199 | 3300006237 | Ga0097621_100389719 | Ga0097621_1003897191 | 226 |
| 200 | 3300014325 | Ga0163163_10277204 | Ga0163163_102772043 | 226 |
| 201 | 3300025910 | Ga0207684_10085853 | Ga0207684_100858532 | 226 |
| 202 | 3300025922 | Ga0207646_10011116 | Ga0207646_1001111616 | 226 |
| 203 | 3300025931 | Ga0207644_10034752 | Ga0207644_100347522 | 226 |
| 204 | 3300025949 | Ga0207667_10909858 | Ga0207667_109098581 | 226 |
| 205 | 3300031731 | Ga0307405_10016948 | Ga0307405_100169484 | 226 |
| 206 | 3300031911 | Ga0307412_10010192 | Ga0307412_100101924 | 226 |
| 207 | 3300031995 | Ga0307409_100421071 | Ga0307409_1004210711 | 226 |
| 208 | 3300032002 | Ga0307416_100030319 | Ga0307416_1000303197 | 226 |
| 209 | 3300032004 | Ga0307414_10264523 | Ga0307414_102645231 | 226 |
| 210 | 3300032126 | Ga0307415_100016722 | Ga0307415_1000167223 | 226 |
| 211 | 3300032168 | Ga0316593_10051094 | Ga0316593_100510942 | 226 |
| 212 | 3300046681 | Ga0495647_0244132 | Ga0495647_0244132_48_743 | 226 |
| 213 | 3300048915 | Ga0496112_0427076 | Ga0496112_0427076_45_740 | 226 |
| 214 | 3300049521 | Ga0501298_002295 | Ga0501298_002295_2033_2728 | 226 |
| 215 | 3300049764 | Ga0501267_004623 | Ga0501267_004623_23_718 | 226 |
| 216 | 3300004800 | Ga0058861_11955377 | Ga0058861_119553771 | 227 |
| 217 | 3300004800 | Ga0058861_12040784 | Ga0058861_120407842 | 227 |
| 218 | 3300005327 | Ga0070658_10209182 | Ga0070658_102091822 | 227 |
| 219 | 3300005456 | Ga0070678_100567328 | Ga0070678_1005673281 | 227 |
| 220 | 3300005563 | Ga0068855_100749166 | Ga0068855_1007491662 | 227 |
| 221 | 3300005618 | Ga0068864_100154460 | Ga0068864_1001544603 | 227 |
| 222 | 3300006881 | Ga0068865_100166495 | Ga0068865_1001664953 | 227 |
| 223 | 3300014325 | Ga0163163_10450424 | Ga0163163_104504242 | 227 |
| 224 | 3300025934 | Ga0207686_10098042 | Ga0207686_100980421 | 227 |
| 225 | 3300026121 | Ga0207683_10025820 | Ga0207683_100258204 | 227 |
| 226 | 3300030877 | Ga0265777_104945 | Ga0265777_1049451 | 227 |
| 227 | 3300031249 | Ga0265339_10062413 | Ga0265339_100624132 | 227 |
| 228 | 3300031649 | Ga0307514_10050235 | Ga0307514_100502352 | 227 |
| 229 | 3300031649 | Ga0307514_10132139 | Ga0307514_101321392 | 227 |
| 230 | 3300037471 | Ga0395905_0532956 | Ga0395905_0532956_25_735 | 227 |
| 231 | 3300044712 | Ga0453684_0298665 | Ga0453684_0298665_945_1655 | 227 |
| 232 | 3300059506 | Ga0587085_001894 | Ga0587085_001894_1223_1933 | 227 |
| 233 | 3300059639 | Ga0587062_002810 | Ga0587062_002810_876_1586 | 227 |
| 234 | 3300025918 | Ga0207662_10460748 | Ga0207662_104607481 | 228 |
| 235 | 3300027907 | Ga0207428_10057402 | Ga0207428_100574025 | 228 |
| 236 | 3300059506 | Ga0587085_045285 | Ga0587085_045285_21_746 | 228 |
| 237 | 3300005468 | Ga0070707_100148635 | Ga0070707_1001486351 | 229 |
| 238 | 3300025922 | Ga0207646_10124327 | Ga0207646_101243273 | 229 |
| 239 | 3300033528 | Ga0316588_1049462 | Ga0316588_10494621 | 229 |
| 240 | 3300003203 | JGI25406J46586_10014740 | JGI25406J46586_100147404 | 230 |
| 241 | 3300005336 | Ga0070680_100317539 | Ga0070680_1003175392 | 230 |
| 242 | 3300005439 | Ga0070711_100077619 | Ga0070711_1000776192 | 230 |
| 243 | 3300009545 | Ga0105237_10053364 | Ga0105237_100533647 | 230 |
| 244 | 3300013307 | Ga0157372_10107622 | Ga0157372_101076227 | 230 |
| 245 | 3300025940 | Ga0207691_10002381 | Ga0207691_1000238113 | 230 |
| 246 | 3300037418 | Ga0395900_0456029 | Ga0395900_0456029_184_918 | 230 |
| 247 | 3300037466 | Ga0395898_0647476 | Ga0395898_0647476_180_914 | 230 |
| 248 | 3300037471 | Ga0395905_0008542 | Ga0395905_0008542_4090_4824 | 230 |
| 249 | 3300037471 | Ga0395905_0010746 | Ga0395905_0010746_7647_8381 | 230 |
| 250 | 3300037471 | Ga0395905_0030677 | Ga0395905_0030677_495_1229 | 230 |
| 251 | 3300037471 | Ga0395905_0144217 | Ga0395905_0144217_173_907 | 230 |
| 252 | 3300053078 | Ga0495612_0021140 | Ga0495612_0021140_550_1260 | 230 |
| 253 | 3300059505 | Ga0587083_0022585 | Ga0587083_0022585_183_917 | 230 |
| 254 | 3300000531 | CNBas_1000372 | CNBas_10003722 | 231 |
| 255 | 3300000532 | CNAas_1001813 | CNAas_10018132 | 231 |
| 256 | 3300002459 | JGI24751J29686_10000074 | JGI24751J29686_100000747 | 231 |
| 257 | 3300003203 | JGI25406J46586_10011912 | JGI25406J46586_100119127 | 231 |
| 258 | 3300003203 | JGI25406J46586_10026245 | JGI25406J46586_100262452 | 231 |
| 259 | 3300005288 | Ga0065714_10064450 | Ga0065714_1006445057 | 231 |
| 260 | 3300005289 | Ga0065704_10002971 | Ga0065704_100029711 | 231 |
| 261 | 3300005289 | Ga0065704_10093725 | Ga0065704_100937253 | 231 |
| 262 | 3300005289 | Ga0065704_10097529 | Ga0065704_100975293 | 231 |
| 263 | 3300005289 | Ga0065704_10173484 | Ga0065704_101734841 | 231 |
| 264 | 3300005290 | Ga0065712_10001740 | Ga0065712_100017408 | 231 |
| 265 | 3300005290 | Ga0065712_10004552 | Ga0065712_100045525 | 231 |
| 266 | 3300005290 | Ga0065712_10015500 | Ga0065712_100155003 | 231 |
| 267 | 3300005290 | Ga0065712_10018916 | Ga0065712_100189162 | 231 |
| 268 | 3300005290 | Ga0065712_10022326 | Ga0065712_100223262 | 231 |
| 269 | 3300005290 | Ga0065712_10072502 | Ga0065712_100725023 | 231 |
| 270 | 3300005290 | Ga0065712_10159279 | Ga0065712_101592791 | 231 |
| 271 | 3300005293 | Ga0065715_10005007 | Ga0065715_100050074 | 231 |
| 272 | 3300005293 | Ga0065715_10027997 | Ga0065715_100279971 | 231 |
| 273 | 3300005293 | Ga0065715_10094215 | Ga0065715_100942152 | 231 |
| 274 | 3300005293 | Ga0065715_10095075 | Ga0065715_100950756 | 231 |
| 275 | 3300005293 | Ga0065715_10097309 | Ga0065715_100973096 | 231 |
| 276 | 3300005293 | Ga0065715_10166863 | Ga0065715_101668632 | 231 |
| 277 | 3300005293 | Ga0065715_10170832 | Ga0065715_101708321 | 231 |
| 278 | 3300005293 | Ga0065715_10187026 | Ga0065715_101870262 | 231 |
| 279 | 3300005295 | Ga0065707_10005254 | Ga0065707_100052544 | 231 |
| 280 | 3300005295 | Ga0065707_10008773 | Ga0065707_100087732 | 231 |
| 281 | 3300005295 | Ga0065707_10043579 | Ga0065707_100435792 | 231 |
| 282 | 3300005295 | Ga0065707_10091832 | Ga0065707_100918327 | 231 |
| 283 | 3300005328 | Ga0070676_10429273 | Ga0070676_104292731 | 231 |
| 284 | 3300005328 | Ga0070676_10455928 | Ga0070676_104559281 | 231 |
| 285 | 3300005330 | Ga0070690_100004097 | Ga0070690_1000040977 | 231 |
| 286 | 3300005330 | Ga0070690_100148584 | Ga0070690_1001485841 | 231 |
| 287 | 3300005331 | Ga0070670_100013886 | Ga0070670_1000138867 | 231 |
| 288 | 3300005331 | Ga0070670_100039282 | Ga0070670_1000392824 | 231 |
| 289 | 3300005331 | Ga0070670_100129699 | Ga0070670_1001296994 | 231 |
| 290 | 3300005331 | Ga0070670_100228883 | Ga0070670_1002288833 | 231 |
| 291 | 3300005331 | Ga0070670_100416906 | Ga0070670_1004169062 | 231 |
| 292 | 3300005331 | Ga0070670_100666608 | Ga0070670_1006666081 | 231 |
| 293 | 3300005335 | Ga0070666_10018717 | Ga0070666_100187174 | 231 |
| 294 | 3300005336 | Ga0070680_100000103 | Ga0070680_10000010337 | 231 |
| 295 | 3300005336 | Ga0070680_100137262 | Ga0070680_1001372623 | 231 |
| 296 | 3300005336 | Ga0070680_100641303 | Ga0070680_1006413031 | 231 |
| 297 | 3300005337 | Ga0070682_100019793 | Ga0070682_1000197934 | 231 |
| 298 | 3300005337 | Ga0070682_100602823 | Ga0070682_1006028231 | 231 |
| 299 | 3300005338 | Ga0068868_100362253 | Ga0068868_1003622531 | 231 |
| 300 | 3300005339 | Ga0070660_100011939 | Ga0070660_1000119395 | 231 |
| 301 | 3300005340 | Ga0070689_100020570 | Ga0070689_1000205702 | 231 |
| 302 | 3300005340 | Ga0070689_100038497 | Ga0070689_1000384976 | 231 |
| 303 | 3300005340 | Ga0070689_100479284 | Ga0070689_1004792842 | 231 |
| 304 | 3300005341 | Ga0070691_10204574 | Ga0070691_102045742 | 231 |
| 305 | 3300005343 | Ga0070687_100002413 | Ga0070687_1000024135 | 231 |
| 306 | 3300005343 | Ga0070687_100019756 | Ga0070687_1000197566 | 231 |
| 307 | 3300005343 | Ga0070687_100045207 | Ga0070687_1000452073 | 231 |
| 308 | 3300005343 | Ga0070687_100186574 | Ga0070687_1001865741 | 231 |
| 309 | 3300005344 | Ga0070661_100033024 | Ga0070661_1000330246 | 231 |
| 310 | 3300005344 | Ga0070661_100265816 | Ga0070661_1002658162 | 231 |
| 311 | 3300005345 | Ga0070692_10007532 | Ga0070692_100075324 | 231 |
| 312 | 3300005345 | Ga0070692_10088217 | Ga0070692_100882172 | 231 |
| 313 | 3300005353 | Ga0070669_100018533 | Ga0070669_1000185336 | 231 |
| 314 | 3300005353 | Ga0070669_100055779 | Ga0070669_1000557793 | 231 |
| 315 | 3300005353 | Ga0070669_100123593 | Ga0070669_1001235933 | 231 |
| 316 | 3300005354 | Ga0070675_100116074 | Ga0070675_1001160742 | 231 |
| 317 | 3300005354 | Ga0070675_100657886 | Ga0070675_1006578862 | 231 |
| 318 | 3300005355 | Ga0070671_100007852 | Ga0070671_1000078525 | 231 |
| 319 | 3300005355 | Ga0070671_100168905 | Ga0070671_1001689053 | 231 |
| 320 | 3300005364 | Ga0070673_100077535 | Ga0070673_1000775356 | 231 |
| 321 | 3300005364 | Ga0070673_100095069 | Ga0070673_1000950694 | 231 |
| 322 | 3300005364 | Ga0070673_100176116 | Ga0070673_1001761163 | 231 |
| 323 | 3300005365 | Ga0070688_100003329 | Ga0070688_1000033294 | 231 |
| 324 | 3300005365 | Ga0070688_100517022 | Ga0070688_1005170221 | 231 |
| 325 | 3300005366 | Ga0070659_100107817 | Ga0070659_1001078173 | 231 |
| 326 | 3300005367 | Ga0070667_100036777 | Ga0070667_1000367771 | 231 |
| 327 | 3300005406 | Ga0070703_10000193 | Ga0070703_100001938 | 231 |
| 328 | 3300005406 | Ga0070703_10006781 | Ga0070703_100067814 | 231 |
| 329 | 3300005406 | Ga0070703_10032886 | Ga0070703_100328862 | 231 |
| 330 | 3300005438 | Ga0070701_10013118 | Ga0070701_100131183 | 231 |
| 331 | 3300005440 | Ga0070705_100000982 | Ga0070705_1000009829 | 231 |
| 332 | 3300005440 | Ga0070705_100062699 | Ga0070705_1000626992 | 231 |
| 333 | 3300005440 | Ga0070705_100178306 | Ga0070705_1001783062 | 231 |
| 334 | 3300005441 | Ga0070700_100005796 | Ga0070700_1000057964 | 231 |
| 335 | 3300005441 | Ga0070700_100010746 | Ga0070700_1000107462 | 231 |
| 336 | 3300005441 | Ga0070700_100041257 | Ga0070700_1000412574 | 231 |
| 337 | 3300005441 | Ga0070700_100055987 | Ga0070700_1000559872 | 231 |
| 338 | 3300005444 | Ga0070694_100015866 | Ga0070694_1000158662 | 231 |
| 339 | 3300005444 | Ga0070694_100021679 | Ga0070694_1000216794 | 231 |
| 340 | 3300005444 | Ga0070694_100044559 | Ga0070694_1000445595 | 231 |
| 341 | 3300005444 | Ga0070694_100055794 | Ga0070694_1000557942 | 231 |
| 342 | 3300005444 | Ga0070694_100068041 | Ga0070694_1000680414 | 231 |
| 343 | 3300005444 | Ga0070694_100079786 | Ga0070694_1000797862 | 231 |
| 344 | 3300005444 | Ga0070694_100082443 | Ga0070694_1000824431 | 231 |
| 345 | 3300005444 | Ga0070694_100090985 | Ga0070694_1000909853 | 231 |
| 346 | 3300005445 | Ga0070708_100001743 | Ga0070708_1000017438 | 231 |
| 347 | 3300005445 | Ga0070708_100280955 | Ga0070708_1002809551 | 231 |
| 348 | 3300005445 | Ga0070708_100311833 | Ga0070708_1003118332 | 231 |
| 349 | 3300005457 | Ga0070662_100029069 | Ga0070662_1000290693 | 231 |
| 350 | 3300005457 | Ga0070662_100289628 | Ga0070662_1002896282 | 231 |
| 351 | 3300005457 | Ga0070662_100447912 | Ga0070662_1004479122 | 231 |
| 352 | 3300005457 | Ga0070662_100653125 | Ga0070662_1006531251 | 231 |
| 353 | 3300005458 | Ga0070681_10000095 | Ga0070681_100000956 | 231 |
| 354 | 3300005458 | Ga0070681_10006380 | Ga0070681_100063802 | 231 |
| 355 | 3300005458 | Ga0070681_10027357 | Ga0070681_100273574 | 231 |
| 356 | 3300005458 | Ga0070681_10150615 | Ga0070681_101506151 | 231 |
| 357 | 3300005459 | Ga0068867_100027874 | Ga0068867_1000278744 | 231 |
| 358 | 3300005459 | Ga0068867_100139144 | Ga0068867_1001391443 | 231 |
| 359 | 3300005459 | Ga0068867_100175345 | Ga0068867_1001753452 | 231 |
| 360 | 3300005459 | Ga0068867_100563000 | Ga0068867_1005630001 | 231 |
| 361 | 3300005466 | Ga0070685_10061109 | Ga0070685_100611093 | 231 |
| 362 | 3300005466 | Ga0070685_10447502 | Ga0070685_104475021 | 231 |
| 363 | 3300005467 | Ga0070706_100000920 | Ga0070706_10000092023 | 231 |
| 364 | 3300005467 | Ga0070706_100005925 | Ga0070706_1000059257 | 231 |
| 365 | 3300005467 | Ga0070706_100150458 | Ga0070706_1001504582 | 231 |
| 366 | 3300005467 | Ga0070706_100152848 | Ga0070706_1001528482 | 231 |
| 367 | 3300005468 | Ga0070707_100014408 | Ga0070707_1000144084 | 231 |
| 368 | 3300005468 | Ga0070707_100068181 | Ga0070707_1000681812 | 231 |
| 369 | 3300005468 | Ga0070707_100208109 | Ga0070707_1002081092 | 231 |
| 370 | 3300005471 | Ga0070698_100005496 | Ga0070698_1000054967 | 231 |
| 371 | 3300005471 | Ga0070698_100005600 | Ga0070698_1000056006 | 231 |
| 372 | 3300005471 | Ga0070698_100035463 | Ga0070698_1000354634 | 231 |
| 373 | 3300005518 | Ga0070699_100026662 | Ga0070699_1000266627 | 231 |
| 374 | 3300005518 | Ga0070699_100038208 | Ga0070699_1000382086 | 231 |
| 375 | 3300005518 | Ga0070699_100059963 | Ga0070699_1000599632 | 231 |
| 376 | 3300005518 | Ga0070699_100643203 | Ga0070699_1006432031 | 231 |
| 377 | 3300005530 | Ga0070679_100000661 | Ga0070679_10000066121 | 231 |
| 378 | 3300005535 | Ga0070684_100371671 | Ga0070684_1003716712 | 231 |
| 379 | 3300005536 | Ga0070697_100072663 | Ga0070697_1000726637 | 231 |
| 380 | 3300005536 | Ga0070697_100137242 | Ga0070697_1001372423 | 231 |
| 381 | 3300005539 | Ga0068853_100067207 | Ga0068853_1000672077 | 231 |
| 382 | 3300005539 | Ga0068853_100101661 | Ga0068853_1001016612 | 231 |
| 383 | 3300005539 | Ga0068853_100163176 | Ga0068853_1001631761 | 231 |
| 384 | 3300005539 | Ga0068853_100181150 | Ga0068853_1001811501 | 231 |
| 385 | 3300005539 | Ga0068853_100403852 | Ga0068853_1004038522 | 231 |
| 386 | 3300005543 | Ga0070672_100026540 | Ga0070672_1000265404 | 231 |
| 387 | 3300005544 | Ga0070686_100005785 | Ga0070686_1000057851 | 231 |
| 388 | 3300005544 | Ga0070686_100013995 | Ga0070686_1000139957 | 231 |
| 389 | 3300005544 | Ga0070686_100046653 | Ga0070686_1000466532 | 231 |
| 390 | 3300005544 | Ga0070686_100122582 | Ga0070686_1001225821 | 231 |
| 391 | 3300005545 | Ga0070695_100018991 | Ga0070695_1000189912 | 231 |
| 392 | 3300005545 | Ga0070695_100033900 | Ga0070695_1000339005 | 231 |
| 393 | 3300005545 | Ga0070695_100083578 | Ga0070695_1000835782 | 231 |
| 394 | 3300005545 | Ga0070695_100283761 | Ga0070695_1002837612 | 231 |
| 395 | 3300005545 | Ga0070695_100306856 | Ga0070695_1003068561 | 231 |
| 396 | 3300005545 | Ga0070695_100411713 | Ga0070695_1004117132 | 231 |
| 397 | 3300005546 | Ga0070696_100042662 | Ga0070696_1000426622 | 231 |
| 398 | 3300005546 | Ga0070696_100047947 | Ga0070696_1000479474 | 231 |
| 399 | 3300005546 | Ga0070696_100053664 | Ga0070696_1000536643 | 231 |
| 400 | 3300005546 | Ga0070696_100133532 | Ga0070696_1001335322 | 231 |
| 401 | 3300005546 | Ga0070696_100182939 | Ga0070696_1001829391 | 231 |
| 402 | 3300005546 | Ga0070696_100308375 | Ga0070696_1003083752 | 231 |
| 403 | 3300005546 | Ga0070696_100865886 | Ga0070696_1008658861 | 231 |
| 404 | 3300005547 | Ga0070693_100003410 | Ga0070693_1000034105 | 231 |
| 405 | 3300005547 | Ga0070693_100021759 | Ga0070693_1000217593 | 231 |
| 406 | 3300005547 | Ga0070693_100067661 | Ga0070693_1000676612 | 231 |
| 407 | 3300005547 | Ga0070693_100093271 | Ga0070693_1000932713 | 231 |
| 408 | 3300005547 | Ga0070693_100117588 | Ga0070693_1001175882 | 231 |
| 409 | 3300005547 | Ga0070693_100171887 | Ga0070693_1001718872 | 231 |
| 410 | 3300005549 | Ga0070704_100018581 | Ga0070704_1000185814 | 231 |
| 411 | 3300005549 | Ga0070704_100028182 | Ga0070704_1000281827 | 231 |
| 412 | 3300005549 | Ga0070704_100034482 | Ga0070704_1000344824 | 231 |
| 413 | 3300005549 | Ga0070704_100078833 | Ga0070704_1000788334 | 231 |
| 414 | 3300005549 | Ga0070704_100222718 | Ga0070704_1002227182 | 231 |
| 415 | 3300005549 | Ga0070704_100655696 | Ga0070704_1006556961 | 231 |
| 416 | 3300005563 | Ga0068855_100261345 | Ga0068855_1002613454 | 231 |
| 417 | 3300005563 | Ga0068855_100653339 | Ga0068855_1006533392 | 231 |
| 418 | 3300005564 | Ga0070664_100003167 | Ga0070664_1000031677 | 231 |
| 419 | 3300005577 | Ga0068857_100256564 | Ga0068857_1002565642 | 231 |
| 420 | 3300005577 | Ga0068857_100422995 | Ga0068857_1004229952 | 231 |
| 421 | 3300005577 | Ga0068857_100472240 | Ga0068857_1004722402 | 231 |
| 422 | 3300005578 | Ga0068854_100020758 | Ga0068854_1000207584 | 231 |
| 423 | 3300005578 | Ga0068854_100274091 | Ga0068854_1002740912 | 231 |
| 424 | 3300005615 | Ga0070702_100015413 | Ga0070702_1000154134 | 231 |
| 425 | 3300005615 | Ga0070702_100015955 | Ga0070702_1000159551 | 231 |
| 426 | 3300005615 | Ga0070702_100039137 | Ga0070702_1000391373 | 231 |
| 427 | 3300005615 | Ga0070702_100330610 | Ga0070702_1003306102 | 231 |
| 428 | 3300005615 | Ga0070702_100494786 | Ga0070702_1004947861 | 231 |
| 429 | 3300005616 | Ga0068852_100087406 | Ga0068852_1000874064 | 231 |
| 430 | 3300005616 | Ga0068852_100537314 | Ga0068852_1005373142 | 231 |
| 431 | 3300005616 | Ga0068852_100627698 | Ga0068852_1006276982 | 231 |
| 432 | 3300005617 | Ga0068859_100005985 | Ga0068859_1000059856 | 231 |
| 433 | 3300005617 | Ga0068859_100056053 | Ga0068859_1000560535 | 231 |
| 434 | 3300005617 | Ga0068859_100067591 | Ga0068859_1000675913 | 231 |
| 435 | 3300005617 | Ga0068859_100102551 | Ga0068859_1001025516 | 231 |
| 436 | 3300005617 | Ga0068859_100129114 | Ga0068859_1001291144 | 231 |
| 437 | 3300005617 | Ga0068859_100156767 | Ga0068859_1001567673 | 231 |
| 438 | 3300005617 | Ga0068859_100237255 | Ga0068859_1002372552 | 231 |
| 439 | 3300005617 | Ga0068859_100296389 | Ga0068859_1002963892 | 231 |
| 440 | 3300005617 | Ga0068859_100496219 | Ga0068859_1004962191 | 231 |
| 441 | 3300005617 | Ga0068859_100522944 | Ga0068859_1005229442 | 231 |
| 442 | 3300005617 | Ga0068859_100816687 | Ga0068859_1008166872 | 231 |
| 443 | 3300005618 | Ga0068864_100041104 | Ga0068864_1000411041 | 231 |
| 444 | 3300005618 | Ga0068864_100049121 | Ga0068864_1000491214 | 231 |
| 445 | 3300005618 | Ga0068864_100051844 | Ga0068864_1000518444 | 231 |
| 446 | 3300005618 | Ga0068864_100056009 | Ga0068864_1000560097 | 231 |
| 447 | 3300005618 | Ga0068864_100063202 | Ga0068864_1000632027 | 231 |
| 448 | 3300005618 | Ga0068864_100556228 | Ga0068864_1005562282 | 231 |
| 449 | 3300005718 | Ga0068866_10012501 | Ga0068866_100125013 | 231 |
| 450 | 3300005719 | Ga0068861_100048837 | Ga0068861_1000488374 | 231 |
| 451 | 3300005719 | Ga0068861_100212775 | Ga0068861_1002127752 | 231 |
| 452 | 3300005719 | Ga0068861_100355548 | Ga0068861_1003555481 | 231 |
| 453 | 3300005719 | Ga0068861_100725438 | Ga0068861_1007254381 | 231 |
| 454 | 3300005834 | Ga0068851_10036164 | Ga0068851_100361641 | 231 |
| 455 | 3300005840 | Ga0068870_10009612 | Ga0068870_100096127 | 231 |
| 456 | 3300005840 | Ga0068870_10024974 | Ga0068870_100249744 | 231 |
| 457 | 3300005840 | Ga0068870_10063049 | Ga0068870_100630492 | 231 |
| 458 | 3300005841 | Ga0068863_100042226 | Ga0068863_1000422264 | 231 |
| 459 | 3300005841 | Ga0068863_100082290 | Ga0068863_1000822904 | 231 |
| 460 | 3300005841 | Ga0068863_100116302 | Ga0068863_1001163021 | 231 |
| 461 | 3300005841 | Ga0068863_100537209 | Ga0068863_1005372092 | 231 |
| 462 | 3300005841 | Ga0068863_100593222 | Ga0068863_1005932222 | 231 |
| 463 | 3300005841 | Ga0068863_100764867 | Ga0068863_1007648671 | 231 |
| 464 | 3300005842 | Ga0068858_100105533 | Ga0068858_1001055332 | 231 |
| 465 | 3300005842 | Ga0068858_100110403 | Ga0068858_1001104032 | 231 |
| 466 | 3300005842 | Ga0068858_100136860 | Ga0068858_1001368602 | 231 |
| 467 | 3300005842 | Ga0068858_100292735 | Ga0068858_1002927352 | 231 |
| 468 | 3300005842 | Ga0068858_100428199 | Ga0068858_1004281992 | 231 |
| 469 | 3300005842 | Ga0068858_100749463 | Ga0068858_1007494631 | 231 |
| 470 | 3300005842 | Ga0068858_101164130 | Ga0068858_1011641301 | 231 |
| 471 | 3300005843 | Ga0068860_100057451 | Ga0068860_1000574515 | 231 |
| 472 | 3300005843 | Ga0068860_100102558 | Ga0068860_1001025582 | 231 |
| 473 | 3300005843 | Ga0068860_100136406 | Ga0068860_1001364061 | 231 |
| 474 | 3300005843 | Ga0068860_100320613 | Ga0068860_1003206132 | 231 |
| 475 | 3300005843 | Ga0068860_100669072 | Ga0068860_1006690722 | 231 |
| 476 | 3300005844 | Ga0068862_100022289 | Ga0068862_1000222896 | 231 |
| 477 | 3300005844 | Ga0068862_100039853 | Ga0068862_1000398534 | 231 |
| 478 | 3300005844 | Ga0068862_100040779 | Ga0068862_1000407793 | 231 |
| 479 | 3300005844 | Ga0068862_100447220 | Ga0068862_1004472202 | 231 |
| 480 | 3300005985 | Ga0081539_10000976 | Ga0081539_100009767 | 231 |
| 481 | 3300005985 | Ga0081539_10003361 | Ga0081539_100033617 | 231 |
| 482 | 3300005985 | Ga0081539_10005422 | Ga0081539_100054227 | 231 |
| 483 | 3300006237 | Ga0097621_100061660 | Ga0097621_1000616602 | 231 |
| 484 | 3300006237 | Ga0097621_100552084 | Ga0097621_1005520842 | 231 |
| 485 | 3300006358 | Ga0068871_100005005 | Ga0068871_10000500513 | 231 |
| 486 | 3300006358 | Ga0068871_100059136 | Ga0068871_1000591362 | 231 |
| 487 | 3300006844 | Ga0075428_100081117 | Ga0075428_1000811173 | 231 |
| 488 | 3300006846 | Ga0075430_100058059 | Ga0075430_1000580592 | 231 |
| 489 | 3300006846 | Ga0075430_100148436 | Ga0075430_1001484362 | 231 |
| 490 | 3300006846 | Ga0075430_100189610 | Ga0075430_1001896103 | 231 |
| 491 | 3300006847 | Ga0075431_100126819 | Ga0075431_1001268193 | 231 |
| 492 | 3300006847 | Ga0075431_100530951 | Ga0075431_1005309512 | 231 |
| 493 | 3300006852 | Ga0075433_10032041 | Ga0075433_100320414 | 231 |
| 494 | 3300006852 | Ga0075433_10080731 | Ga0075433_100807317 | 231 |
| 495 | 3300006852 | Ga0075433_10113009 | Ga0075433_101130093 | 231 |
| 496 | 3300006852 | Ga0075433_10315016 | Ga0075433_103150162 | 231 |
| 497 | 3300006871 | Ga0075434_100017958 | Ga0075434_1000179583 | 231 |
| 498 | 3300006871 | Ga0075434_100034935 | Ga0075434_1000349353 | 231 |
| 499 | 3300006871 | Ga0075434_100171056 | Ga0075434_1001710563 | 231 |
| 500 | 3300006871 | Ga0075434_100238187 | Ga0075434_1002381872 | 231 |
| 501 | 3300006880 | Ga0075429_100029946 | Ga0075429_1000299462 | 231 |
| 502 | 3300006880 | Ga0075429_100049604 | Ga0075429_1000496047 | 231 |
| 503 | 3300006880 | Ga0075429_100128517 | Ga0075429_1001285174 | 231 |
| 504 | 3300006880 | Ga0075429_100248821 | Ga0075429_1002488212 | 231 |
| 505 | 3300006880 | Ga0075429_100353225 | Ga0075429_1003532252 | 231 |
| 506 | 3300006881 | Ga0068865_100012683 | Ga0068865_1000126834 | 231 |
| 507 | 3300006881 | Ga0068865_100269210 | Ga0068865_1002692102 | 231 |
| 508 | 3300006914 | Ga0075436_100152989 | Ga0075436_1001529893 | 231 |
| 509 | 3300006914 | Ga0075436_100519687 | Ga0075436_1005196871 | 231 |
| 510 | 3300006931 | Ga0097620_100005985 | Ga0097620_1000059855 | 231 |
| 511 | 3300006931 | Ga0097620_100056054 | Ga0097620_1000560544 | 231 |
| 512 | 3300006931 | Ga0097620_100067591 | Ga0097620_1000675913 | 231 |
| 513 | 3300006931 | Ga0097620_100102553 | Ga0097620_1001025536 | 231 |
| 514 | 3300006931 | Ga0097620_100129107 | Ga0097620_1001291074 | 231 |
| 515 | 3300006931 | Ga0097620_100156772 | Ga0097620_1001567723 | 231 |
| 516 | 3300006931 | Ga0097620_100237249 | Ga0097620_1002372492 | 231 |
| 517 | 3300006931 | Ga0097620_100296397 | Ga0097620_1002963972 | 231 |
| 518 | 3300006931 | Ga0097620_100496266 | Ga0097620_1004962661 | 231 |
| 519 | 3300006931 | Ga0097620_100522942 | Ga0097620_1005229421 | 231 |
| 520 | 3300006931 | Ga0097620_100816681 | Ga0097620_1008166812 | 231 |
| 521 | 3300009011 | Ga0105251_10039112 | Ga0105251_100391124 | 231 |
| 522 | 3300009093 | Ga0105240_10171414 | Ga0105240_101714144 | 231 |
| 523 | 3300009093 | Ga0105240_11074102 | Ga0105240_110741022 | 231 |
| 524 | 3300009094 | Ga0111539_10005598 | Ga0111539_1000559810 | 231 |
| 525 | 3300009094 | Ga0111539_10022660 | Ga0111539_100226607 | 231 |
| 526 | 3300009094 | Ga0111539_10111096 | Ga0111539_101110963 | 231 |
| 527 | 3300009094 | Ga0111539_10155362 | Ga0111539_101553623 | 231 |
| 528 | 3300009094 | Ga0111539_10442820 | Ga0111539_104428202 | 231 |
| 529 | 3300009098 | Ga0105245_10018594 | Ga0105245_100185943 | 231 |
| 530 | 3300009098 | Ga0105245_10754080 | Ga0105245_107540802 | 231 |
| 531 | 3300009101 | Ga0105247_10057749 | Ga0105247_100577493 | 231 |
| 532 | 3300009101 | Ga0105247_10125804 | Ga0105247_101258042 | 231 |
| 533 | 3300009147 | Ga0114129_10033278 | Ga0114129_100332784 | 231 |
| 534 | 3300009147 | Ga0114129_10051383 | Ga0114129_100513834 | 231 |
| 535 | 3300009147 | Ga0114129_10134336 | Ga0114129_101343363 | 231 |
| 536 | 3300009147 | Ga0114129_10152363 | Ga0114129_101523633 | 231 |
| 537 | 3300009147 | Ga0114129_10165342 | Ga0114129_101653426 | 231 |
| 538 | 3300009147 | Ga0114129_10253970 | Ga0114129_102539703 | 231 |
| 539 | 3300009147 | Ga0114129_10468658 | Ga0114129_104686583 | 231 |
| 540 | 3300009147 | Ga0114129_10605425 | Ga0114129_106054252 | 231 |
| 541 | 3300009148 | Ga0105243_10007055 | Ga0105243_100070552 | 231 |
| 542 | 3300009148 | Ga0105243_10038543 | Ga0105243_100385437 | 231 |
| 543 | 3300009148 | Ga0105243_10516701 | Ga0105243_105167012 | 231 |
| 544 | 3300009148 | Ga0105243_11331636 | Ga0105243_113316361 | 231 |
| 545 | 3300009174 | Ga0105241_10091628 | Ga0105241_100916282 | 231 |
| 546 | 3300009174 | Ga0105241_10142240 | Ga0105241_101422403 | 231 |
| 547 | 3300009174 | Ga0105241_10203148 | Ga0105241_102031481 | 231 |
| 548 | 3300009174 | Ga0105241_10331343 | Ga0105241_103313432 | 231 |
| 549 | 3300009174 | Ga0105241_10602845 | Ga0105241_106028452 | 231 |
| 550 | 3300009176 | Ga0105242_10034629 | Ga0105242_100346293 | 231 |
| 551 | 3300009176 | Ga0105242_10159698 | Ga0105242_101596983 | 231 |
| 552 | 3300009176 | Ga0105242_10342883 | Ga0105242_103428832 | 231 |
| 553 | 3300009176 | Ga0105242_11026118 | Ga0105242_110261181 | 231 |
| 554 | 3300009177 | Ga0105248_10015006 | Ga0105248_100150065 | 231 |
| 555 | 3300009177 | Ga0105248_10043401 | Ga0105248_100434014 | 231 |
| 556 | 3300009177 | Ga0105248_10108633 | Ga0105248_101086332 | 231 |
| 557 | 3300009177 | Ga0105248_10129394 | Ga0105248_101293942 | 231 |
| 558 | 3300009177 | Ga0105248_10168767 | Ga0105248_101687674 | 231 |
| 559 | 3300009177 | Ga0105248_10247200 | Ga0105248_102472002 | 231 |
| 560 | 3300009177 | Ga0105248_10257463 | Ga0105248_102574633 | 231 |
| 561 | 3300009177 | Ga0105248_11083496 | Ga0105248_110834961 | 231 |
| 562 | 3300009177 | Ga0105248_11228796 | Ga0105248_112287961 | 231 |
| 563 | 3300009177 | Ga0105248_11269653 | Ga0105248_112696531 | 231 |
| 564 | 3300009545 | Ga0105237_10007174 | Ga0105237_100071746 | 231 |
| 565 | 3300009545 | Ga0105237_10062079 | Ga0105237_100620794 | 231 |
| 566 | 3300009545 | Ga0105237_10220127 | Ga0105237_102201272 | 231 |
| 567 | 3300009545 | Ga0105237_10674263 | Ga0105237_106742632 | 231 |
| 568 | 3300009551 | Ga0105238_10036920 | Ga0105238_100369202 | 231 |
| 569 | 3300009551 | Ga0105238_10124612 | Ga0105238_101246122 | 231 |
| 570 | 3300009551 | Ga0105238_10533444 | Ga0105238_105334441 | 231 |
| 571 | 3300009553 | Ga0105249_10025118 | Ga0105249_100251185 | 231 |
| 572 | 3300009553 | Ga0105249_10026857 | Ga0105249_100268573 | 231 |
| 573 | 3300009553 | Ga0105249_10100720 | Ga0105249_101007203 | 231 |
| 574 | 3300009553 | Ga0105249_10613873 | Ga0105249_106138732 | 231 |
| 575 | 3300010375 | Ga0105239_10201039 | Ga0105239_102010392 | 231 |
| 576 | 3300010375 | Ga0105239_10287476 | Ga0105239_102874763 | 231 |
| 577 | 3300011119 | Ga0105246_10015588 | Ga0105246_100155884 | 231 |
| 578 | 3300011119 | Ga0105246_10184623 | Ga0105246_101846233 | 231 |
| 579 | 3300011119 | Ga0105246_10223515 | Ga0105246_102235152 | 231 |
| 580 | 3300011119 | Ga0105246_10315615 | Ga0105246_103156152 | 231 |
| 581 | 3300011119 | Ga0105246_10701331 | Ga0105246_107013312 | 231 |
| 582 | 3300011119 | Ga0105246_10704992 | Ga0105246_107049921 | 231 |
| 583 | 3300013100 | Ga0157373_10021532 | Ga0157373_100215324 | 231 |
| 584 | 3300013100 | Ga0157373_10041447 | Ga0157373_100414477 | 231 |
| 585 | 3300013100 | Ga0157373_10052446 | Ga0157373_100524463 | 231 |
| 586 | 3300013100 | Ga0157373_10257455 | Ga0157373_102574551 | 231 |
| 587 | 3300013100 | Ga0157373_10393453 | Ga0157373_103934532 | 231 |
| 588 | 3300013102 | Ga0157371_10326027 | Ga0157371_103260272 | 231 |
| 589 | 3300013296 | Ga0157374_10050453 | Ga0157374_100504535 | 231 |
| 590 | 3300013296 | Ga0157374_10104758 | Ga0157374_101047582 | 231 |
| 591 | 3300013297 | Ga0157378_10026642 | Ga0157378_100266425 | 231 |
| 592 | 3300013297 | Ga0157378_10150111 | Ga0157378_101501114 | 231 |
| 593 | 3300013297 | Ga0157378_10182405 | Ga0157378_101824052 | 231 |
| 594 | 3300013297 | Ga0157378_10459996 | Ga0157378_104599962 | 231 |
| 595 | 3300013297 | Ga0157378_10724135 | Ga0157378_107241351 | 231 |
| 596 | 3300013297 | Ga0157378_11099146 | Ga0157378_110991461 | 231 |
| 597 | 3300013306 | Ga0163162_10004596 | Ga0163162_100045969 | 231 |
| 598 | 3300013306 | Ga0163162_10006687 | Ga0163162_100066875 | 231 |
| 599 | 3300013306 | Ga0163162_10051628 | Ga0163162_100516283 | 231 |
| 600 | 3300013306 | Ga0163162_10112004 | Ga0163162_101120043 | 231 |
| 601 | 3300013306 | Ga0163162_10366884 | Ga0163162_103668842 | 231 |
| 602 | 3300013307 | Ga0157372_10095280 | Ga0157372_100952804 | 231 |
| 603 | 3300013307 | Ga0157372_10194152 | Ga0157372_101941522 | 231 |
| 604 | 3300013307 | Ga0157372_10204237 | Ga0157372_102042371 | 231 |
| 605 | 3300013308 | Ga0157375_10045126 | Ga0157375_100451264 | 231 |
| 606 | 3300013308 | Ga0157375_10094256 | Ga0157375_100942561 | 231 |
| 607 | 3300013308 | Ga0157375_10094340 | Ga0157375_100943405 | 231 |
| 608 | 3300013308 | Ga0157375_10302145 | Ga0157375_103021451 | 231 |
| 609 | 3300013308 | Ga0157375_10531190 | Ga0157375_105311902 | 231 |
| 610 | 3300013308 | Ga0157375_10561574 | Ga0157375_105615742 | 231 |
| 611 | 3300013308 | Ga0157375_11293573 | Ga0157375_112935731 | 231 |
| 612 | 3300014325 | Ga0163163_10006543 | Ga0163163_100065432 | 231 |
| 613 | 3300014325 | Ga0163163_10011579 | Ga0163163_100115791 | 231 |
| 614 | 3300014325 | Ga0163163_10037229 | Ga0163163_100372294 | 231 |
| 615 | 3300014325 | Ga0163163_10061741 | Ga0163163_100617413 | 231 |
| 616 | 3300014325 | Ga0163163_10134020 | Ga0163163_101340205 | 231 |
| 617 | 3300014325 | Ga0163163_10300848 | Ga0163163_103008483 | 231 |
| 618 | 3300014325 | Ga0163163_10416433 | Ga0163163_104164332 | 231 |
| 619 | 3300014326 | Ga0157380_10005145 | Ga0157380_100051455 | 231 |
| 620 | 3300014326 | Ga0157380_10019969 | Ga0157380_100199694 | 231 |
| 621 | 3300014326 | Ga0157380_10027759 | Ga0157380_100277593 | 231 |
| 622 | 3300014326 | Ga0157380_10073876 | Ga0157380_100738762 | 231 |
| 623 | 3300014326 | Ga0157380_10102702 | Ga0157380_101027023 | 231 |
| 624 | 3300014326 | Ga0157380_10339091 | Ga0157380_103390911 | 231 |
| 625 | 3300014745 | Ga0157377_10051456 | Ga0157377_100514563 | 231 |
| 626 | 3300014745 | Ga0157377_10285994 | Ga0157377_102859941 | 231 |
| 627 | 3300014968 | Ga0157379_10229529 | Ga0157379_102295293 | 231 |
| 628 | 3300014969 | Ga0157376_10009083 | Ga0157376_100090834 | 231 |
| 629 | 3300014969 | Ga0157376_10087182 | Ga0157376_100871821 | 231 |
| 630 | 3300017792 | Ga0163161_10023268 | Ga0163161_100232683 | 231 |
| 631 | 3300017792 | Ga0163161_10183133 | Ga0163161_101831333 | 231 |
| 632 | 3300021384 | Ga0213876_10000189 | Ga0213876_100001895 | 231 |
| 633 | 3300021384 | Ga0213876_10012169 | Ga0213876_100121694 | 231 |
| 634 | 3300025885 | Ga0207653_10000289 | Ga0207653_100002898 | 231 |
| 635 | 3300025885 | Ga0207653_10084115 | Ga0207653_100841152 | 231 |
| 636 | 3300025885 | Ga0207653_10125349 | Ga0207653_101253492 | 231 |
| 637 | 3300025900 | Ga0207710_10008744 | Ga0207710_100087443 | 231 |
| 638 | 3300025900 | Ga0207710_10248278 | Ga0207710_102482781 | 231 |
| 639 | 3300025901 | Ga0207688_10229092 | Ga0207688_102290922 | 231 |
| 640 | 3300025903 | Ga0207680_10023352 | Ga0207680_100233524 | 231 |
| 641 | 3300025904 | Ga0207647_10102056 | Ga0207647_101020562 | 231 |
| 642 | 3300025904 | Ga0207647_10119899 | Ga0207647_101198993 | 231 |
| 643 | 3300025904 | Ga0207647_10156058 | Ga0207647_101560582 | 231 |
| 644 | 3300025907 | Ga0207645_10063229 | Ga0207645_100632293 | 231 |
| 645 | 3300025907 | Ga0207645_10339849 | Ga0207645_103398491 | 231 |
| 646 | 3300025908 | Ga0207643_10020369 | Ga0207643_100203693 | 231 |
| 647 | 3300025908 | Ga0207643_10087555 | Ga0207643_100875553 | 231 |
| 648 | 3300025908 | Ga0207643_10122340 | Ga0207643_101223402 | 231 |
| 649 | 3300025910 | Ga0207684_10000085 | Ga0207684_1000008591 | 231 |
| 650 | 3300025910 | Ga0207684_10152505 | Ga0207684_101525052 | 231 |
| 651 | 3300025910 | Ga0207684_10329167 | Ga0207684_103291672 | 231 |
| 652 | 3300025911 | Ga0207654_10013384 | Ga0207654_100133844 | 231 |
| 653 | 3300025911 | Ga0207654_10110300 | Ga0207654_101103001 | 231 |
| 654 | 3300025911 | Ga0207654_10438647 | Ga0207654_104386471 | 231 |
| 655 | 3300025912 | Ga0207707_10000503 | Ga0207707_1000050333 | 231 |
| 656 | 3300025912 | Ga0207707_10050582 | Ga0207707_100505824 | 231 |
| 657 | 3300025912 | Ga0207707_10168562 | Ga0207707_101685623 | 231 |
| 658 | 3300025913 | Ga0207695_10081076 | Ga0207695_100810763 | 231 |
| 659 | 3300025913 | Ga0207695_10250144 | Ga0207695_102501442 | 231 |
| 660 | 3300025914 | Ga0207671_10004181 | Ga0207671_100041816 | 231 |
| 661 | 3300025914 | Ga0207671_10266569 | Ga0207671_102665692 | 231 |
| 662 | 3300025914 | Ga0207671_10275488 | Ga0207671_102754882 | 231 |
| 663 | 3300025917 | Ga0207660_10001058 | Ga0207660_1000105811 | 231 |
| 664 | 3300025917 | Ga0207660_10122254 | Ga0207660_101222543 | 231 |
| 665 | 3300025918 | Ga0207662_10005060 | Ga0207662_100050605 | 231 |
| 666 | 3300025918 | Ga0207662_10040549 | Ga0207662_100405492 | 231 |
| 667 | 3300025918 | Ga0207662_10059769 | Ga0207662_100597693 | 231 |
| 668 | 3300025918 | Ga0207662_10071042 | Ga0207662_100710423 | 231 |
| 669 | 3300025919 | Ga0207657_10084649 | Ga0207657_100846492 | 231 |
| 670 | 3300025920 | Ga0207649_10024546 | Ga0207649_100245463 | 231 |
| 671 | 3300025921 | Ga0207652_10000427 | Ga0207652_1000042737 | 231 |
| 672 | 3300025921 | Ga0207652_10123680 | Ga0207652_101236804 | 231 |
| 673 | 3300025922 | Ga0207646_10005737 | Ga0207646_100057376 | 231 |
| 674 | 3300025922 | Ga0207646_10032750 | Ga0207646_100327505 | 231 |
| 675 | 3300025922 | Ga0207646_10125665 | Ga0207646_101256651 | 231 |
| 676 | 3300025923 | Ga0207681_10005504 | Ga0207681_100055047 | 231 |
| 677 | 3300025923 | Ga0207681_10679801 | Ga0207681_106798011 | 231 |
| 678 | 3300025924 | Ga0207694_10004209 | Ga0207694_100042098 | 231 |
| 679 | 3300025924 | Ga0207694_10070744 | Ga0207694_100707444 | 231 |
| 680 | 3300025925 | Ga0207650_10000028 | Ga0207650_100000287 | 231 |
| 681 | 3300025925 | Ga0207650_10103447 | Ga0207650_101034472 | 231 |
| 682 | 3300025925 | Ga0207650_10194481 | Ga0207650_101944811 | 231 |
| 683 | 3300025925 | Ga0207650_10304601 | Ga0207650_103046012 | 231 |
| 684 | 3300025925 | Ga0207650_10480823 | Ga0207650_104808232 | 231 |
| 685 | 3300025926 | Ga0207659_10049731 | Ga0207659_100497312 | 231 |
| 686 | 3300025926 | Ga0207659_10293103 | Ga0207659_102931032 | 231 |
| 687 | 3300025927 | Ga0207687_10053920 | Ga0207687_100539203 | 231 |
| 688 | 3300025927 | Ga0207687_10315948 | Ga0207687_103159482 | 231 |
| 689 | 3300025931 | Ga0207644_10003226 | Ga0207644_100032266 | 231 |
| 690 | 3300025931 | Ga0207644_10650219 | Ga0207644_106502192 | 231 |
| 691 | 3300025932 | Ga0207690_10003154 | Ga0207690_100031545 | 231 |
| 692 | 3300025932 | Ga0207690_10930261 | Ga0207690_109302611 | 231 |
| 693 | 3300025933 | Ga0207706_10050740 | Ga0207706_100507404 | 231 |
| 694 | 3300025933 | Ga0207706_10352273 | Ga0207706_103522732 | 231 |
| 695 | 3300025933 | Ga0207706_10388538 | Ga0207706_103885381 | 231 |
| 696 | 3300025933 | Ga0207706_10408407 | Ga0207706_104084072 | 231 |
| 697 | 3300025934 | Ga0207686_10010563 | Ga0207686_100105634 | 231 |
| 698 | 3300025934 | Ga0207686_10121904 | Ga0207686_101219043 | 231 |
| 699 | 3300025935 | Ga0207709_10034818 | Ga0207709_100348183 | 231 |
| 700 | 3300025935 | Ga0207709_10045264 | Ga0207709_100452642 | 231 |
| 701 | 3300025935 | Ga0207709_10053093 | Ga0207709_100530932 | 231 |
| 702 | 3300025935 | Ga0207709_10101498 | Ga0207709_101014981 | 231 |
| 703 | 3300025935 | Ga0207709_10875139 | Ga0207709_108751391 | 231 |
| 704 | 3300025936 | Ga0207670_10002963 | Ga0207670_100029635 | 231 |
| 705 | 3300025937 | Ga0207669_10141252 | Ga0207669_101412522 | 231 |
| 706 | 3300025938 | Ga0207704_10010523 | Ga0207704_100105234 | 231 |
| 707 | 3300025938 | Ga0207704_10566315 | Ga0207704_105663151 | 231 |
| 708 | 3300025939 | Ga0207665_10160343 | Ga0207665_101603432 | 231 |
| 709 | 3300025940 | Ga0207691_10032538 | Ga0207691_100325384 | 231 |
| 710 | 3300025940 | Ga0207691_10201269 | Ga0207691_102012692 | 231 |
| 711 | 3300025941 | Ga0207711_10087939 | Ga0207711_100879394 | 231 |
| 712 | 3300025941 | Ga0207711_10208116 | Ga0207711_102081162 | 231 |
| 713 | 3300025941 | Ga0207711_10217021 | Ga0207711_102170212 | 231 |
| 714 | 3300025941 | Ga0207711_10230622 | Ga0207711_102306223 | 231 |
| 715 | 3300025941 | Ga0207711_10536294 | Ga0207711_105362941 | 231 |
| 716 | 3300025942 | Ga0207689_10037371 | Ga0207689_100373713 | 231 |
| 717 | 3300025942 | Ga0207689_10042361 | Ga0207689_100423614 | 231 |
| 718 | 3300025942 | Ga0207689_10080358 | Ga0207689_100803584 | 231 |
| 719 | 3300025942 | Ga0207689_10131493 | Ga0207689_101314932 | 231 |
| 720 | 3300025942 | Ga0207689_10756769 | Ga0207689_107567691 | 231 |
| 721 | 3300025945 | Ga0207679_10057001 | Ga0207679_100570012 | 231 |
| 722 | 3300025945 | Ga0207679_10397717 | Ga0207679_103977172 | 231 |
| 723 | 3300025945 | Ga0207679_10961693 | Ga0207679_109616931 | 231 |
| 724 | 3300025949 | Ga0207667_10281602 | Ga0207667_102816022 | 231 |
| 725 | 3300025961 | Ga0207712_10020659 | Ga0207712_100206593 | 231 |
| 726 | 3300025961 | Ga0207712_10064063 | Ga0207712_100640633 | 231 |
| 727 | 3300025981 | Ga0207640_10088859 | Ga0207640_100888591 | 231 |
| 728 | 3300025981 | Ga0207640_10451175 | Ga0207640_104511752 | 231 |
| 729 | 3300025986 | Ga0207658_10133133 | Ga0207658_101331331 | 231 |
| 730 | 3300026023 | Ga0207677_10273050 | Ga0207677_102730502 | 231 |
| 731 | 3300026035 | Ga0207703_10080321 | Ga0207703_100803215 | 231 |
| 732 | 3300026035 | Ga0207703_10086633 | Ga0207703_100866332 | 231 |
| 733 | 3300026035 | Ga0207703_10088339 | Ga0207703_100883394 | 231 |
| 734 | 3300026035 | Ga0207703_10411899 | Ga0207703_104118991 | 231 |
| 735 | 3300026041 | Ga0207639_10013858 | Ga0207639_100138584 | 231 |
| 736 | 3300026041 | Ga0207639_10071514 | Ga0207639_100715141 | 231 |
| 737 | 3300026041 | Ga0207639_10132216 | Ga0207639_101322161 | 231 |
| 738 | 3300026041 | Ga0207639_10798569 | Ga0207639_107985692 | 231 |
| 739 | 3300026075 | Ga0207708_10008557 | Ga0207708_100085574 | 231 |
| 740 | 3300026075 | Ga0207708_10011438 | Ga0207708_100114384 | 231 |
| 741 | 3300026075 | Ga0207708_10020009 | Ga0207708_100200094 | 231 |
| 742 | 3300026075 | Ga0207708_10054210 | Ga0207708_100542105 | 231 |
| 743 | 3300026075 | Ga0207708_10185355 | Ga0207708_101853552 | 231 |
| 744 | 3300026075 | Ga0207708_10309400 | Ga0207708_103094002 | 231 |
| 745 | 3300026075 | Ga0207708_10459200 | Ga0207708_104592002 | 231 |
| 746 | 3300026078 | Ga0207702_10003231 | Ga0207702_100032318 | 231 |
| 747 | 3300026088 | Ga0207641_10060418 | Ga0207641_100604182 | 231 |
| 748 | 3300026088 | Ga0207641_10239501 | Ga0207641_102395011 | 231 |
| 749 | 3300026088 | Ga0207641_10538699 | Ga0207641_105386992 | 231 |
| 750 | 3300026088 | Ga0207641_10865173 | Ga0207641_108651732 | 231 |
| 751 | 3300026089 | Ga0207648_10050189 | Ga0207648_100501894 | 231 |
| 752 | 3300026089 | Ga0207648_10052615 | Ga0207648_100526155 | 231 |
| 753 | 3300026089 | Ga0207648_10079277 | Ga0207648_100792772 | 231 |
| 754 | 3300026089 | Ga0207648_10565020 | Ga0207648_105650202 | 231 |
| 755 | 3300026089 | Ga0207648_10705433 | Ga0207648_107054331 | 231 |
| 756 | 3300026095 | Ga0207676_10029900 | Ga0207676_100299006 | 231 |
| 757 | 3300026095 | Ga0207676_10040297 | Ga0207676_100402973 | 231 |
| 758 | 3300026095 | Ga0207676_10044163 | Ga0207676_100441636 | 231 |
| 759 | 3300026095 | Ga0207676_10128702 | Ga0207676_101287022 | 231 |
| 760 | 3300026095 | Ga0207676_10226274 | Ga0207676_102262741 | 231 |
| 761 | 3300026095 | Ga0207676_10748236 | Ga0207676_107482362 | 231 |
| 762 | 3300026116 | Ga0207674_10006877 | Ga0207674_100068777 | 231 |
| 763 | 3300026116 | Ga0207674_10215525 | Ga0207674_102155252 | 231 |
| 764 | 3300026116 | Ga0207674_10781764 | Ga0207674_107817642 | 231 |
| 765 | 3300026118 | Ga0207675_100014977 | Ga0207675_1000149774 | 231 |
| 766 | 3300026118 | Ga0207675_100017801 | Ga0207675_1000178017 | 231 |
| 767 | 3300026118 | Ga0207675_100057101 | Ga0207675_1000571012 | 231 |
| 768 | 3300026118 | Ga0207675_100116020 | Ga0207675_1001160201 | 231 |
| 769 | 3300026118 | Ga0207675_100215370 | Ga0207675_1002153702 | 231 |
| 770 | 3300026118 | Ga0207675_100232587 | Ga0207675_1002325872 | 231 |
| 771 | 3300026118 | Ga0207675_100284789 | Ga0207675_1002847892 | 231 |
| 772 | 3300026142 | Ga0207698_10267356 | Ga0207698_102673562 | 231 |
| 773 | 3300026142 | Ga0207698_10425608 | Ga0207698_104256082 | 231 |
| 774 | 3300026142 | Ga0207698_10500083 | Ga0207698_105000832 | 231 |
| 775 | 3300026142 | Ga0207698_10741452 | Ga0207698_107414522 | 231 |
| 776 | 3300027907 | Ga0207428_10008641 | Ga0207428_100086415 | 231 |
| 777 | 3300027907 | Ga0207428_10029137 | Ga0207428_100291372 | 231 |
| 778 | 3300027907 | Ga0207428_10291965 | Ga0207428_102919652 | 231 |
| 779 | 3300028380 | Ga0268265_10016285 | Ga0268265_100162852 | 231 |
| 780 | 3300028380 | Ga0268265_10428950 | Ga0268265_104289502 | 231 |
| 781 | 3300028380 | Ga0268265_11026802 | Ga0268265_110268021 | 231 |
| 782 | 3300028381 | Ga0268264_10067613 | Ga0268264_100676133 | 231 |
| 783 | 3300028381 | Ga0268264_10073195 | Ga0268264_100731952 | 231 |
| 784 | 3300028381 | Ga0268264_10073340 | Ga0268264_100733402 | 231 |
| 785 | 3300028381 | Ga0268264_10094740 | Ga0268264_100947404 | 231 |
| 786 | 3300028381 | Ga0268264_10221688 | Ga0268264_102216882 | 231 |
| 787 | 3300031456 | Ga0307513_10006106 | Ga0307513_100061068 | 231 |
| 788 | 3300031548 | Ga0307408_100097520 | Ga0307408_1000975202 | 231 |
| 789 | 3300031548 | Ga0307408_100218128 | Ga0307408_1002181282 | 231 |
| 790 | 3300031731 | Ga0307405_10664672 | Ga0307405_106646721 | 231 |
| 791 | 3300031852 | Ga0307410_10460867 | Ga0307410_104608672 | 231 |
| 792 | 3300031903 | Ga0307407_10092030 | Ga0307407_100920302 | 231 |
| 793 | 3300031911 | Ga0307412_10094052 | Ga0307412_100940523 | 231 |
| 794 | 3300031911 | Ga0307412_10162625 | Ga0307412_101626251 | 231 |
| 795 | 3300031995 | Ga0307409_100541704 | Ga0307409_1005417042 | 231 |
| 796 | 3300032002 | Ga0307416_100169744 | Ga0307416_1001697442 | 231 |
| 797 | 3300032002 | Ga0307416_100303153 | Ga0307416_1003031532 | 231 |
| 798 | 3300032005 | Ga0307411_10220409 | Ga0307411_102204092 | 231 |
| 799 | 3300032126 | Ga0307415_100061990 | Ga0307415_1000619902 | 231 |
| 800 | 3300032126 | Ga0307415_100103517 | Ga0307415_1001035172 | 231 |
| 801 | 3300035091 | Ga0373951_0003684 | Ga0373951_0003684_2690_3385 | 231 |
| 802 | 3300035115 | Ga0373941_0014628 | Ga0373941_0014628_1196_1891 | 231 |
| 803 | 3300035241 | Ga0373961_0015753 | Ga0373961_0015753_957_1652 | 231 |
| 804 | 3300037312 | Ga0395899_0366668 | Ga0395899_0366668_247_942 | 231 |
| 805 | 3300037418 | Ga0395900_0449590 | Ga0395900_0449590_158_853 | 231 |
| 806 | 3300037418 | Ga0395900_0701935 | Ga0395900_0701935_173_868 | 231 |
| 807 | 3300037466 | Ga0395898_0243037 | Ga0395898_0243037_22_717 | 231 |
| 808 | 3300037466 | Ga0395898_0536086 | Ga0395898_0536086_371_1066 | 231 |
| 809 | 3300037471 | Ga0395905_0056292 | Ga0395905_0056292_817_1512 | 231 |
| 810 | 3300037471 | Ga0395905_0090677 | Ga0395905_0090677_1367_2062 | 231 |
| 811 | 3300037471 | Ga0395905_0181892 | Ga0395905_0181892_168_863 | 231 |
| 812 | 3300037853 | Ga0436364_0946147 | Ga0436364_0946147_340_1035 | 231 |
| 813 | 3300038443 | Ga0395901_0079524 | Ga0395901_0079524_888_1583 | 231 |
| 814 | 3300038443 | Ga0395901_0307224 | Ga0395901_0307224_482_1177 | 231 |
| 815 | 3300038443 | Ga0395901_0451249 | Ga0395901_0451249_130_825 | 231 |
| 816 | 3300038699 | Ga0242422_00217 | Ga0242422_00217_681_1376 | 231 |
| 817 | 3300039437 | Ga0436365_0668830 | Ga0436365_0668830_3350_4054 | 231 |
| 818 | 3300039437 | Ga0436365_1324789 | Ga0436365_1324789_3430_4134 | 231 |
| 819 | 3300042000 | Ga0439437_004698 | Ga0439437_004698_27_722 | 231 |
| 820 | 3300042012 | Ga0439455_0024392 | Ga0439455_0024392_571_1266 | 231 |
| 821 | 3300042015 | Ga0439462_0018632 | Ga0439462_0018632_11_706 | 231 |
| 822 | 3300044712 | Ga0453684_0135319 | Ga0453684_0135319_1296_1991 | 231 |
| 823 | 3300045051 | Ga0451576_0042679 | Ga0451576_0042679_2662_3357 | 231 |
| 824 | 3300045051 | Ga0451576_0123757 | Ga0451576_0123757_795_1490 | 231 |
| 825 | 3300045051 | Ga0451576_0467571 | Ga0451576_0467571_528_1223 | 231 |
| 826 | 3300046476 | Ga0495662_0049709 | Ga0495662_0049709_80_775 | 231 |
| 827 | 3300046539 | Ga0495621_0035293 | Ga0495621_0035293_361_1056 | 231 |
| 828 | 3300046684 | Ga0495669_0209013 | Ga0495669_0209013_145_840 | 231 |
| 829 | 3300046690 | Ga0495624_0279216 | Ga0495624_0279216_157_852 | 231 |
| 830 | 3300047320 | Ga0495672_0108240 | Ga0495672_0108240_592_1287 | 231 |
| 831 | 3300048903 | Ga0496100_0337786 | Ga0496100_0337786_179_874 | 231 |
| 832 | 3300048905 | Ga0496102_0219944 | Ga0496102_0219944_114_809 | 231 |
| 833 | 3300048905 | Ga0496102_0544190 | Ga0496102_0544190_46_741 | 231 |
| 834 | 3300048906 | Ga0496103_0102110 | Ga0496103_0102110_625_1320 | 231 |
| 835 | 3300048907 | Ga0496104_0128970 | Ga0496104_0128970_911_1606 | 231 |
| 836 | 3300048907 | Ga0496104_0606617 | Ga0496104_0606617_280_975 | 231 |
| 837 | 3300048909 | Ga0496106_0123767 | Ga0496106_0123767_142_837 | 231 |
| 838 | 3300048911 | Ga0496108_0047160 | Ga0496108_0047160_1497_2192 | 231 |
| 839 | 3300048911 | Ga0496108_0108888 | Ga0496108_0108888_814_1509 | 231 |
| 840 | 3300048911 | Ga0496108_0220303 | Ga0496108_0220303_131_826 | 231 |
| 841 | 3300048912 | Ga0496109_0450319 | Ga0496109_0450319_25_720 | 231 |
| 842 | 3300048913 | Ga0496110_0277632 | Ga0496110_0277632_41_736 | 231 |
| 843 | 3300048915 | Ga0496112_0706399 | Ga0496112_0706399_19_714 | 231 |
| 844 | 3300048916 | Ga0496113_0069556 | Ga0496113_0069556_1093_1788 | 231 |
| 845 | 3300048916 | Ga0496113_0620813 | Ga0496113_0620813_65_760 | 231 |
| 846 | 3300049514 | Ga0501291_002976 | Ga0501291_002976_1119_1814 | 231 |
| 847 | 3300049515 | Ga0501292_008452 | Ga0501292_008452_602_1297 | 231 |
| 848 | 3300049521 | Ga0501298_000210 | Ga0501298_000210_204_899 | 231 |
| 849 | 3300049568 | Ga0501031_0491202 | Ga0501031_0491202_16_711 | 231 |
| 850 | 3300049572 | Ga0501036_0609701 | Ga0501036_0609701_65_760 | 231 |
| 851 | 3300049574 | Ga0501038_0039911 | Ga0501038_0039911_1318_2013 | 231 |
| 852 | 3300049575 | Ga0501039_0306734 | Ga0501039_0306734_391_1086 | 231 |
| 853 | 3300049580 | Ga0501046_0523599 | Ga0501046_0523599_27_722 | 231 |
| 854 | 3300049582 | Ga0501048_0172078 | Ga0501048_0172078_565_1260 | 231 |
| 855 | 3300049649 | Ga0501198_004864 | Ga0501198_004864_175_870 | 231 |
| 856 | 3300049649 | Ga0501198_012550 | Ga0501198_012550_206_901 | 231 |
| 857 | 3300049660 | Ga0501216_008119 | Ga0501216_008119_36_731 | 231 |
| 858 | 3300049661 | Ga0501217_001526 | Ga0501217_001526_3280_3975 | 231 |
| 859 | 3300049661 | Ga0501217_042366 | Ga0501217_042366_369_1064 | 231 |
| 860 | 3300049663 | Ga0501223_004673 | Ga0501223_004673_286_981 | 231 |
| 861 | 3300049665 | Ga0501227_000676 | Ga0501227_000676_4127_4822 | 231 |
| 862 | 3300049665 | Ga0501227_013089 | Ga0501227_013089_564_1259 | 231 |
| 863 | 3300049668 | Ga0501233_001251 | Ga0501233_001251_88_783 | 231 |
| 864 | 3300049668 | Ga0501233_082490 | Ga0501233_082490_78_773 | 231 |
| 865 | 3300049669 | Ga0501235_027812 | Ga0501235_027812_326_1021 | 231 |
| 866 | 3300049673 | Ga0501240_007538 | Ga0501240_007538_387_1082 | 231 |
| 867 | 3300049675 | Ga0501243_004136 | Ga0501243_004136_920_1615 | 231 |
| 868 | 3300049679 | Ga0501249_029095 | Ga0501249_029095_28_723 | 231 |
| 869 | 3300049680 | Ga0501250_005082 | Ga0501250_005082_618_1313 | 231 |
| 870 | 3300049686 | Ga0501257_048050 | Ga0501257_048050_75_770 | 231 |
| 871 | 3300049689 | Ga0501260_005348 | Ga0501260_005348_311_1006 | 231 |
| 872 | 3300049704 | Ga0501221_029838 | Ga0501221_029838_245_940 | 231 |
| 873 | 3300049705 | Ga0501225_0005103 | Ga0501225_0005103_2886_3581 | 231 |
| 874 | 3300049705 | Ga0501225_0008807 | Ga0501225_0008807_1045_1740 | 231 |
| 875 | 3300049705 | Ga0501225_0043454 | Ga0501225_0043454_529_1224 | 231 |
| 876 | 3300049706 | Ga0501229_005706 | Ga0501229_005706_495_1190 | 231 |
| 877 | 3300049707 | Ga0501234_005684 | Ga0501234_005684_642_1337 | 231 |
| 878 | 3300049743 | Ga0501081_0217249 | Ga0501081_0217249_151_846 | 231 |
| 879 | 3300049765 | Ga0501268_002066 | Ga0501268_002066_567_1262 | 231 |
| 880 | 3300049770 | Ga0501273_002856 | Ga0501273_002856_957_1652 | 231 |
| 881 | 3300049779 | Ga0501283_000878 | Ga0501283_000878_100_795 | 231 |
| 882 | 3300049824 | Ga0501045_0137018 | Ga0501045_0137018_608_1303 | 231 |
| 883 | 3300049851 | Ga0501212_005060 | Ga0501212_005060_613_1308 | 231 |
| 884 | 3300049851 | Ga0501212_009563 | Ga0501212_009563_140_835 | 231 |
| 885 | 3300050507 | nmdc:mga05p37_1016194_c1 | nmdc:mga05p37_1016194_c1_87_782 | 231 |
| 886 | 3300050507 | nmdc:mga05p37_128116_c1 | nmdc:mga05p37_128116_c1_217_912 | 231 |
| 887 | 3300050507 | nmdc:mga05p37_240436_c1 | nmdc:mga05p37_240436_c1_772_1467 | 231 |
| 888 | 3300050507 | nmdc:mga05p37_24636_c1 | nmdc:mga05p37_24636_c1_2114_2809 | 231 |
| 889 | 3300050507 | nmdc:mga05p37_400677_c1 | nmdc:mga05p37_400677_c1_228_923 | 231 |
| 890 | 3300050507 | nmdc:mga05p37_62370_c1 | nmdc:mga05p37_62370_c1_2405_3100 | 231 |
| 891 | 3300050507 | nmdc:mga05p37_9408_c1 | nmdc:mga05p37_9408_c1_7183_7878 | 231 |
| 892 | 3300050508 | nmdc:mga09592_290034_c1 | nmdc:mga09592_290034_c1_208_903 | 231 |
| 893 | 3300050508 | nmdc:mga09592_490396_c1 | nmdc:mga09592_490396_c1_210_905 | 231 |
| 894 | 3300050509 | nmdc:mga0qj67_19355_c1 | nmdc:mga0qj67_19355_c1_433_1128 | 231 |
| 895 | 3300050509 | nmdc:mga0qj67_40806_c1 | nmdc:mga0qj67_40806_c1_2605_3300 | 231 |
| 896 | 3300050510 | nmdc:mga06r32_1057685_c1 | nmdc:mga06r32_1057685_c1_40_735 | 231 |
| 897 | 3300050510 | nmdc:mga06r32_119210_c1 | nmdc:mga06r32_119210_c1_441_1136 | 231 |
| 898 | 3300050510 | nmdc:mga06r32_34611_c1 | nmdc:mga06r32_34611_c1_620_1315 | 231 |
| 899 | 3300050510 | nmdc:mga06r32_400396_c1 | nmdc:mga06r32_400396_c1_260_955 | 231 |
| 900 | 3300050511 | nmdc:mga08y16_257168_c1 | nmdc:mga08y16_257168_c1_484_1179 | 231 |
| 901 | 3300050511 | nmdc:mga08y16_512728_c1 | nmdc:mga08y16_512728_c1_372_1067 | 231 |
| 902 | 3300050511 | nmdc:mga08y16_55017_c1 | nmdc:mga08y16_55017_c1_1839_2534 | 231 |
| 903 | 3300050512 | nmdc:mga0n895_218271_c1 | nmdc:mga0n895_218271_c1_947_1642 | 231 |
| 904 | 3300050512 | nmdc:mga0n895_236290_c1 | nmdc:mga0n895_236290_c1_364_1059 | 231 |
| 905 | 3300050512 | nmdc:mga0n895_237760_c1 | nmdc:mga0n895_237760_c1_264_959 | 231 |
| 906 | 3300050512 | nmdc:mga0n895_534629_c1 | nmdc:mga0n895_534629_c1_385_1080 | 231 |
| 907 | 3300050512 | nmdc:mga0n895_94842_c1 | nmdc:mga0n895_94842_c1_1732_2427 | 231 |
| 908 | 3300050513 | nmdc:mga0rr50_66420_c1 | nmdc:mga0rr50_66420_c1_1377_2072 | 231 |
| 909 | 3300050513 | nmdc:mga0rr50_8964_c1 | nmdc:mga0rr50_8964_c1_3663_4358 | 231 |
| 910 | 3300050514 | nmdc:mga08x19_383877_c1 | nmdc:mga08x19_383877_c1_40_735 | 231 |
| 911 | 3300050515 | nmdc:mga0a205_149264_c1 | nmdc:mga0a205_149264_c1_452_1147 | 231 |
| 912 | 3300050515 | nmdc:mga0a205_22736_c1 | nmdc:mga0a205_22736_c1_4280_4975 | 231 |
| 913 | 3300050515 | nmdc:mga0a205_323544_c1 | nmdc:mga0a205_323544_c1_490_1185 | 231 |
| 914 | 3300050515 | nmdc:mga0a205_32992_c2 | nmdc:mga0a205_32992_c2_1102_1797 | 231 |
| 915 | 3300050515 | nmdc:mga0a205_55769_c1 | nmdc:mga0a205_55769_c1_1021_1716 | 231 |
| 916 | 3300053083 | Ga0495655_0004445 | Ga0495655_0004445_1075_1770 | 231 |
| 917 | 3300053153 | Ga0500616_0003846 | Ga0500616_0003846_8278_8973 | 231 |
| 918 | 3300054114 | Ga0501084_0139680 | Ga0501084_0139680_400_1095 | 231 |
| 919 | 3300059511 | Ga0587091_033311 | Ga0587091_033311_94_789 | 231 |
| 920 | 3300059513 | Ga0587094_020417 | Ga0587094_020417_74_769 | 231 |
| 921 | 3300061734 | Ga0530510_0109649 | Ga0530510_0109649_39_734 | 231 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4v9h-assembly1.cif.gz_BC | crystal structure of the ribosome bound to elongation factor g in the guanosine triphosphatase state | 0.9622 | 3 | 225 |
| 4v8y-assembly1.cif.gz_CL | cryo-em reconstruction of the 80s-eif5b-met-itrnamet eukaryotic translation initiation complex | 0.9619 | 3 | 225 |
| 5npm-assembly1.cif.gz_A | crystal structure of mutant ribosomal protein tthl1 lacking 8 n-terminal residues in complex with 80nt 23s rna from thermus thermophilus | 0.9616 | 19 | 227 |
| 4qg3-assembly1.cif.gz_A | crystal structure of mutant ribosomal protein g219v tthl1 in complex with 80nt 23s rna from thermus thermophilus | 0.9592 | 3 | 227 |
| 4v5f-assembly1.cif.gz_BC | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.9584 | 3 | 225 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q60E59_194_280_3.40.50.790 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Ribosomal protein L1/L10, domain II | 0.9837 | 74 | 159 | 3.40.50.790 |
| af_P9WHC7_16_229_3.30.190.20 | Alpha Beta;2-Layer Sandwich;Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase;Ribosomal protein L1/L10, rRNA-binding domain | 0.9753 | 16 | 228 | 3.30.190.20 |
| af_I1L5L1_126_340_3.30.190.20 | Alpha Beta;2-Layer Sandwich;Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase;Ribosomal protein L1/L10, rRNA-binding domain | 0.9692 | 19 | 230 | 3.30.190.20 |
| af_P9WHC7_16_229_3.30.190.20 | Alpha Beta;2-Layer Sandwich;Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase;Ribosomal protein L1/L10, rRNA-binding domain | 0.9663 | 16 | 228 | 3.30.190.20 |
| af_Q60E59_194_280_3.40.50.790 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Ribosomal protein L1/L10, domain II | 0.9617 | 74 | 159 | 3.40.50.790 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3D0ZF81-F1-model_v4 | Ribosomal protein | 0.9824 | 75 | 229 |
GO:0000049
GO:0003735 GO:0006412 GO:0006417 GO:0015934 GO:0019843 |
| AF-A0A7C2WPR6-F1-model_v4 | Ribosomal protein | 0.9806 | 66 | 229 |
GO:0003735
GO:0006412 GO:0006417 GO:0015934 GO:0019843 |
| AF-A0A523D245-F1-model_v4 | Ribosomal protein | 0.9803 | 48 | 229 |
GO:0003735
GO:0006412 GO:0006417 GO:0015934 GO:0019843 |
| AF-A0A5B9PBB2-F1-model_v4 | Large ribosomal subunit protein uL1 | 0.9795 | 1 | 225 |
GO:0000049
GO:0003735 GO:0006412 GO:0006417 GO:0015934 GO:0019843 |
| AF-A0A4Q6EU90-F1-model_v4 | deleted | 0.9786 | 70 | 229 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar