F485758

General Info

Members Datasets Scaffolds Average Seq Length
921 298 921 228

Family's Representative Sequence

Representative Sequence 3300009101|Ga0105247_10327849|Ga0105247_103278492
Length 225
Sequence MAKKGKKYRAALEKIEPNKKYTLDEGLAKVKEISFAKFDETVELTMWLGVDPRKADQLVRGTIVLPHGLGGAAKKVVVIAQGDKIREAQEAGADIVDRIKGGWLEFDALIATPDMMGKVGQLGKVLGPRGLMPNPKTGTVTMDVAKAIQETKAGKVEYRVDKTGVIHSPVGKVSFDGAKLKENASVLINAVMRAKPATAKGRYLKKINLAPTMGPGVLLDELAYV

Samples

Sample ID Description Type Environment
1 3300000531 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB_Illumina_Assembled Metagenome Rhizosphere
2 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
3 3300001426 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 Metagenome Rhizosphere
4 3300001432 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
6 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
7 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
8 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
9 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
10 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
11 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
13 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
14 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
28 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
41 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
42 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
43 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
44 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
45 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
46 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
47 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
48 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
49 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
50 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
51 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
52 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
53 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
54 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
55 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
56 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
57 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
58 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
59 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
60 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
61 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
62 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
63 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
64 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
65 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
66 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
67 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
68 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
69 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
70 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
71 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
72 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
73 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
74 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
75 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
76 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
77 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
78 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
79 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
80 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
81 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
82 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
83 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
84 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
85 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
86 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
88 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
89 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
90 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
91 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
92 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
93 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
94 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
95 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
96 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
97 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
98 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
99 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
100 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
101 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
102 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
103 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
104 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
105 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
106 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
107 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
108 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
109 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
110 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
111 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
112 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
113 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
114 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
115 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
116 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
117 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
118 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
119 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
120 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
121 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
122 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
123 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
124 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
125 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
126 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
127 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
128 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
186 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300030877 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
189 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
190 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
191 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
192 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
193 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
194 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
195 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
196 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
197 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
198 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
199 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
200 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
201 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
202 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
203 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
204 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
205 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
206 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
207 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
208 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
209 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
210 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
211 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
212 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
213 3300038699 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 Metagenome Rhizosphere
214 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
215 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
216 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
217 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
218 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
219 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
220 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
221 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
222 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
223 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
224 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
225 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
226 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
227 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
228 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
229 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
230 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
231 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
232 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
233 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
234 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
235 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
236 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
237 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
238 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
239 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
240 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
241 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
242 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
243 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
244 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
245 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
246 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
247 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
248 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
253 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
256 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
257 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
258 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
259 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
260 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
261 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
262 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
263 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
264 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
265 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
266 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
267 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
268 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
269 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
270 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
271 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
272 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
273 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
274 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
275 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
276 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
277 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
278 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
279 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
280 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
281 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
282 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
283 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
284 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
285 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
286 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
287 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
288 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
289 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
290 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
291 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
292 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
293 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
294 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
295 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
296 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
297 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
298 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.7
Metatranscriptomes 1.3
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.11
Nodule 0
Rhizoplane 1.74
Rhizosphere 96.96
Stem 0
Stem Tuber 0
Unclassified 1.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNBas_1000372 3300000531 Bacteria 1893
2 CNAas_1001813 3300000532 Bacteria 1666
3 JGI24030J14995_100433 3300001426 Bacteria 1327
4 JGI24034J14986_100801 3300001432 Bacteria 1873
5 JGI24748J21848_1000014 3300002074 Bacteria 147126
6 JGI24034J26672_10000012 3300002239 Bacteria 146139
7 JGI24751J29686_10000074 3300002459 Bacteria 56035
8 JGI25406J46586_10011912 3300003203 Bacteria 3794
9 JGI25406J46586_10014740 3300003203 Bacteria 3318
10 JGI25406J46586_10026245 3300003203 Bacteria 2249
11 Ga0058863_10009163 3300004799 Bacteria 2201
12 Ga0058861_11955377 3300004800 Bacteria 1646
13 Ga0058861_12040784 3300004800 Bacteria 1089
14 Ga0065714_10064450 3300005288 Bacteria 77548
15 Ga0065704_10002971 3300005289 Bacteria 6761
16 Ga0065704_10093725 3300005289 Bacteria 2581
17 Ga0065704_10097529 3300005289 Bacteria 2390
18 Ga0065704_10173484 3300005289 Bacteria 1277
19 Ga0065704_10187416 3300005289 Bacteria 1206
20 Ga0065712_10001740 3300005290 Bacteria 6000
21 Ga0065712_10004552 3300005290 Bacteria 6010
22 Ga0065712_10015500 3300005290 Bacteria 3002
23 Ga0065712_10018916 3300005290 Bacteria 2374
24 Ga0065712_10022326 3300005290 Bacteria 2083
25 Ga0065712_10072502 3300005290 Bacteria 4727
26 Ga0065712_10159279 3300005290 Bacteria 1308
27 Ga0065715_10005007 3300005293 Bacteria 3558
28 Ga0065715_10027997 3300005293 Bacteria 1266
29 Ga0065715_10094215 3300005293 Bacteria 4402
30 Ga0065715_10095075 3300005293 Bacteria 4174
31 Ga0065715_10097309 3300005293 Bacteria 3683
32 Ga0065715_10166863 3300005293 Bacteria 1574
33 Ga0065715_10170832 3300005293 Bacteria 1537
34 Ga0065715_10187026 3300005293 Bacteria 1391
35 Ga0065707_10005254 3300005295 Bacteria 2904
36 Ga0065707_10008773 3300005295 Bacteria 2186
37 Ga0065707_10043579 3300005295 Bacteria 965
38 Ga0065707_10091832 3300005295 Bacteria 3865
39 Ga0065707_10269917 3300005295 Unclassified 1043
40 Ga0070658_10209182 3300005327 Bacteria 1648
41 Ga0070676_10429273 3300005328 Bacteria 925
42 Ga0070676_10455928 3300005328 Bacteria 900
43 Ga0070690_100004097 3300005330 Bacteria 8069
44 Ga0070690_100014199 3300005330 Bacteria 4722
45 Ga0070690_100027424 3300005330 Bacteria 3521
46 Ga0070690_100148584 3300005330 Bacteria 1597
47 Ga0070690_100252469 3300005330 Bacteria 1248
48 Ga0070670_100005027 3300005331 Bacteria 11126
49 Ga0070670_100013886 3300005331 Bacteria 6907
50 Ga0070670_100039282 3300005331 Bacteria 4070
51 Ga0070670_100129699 3300005331 Bacteria 2177
52 Ga0070670_100228883 3300005331 Bacteria 1618
53 Ga0070670_100416906 3300005331 Bacteria 1187
54 Ga0070670_100666608 3300005331 Unclassified 934
55 Ga0068869_100010725 3300005334 Bacteria 5983
56 Ga0068869_100050225 3300005334 Bacteria 3022
57 Ga0070666_10018717 3300005335 Bacteria 4459
58 Ga0070666_10088219 3300005335 Bacteria 2128
59 Ga0070680_100000103 3300005336 Bacteria 48805
60 Ga0070680_100134655 3300005336 Bacteria 2069
61 Ga0070680_100137262 3300005336 Bacteria 2049
62 Ga0070680_100317539 3300005336 Bacteria 1322
63 Ga0070680_100641303 3300005336 Bacteria 913
64 Ga0070682_100005522 3300005337 Bacteria 7038
65 Ga0070682_100019793 3300005337 Bacteria 3953
66 Ga0070682_100602823 3300005337 Bacteria 867
67 Ga0068868_100362253 3300005338 Bacteria 1244
68 Ga0068868_100401032 3300005338 Bacteria 1184
69 Ga0070660_100011939 3300005339 Bacteria 6198
70 Ga0070689_100020570 3300005340 Bacteria 4899
71 Ga0070689_100038497 3300005340 Bacteria 3659
72 Ga0070689_100057269 3300005340 Bacteria 3025
73 Ga0070689_100227946 3300005340 Bacteria 1531
74 Ga0070689_100258063 3300005340 Bacteria 1440
75 Ga0070689_100381665 3300005340 Bacteria 1188
76 Ga0070689_100479284 3300005340 Bacteria 1063
77 Ga0070691_10204574 3300005341 Bacteria 1039
78 Ga0070687_100002413 3300005343 Bacteria 6986
79 Ga0070687_100019756 3300005343 Bacteria 3140
80 Ga0070687_100045207 3300005343 Bacteria 2247
81 Ga0070687_100186574 3300005343 Bacteria 1246
82 Ga0070687_100300670 3300005343 Bacteria 1018
83 Ga0070661_100033024 3300005344 Bacteria 3748
84 Ga0070661_100265816 3300005344 Bacteria 1327
85 Ga0070692_10007532 3300005345 Bacteria 4800
86 Ga0070692_10088217 3300005345 Bacteria 1682
87 Ga0070668_100048014 3300005347 Bacteria 3283
88 Ga0070669_100018533 3300005353 Bacteria 4973
89 Ga0070669_100053168 3300005353 Bacteria 2964
90 Ga0070669_100055779 3300005353 Bacteria 2895
91 Ga0070669_100095460 3300005353 Bacteria 2236
92 Ga0070669_100123593 3300005353 Bacteria 1978
93 Ga0070675_100116074 3300005354 Bacteria 2270
94 Ga0070675_100187501 3300005354 Unclassified 1791
95 Ga0070675_100657886 3300005354 Bacteria 952
96 Ga0070671_100007852 3300005355 Bacteria 8529
97 Ga0070671_100168905 3300005355 Bacteria 1850
98 Ga0070671_100471292 3300005355 Unclassified 1078
99 Ga0070674_100855836 3300005356 Bacteria 789
100 Ga0070673_100028099 3300005364 Bacteria 4179
101 Ga0070673_100077535 3300005364 Bacteria 2686
102 Ga0070673_100095069 3300005364 Bacteria 2444
103 Ga0070673_100176116 3300005364 Bacteria 1828
104 Ga0070673_100264116 3300005364 Unclassified 1505
105 Ga0070673_100498068 3300005364 Bacteria 1102
106 Ga0070688_100003329 3300005365 Bacteria 8238
107 Ga0070688_100517022 3300005365 Bacteria 903
108 Ga0070659_100107817 3300005366 Bacteria 2246
109 Ga0070667_100036777 3300005367 Bacteria 4105
110 Ga0070703_10000193 3300005406 Bacteria 29596
111 Ga0070703_10006781 3300005406 Bacteria 3214
112 Ga0070703_10032886 3300005406 Bacteria 1577
113 Ga0070703_10044631 3300005406 Bacteria 1394
114 Ga0070701_10013118 3300005438 Bacteria 3760
115 Ga0070701_10049658 3300005438 Bacteria 2170
116 Ga0070711_100077619 3300005439 Bacteria 2358
117 Ga0070705_100000982 3300005440 Bacteria 15936
118 Ga0070705_100062699 3300005440 Bacteria 2214
119 Ga0070705_100176546 3300005440 Bacteria 1443
120 Ga0070705_100178306 3300005440 Bacteria 1437
121 Ga0070705_100349490 3300005440 Bacteria 1077
122 Ga0070700_100005796 3300005441 Bacteria 6556
123 Ga0070700_100010746 3300005441 Bacteria 5058
124 Ga0070700_100041257 3300005441 Bacteria 2829
125 Ga0070700_100055987 3300005441 Bacteria 2470
126 Ga0070700_100233304 3300005441 Bacteria 1311
127 Ga0070694_100008189 3300005444 Bacteria 6387
128 Ga0070694_100015866 3300005444 Bacteria 4739
129 Ga0070694_100021679 3300005444 Bacteria 4110
130 Ga0070694_100032476 3300005444 Bacteria 3428
131 Ga0070694_100044559 3300005444 Bacteria 2969
132 Ga0070694_100055794 3300005444 Bacteria 2680
133 Ga0070694_100068041 3300005444 Bacteria 2446
134 Ga0070694_100079786 3300005444 Bacteria 2273
135 Ga0070694_100082443 3300005444 Bacteria 2240
136 Ga0070694_100090985 3300005444 Bacteria 2140
137 Ga0070694_100242083 3300005444 Unclassified 1361
138 Ga0070708_100001743 3300005445 Bacteria 16700
139 Ga0070708_100050740 3300005445 Bacteria 3674
140 Ga0070708_100280955 3300005445 Bacteria 1567
141 Ga0070708_100311833 3300005445 Bacteria 1482
142 Ga0070678_100567328 3300005456 Bacteria 1009
143 Ga0070662_100029069 3300005457 Bacteria 3855
144 Ga0070662_100289628 3300005457 Bacteria 1327
145 Ga0070662_100447912 3300005457 Bacteria 1071
146 Ga0070662_100653125 3300005457 Bacteria 887
147 Ga0070681_10000095 3300005458 Bacteria 65410
148 Ga0070681_10006380 3300005458 Bacteria 11465
149 Ga0070681_10027357 3300005458 Bacteria 5733
150 Ga0070681_10150615 3300005458 Bacteria 2253
151 Ga0068867_100027874 3300005459 Bacteria 4063
152 Ga0068867_100139144 3300005459 Bacteria 1896
153 Ga0068867_100175345 3300005459 Bacteria 1701
154 Ga0068867_100432215 3300005459 Bacteria 1118
155 Ga0068867_100563000 3300005459 Bacteria 989
156 Ga0070685_10061109 3300005466 Bacteria 2205
157 Ga0070685_10447502 3300005466 Bacteria 904
158 Ga0070706_100000920 3300005467 Bacteria 32204
159 Ga0070706_100005925 3300005467 Bacteria 11570
160 Ga0070706_100020710 3300005467 Bacteria 6058
161 Ga0070706_100131556 3300005467 Bacteria 2335
162 Ga0070706_100150458 3300005467 Unclassified 2173
163 Ga0070706_100152848 3300005467 Bacteria 2155
164 Ga0070706_100346629 3300005467 Bacteria 1385
165 Ga0070707_100003296 3300005468 Bacteria 15256
166 Ga0070707_100014408 3300005468 Bacteria 7412
167 Ga0070707_100028004 3300005468 Bacteria 5360
168 Ga0070707_100068181 3300005468 Bacteria 3423
169 Ga0070707_100148635 3300005468 Bacteria 2281
170 Ga0070707_100208109 3300005468 Unclassified 1907
171 Ga0070698_100000374 3300005471 Bacteria 46633
172 Ga0070698_100005496 3300005471 Bacteria 13834
173 Ga0070698_100005600 3300005471 Bacteria 13738
174 Ga0070698_100016601 3300005471 Bacteria 7770
175 Ga0070698_100035264 3300005471 Bacteria 5174
176 Ga0070698_100035463 3300005471 Bacteria 5159
177 Ga0070698_100066401 3300005471 Bacteria 3631
178 Ga0070698_100074362 3300005471 Bacteria 3403
179 Ga0070698_100076608 3300005471 Bacteria 3346
180 Ga0070698_100204080 3300005471 Bacteria 1912
181 Ga0070699_100019115 3300005518 Bacteria 5894
182 Ga0070699_100026662 3300005518 Bacteria 4984
183 Ga0070699_100038208 3300005518 Bacteria 4156
184 Ga0070699_100059963 3300005518 Bacteria 3296
185 Ga0070699_100062651 3300005518 Bacteria 3224
186 Ga0070699_100114649 3300005518 Bacteria 2367
187 Ga0070699_100195455 3300005518 Unclassified 1798
188 Ga0070699_100302535 3300005518 Bacteria 1435
189 Ga0070699_100643203 3300005518 Bacteria 968
190 Ga0070699_100740242 3300005518 Bacteria 899
191 Ga0070679_100000661 3300005530 Bacteria 29364
192 Ga0070684_100371671 3300005535 Bacteria 1316
193 Ga0070697_100002791 3300005536 Bacteria 13453
194 Ga0070697_100006646 3300005536 Bacteria 8965
195 Ga0070697_100072663 3300005536 Bacteria 2822
196 Ga0070697_100137242 3300005536 Bacteria 2054
197 Ga0070697_100195414 3300005536 Unclassified 1718
198 Ga0068853_100067207 3300005539 Bacteria 3113
199 Ga0068853_100101661 3300005539 Bacteria 2542
200 Ga0068853_100163176 3300005539 Bacteria 2012
201 Ga0068853_100181150 3300005539 Unclassified 1911
202 Ga0068853_100403852 3300005539 Bacteria 1279
203 Ga0070672_100026540 3300005543 Bacteria 4312
204 Ga0070686_100005785 3300005544 Bacteria 6854
205 Ga0070686_100013995 3300005544 Bacteria 4610
206 Ga0070686_100028009 3300005544 Bacteria 3413
207 Ga0070686_100028019 3300005544 Bacteria 3413
208 Ga0070686_100046653 3300005544 Bacteria 2735
209 Ga0070686_100122582 3300005544 Bacteria 1787
210 Ga0070686_100196518 3300005544 Bacteria 1443
211 Ga0070695_100018991 3300005545 Bacteria 4179
212 Ga0070695_100033900 3300005545 Bacteria 3196
213 Ga0070695_100083578 3300005545 Bacteria 2116
214 Ga0070695_100219637 3300005545 Bacteria 1369
215 Ga0070695_100266016 3300005545 Bacteria 1254
216 Ga0070695_100283761 3300005545 Unclassified 1218
217 Ga0070695_100306856 3300005545 Bacteria 1175
218 Ga0070695_100411713 3300005545 Bacteria 1027
219 Ga0070696_100013482 3300005546 Bacteria 5484
220 Ga0070696_100042662 3300005546 Bacteria 3135
221 Ga0070696_100047947 3300005546 Bacteria 2965
222 Ga0070696_100053664 3300005546 Bacteria 2807
223 Ga0070696_100133532 3300005546 Bacteria 1808
224 Ga0070696_100182939 3300005546 Unclassified 1556
225 Ga0070696_100308375 3300005546 Bacteria 1214
226 Ga0070696_100614770 3300005546 Bacteria 877
227 Ga0070696_100865886 3300005546 Bacteria 747
228 Ga0070693_100003410 3300005547 Bacteria 7407
229 Ga0070693_100021759 3300005547 Bacteria 3401
230 Ga0070693_100067661 3300005547 Bacteria 2094
231 Ga0070693_100093271 3300005547 Bacteria 1819
232 Ga0070693_100117588 3300005547 Bacteria 1645
233 Ga0070693_100171887 3300005547 Bacteria 1389
234 Ga0070704_100013577 3300005549 Bacteria 5060
235 Ga0070704_100013963 3300005549 Bacteria 5004
236 Ga0070704_100018581 3300005549 Bacteria 4449
237 Ga0070704_100028182 3300005549 Bacteria 3733
238 Ga0070704_100034482 3300005549 Bacteria 3433
239 Ga0070704_100078833 3300005549 Bacteria 2418
240 Ga0070704_100165307 3300005549 Bacteria 1754
241 Ga0070704_100169561 3300005549 Bacteria 1734
242 Ga0070704_100222718 3300005549 Bacteria 1534
243 Ga0070704_100388833 3300005549 Bacteria 1187
244 Ga0070704_100655696 3300005549 Bacteria 927
245 Ga0068855_100261345 3300005563 Bacteria 1928
246 Ga0068855_100653339 3300005563 Bacteria 1129
247 Ga0068855_100749166 3300005563 Bacteria 1042
248 Ga0070664_100003167 3300005564 Bacteria 13297
249 Ga0068857_100256564 3300005577 Bacteria 1604
250 Ga0068857_100422995 3300005577 Bacteria 1242
251 Ga0068857_100472240 3300005577 Bacteria 1175
252 Ga0068854_100020758 3300005578 Bacteria 4451
253 Ga0068854_100274091 3300005578 Bacteria 1356
254 Ga0070702_100015413 3300005615 Bacteria 3903
255 Ga0070702_100015955 3300005615 Bacteria 3846
256 Ga0070702_100036883 3300005615 Bacteria 2712
257 Ga0070702_100039137 3300005615 Bacteria 2644
258 Ga0070702_100174622 3300005615 Bacteria 1401
259 Ga0070702_100330610 3300005615 Bacteria 1066
260 Ga0070702_100494786 3300005615 Bacteria 896
261 Ga0068852_100087406 3300005616 Bacteria 2781
262 Ga0068852_100537314 3300005616 Bacteria 1168
263 Ga0068852_100627698 3300005616 Bacteria 1080
264 Ga0068859_100005985 3300005617 Bacteria 12354
265 Ga0068859_100056053 3300005617 Bacteria 3966
266 Ga0068859_100067591 3300005617 Bacteria 3608
267 Ga0068859_100102551 3300005617 Bacteria 2919
268 Ga0068859_100109843 3300005617 Bacteria 2819
269 Ga0068859_100129114 3300005617 Bacteria 2598
270 Ga0068859_100156767 3300005617 Bacteria 2354
271 Ga0068859_100237255 3300005617 Bacteria 1912
272 Ga0068859_100296389 3300005617 Bacteria 1710
273 Ga0068859_100496219 3300005617 Bacteria 1316
274 Ga0068859_100522944 3300005617 Bacteria 1281
275 Ga0068859_100816687 3300005617 Bacteria 1019
276 Ga0068864_100021548 3300005618 Bacteria 5398
277 Ga0068864_100041104 3300005618 Bacteria 3955
278 Ga0068864_100049121 3300005618 Bacteria 3629
279 Ga0068864_100051844 3300005618 Bacteria 3536
280 Ga0068864_100056009 3300005618 Bacteria 3406
281 Ga0068864_100063202 3300005618 Bacteria 3208
282 Ga0068864_100154460 3300005618 Bacteria 2082
283 Ga0068864_100556228 3300005618 Bacteria 1109
284 Ga0068864_101039464 3300005618 Unclassified 813
285 Ga0068866_10012501 3300005718 Bacteria 3700
286 Ga0068861_100015822 3300005719 Bacteria 5326
287 Ga0068861_100048837 3300005719 Bacteria 3201
288 Ga0068861_100056288 3300005719 Bacteria 3001
289 Ga0068861_100077905 3300005719 Bacteria 2587
290 Ga0068861_100168921 3300005719 Bacteria 1811
291 Ga0068861_100212775 3300005719 Bacteria 1629
292 Ga0068861_100355548 3300005719 Bacteria 1286
293 Ga0068861_100553071 3300005719 Bacteria 1049
294 Ga0068861_100725438 3300005719 Unclassified 926
295 Ga0068851_10036164 3300005834 Bacteria 2472
296 Ga0068870_10009612 3300005840 Bacteria 4406
297 Ga0068870_10024974 3300005840 Bacteria 2962
298 Ga0068870_10063049 3300005840 Bacteria 1998
299 Ga0068863_100042226 3300005841 Bacteria 4333
300 Ga0068863_100082290 3300005841 Bacteria 3050
301 Ga0068863_100116302 3300005841 Bacteria 2548
302 Ga0068863_100537209 3300005841 Bacteria 1154
303 Ga0068863_100588034 3300005841 Bacteria 1101
304 Ga0068863_100593222 3300005841 Bacteria 1096
305 Ga0068863_100764867 3300005841 Bacteria 962
306 Ga0068858_100008879 3300005842 Bacteria 9636
307 Ga0068858_100105533 3300005842 Bacteria 2629
308 Ga0068858_100110403 3300005842 Bacteria 2568
309 Ga0068858_100136860 3300005842 Bacteria 2298
310 Ga0068858_100292735 3300005842 Bacteria 1552
311 Ga0068858_100428199 3300005842 Unclassified 1273
312 Ga0068858_100672416 3300005842 Bacteria 1007
313 Ga0068858_100749463 3300005842 Bacteria 951
314 Ga0068858_101164130 3300005842 Bacteria 758
315 Ga0068860_100057451 3300005843 Bacteria 3699
316 Ga0068860_100102558 3300005843 Bacteria 2730
317 Ga0068860_100136406 3300005843 Bacteria 2356
318 Ga0068860_100171331 3300005843 Bacteria 2097
319 Ga0068860_100320613 3300005843 Bacteria 1521
320 Ga0068860_100337596 3300005843 Bacteria 1481
321 Ga0068860_100669072 3300005843 Bacteria 1047
322 Ga0068862_100009823 3300005844 Bacteria 7905
323 Ga0068862_100022289 3300005844 Bacteria 5297
324 Ga0068862_100039853 3300005844 Bacteria 3991
325 Ga0068862_100040779 3300005844 Bacteria 3947
326 Ga0068862_100447220 3300005844 Bacteria 1217
327 Ga0081540_1142299 3300005983 Unclassified 960
328 Ga0081539_10000976 3300005985 Bacteria 53364
329 Ga0081539_10003361 3300005985 Bacteria 19802
330 Ga0081539_10005422 3300005985 Bacteria 13033
331 Ga0070715_10000039 3300006163 Bacteria 66918
332 Ga0070716_100113914 3300006173 Bacteria 1681
333 Ga0097621_100061660 3300006237 Bacteria 3076
334 Ga0097621_100389719 3300006237 Bacteria 1245
335 Ga0097621_100552084 3300006237 Bacteria 1048
336 Ga0068871_100005005 3300006358 Bacteria 9259
337 Ga0068871_100059136 3300006358 Bacteria 3122
338 Ga0075428_100081117 3300006844 Bacteria 3541
339 Ga0075430_100058059 3300006846 Bacteria 3253
340 Ga0075430_100148436 3300006846 Bacteria 1952
341 Ga0075430_100189610 3300006846 Bacteria 1709
342 Ga0075431_100126819 3300006847 Bacteria 2633
343 Ga0075431_100530951 3300006847 Unclassified 1165
344 Ga0075433_10032041 3300006852 Bacteria 4499
345 Ga0075433_10036894 3300006852 Bacteria 4213
346 Ga0075433_10080731 3300006852 Bacteria 2867
347 Ga0075433_10113009 3300006852 Bacteria 2409
348 Ga0075433_10315016 3300006852 Bacteria 1384
349 Ga0075434_100017958 3300006871 Bacteria 6825
350 Ga0075434_100034935 3300006871 Bacteria 4968
351 Ga0075434_100093178 3300006871 Bacteria 3015
352 Ga0075434_100171056 3300006871 Bacteria 2193
353 Ga0075434_100238187 3300006871 Bacteria 1840
354 Ga0075429_100029946 3300006880 Bacteria 4728
355 Ga0075429_100049604 3300006880 Bacteria 3650
356 Ga0075429_100128517 3300006880 Bacteria 2216
357 Ga0075429_100248821 3300006880 Bacteria 1556
358 Ga0075429_100353225 3300006880 Bacteria 1287
359 Ga0068865_100012683 3300006881 Bacteria 5311
360 Ga0068865_100166495 3300006881 Bacteria 1686
361 Ga0068865_100269210 3300006881 Bacteria 1352
362 Ga0075436_100015347 3300006914 Bacteria 5247
363 Ga0075436_100152989 3300006914 Bacteria 1624
364 Ga0075436_100519687 3300006914 Unclassified 872
365 Ga0097620_100005985 3300006931 Bacteria 12354
366 Ga0097620_100056054 3300006931 Bacteria 3966
367 Ga0097620_100067591 3300006931 Bacteria 3608
368 Ga0097620_100102553 3300006931 Bacteria 2919
369 Ga0097620_100109848 3300006931 Bacteria 2819
370 Ga0097620_100129107 3300006931 Bacteria 2598
371 Ga0097620_100156772 3300006931 Bacteria 2354
372 Ga0097620_100237249 3300006931 Bacteria 1912
373 Ga0097620_100296397 3300006931 Bacteria 1710
374 Ga0097620_100496266 3300006931 Bacteria 1316
375 Ga0097620_100522942 3300006931 Bacteria 1281
376 Ga0097620_100816681 3300006931 Bacteria 1019
377 Ga0075435_100020792 3300007076 Bacteria 5037
378 Ga0099794_10040454 3300007265 Bacteria 2216
379 Ga0105251_10039112 3300009011 Bacteria 2319
380 Ga0105240_10171414 3300009093 Bacteria 2570
381 Ga0105240_10332740 3300009093 Bacteria 1727
382 Ga0105240_11074102 3300009093 Bacteria 858
383 Ga0111539_10005598 3300009094 Bacteria 16251
384 Ga0111539_10022660 3300009094 Bacteria 7715
385 Ga0111539_10111096 3300009094 Bacteria 3216
386 Ga0111539_10155362 3300009094 Bacteria 2677
387 Ga0111539_10442820 3300009094 Bacteria 1513
388 Ga0105245_10018594 3300009098 Bacteria 6078
389 Ga0105245_10349965 3300009098 Bacteria 1464
390 Ga0105245_10754080 3300009098 Bacteria 1009
391 Ga0105247_10000050 3300009101 Bacteria 146183
392 Ga0105247_10057749 3300009101 Bacteria 2399
393 Ga0105247_10125804 3300009101 Bacteria 1666
394 Ga0105247_10312562 3300009101 Bacteria 1094
395 Ga0105247_10327849 3300009101 Bacteria 1070
396 Ga0114129_10033278 3300009147 Bacteria 7285
397 Ga0114129_10051383 3300009147 Bacteria 5787
398 Ga0114129_10134336 3300009147 Bacteria 3396
399 Ga0114129_10152363 3300009147 Bacteria 3163
400 Ga0114129_10165342 3300009147 Bacteria 3020
401 Ga0114129_10253970 3300009147 Bacteria 2359
402 Ga0114129_10468658 3300009147 Bacteria 1650
403 Ga0114129_10605425 3300009147 Bacteria 1419
404 Ga0105243_10001520 3300009148 Bacteria 20276
405 Ga0105243_10007055 3300009148 Bacteria 8639
406 Ga0105243_10031915 3300009148 Bacteria 4064
407 Ga0105243_10038543 3300009148 Bacteria 3722
408 Ga0105243_10291002 3300009148 Unclassified 1476
409 Ga0105243_10516701 3300009148 Bacteria 1135
410 Ga0105243_11331636 3300009148 Bacteria 736
411 Ga0105241_10091628 3300009174 Bacteria 2399
412 Ga0105241_10142240 3300009174 Bacteria 1955
413 Ga0105241_10203148 3300009174 Bacteria 1656
414 Ga0105241_10331343 3300009174 Bacteria 1316
415 Ga0105241_10602845 3300009174 Bacteria 992
416 Ga0105241_10854187 3300009174 Bacteria 842
417 Ga0105242_10001223 3300009176 Bacteria 20281
418 Ga0105242_10034629 3300009176 Bacteria 4049
419 Ga0105242_10045777 3300009176 Bacteria 3547
420 Ga0105242_10159698 3300009176 Bacteria 1972
421 Ga0105242_10342883 3300009176 Bacteria 1377
422 Ga0105242_10405198 3300009176 Bacteria 1274
423 Ga0105242_10667596 3300009176 Bacteria 1013
424 Ga0105242_11026118 3300009176 Bacteria 834
425 Ga0105248_10015006 3300009177 Bacteria 8528
426 Ga0105248_10043401 3300009177 Bacteria 5041
427 Ga0105248_10053458 3300009177 Bacteria 4532
428 Ga0105248_10108633 3300009177 Bacteria 3128
429 Ga0105248_10129394 3300009177 Bacteria 2848
430 Ga0105248_10168767 3300009177 Bacteria 2466
431 Ga0105248_10247200 3300009177 Bacteria 2008
432 Ga0105248_10257463 3300009177 Bacteria 1965
433 Ga0105248_11083496 3300009177 Bacteria 905
434 Ga0105248_11228796 3300009177 Bacteria 847
435 Ga0105248_11269653 3300009177 Bacteria 833
436 Ga0105237_10007174 3300009545 Bacteria 12244
437 Ga0105237_10053364 3300009545 Bacteria 4054
438 Ga0105237_10062079 3300009545 Bacteria 3735
439 Ga0105237_10220127 3300009545 Bacteria 1898
440 Ga0105237_10674263 3300009545 Bacteria 1041
441 Ga0105238_10036920 3300009551 Bacteria 4969
442 Ga0105238_10124612 3300009551 Bacteria 2556
443 Ga0105238_10533444 3300009551 Bacteria 1177
444 Ga0105249_10013119 3300009553 Bacteria 7312
445 Ga0105249_10025118 3300009553 Bacteria 5362
446 Ga0105249_10026857 3300009553 Bacteria 5191
447 Ga0105249_10100720 3300009553 Bacteria 2717
448 Ga0105249_10613873 3300009553 Bacteria 1143
449 Ga0105239_10201039 3300010375 Bacteria 2232
450 Ga0105239_10287476 3300010375 Bacteria 1851
451 Ga0105246_10015588 3300011119 Bacteria 4802
452 Ga0105246_10184623 3300011119 Bacteria 1609
453 Ga0105246_10223515 3300011119 Bacteria 1477
454 Ga0105246_10315615 3300011119 Bacteria 1268
455 Ga0105246_10701331 3300011119 Unclassified 887
456 Ga0105246_10704992 3300011119 Bacteria 885
457 Ga0157373_10021532 3300013100 Bacteria 4682
458 Ga0157373_10041447 3300013100 Bacteria 3294
459 Ga0157373_10052446 3300013100 Bacteria 2902
460 Ga0157373_10257455 3300013100 Bacteria 1235
461 Ga0157373_10393453 3300013100 Bacteria 993
462 Ga0157373_10437356 3300013100 Bacteria 940
463 Ga0157371_10326027 3300013102 Bacteria 1115
464 Ga0157374_10050453 3300013296 Bacteria 3868
465 Ga0157374_10104758 3300013296 Bacteria 2716
466 Ga0157378_10026642 3300013297 Bacteria 5095
467 Ga0157378_10061204 3300013297 Bacteria 3359
468 Ga0157378_10095561 3300013297 Bacteria 2707
469 Ga0157378_10118185 3300013297 Bacteria 2440
470 Ga0157378_10129961 3300013297 Bacteria 2331
471 Ga0157378_10150111 3300013297 Bacteria 2171
472 Ga0157378_10182405 3300013297 Bacteria 1975
473 Ga0157378_10459996 3300013297 Bacteria 1264
474 Ga0157378_10527306 3300013297 Bacteria 1183
475 Ga0157378_10724135 3300013297 Bacteria 1016
476 Ga0157378_11099146 3300013297 Bacteria 832
477 Ga0163162_10000784 3300013306 Bacteria 29548
478 Ga0163162_10004596 3300013306 Bacteria 13298
479 Ga0163162_10006687 3300013306 Bacteria 11182
480 Ga0163162_10041843 3300013306 Bacteria 4584
481 Ga0163162_10051628 3300013306 Bacteria 4126
482 Ga0163162_10112004 3300013306 Bacteria 2827
483 Ga0163162_10337071 3300013306 Bacteria 1640
484 Ga0163162_10366884 3300013306 Unclassified 1573
485 Ga0157372_10095280 3300013307 Bacteria 3391
486 Ga0157372_10107622 3300013307 Bacteria 3190
487 Ga0157372_10194152 3300013307 Unclassified 2352
488 Ga0157372_10204237 3300013307 Bacteria 2289
489 Ga0157375_10045126 3300013308 Bacteria 4289
490 Ga0157375_10094256 3300013308 Bacteria 3062
491 Ga0157375_10094340 3300013308 Bacteria 3061
492 Ga0157375_10302145 3300013308 Bacteria 1764
493 Ga0157375_10531190 3300013308 Bacteria 1339
494 Ga0157375_10561574 3300013308 Bacteria 1302
495 Ga0157375_10972718 3300013308 Bacteria 990
496 Ga0157375_11293573 3300013308 Bacteria 857
497 Ga0163163_10006543 3300014325 Bacteria 10202
498 Ga0163163_10011579 3300014325 Bacteria 8011
499 Ga0163163_10037229 3300014325 Bacteria 4732
500 Ga0163163_10058422 3300014325 Bacteria 3814
501 Ga0163163_10061741 3300014325 Bacteria 3713
502 Ga0163163_10134020 3300014325 Bacteria 2518
503 Ga0163163_10277204 3300014325 Bacteria 1728
504 Ga0163163_10300848 3300014325 Bacteria 1657
505 Ga0163163_10356018 3300014325 Bacteria 1520
506 Ga0163163_10416433 3300014325 Bacteria 1402
507 Ga0163163_10450424 3300014325 Bacteria 1347
508 Ga0157380_10005145 3300014326 Bacteria 9138
509 Ga0157380_10006345 3300014326 Bacteria 8316
510 Ga0157380_10019969 3300014326 Bacteria 5001
511 Ga0157380_10027759 3300014326 Bacteria 4307
512 Ga0157380_10073876 3300014326 Bacteria 2766
513 Ga0157380_10102702 3300014326 Bacteria 2384
514 Ga0157380_10259179 3300014326 Bacteria 1578
515 Ga0157380_10339091 3300014326 Bacteria 1401
516 Ga0157377_10051456 3300014745 Bacteria 2323
517 Ga0157377_10285994 3300014745 Bacteria 1083
518 Ga0157379_10037517 3300014968 Bacteria 4322
519 Ga0157379_10229529 3300014968 Bacteria 1682
520 Ga0157376_10009083 3300014969 Bacteria 7202
521 Ga0157376_10087182 3300014969 Bacteria 2693
522 Ga0157376_11164402 3300014969 Unclassified 798
523 Ga0163161_10011008 3300017792 Bacteria 6268
524 Ga0163161_10023268 3300017792 Bacteria 4370
525 Ga0163161_10183133 3300017792 Bacteria 1607
526 Ga0213876_10000189 3300021384 Bacteria 64122
527 Ga0213876_10012169 3300021384 Bacteria 4582
528 Ga0213876_10043703 3300021384 Bacteria 2368
529 Ga0207672_1000149 3300025223 Bacteria 9525
530 Ga0207653_10000289 3300025885 Bacteria 29336
531 Ga0207653_10023644 3300025885 Bacteria 1958
532 Ga0207653_10084115 3300025885 Bacteria 1106
533 Ga0207653_10125349 3300025885 Bacteria 928
534 Ga0207710_10000003 3300025900 Bacteria 1071597
535 Ga0207710_10008744 3300025900 Bacteria 4267
536 Ga0207710_10166752 3300025900 Bacteria 1075
537 Ga0207710_10248278 3300025900 Bacteria 889
538 Ga0207688_10229092 3300025901 Bacteria 1121
539 Ga0207680_10023352 3300025903 Bacteria 3376
540 Ga0207647_10102056 3300025904 Bacteria 1701
541 Ga0207647_10119899 3300025904 Unclassified 1551
542 Ga0207647_10156058 3300025904 Bacteria 1333
543 Ga0207685_10000024 3300025905 Bacteria 113741
544 Ga0207645_10063229 3300025907 Bacteria 2365
545 Ga0207645_10339849 3300025907 Bacteria 1003
546 Ga0207643_10020369 3300025908 Bacteria 3640
547 Ga0207643_10087555 3300025908 Bacteria 1811
548 Ga0207643_10122340 3300025908 Bacteria 1542
549 Ga0207684_10000085 3300025910 Bacteria 175922
550 Ga0207684_10003150 3300025910 Bacteria 16233
551 Ga0207684_10085853 3300025910 Bacteria 2680
552 Ga0207684_10152505 3300025910 Bacteria 1988
553 Ga0207684_10329167 3300025910 Bacteria 1316
554 Ga0207654_10013384 3300025911 Bacteria 4221
555 Ga0207654_10110300 3300025911 Bacteria 1711
556 Ga0207654_10438647 3300025911 Unclassified 914
557 Ga0207654_10647373 3300025911 Bacteria 757
558 Ga0207707_10000503 3300025912 Bacteria 40256
559 Ga0207707_10050582 3300025912 Bacteria 3619
560 Ga0207707_10168562 3300025912 Bacteria 1913
561 Ga0207695_10081076 3300025913 Bacteria 3285
562 Ga0207695_10250144 3300025913 Unclassified 1672
563 Ga0207671_10004181 3300025914 Bacteria 13939
564 Ga0207671_10266569 3300025914 Bacteria 1349
565 Ga0207671_10275488 3300025914 Bacteria 1326
566 Ga0207660_10001058 3300025917 Bacteria 18239
567 Ga0207660_10122254 3300025917 Bacteria 1972
568 Ga0207662_10005060 3300025918 Bacteria 6986
569 Ga0207662_10040549 3300025918 Bacteria 2738
570 Ga0207662_10059769 3300025918 Bacteria 2285
571 Ga0207662_10071042 3300025918 Bacteria 2107
572 Ga0207662_10460748 3300025918 Bacteria 871
573 Ga0207657_10084649 3300025919 Bacteria 2657
574 Ga0207649_10024546 3300025920 Bacteria 3506
575 Ga0207652_10000427 3300025921 Bacteria 43779
576 Ga0207652_10123680 3300025921 Bacteria 2303
577 Ga0207646_10005737 3300025922 Bacteria 13012
578 Ga0207646_10005747 3300025922 Bacteria 13005
579 Ga0207646_10011116 3300025922 Bacteria 8741
580 Ga0207646_10032750 3300025922 Bacteria 4702
581 Ga0207646_10124327 3300025922 Bacteria 2319
582 Ga0207646_10125665 3300025922 Bacteria 2306
583 Ga0207646_10734902 3300025922 Bacteria 881
584 Ga0207681_10004264 3300025923 Bacteria 8825
585 Ga0207681_10005504 3300025923 Bacteria 7776
586 Ga0207681_10150053 3300025923 Bacteria 1746
587 Ga0207681_10469556 3300025923 Bacteria 1026
588 Ga0207681_10679801 3300025923 Bacteria 855
589 Ga0207694_10004209 3300025924 Bacteria 11267
590 Ga0207694_10070744 3300025924 Bacteria 2726
591 Ga0207650_10000028 3300025925 Bacteria 236867
592 Ga0207650_10002078 3300025925 Bacteria 14001
593 Ga0207650_10103447 3300025925 Bacteria 2196
594 Ga0207650_10194481 3300025925 Bacteria 1622
595 Ga0207650_10215666 3300025925 Bacteria 1543
596 Ga0207650_10304601 3300025925 Bacteria 1302
597 Ga0207650_10480823 3300025925 Bacteria 1036
598 Ga0207659_10049731 3300025926 Bacteria 2975
599 Ga0207659_10293103 3300025926 Bacteria 1334
600 Ga0207687_10053920 3300025927 Bacteria 2811
601 Ga0207687_10315948 3300025927 Bacteria 1263
602 Ga0207644_10001958 3300025931 Bacteria 13331
603 Ga0207644_10003226 3300025931 Bacteria 10516
604 Ga0207644_10034752 3300025931 Bacteria 3528
605 Ga0207644_10650219 3300025931 Bacteria 878
606 Ga0207690_10003154 3300025932 Bacteria 9900
607 Ga0207690_10930261 3300025932 Bacteria 722
608 Ga0207706_10050740 3300025933 Bacteria 3666
609 Ga0207706_10352273 3300025933 Unclassified 1280
610 Ga0207706_10388538 3300025933 Bacteria 1210
611 Ga0207706_10408407 3300025933 Bacteria 1177
612 Ga0207686_10000392 3300025934 Bacteria 30379
613 Ga0207686_10000659 3300025934 Bacteria 21331
614 Ga0207686_10010563 3300025934 Bacteria 5030
615 Ga0207686_10098042 3300025934 Bacteria 1951
616 Ga0207686_10121904 3300025934 Bacteria 1776
617 Ga0207686_10327456 3300025934 Bacteria 1147
618 Ga0207709_10000037 3300025935 Bacteria 279771
619 Ga0207709_10034818 3300025935 Bacteria 2972
620 Ga0207709_10045264 3300025935 Bacteria 2664
621 Ga0207709_10053093 3300025935 Bacteria 2493
622 Ga0207709_10101498 3300025935 Bacteria 1903
623 Ga0207709_10163669 3300025935 Bacteria 1554
624 Ga0207709_10875139 3300025935 Bacteria 729
625 Ga0207670_10002963 3300025936 Bacteria 8965
626 Ga0207670_10046086 3300025936 Bacteria 2894
627 Ga0207670_10182241 3300025936 Bacteria 1583
628 Ga0207669_10141252 3300025937 Bacteria 1672
629 Ga0207704_10010523 3300025938 Bacteria 4518
630 Ga0207704_10566315 3300025938 Bacteria 925
631 Ga0207665_10011629 3300025939 Bacteria 5783
632 Ga0207665_10160343 3300025939 Bacteria 1617
633 Ga0207691_10002381 3300025940 Bacteria 18401
634 Ga0207691_10032538 3300025940 Bacteria 4862
635 Ga0207691_10201269 3300025940 Bacteria 1733
636 Ga0207711_10087939 3300025941 Bacteria 2727
637 Ga0207711_10208116 3300025941 Bacteria 1787
638 Ga0207711_10217021 3300025941 Bacteria 1748
639 Ga0207711_10230622 3300025941 Bacteria 1696
640 Ga0207711_10536294 3300025941 Bacteria 1091
641 Ga0207689_10013420 3300025942 Bacteria 6995
642 Ga0207689_10028316 3300025942 Bacteria 4687
643 Ga0207689_10037371 3300025942 Bacteria 4027
644 Ga0207689_10042361 3300025942 Bacteria 3767
645 Ga0207689_10080358 3300025942 Bacteria 2680
646 Ga0207689_10110965 3300025942 Bacteria 2254
647 Ga0207689_10131493 3300025942 Bacteria 2060
648 Ga0207689_10645341 3300025942 Bacteria 892
649 Ga0207689_10756769 3300025942 Bacteria 820
650 Ga0207679_10057001 3300025945 Bacteria 2888
651 Ga0207679_10397717 3300025945 Bacteria 1211
652 Ga0207679_10444615 3300025945 Bacteria 1149
653 Ga0207679_10961693 3300025945 Bacteria 782
654 Ga0207667_10281602 3300025949 Bacteria 1699
655 Ga0207667_10909858 3300025949 Bacteria 871
656 Ga0207651_10026556 3300025960 Bacteria 3620
657 Ga0207651_10042074 3300025960 Bacteria 3038
658 Ga0207712_10000586 3300025961 Bacteria 29417
659 Ga0207712_10020659 3300025961 Bacteria 4316
660 Ga0207712_10064063 3300025961 Bacteria 2619
661 Ga0207668_10009419 3300025972 Bacteria 5854
662 Ga0207640_10088859 3300025981 Bacteria 2134
663 Ga0207640_10451175 3300025981 Unclassified 1060
664 Ga0207658_10133133 3300025986 Bacteria 2000
665 Ga0207658_10613166 3300025986 Bacteria 978
666 Ga0207677_10038376 3300026023 Bacteria 3140
667 Ga0207677_10273050 3300026023 Bacteria 1384
668 Ga0207703_10000355 3300026035 Bacteria 49221
669 Ga0207703_10080321 3300026035 Bacteria 2715
670 Ga0207703_10086633 3300026035 Bacteria 2624
671 Ga0207703_10088339 3300026035 Bacteria 2601
672 Ga0207703_10411899 3300026035 Bacteria 1256
673 Ga0207639_10013858 3300026041 Bacteria 5654
674 Ga0207639_10071514 3300026041 Bacteria 2713
675 Ga0207639_10132216 3300026041 Bacteria 2067
676 Ga0207639_10798569 3300026041 Unclassified 879
677 Ga0207708_10008557 3300026075 Bacteria 7571
678 Ga0207708_10011438 3300026075 Bacteria 6610
679 Ga0207708_10020009 3300026075 Bacteria 5047
680 Ga0207708_10054210 3300026075 Bacteria 3057
681 Ga0207708_10174764 3300026075 Bacteria 1703
682 Ga0207708_10185355 3300026075 Bacteria 1653
683 Ga0207708_10309400 3300026075 Bacteria 1287
684 Ga0207708_10459200 3300026075 Bacteria 1062
685 Ga0207702_10003231 3300026078 Bacteria 15058
686 Ga0207641_10060418 3300026088 Bacteria 3231
687 Ga0207641_10239501 3300026088 Unclassified 1690
688 Ga0207641_10280753 3300026088 Bacteria 1566
689 Ga0207641_10538699 3300026088 Bacteria 1137
690 Ga0207641_10865173 3300026088 Bacteria 896
691 Ga0207648_10050189 3300026089 Bacteria 3649
692 Ga0207648_10052615 3300026089 Bacteria 3561
693 Ga0207648_10079277 3300026089 Bacteria 2865
694 Ga0207648_10204062 3300026089 Bacteria 1754
695 Ga0207648_10260934 3300026089 Bacteria 1546
696 Ga0207648_10453890 3300026089 Bacteria 1167
697 Ga0207648_10565020 3300026089 Unclassified 1046
698 Ga0207648_10705433 3300026089 Bacteria 935
699 Ga0207676_10029900 3300026095 Bacteria 4082
700 Ga0207676_10040297 3300026095 Bacteria 3579
701 Ga0207676_10044163 3300026095 Bacteria 3436
702 Ga0207676_10104838 3300026095 Bacteria 2353
703 Ga0207676_10128702 3300026095 Bacteria 2149
704 Ga0207676_10226274 3300026095 Bacteria 1669
705 Ga0207676_10748236 3300026095 Bacteria 950
706 Ga0207674_10006877 3300026116 Bacteria 13328
707 Ga0207674_10215525 3300026116 Bacteria 1868
708 Ga0207674_10301940 3300026116 Bacteria 1550
709 Ga0207674_10781764 3300026116 Bacteria 921
710 Ga0207675_100014977 3300026118 Bacteria 7238
711 Ga0207675_100017801 3300026118 Bacteria 6629
712 Ga0207675_100021754 3300026118 Bacteria 5970
713 Ga0207675_100047591 3300026118 Bacteria 4003
714 Ga0207675_100057101 3300026118 Bacteria 3642
715 Ga0207675_100116020 3300026118 Bacteria 2530
716 Ga0207675_100215370 3300026118 Bacteria 1849
717 Ga0207675_100232587 3300026118 Bacteria 1778
718 Ga0207675_100284789 3300026118 Bacteria 1606
719 Ga0207683_10025820 3300026121 Bacteria 5068
720 Ga0207698_10267356 3300026142 Bacteria 1574
721 Ga0207698_10425608 3300026142 Bacteria 1275
722 Ga0207698_10500083 3300026142 Bacteria 1183
723 Ga0207698_10741452 3300026142 Bacteria 980
724 Ga0209588_1005410 3300027671 Bacteria 3660
725 Ga0207428_10008641 3300027907 Bacteria 9197
726 Ga0207428_10029137 3300027907 Bacteria 4579
727 Ga0207428_10057402 3300027907 Bacteria 3090
728 Ga0207428_10291965 3300027907 Bacteria 1208
729 Ga0268265_10016285 3300028380 Bacteria 5103
730 Ga0268265_10035479 3300028380 Bacteria 3644
731 Ga0268265_10428950 3300028380 Bacteria 1229
732 Ga0268265_11026802 3300028380 Bacteria 815
733 Ga0268264_10067613 3300028381 Bacteria 3016
734 Ga0268264_10073195 3300028381 Bacteria 2907
735 Ga0268264_10073340 3300028381 Bacteria 2905
736 Ga0268264_10094740 3300028381 Bacteria 2582
737 Ga0268264_10221688 3300028381 Bacteria 1741
738 Ga0268264_10305727 3300028381 Bacteria 1499
739 Ga0265777_104945 3300030877 Bacteria 867
740 Ga0265339_10062413 3300031249 Bacteria 2003
741 Ga0307513_10006106 3300031456 Bacteria 15813
742 Ga0307513_10535520 3300031456 Unclassified 885
743 Ga0307408_100097520 3300031548 Bacteria 2233
744 Ga0307408_100218128 3300031548 Bacteria 1555
745 Ga0307514_10050235 3300031649 Bacteria 3239
746 Ga0307514_10132139 3300031649 Bacteria 1716
747 Ga0307405_10016948 3300031731 Bacteria 3987
748 Ga0307405_10664672 3300031731 Bacteria 858
749 Ga0307410_10460867 3300031852 Bacteria 1039
750 Ga0307407_10092030 3300031903 Bacteria 1861
751 Ga0307412_10010192 3300031911 Bacteria 5408
752 Ga0307412_10094052 3300031911 Bacteria 2104
753 Ga0307412_10162625 3300031911 Bacteria 1660
754 Ga0307409_100421071 3300031995 Bacteria 1281
755 Ga0307409_100541704 3300031995 Bacteria 1141
756 Ga0307416_100030319 3300032002 Bacteria 4056
757 Ga0307416_100169744 3300032002 Bacteria 2029
758 Ga0307416_100303153 3300032002 Bacteria 1589
759 Ga0307414_10264523 3300032004 Bacteria 1437
760 Ga0307411_10220409 3300032005 Bacteria 1471
761 Ga0307415_100016722 3300032126 Bacteria 4379
762 Ga0307415_100061990 3300032126 Bacteria 2591
763 Ga0307415_100076589 3300032126 Bacteria 2372
764 Ga0307415_100103517 3300032126 Bacteria 2095
765 Ga0316593_10051094 3300032168 Bacteria 1397
766 Ga0316588_1049462 3300033528 Bacteria 1018
767 Ga0373951_0003684 3300035091 Bacteria 3697
768 Ga0373941_0014628 3300035115 Bacteria 2100
769 Ga0373961_0015753 3300035241 Bacteria 1938
770 Ga0395899_0366668 3300037312 Bacteria 960
771 Ga0395900_0449590 3300037418 Bacteria 1245
772 Ga0395900_0456029 3300037418 Bacteria 1234
773 Ga0395900_0701935 3300037418 Bacteria 945
774 Ga0395898_0243037 3300037466 Bacteria 1717
775 Ga0395898_0536086 3300037466 Bacteria 1112
776 Ga0395898_0647476 3300037466 Unclassified 999
777 Ga0395905_0008542 3300037471 Bacteria 10098
778 Ga0395905_0010746 3300037471 Bacteria 8876
779 Ga0395905_0030677 3300037471 Bacteria 5063
780 Ga0395905_0056292 3300037471 Bacteria 3679
781 Ga0395905_0090677 3300037471 Bacteria 2866
782 Ga0395905_0144217 3300037471 Bacteria 2241
783 Ga0395905_0181892 3300037471 Unclassified 1974
784 Ga0395905_0532956 3300037471 Bacteria 1075
785 Ga0436364_0946147 3300037853 Unclassified 1725
786 Ga0395901_0079524 3300038443 Bacteria 3424
787 Ga0395901_0307224 3300038443 Bacteria 1643
788 Ga0395901_0451249 3300038443 Bacteria 1315
789 Ga0242422_00217 3300038699 Bacteria 3314
790 Ga0242420_018381 3300038996 Bacteria 1230
791 Ga0436365_0668830 3300039437 Bacteria 6208
792 Ga0436365_1052004 3300039437 Bacteria 3676
793 Ga0436365_1324789 3300039437 Bacteria 7439
794 Ga0436362_0610441 3300039453 Bacteria 745
795 Ga0439437_004698 3300042000 Bacteria 1494
796 Ga0439455_0024392 3300042012 Bacteria 1463
797 Ga0439462_0018632 3300042015 Bacteria 1803
798 Ga0453684_0135319 3300044712 Bacteria 2952
799 Ga0453684_0298665 3300044712 Bacteria 1831
800 Ga0451576_0042679 3300045051 Bacteria 4787
801 Ga0451576_0123757 3300045051 Bacteria 2694
802 Ga0451576_0467571 3300045051 Bacteria 1324
803 Ga0495662_0049709 3300046476 Bacteria 2024
804 Ga0495610_0044352 3300046512 Bacteria 2207
805 Ga0495620_0062541 3300046515 Bacteria 1546
806 Ga0495631_0123360 3300046518 Bacteria 1114
807 Ga0495663_0000620 3300046525 Bacteria 12368
808 Ga0495598_0001218 3300046537 Bacteria 4984
809 Ga0495621_0002543 3300046539 Bacteria 4921
810 Ga0495621_0035293 3300046539 Bacteria 1732
811 Ga0495656_0154167 3300046615 Bacteria 1112
812 Ga0495647_0244132 3300046681 Unclassified 798
813 Ga0495669_0209013 3300046684 Bacteria 934
814 Ga0495624_0279216 3300046690 Bacteria 1009
815 Ga0495604_0171370 3300047317 Bacteria 1526
816 Ga0495672_0108240 3300047320 Bacteria 1496
817 Ga0495672_0195447 3300047320 Bacteria 1014
818 Ga0496100_0337786 3300048903 Bacteria 1135
819 Ga0496102_0219944 3300048905 Unclassified 1790
820 Ga0496102_0544190 3300048905 Bacteria 1084
821 Ga0496103_0102110 3300048906 Bacteria 1816
822 Ga0496104_0128970 3300048907 Bacteria 2429
823 Ga0496104_0606617 3300048907 Unclassified 1005
824 Ga0496106_0123767 3300048909 Bacteria 2023
825 Ga0496108_0047160 3300048911 Bacteria 3602
826 Ga0496108_0108888 3300048911 Bacteria 2367
827 Ga0496108_0220303 3300048911 Bacteria 1649
828 Ga0496109_0450319 3300048912 Bacteria 1216
829 Ga0496110_0277632 3300048913 Bacteria 1526
830 Ga0496112_0427076 3300048915 Bacteria 1264
831 Ga0496112_0706399 3300048915 Bacteria 936
832 Ga0496113_0069556 3300048916 Bacteria 2674
833 Ga0496113_0620813 3300048916 Bacteria 865
834 Ga0501291_002976 3300049514 Bacteria 2081
835 Ga0501292_008452 3300049515 Bacteria 1506
836 Ga0501298_000210 3300049521 Bacteria 7431
837 Ga0501298_002295 3300049521 Bacteria 2885
838 Ga0501031_0491202 3300049568 Bacteria 792
839 Ga0501032_0241454 3300049569 Bacteria 1173
840 Ga0501036_0609701 3300049572 Bacteria 905
841 Ga0501038_0039911 3300049574 Bacteria 4103
842 Ga0501039_0306734 3300049575 Unclassified 1248
843 Ga0501046_0523599 3300049580 Bacteria 847
844 Ga0501048_0172078 3300049582 Bacteria 1534
845 Ga0501067_0194417 3300049583 Bacteria 1130
846 Ga0501198_004864 3300049649 Bacteria 1877
847 Ga0501198_012550 3300049649 Bacteria 1275
848 Ga0501216_008119 3300049660 Bacteria 1646
849 Ga0501217_001526 3300049661 Bacteria 4361
850 Ga0501217_042366 3300049661 Bacteria 1162
851 Ga0501223_004673 3300049663 Bacteria 2913
852 Ga0501227_000676 3300049665 Bacteria 7475
853 Ga0501227_013089 3300049665 Bacteria 1823
854 Ga0501233_001251 3300049668 Bacteria 4328
855 Ga0501233_082490 3300049668 Bacteria 829
856 Ga0501235_027812 3300049669 Bacteria 1269
857 Ga0501240_007538 3300049673 Bacteria 1371
858 Ga0501243_004136 3300049675 Bacteria 2169
859 Ga0501249_029095 3300049679 Bacteria 1228
860 Ga0501250_005082 3300049680 Bacteria 1338
861 Ga0501257_048050 3300049686 Unclassified 1060
862 Ga0501260_005348 3300049689 Bacteria 1207
863 Ga0501221_029838 3300049704 Bacteria 1130
864 Ga0501225_0005103 3300049705 Bacteria 3869
865 Ga0501225_0008807 3300049705 Bacteria 2889
866 Ga0501225_0043454 3300049705 Bacteria 1242
867 Ga0501229_005706 3300049706 Bacteria 1531
868 Ga0501234_005684 3300049707 Bacteria 1949
869 Ga0501081_0217249 3300049743 Bacteria 1389
870 Ga0501267_004623 3300049764 Bacteria 1286
871 Ga0501268_002066 3300049765 Bacteria 2598
872 Ga0501273_002856 3300049770 Bacteria 1793
873 Ga0501283_000878 3300049779 Bacteria 3970
874 Ga0501045_0137018 3300049824 Bacteria 1820
875 Ga0501212_005060 3300049851 Bacteria 1727
876 Ga0501212_009563 3300049851 Bacteria 1368
877 nmdc:mga05p37_1016194_c1 3300050507 Bacteria 879
878 nmdc:mga05p37_128116_c1 3300050507 Bacteria 3116
879 nmdc:mga05p37_240436_c1 3300050507 Bacteria 2177
880 nmdc:mga05p37_24636_c1 3300050507 Bacteria 7314
881 nmdc:mga05p37_400677_c1 3300050507 Bacteria 1602
882 nmdc:mga05p37_62370_c1 3300050507 Bacteria 4587
883 nmdc:mga05p37_9408_c1 3300050507 Bacteria 11567
884 nmdc:mga09592_290034_c1 3300050508 Bacteria 1419
885 nmdc:mga09592_490396_c1 3300050508 Bacteria 1058
886 nmdc:mga0qj67_19355_c1 3300050509 Bacteria 5200
887 nmdc:mga0qj67_40806_c1 3300050509 Bacteria 3648
888 nmdc:mga06r32_1057685_c1 3300050510 Bacteria 762
889 nmdc:mga06r32_119210_c1 3300050510 Bacteria 2602
890 nmdc:mga06r32_34611_c1 3300050510 Bacteria 4764
891 nmdc:mga06r32_400396_c1 3300050510 Bacteria 1355
892 nmdc:mga08y16_257168_c1 3300050511 Bacteria 1804
893 nmdc:mga08y16_512728_c1 3300050511 Bacteria 1217
894 nmdc:mga08y16_55017_c1 3300050511 Bacteria 4159
895 nmdc:mga0n895_173908_c1 3300050512 Bacteria 2185
896 nmdc:mga0n895_218271_c1 3300050512 Bacteria 1936
897 nmdc:mga0n895_236290_c1 3300050512 Bacteria 1855
898 nmdc:mga0n895_237760_c1 3300050512 Bacteria 1848
899 nmdc:mga0n895_534629_c1 3300050512 Bacteria 1179
900 nmdc:mga0n895_94842_c1 3300050512 Bacteria 2988
901 nmdc:mga0rr50_432_c1 3300050513 Bacteria 22538
902 nmdc:mga0rr50_66420_c1 3300050513 Bacteria 2736
903 nmdc:mga0rr50_8964_c1 3300050513 Bacteria 6256
904 nmdc:mga08x19_27_c1 3300050514 Bacteria 226652
905 nmdc:mga08x19_383877_c1 3300050514 Bacteria 984
906 nmdc:mga0a205_149264_c1 3300050515 Bacteria 2238
907 nmdc:mga0a205_22736_c1 3300050515 Bacteria 5944
908 nmdc:mga0a205_323544_c1 3300050515 Bacteria 1413
909 nmdc:mga0a205_32992_c2 3300050515 Bacteria 1867
910 nmdc:mga0a205_55769_c1 3300050515 Bacteria 3816
911 Ga0495612_0021140 3300053078 Bacteria 2611
912 Ga0495655_0004445 3300053083 Bacteria 2396
913 Ga0500616_0003846 3300053153 Bacteria 11091
914 Ga0501084_0139680 3300054114 Bacteria 2040
915 Ga0587083_0022585 3300059505 Bacteria 1180
916 Ga0587085_001894 3300059506 Bacteria 2045
917 Ga0587085_045285 3300059506 Bacteria 782
918 Ga0587091_033311 3300059511 Bacteria 979
919 Ga0587094_020417 3300059513 Bacteria 958
920 Ga0587062_002810 3300059639 Bacteria 1700
921 Ga0530510_0109649 3300061734 Bacteria 2021

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039453 Ga0436362_0610441 Ga0436362_0610441_106_732 198
2 3300047317 Ga0495604_0171370 Ga0495604_0171370_865_1500 201
3 3300005335 Ga0070666_10088219 Ga0070666_100882193 203
4 3300025923 Ga0207681_10469556 Ga0207681_104695561 203
5 3300025935 Ga0207709_10163669 Ga0207709_101636692 203
6 3300025986 Ga0207658_10613166 Ga0207658_106131661 203
7 3300049569 Ga0501032_0241454 Ga0501032_0241454_520_1149 203
8 3300009098 Ga0105245_10349965 Ga0105245_103499652 204
9 3300025911 Ga0207654_10647373 Ga0207654_106473731 206
10 3300047320 Ga0495672_0195447 Ga0495672_0195447_237_932 208
11 3300005289 Ga0065704_10187416 Ga0065704_101874162 213
12 3300005295 Ga0065707_10269917 Ga0065707_102699171 213
13 3300005331 Ga0070670_100005027 Ga0070670_1000050272 213
14 3300005334 Ga0068869_100010725 Ga0068869_1000107252 213
15 3300005334 Ga0068869_100050225 Ga0068869_1000502253 213
16 3300005338 Ga0068868_100401032 Ga0068868_1004010321 213
17 3300005340 Ga0070689_100057269 Ga0070689_1000572693 213
18 3300005347 Ga0070668_100048014 Ga0070668_1000480143 213
19 3300005353 Ga0070669_100053168 Ga0070669_1000531682 213
20 3300005353 Ga0070669_100095460 Ga0070669_1000954603 213
21 3300005364 Ga0070673_100028099 Ga0070673_1000280993 213
22 3300005364 Ga0070673_100498068 Ga0070673_1004980682 213
23 3300005440 Ga0070705_100349490 Ga0070705_1003494902 213
24 3300005441 Ga0070700_100233304 Ga0070700_1002333041 213
25 3300005444 Ga0070694_100242083 Ga0070694_1002420831 213
26 3300005445 Ga0070708_100050740 Ga0070708_1000507404 213
27 3300005467 Ga0070706_100020710 Ga0070706_1000207104 213
28 3300005471 Ga0070698_100066401 Ga0070698_1000664013 213
29 3300005471 Ga0070698_100074362 Ga0070698_1000743622 213
30 3300005471 Ga0070698_100204080 Ga0070698_1002040802 213
31 3300005518 Ga0070699_100019115 Ga0070699_1000191156 213
32 3300005518 Ga0070699_100195455 Ga0070699_1001954552 213
33 3300005518 Ga0070699_100302535 Ga0070699_1003025352 213
34 3300005518 Ga0070699_100740242 Ga0070699_1007402421 213
35 3300005536 Ga0070697_100006646 Ga0070697_1000066466 213
36 3300005545 Ga0070695_100219637 Ga0070695_1002196372 213
37 3300005546 Ga0070696_100614770 Ga0070696_1006147701 213
38 3300005549 Ga0070704_100169561 Ga0070704_1001695612 213
39 3300005719 Ga0068861_100015822 Ga0068861_1000158226 213
40 3300005719 Ga0068861_100553071 Ga0068861_1005530711 213
41 3300005841 Ga0068863_100588034 Ga0068863_1005880341 213
42 3300006163 Ga0070715_10000039 Ga0070715_1000003959 213
43 3300007265 Ga0099794_10040454 Ga0099794_100404544 213
44 3300009148 Ga0105243_10031915 Ga0105243_100319154 213
45 3300009148 Ga0105243_10291002 Ga0105243_102910022 213
46 3300009174 Ga0105241_10854187 Ga0105241_108541871 213
47 3300009176 Ga0105242_10405198 Ga0105242_104051981 213
48 3300009553 Ga0105249_10013119 Ga0105249_100131197 213
49 3300013100 Ga0157373_10437356 Ga0157373_104373562 213
50 3300013297 Ga0157378_10095561 Ga0157378_100955614 213
51 3300013306 Ga0163162_10000784 Ga0163162_100007847 213
52 3300013308 Ga0157375_10972718 Ga0157375_109727182 213
53 3300014325 Ga0163163_10058422 Ga0163163_100584227 213
54 3300014325 Ga0163163_10356018 Ga0163163_103560183 213
55 3300025905 Ga0207685_10000024 Ga0207685_1000002457 213
56 3300025910 Ga0207684_10003150 Ga0207684_1000315015 213
57 3300025923 Ga0207681_10004264 Ga0207681_100042646 213
58 3300025923 Ga0207681_10150053 Ga0207681_101500533 213
59 3300025925 Ga0207650_10002078 Ga0207650_1000207815 213
60 3300025925 Ga0207650_10215666 Ga0207650_102156662 213
61 3300025934 Ga0207686_10327456 Ga0207686_103274561 213
62 3300025936 Ga0207670_10046086 Ga0207670_100460862 213
63 3300025942 Ga0207689_10028316 Ga0207689_100283163 213
64 3300025942 Ga0207689_10110965 Ga0207689_101109653 213
65 3300025942 Ga0207689_10645341 Ga0207689_106453411 213
66 3300025945 Ga0207679_10444615 Ga0207679_104446152 213
67 3300025960 Ga0207651_10026556 Ga0207651_100265563 213
68 3300025961 Ga0207712_10000586 Ga0207712_1000058620 213
69 3300025972 Ga0207668_10009419 Ga0207668_100094193 213
70 3300026075 Ga0207708_10174764 Ga0207708_101747642 213
71 3300026088 Ga0207641_10280753 Ga0207641_102807531 213
72 3300026118 Ga0207675_100021754 Ga0207675_1000217545 213
73 3300027671 Ga0209588_1005410 Ga0209588_10054104 213
74 3300031456 Ga0307513_10535520 Ga0307513_105355202 213
75 3300049583 Ga0501067_0194417 Ga0501067_0194417_333_1028 213
76 3300005549 Ga0070704_100388833 Ga0070704_1003888332 214
77 3300032126 Ga0307415_100076589 Ga0307415_1000765895 214
78 3300005337 Ga0070682_100005522 Ga0070682_1000055227 215
79 3300005340 Ga0070689_100381665 Ga0070689_1003816652 215
80 3300005438 Ga0070701_10049658 Ga0070701_100496582 215
81 3300005544 Ga0070686_100028019 Ga0070686_1000280196 215
82 3300005843 Ga0068860_100171331 Ga0068860_1001713312 215
83 3300009093 Ga0105240_10332740 Ga0105240_103327403 215
84 3300013297 Ga0157378_10118185 Ga0157378_101181854 215
85 3300013297 Ga0157378_10129961 Ga0157378_101299613 215
86 3300014326 Ga0157380_10259179 Ga0157380_102591792 215
87 3300021384 Ga0213876_10043703 Ga0213876_100437033 215
88 3300025936 Ga0207670_10182241 Ga0207670_101822412 215
89 3300025960 Ga0207651_10042074 Ga0207651_100420745 215
90 3300026116 Ga0207674_10301940 Ga0207674_103019402 215
91 3300039437 Ga0436365_1052004 Ga0436365_1052004_2732_3427 215
92 3300046512 Ga0495610_0044352 Ga0495610_0044352_799_1494 215
93 3300046515 Ga0495620_0062541 Ga0495620_0062541_722_1417 215
94 3300046518 Ga0495631_0123360 Ga0495631_0123360_36_731 215
95 3300046525 Ga0495663_0000620 Ga0495663_0000620_4153_4848 215
96 3300046537 Ga0495598_0001218 Ga0495598_0001218_4012_4707 215
97 3300046539 Ga0495621_0002543 Ga0495621_0002543_2259_2954 215
98 3300046615 Ga0495656_0154167 Ga0495656_0154167_29_724 215
99 3300005330 Ga0070690_100014199 Ga0070690_1000141995 216
100 3300005336 Ga0070680_100134655 Ga0070680_1001346553 216
101 3300005343 Ga0070687_100300670 Ga0070687_1003006701 216
102 3300005406 Ga0070703_10044631 Ga0070703_100446311 216
103 3300005440 Ga0070705_100176546 Ga0070705_1001765462 216
104 3300005467 Ga0070706_100131556 Ga0070706_1001315561 216
105 3300005545 Ga0070695_100266016 Ga0070695_1002660162 216
106 3300005549 Ga0070704_100013577 Ga0070704_1000135776 216
107 3300005719 Ga0068861_100077905 Ga0068861_1000779054 216
108 3300005843 Ga0068860_100337596 Ga0068860_1003375962 216
109 3300005844 Ga0068862_100009823 Ga0068862_10000982310 216
110 3300005983 Ga0081540_1142299 Ga0081540_11422992 216
111 3300006173 Ga0070716_100113914 Ga0070716_1001139142 216
112 3300006914 Ga0075436_100015347 Ga0075436_1000153474 216
113 3300007076 Ga0075435_100020792 Ga0075435_1000207923 216
114 3300013297 Ga0157378_10527306 Ga0157378_105273062 216
115 3300014326 Ga0157380_10006345 Ga0157380_100063456 216
116 3300025885 Ga0207653_10023644 Ga0207653_100236443 216
117 3300025922 Ga0207646_10734902 Ga0207646_107349021 216
118 3300025939 Ga0207665_10011629 Ga0207665_100116296 216
119 3300028380 Ga0268265_10035479 Ga0268265_100354793 216
120 3300028381 Ga0268264_10305727 Ga0268264_103057272 216
121 3300050513 nmdc:mga0rr50_432_c1 nmdc:mga0rr50_432_c1_813_1508 216
122 3300050514 nmdc:mga08x19_27_c1 nmdc:mga08x19_27_c1_223181_223876 216
123 3300005536 Ga0070697_100002791 Ga0070697_1000027915 217
124 3300026095 Ga0207676_10104838 Ga0207676_101048383 217
125 3300005340 Ga0070689_100258063 Ga0070689_1002580632 218
126 3300005444 Ga0070694_100032476 Ga0070694_1000324766 218
127 3300005468 Ga0070707_100003296 Ga0070707_10000329610 218
128 3300005471 Ga0070698_100035264 Ga0070698_1000352645 218
129 3300005518 Ga0070699_100062651 Ga0070699_1000626512 218
130 3300005549 Ga0070704_100013963 Ga0070704_1000139637 218
131 3300025922 Ga0207646_10005747 Ga0207646_100057474 218
132 3300005354 Ga0070675_100187501 Ga0070675_1001875012 219
133 3300005330 Ga0070690_100027424 Ga0070690_1000274243 220
134 3300005544 Ga0070686_100196518 Ga0070686_1001965182 220
135 3300005719 Ga0068861_100168921 Ga0068861_1001689211 220
136 3300005842 Ga0068858_100672416 Ga0068858_1006724162 220
137 3300009176 Ga0105242_10045777 Ga0105242_100457778 220
138 3300009176 Ga0105242_10667596 Ga0105242_106675962 220
139 3300017792 Ga0163161_10011008 Ga0163161_100110084 220
140 3300025934 Ga0207686_10000392 Ga0207686_1000039212 220
141 3300026089 Ga0207648_10260934 Ga0207648_102609342 220
142 3300005471 Ga0070698_100000374 Ga0070698_1000003747 221
143 3300001426 JGI24030J14995_100433 JGI24030J14995_1004332 224
144 3300001432 JGI24034J14986_100801 JGI24034J14986_1008011 224
145 3300002074 JGI24748J21848_1000014 JGI24748J21848_1000014117 224
146 3300002239 JGI24034J26672_10000012 JGI24034J26672_100000127 224
147 3300004799 Ga0058863_10009163 Ga0058863_100091632 224
148 3300005330 Ga0070690_100252469 Ga0070690_1002524692 224
149 3300005340 Ga0070689_100227946 Ga0070689_1002279462 224
150 3300005355 Ga0070671_100471292 Ga0070671_1004712922 224
151 3300005459 Ga0068867_100432215 Ga0068867_1004322152 224
152 3300005518 Ga0070699_100114649 Ga0070699_1001146495 224
153 3300005544 Ga0070686_100028009 Ga0070686_1000280097 224
154 3300005549 Ga0070704_100165307 Ga0070704_1001653072 224
155 3300005615 Ga0070702_100036883 Ga0070702_1000368832 224
156 3300005615 Ga0070702_100174622 Ga0070702_1001746221 224
157 3300005617 Ga0068859_100109843 Ga0068859_1001098435 224
158 3300005618 Ga0068864_100021548 Ga0068864_1000215485 224
159 3300005719 Ga0068861_100056288 Ga0068861_1000562888 224
160 3300005842 Ga0068858_100008879 Ga0068858_1000088795 224
161 3300006852 Ga0075433_10036894 Ga0075433_100368943 224
162 3300006871 Ga0075434_100093178 Ga0075434_1000931787 224
163 3300006931 Ga0097620_100109848 Ga0097620_1001098485 224
164 3300009101 Ga0105247_10000050 Ga0105247_10000050116 224
165 3300009101 Ga0105247_10312562 Ga0105247_103125622 224
166 3300009101 Ga0105247_10327849 Ga0105247_103278492 224
167 3300009177 Ga0105248_10053458 Ga0105248_100534584 224
168 3300013297 Ga0157378_10061204 Ga0157378_100612042 224
169 3300013306 Ga0163162_10041843 Ga0163162_100418437 224
170 3300013306 Ga0163162_10337071 Ga0163162_103370712 224
171 3300014968 Ga0157379_10037517 Ga0157379_100375177 224
172 3300025223 Ga0207672_1000149 Ga0207672_10001496 224
173 3300025900 Ga0207710_10000003 Ga0207710_10000003906 224
174 3300025900 Ga0207710_10166752 Ga0207710_101667521 224
175 3300025931 Ga0207644_10001958 Ga0207644_100019586 224
176 3300025942 Ga0207689_10013420 Ga0207689_100134204 224
177 3300026023 Ga0207677_10038376 Ga0207677_100383764 224
178 3300026035 Ga0207703_10000355 Ga0207703_1000035510 224
179 3300026089 Ga0207648_10204062 Ga0207648_102040623 224
180 3300026118 Ga0207675_100047591 Ga0207675_1000475912 224
181 3300038996 Ga0242420_018381 Ga0242420_018381_474_1169 224
182 3300050512 nmdc:mga0n895_173908_c1 nmdc:mga0n895_173908_c1_463_1158 224
183 3300005356 Ga0070674_100855836 Ga0070674_1008558361 225
184 3300005444 Ga0070694_100008189 Ga0070694_1000081897 225
185 3300009148 Ga0105243_10001520 Ga0105243_100015208 225
186 3300009176 Ga0105242_10001223 Ga0105242_1000122313 225
187 3300014969 Ga0157376_11164402 Ga0157376_111644021 225
188 3300025934 Ga0207686_10000659 Ga0207686_1000065913 225
189 3300025935 Ga0207709_10000037 Ga0207709_100000377 225
190 3300026089 Ga0207648_10453890 Ga0207648_104538902 225
191 3300005364 Ga0070673_100264116 Ga0070673_1002641162 226
192 3300005467 Ga0070706_100346629 Ga0070706_1003466292 226
193 3300005468 Ga0070707_100028004 Ga0070707_10002800411 226
194 3300005471 Ga0070698_100016601 Ga0070698_1000166016 226
195 3300005471 Ga0070698_100076608 Ga0070698_1000766082 226
196 3300005536 Ga0070697_100195414 Ga0070697_1001954142 226
197 3300005546 Ga0070696_100013482 Ga0070696_1000134823 226
198 3300005618 Ga0068864_101039464 Ga0068864_1010394641 226
199 3300006237 Ga0097621_100389719 Ga0097621_1003897191 226
200 3300014325 Ga0163163_10277204 Ga0163163_102772043 226
201 3300025910 Ga0207684_10085853 Ga0207684_100858532 226
202 3300025922 Ga0207646_10011116 Ga0207646_1001111616 226
203 3300025931 Ga0207644_10034752 Ga0207644_100347522 226
204 3300025949 Ga0207667_10909858 Ga0207667_109098581 226
205 3300031731 Ga0307405_10016948 Ga0307405_100169484 226
206 3300031911 Ga0307412_10010192 Ga0307412_100101924 226
207 3300031995 Ga0307409_100421071 Ga0307409_1004210711 226
208 3300032002 Ga0307416_100030319 Ga0307416_1000303197 226
209 3300032004 Ga0307414_10264523 Ga0307414_102645231 226
210 3300032126 Ga0307415_100016722 Ga0307415_1000167223 226
211 3300032168 Ga0316593_10051094 Ga0316593_100510942 226
212 3300046681 Ga0495647_0244132 Ga0495647_0244132_48_743 226
213 3300048915 Ga0496112_0427076 Ga0496112_0427076_45_740 226
214 3300049521 Ga0501298_002295 Ga0501298_002295_2033_2728 226
215 3300049764 Ga0501267_004623 Ga0501267_004623_23_718 226
216 3300004800 Ga0058861_11955377 Ga0058861_119553771 227
217 3300004800 Ga0058861_12040784 Ga0058861_120407842 227
218 3300005327 Ga0070658_10209182 Ga0070658_102091822 227
219 3300005456 Ga0070678_100567328 Ga0070678_1005673281 227
220 3300005563 Ga0068855_100749166 Ga0068855_1007491662 227
221 3300005618 Ga0068864_100154460 Ga0068864_1001544603 227
222 3300006881 Ga0068865_100166495 Ga0068865_1001664953 227
223 3300014325 Ga0163163_10450424 Ga0163163_104504242 227
224 3300025934 Ga0207686_10098042 Ga0207686_100980421 227
225 3300026121 Ga0207683_10025820 Ga0207683_100258204 227
226 3300030877 Ga0265777_104945 Ga0265777_1049451 227
227 3300031249 Ga0265339_10062413 Ga0265339_100624132 227
228 3300031649 Ga0307514_10050235 Ga0307514_100502352 227
229 3300031649 Ga0307514_10132139 Ga0307514_101321392 227
230 3300037471 Ga0395905_0532956 Ga0395905_0532956_25_735 227
231 3300044712 Ga0453684_0298665 Ga0453684_0298665_945_1655 227
232 3300059506 Ga0587085_001894 Ga0587085_001894_1223_1933 227
233 3300059639 Ga0587062_002810 Ga0587062_002810_876_1586 227
234 3300025918 Ga0207662_10460748 Ga0207662_104607481 228
235 3300027907 Ga0207428_10057402 Ga0207428_100574025 228
236 3300059506 Ga0587085_045285 Ga0587085_045285_21_746 228
237 3300005468 Ga0070707_100148635 Ga0070707_1001486351 229
238 3300025922 Ga0207646_10124327 Ga0207646_101243273 229
239 3300033528 Ga0316588_1049462 Ga0316588_10494621 229
240 3300003203 JGI25406J46586_10014740 JGI25406J46586_100147404 230
241 3300005336 Ga0070680_100317539 Ga0070680_1003175392 230
242 3300005439 Ga0070711_100077619 Ga0070711_1000776192 230
243 3300009545 Ga0105237_10053364 Ga0105237_100533647 230
244 3300013307 Ga0157372_10107622 Ga0157372_101076227 230
245 3300025940 Ga0207691_10002381 Ga0207691_1000238113 230
246 3300037418 Ga0395900_0456029 Ga0395900_0456029_184_918 230
247 3300037466 Ga0395898_0647476 Ga0395898_0647476_180_914 230
248 3300037471 Ga0395905_0008542 Ga0395905_0008542_4090_4824 230
249 3300037471 Ga0395905_0010746 Ga0395905_0010746_7647_8381 230
250 3300037471 Ga0395905_0030677 Ga0395905_0030677_495_1229 230
251 3300037471 Ga0395905_0144217 Ga0395905_0144217_173_907 230
252 3300053078 Ga0495612_0021140 Ga0495612_0021140_550_1260 230
253 3300059505 Ga0587083_0022585 Ga0587083_0022585_183_917 230
254 3300000531 CNBas_1000372 CNBas_10003722 231
255 3300000532 CNAas_1001813 CNAas_10018132 231
256 3300002459 JGI24751J29686_10000074 JGI24751J29686_100000747 231
257 3300003203 JGI25406J46586_10011912 JGI25406J46586_100119127 231
258 3300003203 JGI25406J46586_10026245 JGI25406J46586_100262452 231
259 3300005288 Ga0065714_10064450 Ga0065714_1006445057 231
260 3300005289 Ga0065704_10002971 Ga0065704_100029711 231
261 3300005289 Ga0065704_10093725 Ga0065704_100937253 231
262 3300005289 Ga0065704_10097529 Ga0065704_100975293 231
263 3300005289 Ga0065704_10173484 Ga0065704_101734841 231
264 3300005290 Ga0065712_10001740 Ga0065712_100017408 231
265 3300005290 Ga0065712_10004552 Ga0065712_100045525 231
266 3300005290 Ga0065712_10015500 Ga0065712_100155003 231
267 3300005290 Ga0065712_10018916 Ga0065712_100189162 231
268 3300005290 Ga0065712_10022326 Ga0065712_100223262 231
269 3300005290 Ga0065712_10072502 Ga0065712_100725023 231
270 3300005290 Ga0065712_10159279 Ga0065712_101592791 231
271 3300005293 Ga0065715_10005007 Ga0065715_100050074 231
272 3300005293 Ga0065715_10027997 Ga0065715_100279971 231
273 3300005293 Ga0065715_10094215 Ga0065715_100942152 231
274 3300005293 Ga0065715_10095075 Ga0065715_100950756 231
275 3300005293 Ga0065715_10097309 Ga0065715_100973096 231
276 3300005293 Ga0065715_10166863 Ga0065715_101668632 231
277 3300005293 Ga0065715_10170832 Ga0065715_101708321 231
278 3300005293 Ga0065715_10187026 Ga0065715_101870262 231
279 3300005295 Ga0065707_10005254 Ga0065707_100052544 231
280 3300005295 Ga0065707_10008773 Ga0065707_100087732 231
281 3300005295 Ga0065707_10043579 Ga0065707_100435792 231
282 3300005295 Ga0065707_10091832 Ga0065707_100918327 231
283 3300005328 Ga0070676_10429273 Ga0070676_104292731 231
284 3300005328 Ga0070676_10455928 Ga0070676_104559281 231
285 3300005330 Ga0070690_100004097 Ga0070690_1000040977 231
286 3300005330 Ga0070690_100148584 Ga0070690_1001485841 231
287 3300005331 Ga0070670_100013886 Ga0070670_1000138867 231
288 3300005331 Ga0070670_100039282 Ga0070670_1000392824 231
289 3300005331 Ga0070670_100129699 Ga0070670_1001296994 231
290 3300005331 Ga0070670_100228883 Ga0070670_1002288833 231
291 3300005331 Ga0070670_100416906 Ga0070670_1004169062 231
292 3300005331 Ga0070670_100666608 Ga0070670_1006666081 231
293 3300005335 Ga0070666_10018717 Ga0070666_100187174 231
294 3300005336 Ga0070680_100000103 Ga0070680_10000010337 231
295 3300005336 Ga0070680_100137262 Ga0070680_1001372623 231
296 3300005336 Ga0070680_100641303 Ga0070680_1006413031 231
297 3300005337 Ga0070682_100019793 Ga0070682_1000197934 231
298 3300005337 Ga0070682_100602823 Ga0070682_1006028231 231
299 3300005338 Ga0068868_100362253 Ga0068868_1003622531 231
300 3300005339 Ga0070660_100011939 Ga0070660_1000119395 231
301 3300005340 Ga0070689_100020570 Ga0070689_1000205702 231
302 3300005340 Ga0070689_100038497 Ga0070689_1000384976 231
303 3300005340 Ga0070689_100479284 Ga0070689_1004792842 231
304 3300005341 Ga0070691_10204574 Ga0070691_102045742 231
305 3300005343 Ga0070687_100002413 Ga0070687_1000024135 231
306 3300005343 Ga0070687_100019756 Ga0070687_1000197566 231
307 3300005343 Ga0070687_100045207 Ga0070687_1000452073 231
308 3300005343 Ga0070687_100186574 Ga0070687_1001865741 231
309 3300005344 Ga0070661_100033024 Ga0070661_1000330246 231
310 3300005344 Ga0070661_100265816 Ga0070661_1002658162 231
311 3300005345 Ga0070692_10007532 Ga0070692_100075324 231
312 3300005345 Ga0070692_10088217 Ga0070692_100882172 231
313 3300005353 Ga0070669_100018533 Ga0070669_1000185336 231
314 3300005353 Ga0070669_100055779 Ga0070669_1000557793 231
315 3300005353 Ga0070669_100123593 Ga0070669_1001235933 231
316 3300005354 Ga0070675_100116074 Ga0070675_1001160742 231
317 3300005354 Ga0070675_100657886 Ga0070675_1006578862 231
318 3300005355 Ga0070671_100007852 Ga0070671_1000078525 231
319 3300005355 Ga0070671_100168905 Ga0070671_1001689053 231
320 3300005364 Ga0070673_100077535 Ga0070673_1000775356 231
321 3300005364 Ga0070673_100095069 Ga0070673_1000950694 231
322 3300005364 Ga0070673_100176116 Ga0070673_1001761163 231
323 3300005365 Ga0070688_100003329 Ga0070688_1000033294 231
324 3300005365 Ga0070688_100517022 Ga0070688_1005170221 231
325 3300005366 Ga0070659_100107817 Ga0070659_1001078173 231
326 3300005367 Ga0070667_100036777 Ga0070667_1000367771 231
327 3300005406 Ga0070703_10000193 Ga0070703_100001938 231
328 3300005406 Ga0070703_10006781 Ga0070703_100067814 231
329 3300005406 Ga0070703_10032886 Ga0070703_100328862 231
330 3300005438 Ga0070701_10013118 Ga0070701_100131183 231
331 3300005440 Ga0070705_100000982 Ga0070705_1000009829 231
332 3300005440 Ga0070705_100062699 Ga0070705_1000626992 231
333 3300005440 Ga0070705_100178306 Ga0070705_1001783062 231
334 3300005441 Ga0070700_100005796 Ga0070700_1000057964 231
335 3300005441 Ga0070700_100010746 Ga0070700_1000107462 231
336 3300005441 Ga0070700_100041257 Ga0070700_1000412574 231
337 3300005441 Ga0070700_100055987 Ga0070700_1000559872 231
338 3300005444 Ga0070694_100015866 Ga0070694_1000158662 231
339 3300005444 Ga0070694_100021679 Ga0070694_1000216794 231
340 3300005444 Ga0070694_100044559 Ga0070694_1000445595 231
341 3300005444 Ga0070694_100055794 Ga0070694_1000557942 231
342 3300005444 Ga0070694_100068041 Ga0070694_1000680414 231
343 3300005444 Ga0070694_100079786 Ga0070694_1000797862 231
344 3300005444 Ga0070694_100082443 Ga0070694_1000824431 231
345 3300005444 Ga0070694_100090985 Ga0070694_1000909853 231
346 3300005445 Ga0070708_100001743 Ga0070708_1000017438 231
347 3300005445 Ga0070708_100280955 Ga0070708_1002809551 231
348 3300005445 Ga0070708_100311833 Ga0070708_1003118332 231
349 3300005457 Ga0070662_100029069 Ga0070662_1000290693 231
350 3300005457 Ga0070662_100289628 Ga0070662_1002896282 231
351 3300005457 Ga0070662_100447912 Ga0070662_1004479122 231
352 3300005457 Ga0070662_100653125 Ga0070662_1006531251 231
353 3300005458 Ga0070681_10000095 Ga0070681_100000956 231
354 3300005458 Ga0070681_10006380 Ga0070681_100063802 231
355 3300005458 Ga0070681_10027357 Ga0070681_100273574 231
356 3300005458 Ga0070681_10150615 Ga0070681_101506151 231
357 3300005459 Ga0068867_100027874 Ga0068867_1000278744 231
358 3300005459 Ga0068867_100139144 Ga0068867_1001391443 231
359 3300005459 Ga0068867_100175345 Ga0068867_1001753452 231
360 3300005459 Ga0068867_100563000 Ga0068867_1005630001 231
361 3300005466 Ga0070685_10061109 Ga0070685_100611093 231
362 3300005466 Ga0070685_10447502 Ga0070685_104475021 231
363 3300005467 Ga0070706_100000920 Ga0070706_10000092023 231
364 3300005467 Ga0070706_100005925 Ga0070706_1000059257 231
365 3300005467 Ga0070706_100150458 Ga0070706_1001504582 231
366 3300005467 Ga0070706_100152848 Ga0070706_1001528482 231
367 3300005468 Ga0070707_100014408 Ga0070707_1000144084 231
368 3300005468 Ga0070707_100068181 Ga0070707_1000681812 231
369 3300005468 Ga0070707_100208109 Ga0070707_1002081092 231
370 3300005471 Ga0070698_100005496 Ga0070698_1000054967 231
371 3300005471 Ga0070698_100005600 Ga0070698_1000056006 231
372 3300005471 Ga0070698_100035463 Ga0070698_1000354634 231
373 3300005518 Ga0070699_100026662 Ga0070699_1000266627 231
374 3300005518 Ga0070699_100038208 Ga0070699_1000382086 231
375 3300005518 Ga0070699_100059963 Ga0070699_1000599632 231
376 3300005518 Ga0070699_100643203 Ga0070699_1006432031 231
377 3300005530 Ga0070679_100000661 Ga0070679_10000066121 231
378 3300005535 Ga0070684_100371671 Ga0070684_1003716712 231
379 3300005536 Ga0070697_100072663 Ga0070697_1000726637 231
380 3300005536 Ga0070697_100137242 Ga0070697_1001372423 231
381 3300005539 Ga0068853_100067207 Ga0068853_1000672077 231
382 3300005539 Ga0068853_100101661 Ga0068853_1001016612 231
383 3300005539 Ga0068853_100163176 Ga0068853_1001631761 231
384 3300005539 Ga0068853_100181150 Ga0068853_1001811501 231
385 3300005539 Ga0068853_100403852 Ga0068853_1004038522 231
386 3300005543 Ga0070672_100026540 Ga0070672_1000265404 231
387 3300005544 Ga0070686_100005785 Ga0070686_1000057851 231
388 3300005544 Ga0070686_100013995 Ga0070686_1000139957 231
389 3300005544 Ga0070686_100046653 Ga0070686_1000466532 231
390 3300005544 Ga0070686_100122582 Ga0070686_1001225821 231
391 3300005545 Ga0070695_100018991 Ga0070695_1000189912 231
392 3300005545 Ga0070695_100033900 Ga0070695_1000339005 231
393 3300005545 Ga0070695_100083578 Ga0070695_1000835782 231
394 3300005545 Ga0070695_100283761 Ga0070695_1002837612 231
395 3300005545 Ga0070695_100306856 Ga0070695_1003068561 231
396 3300005545 Ga0070695_100411713 Ga0070695_1004117132 231
397 3300005546 Ga0070696_100042662 Ga0070696_1000426622 231
398 3300005546 Ga0070696_100047947 Ga0070696_1000479474 231
399 3300005546 Ga0070696_100053664 Ga0070696_1000536643 231
400 3300005546 Ga0070696_100133532 Ga0070696_1001335322 231
401 3300005546 Ga0070696_100182939 Ga0070696_1001829391 231
402 3300005546 Ga0070696_100308375 Ga0070696_1003083752 231
403 3300005546 Ga0070696_100865886 Ga0070696_1008658861 231
404 3300005547 Ga0070693_100003410 Ga0070693_1000034105 231
405 3300005547 Ga0070693_100021759 Ga0070693_1000217593 231
406 3300005547 Ga0070693_100067661 Ga0070693_1000676612 231
407 3300005547 Ga0070693_100093271 Ga0070693_1000932713 231
408 3300005547 Ga0070693_100117588 Ga0070693_1001175882 231
409 3300005547 Ga0070693_100171887 Ga0070693_1001718872 231
410 3300005549 Ga0070704_100018581 Ga0070704_1000185814 231
411 3300005549 Ga0070704_100028182 Ga0070704_1000281827 231
412 3300005549 Ga0070704_100034482 Ga0070704_1000344824 231
413 3300005549 Ga0070704_100078833 Ga0070704_1000788334 231
414 3300005549 Ga0070704_100222718 Ga0070704_1002227182 231
415 3300005549 Ga0070704_100655696 Ga0070704_1006556961 231
416 3300005563 Ga0068855_100261345 Ga0068855_1002613454 231
417 3300005563 Ga0068855_100653339 Ga0068855_1006533392 231
418 3300005564 Ga0070664_100003167 Ga0070664_1000031677 231
419 3300005577 Ga0068857_100256564 Ga0068857_1002565642 231
420 3300005577 Ga0068857_100422995 Ga0068857_1004229952 231
421 3300005577 Ga0068857_100472240 Ga0068857_1004722402 231
422 3300005578 Ga0068854_100020758 Ga0068854_1000207584 231
423 3300005578 Ga0068854_100274091 Ga0068854_1002740912 231
424 3300005615 Ga0070702_100015413 Ga0070702_1000154134 231
425 3300005615 Ga0070702_100015955 Ga0070702_1000159551 231
426 3300005615 Ga0070702_100039137 Ga0070702_1000391373 231
427 3300005615 Ga0070702_100330610 Ga0070702_1003306102 231
428 3300005615 Ga0070702_100494786 Ga0070702_1004947861 231
429 3300005616 Ga0068852_100087406 Ga0068852_1000874064 231
430 3300005616 Ga0068852_100537314 Ga0068852_1005373142 231
431 3300005616 Ga0068852_100627698 Ga0068852_1006276982 231
432 3300005617 Ga0068859_100005985 Ga0068859_1000059856 231
433 3300005617 Ga0068859_100056053 Ga0068859_1000560535 231
434 3300005617 Ga0068859_100067591 Ga0068859_1000675913 231
435 3300005617 Ga0068859_100102551 Ga0068859_1001025516 231
436 3300005617 Ga0068859_100129114 Ga0068859_1001291144 231
437 3300005617 Ga0068859_100156767 Ga0068859_1001567673 231
438 3300005617 Ga0068859_100237255 Ga0068859_1002372552 231
439 3300005617 Ga0068859_100296389 Ga0068859_1002963892 231
440 3300005617 Ga0068859_100496219 Ga0068859_1004962191 231
441 3300005617 Ga0068859_100522944 Ga0068859_1005229442 231
442 3300005617 Ga0068859_100816687 Ga0068859_1008166872 231
443 3300005618 Ga0068864_100041104 Ga0068864_1000411041 231
444 3300005618 Ga0068864_100049121 Ga0068864_1000491214 231
445 3300005618 Ga0068864_100051844 Ga0068864_1000518444 231
446 3300005618 Ga0068864_100056009 Ga0068864_1000560097 231
447 3300005618 Ga0068864_100063202 Ga0068864_1000632027 231
448 3300005618 Ga0068864_100556228 Ga0068864_1005562282 231
449 3300005718 Ga0068866_10012501 Ga0068866_100125013 231
450 3300005719 Ga0068861_100048837 Ga0068861_1000488374 231
451 3300005719 Ga0068861_100212775 Ga0068861_1002127752 231
452 3300005719 Ga0068861_100355548 Ga0068861_1003555481 231
453 3300005719 Ga0068861_100725438 Ga0068861_1007254381 231
454 3300005834 Ga0068851_10036164 Ga0068851_100361641 231
455 3300005840 Ga0068870_10009612 Ga0068870_100096127 231
456 3300005840 Ga0068870_10024974 Ga0068870_100249744 231
457 3300005840 Ga0068870_10063049 Ga0068870_100630492 231
458 3300005841 Ga0068863_100042226 Ga0068863_1000422264 231
459 3300005841 Ga0068863_100082290 Ga0068863_1000822904 231
460 3300005841 Ga0068863_100116302 Ga0068863_1001163021 231
461 3300005841 Ga0068863_100537209 Ga0068863_1005372092 231
462 3300005841 Ga0068863_100593222 Ga0068863_1005932222 231
463 3300005841 Ga0068863_100764867 Ga0068863_1007648671 231
464 3300005842 Ga0068858_100105533 Ga0068858_1001055332 231
465 3300005842 Ga0068858_100110403 Ga0068858_1001104032 231
466 3300005842 Ga0068858_100136860 Ga0068858_1001368602 231
467 3300005842 Ga0068858_100292735 Ga0068858_1002927352 231
468 3300005842 Ga0068858_100428199 Ga0068858_1004281992 231
469 3300005842 Ga0068858_100749463 Ga0068858_1007494631 231
470 3300005842 Ga0068858_101164130 Ga0068858_1011641301 231
471 3300005843 Ga0068860_100057451 Ga0068860_1000574515 231
472 3300005843 Ga0068860_100102558 Ga0068860_1001025582 231
473 3300005843 Ga0068860_100136406 Ga0068860_1001364061 231
474 3300005843 Ga0068860_100320613 Ga0068860_1003206132 231
475 3300005843 Ga0068860_100669072 Ga0068860_1006690722 231
476 3300005844 Ga0068862_100022289 Ga0068862_1000222896 231
477 3300005844 Ga0068862_100039853 Ga0068862_1000398534 231
478 3300005844 Ga0068862_100040779 Ga0068862_1000407793 231
479 3300005844 Ga0068862_100447220 Ga0068862_1004472202 231
480 3300005985 Ga0081539_10000976 Ga0081539_100009767 231
481 3300005985 Ga0081539_10003361 Ga0081539_100033617 231
482 3300005985 Ga0081539_10005422 Ga0081539_100054227 231
483 3300006237 Ga0097621_100061660 Ga0097621_1000616602 231
484 3300006237 Ga0097621_100552084 Ga0097621_1005520842 231
485 3300006358 Ga0068871_100005005 Ga0068871_10000500513 231
486 3300006358 Ga0068871_100059136 Ga0068871_1000591362 231
487 3300006844 Ga0075428_100081117 Ga0075428_1000811173 231
488 3300006846 Ga0075430_100058059 Ga0075430_1000580592 231
489 3300006846 Ga0075430_100148436 Ga0075430_1001484362 231
490 3300006846 Ga0075430_100189610 Ga0075430_1001896103 231
491 3300006847 Ga0075431_100126819 Ga0075431_1001268193 231
492 3300006847 Ga0075431_100530951 Ga0075431_1005309512 231
493 3300006852 Ga0075433_10032041 Ga0075433_100320414 231
494 3300006852 Ga0075433_10080731 Ga0075433_100807317 231
495 3300006852 Ga0075433_10113009 Ga0075433_101130093 231
496 3300006852 Ga0075433_10315016 Ga0075433_103150162 231
497 3300006871 Ga0075434_100017958 Ga0075434_1000179583 231
498 3300006871 Ga0075434_100034935 Ga0075434_1000349353 231
499 3300006871 Ga0075434_100171056 Ga0075434_1001710563 231
500 3300006871 Ga0075434_100238187 Ga0075434_1002381872 231
501 3300006880 Ga0075429_100029946 Ga0075429_1000299462 231
502 3300006880 Ga0075429_100049604 Ga0075429_1000496047 231
503 3300006880 Ga0075429_100128517 Ga0075429_1001285174 231
504 3300006880 Ga0075429_100248821 Ga0075429_1002488212 231
505 3300006880 Ga0075429_100353225 Ga0075429_1003532252 231
506 3300006881 Ga0068865_100012683 Ga0068865_1000126834 231
507 3300006881 Ga0068865_100269210 Ga0068865_1002692102 231
508 3300006914 Ga0075436_100152989 Ga0075436_1001529893 231
509 3300006914 Ga0075436_100519687 Ga0075436_1005196871 231
510 3300006931 Ga0097620_100005985 Ga0097620_1000059855 231
511 3300006931 Ga0097620_100056054 Ga0097620_1000560544 231
512 3300006931 Ga0097620_100067591 Ga0097620_1000675913 231
513 3300006931 Ga0097620_100102553 Ga0097620_1001025536 231
514 3300006931 Ga0097620_100129107 Ga0097620_1001291074 231
515 3300006931 Ga0097620_100156772 Ga0097620_1001567723 231
516 3300006931 Ga0097620_100237249 Ga0097620_1002372492 231
517 3300006931 Ga0097620_100296397 Ga0097620_1002963972 231
518 3300006931 Ga0097620_100496266 Ga0097620_1004962661 231
519 3300006931 Ga0097620_100522942 Ga0097620_1005229421 231
520 3300006931 Ga0097620_100816681 Ga0097620_1008166812 231
521 3300009011 Ga0105251_10039112 Ga0105251_100391124 231
522 3300009093 Ga0105240_10171414 Ga0105240_101714144 231
523 3300009093 Ga0105240_11074102 Ga0105240_110741022 231
524 3300009094 Ga0111539_10005598 Ga0111539_1000559810 231
525 3300009094 Ga0111539_10022660 Ga0111539_100226607 231
526 3300009094 Ga0111539_10111096 Ga0111539_101110963 231
527 3300009094 Ga0111539_10155362 Ga0111539_101553623 231
528 3300009094 Ga0111539_10442820 Ga0111539_104428202 231
529 3300009098 Ga0105245_10018594 Ga0105245_100185943 231
530 3300009098 Ga0105245_10754080 Ga0105245_107540802 231
531 3300009101 Ga0105247_10057749 Ga0105247_100577493 231
532 3300009101 Ga0105247_10125804 Ga0105247_101258042 231
533 3300009147 Ga0114129_10033278 Ga0114129_100332784 231
534 3300009147 Ga0114129_10051383 Ga0114129_100513834 231
535 3300009147 Ga0114129_10134336 Ga0114129_101343363 231
536 3300009147 Ga0114129_10152363 Ga0114129_101523633 231
537 3300009147 Ga0114129_10165342 Ga0114129_101653426 231
538 3300009147 Ga0114129_10253970 Ga0114129_102539703 231
539 3300009147 Ga0114129_10468658 Ga0114129_104686583 231
540 3300009147 Ga0114129_10605425 Ga0114129_106054252 231
541 3300009148 Ga0105243_10007055 Ga0105243_100070552 231
542 3300009148 Ga0105243_10038543 Ga0105243_100385437 231
543 3300009148 Ga0105243_10516701 Ga0105243_105167012 231
544 3300009148 Ga0105243_11331636 Ga0105243_113316361 231
545 3300009174 Ga0105241_10091628 Ga0105241_100916282 231
546 3300009174 Ga0105241_10142240 Ga0105241_101422403 231
547 3300009174 Ga0105241_10203148 Ga0105241_102031481 231
548 3300009174 Ga0105241_10331343 Ga0105241_103313432 231
549 3300009174 Ga0105241_10602845 Ga0105241_106028452 231
550 3300009176 Ga0105242_10034629 Ga0105242_100346293 231
551 3300009176 Ga0105242_10159698 Ga0105242_101596983 231
552 3300009176 Ga0105242_10342883 Ga0105242_103428832 231
553 3300009176 Ga0105242_11026118 Ga0105242_110261181 231
554 3300009177 Ga0105248_10015006 Ga0105248_100150065 231
555 3300009177 Ga0105248_10043401 Ga0105248_100434014 231
556 3300009177 Ga0105248_10108633 Ga0105248_101086332 231
557 3300009177 Ga0105248_10129394 Ga0105248_101293942 231
558 3300009177 Ga0105248_10168767 Ga0105248_101687674 231
559 3300009177 Ga0105248_10247200 Ga0105248_102472002 231
560 3300009177 Ga0105248_10257463 Ga0105248_102574633 231
561 3300009177 Ga0105248_11083496 Ga0105248_110834961 231
562 3300009177 Ga0105248_11228796 Ga0105248_112287961 231
563 3300009177 Ga0105248_11269653 Ga0105248_112696531 231
564 3300009545 Ga0105237_10007174 Ga0105237_100071746 231
565 3300009545 Ga0105237_10062079 Ga0105237_100620794 231
566 3300009545 Ga0105237_10220127 Ga0105237_102201272 231
567 3300009545 Ga0105237_10674263 Ga0105237_106742632 231
568 3300009551 Ga0105238_10036920 Ga0105238_100369202 231
569 3300009551 Ga0105238_10124612 Ga0105238_101246122 231
570 3300009551 Ga0105238_10533444 Ga0105238_105334441 231
571 3300009553 Ga0105249_10025118 Ga0105249_100251185 231
572 3300009553 Ga0105249_10026857 Ga0105249_100268573 231
573 3300009553 Ga0105249_10100720 Ga0105249_101007203 231
574 3300009553 Ga0105249_10613873 Ga0105249_106138732 231
575 3300010375 Ga0105239_10201039 Ga0105239_102010392 231
576 3300010375 Ga0105239_10287476 Ga0105239_102874763 231
577 3300011119 Ga0105246_10015588 Ga0105246_100155884 231
578 3300011119 Ga0105246_10184623 Ga0105246_101846233 231
579 3300011119 Ga0105246_10223515 Ga0105246_102235152 231
580 3300011119 Ga0105246_10315615 Ga0105246_103156152 231
581 3300011119 Ga0105246_10701331 Ga0105246_107013312 231
582 3300011119 Ga0105246_10704992 Ga0105246_107049921 231
583 3300013100 Ga0157373_10021532 Ga0157373_100215324 231
584 3300013100 Ga0157373_10041447 Ga0157373_100414477 231
585 3300013100 Ga0157373_10052446 Ga0157373_100524463 231
586 3300013100 Ga0157373_10257455 Ga0157373_102574551 231
587 3300013100 Ga0157373_10393453 Ga0157373_103934532 231
588 3300013102 Ga0157371_10326027 Ga0157371_103260272 231
589 3300013296 Ga0157374_10050453 Ga0157374_100504535 231
590 3300013296 Ga0157374_10104758 Ga0157374_101047582 231
591 3300013297 Ga0157378_10026642 Ga0157378_100266425 231
592 3300013297 Ga0157378_10150111 Ga0157378_101501114 231
593 3300013297 Ga0157378_10182405 Ga0157378_101824052 231
594 3300013297 Ga0157378_10459996 Ga0157378_104599962 231
595 3300013297 Ga0157378_10724135 Ga0157378_107241351 231
596 3300013297 Ga0157378_11099146 Ga0157378_110991461 231
597 3300013306 Ga0163162_10004596 Ga0163162_100045969 231
598 3300013306 Ga0163162_10006687 Ga0163162_100066875 231
599 3300013306 Ga0163162_10051628 Ga0163162_100516283 231
600 3300013306 Ga0163162_10112004 Ga0163162_101120043 231
601 3300013306 Ga0163162_10366884 Ga0163162_103668842 231
602 3300013307 Ga0157372_10095280 Ga0157372_100952804 231
603 3300013307 Ga0157372_10194152 Ga0157372_101941522 231
604 3300013307 Ga0157372_10204237 Ga0157372_102042371 231
605 3300013308 Ga0157375_10045126 Ga0157375_100451264 231
606 3300013308 Ga0157375_10094256 Ga0157375_100942561 231
607 3300013308 Ga0157375_10094340 Ga0157375_100943405 231
608 3300013308 Ga0157375_10302145 Ga0157375_103021451 231
609 3300013308 Ga0157375_10531190 Ga0157375_105311902 231
610 3300013308 Ga0157375_10561574 Ga0157375_105615742 231
611 3300013308 Ga0157375_11293573 Ga0157375_112935731 231
612 3300014325 Ga0163163_10006543 Ga0163163_100065432 231
613 3300014325 Ga0163163_10011579 Ga0163163_100115791 231
614 3300014325 Ga0163163_10037229 Ga0163163_100372294 231
615 3300014325 Ga0163163_10061741 Ga0163163_100617413 231
616 3300014325 Ga0163163_10134020 Ga0163163_101340205 231
617 3300014325 Ga0163163_10300848 Ga0163163_103008483 231
618 3300014325 Ga0163163_10416433 Ga0163163_104164332 231
619 3300014326 Ga0157380_10005145 Ga0157380_100051455 231
620 3300014326 Ga0157380_10019969 Ga0157380_100199694 231
621 3300014326 Ga0157380_10027759 Ga0157380_100277593 231
622 3300014326 Ga0157380_10073876 Ga0157380_100738762 231
623 3300014326 Ga0157380_10102702 Ga0157380_101027023 231
624 3300014326 Ga0157380_10339091 Ga0157380_103390911 231
625 3300014745 Ga0157377_10051456 Ga0157377_100514563 231
626 3300014745 Ga0157377_10285994 Ga0157377_102859941 231
627 3300014968 Ga0157379_10229529 Ga0157379_102295293 231
628 3300014969 Ga0157376_10009083 Ga0157376_100090834 231
629 3300014969 Ga0157376_10087182 Ga0157376_100871821 231
630 3300017792 Ga0163161_10023268 Ga0163161_100232683 231
631 3300017792 Ga0163161_10183133 Ga0163161_101831333 231
632 3300021384 Ga0213876_10000189 Ga0213876_100001895 231
633 3300021384 Ga0213876_10012169 Ga0213876_100121694 231
634 3300025885 Ga0207653_10000289 Ga0207653_100002898 231
635 3300025885 Ga0207653_10084115 Ga0207653_100841152 231
636 3300025885 Ga0207653_10125349 Ga0207653_101253492 231
637 3300025900 Ga0207710_10008744 Ga0207710_100087443 231
638 3300025900 Ga0207710_10248278 Ga0207710_102482781 231
639 3300025901 Ga0207688_10229092 Ga0207688_102290922 231
640 3300025903 Ga0207680_10023352 Ga0207680_100233524 231
641 3300025904 Ga0207647_10102056 Ga0207647_101020562 231
642 3300025904 Ga0207647_10119899 Ga0207647_101198993 231
643 3300025904 Ga0207647_10156058 Ga0207647_101560582 231
644 3300025907 Ga0207645_10063229 Ga0207645_100632293 231
645 3300025907 Ga0207645_10339849 Ga0207645_103398491 231
646 3300025908 Ga0207643_10020369 Ga0207643_100203693 231
647 3300025908 Ga0207643_10087555 Ga0207643_100875553 231
648 3300025908 Ga0207643_10122340 Ga0207643_101223402 231
649 3300025910 Ga0207684_10000085 Ga0207684_1000008591 231
650 3300025910 Ga0207684_10152505 Ga0207684_101525052 231
651 3300025910 Ga0207684_10329167 Ga0207684_103291672 231
652 3300025911 Ga0207654_10013384 Ga0207654_100133844 231
653 3300025911 Ga0207654_10110300 Ga0207654_101103001 231
654 3300025911 Ga0207654_10438647 Ga0207654_104386471 231
655 3300025912 Ga0207707_10000503 Ga0207707_1000050333 231
656 3300025912 Ga0207707_10050582 Ga0207707_100505824 231
657 3300025912 Ga0207707_10168562 Ga0207707_101685623 231
658 3300025913 Ga0207695_10081076 Ga0207695_100810763 231
659 3300025913 Ga0207695_10250144 Ga0207695_102501442 231
660 3300025914 Ga0207671_10004181 Ga0207671_100041816 231
661 3300025914 Ga0207671_10266569 Ga0207671_102665692 231
662 3300025914 Ga0207671_10275488 Ga0207671_102754882 231
663 3300025917 Ga0207660_10001058 Ga0207660_1000105811 231
664 3300025917 Ga0207660_10122254 Ga0207660_101222543 231
665 3300025918 Ga0207662_10005060 Ga0207662_100050605 231
666 3300025918 Ga0207662_10040549 Ga0207662_100405492 231
667 3300025918 Ga0207662_10059769 Ga0207662_100597693 231
668 3300025918 Ga0207662_10071042 Ga0207662_100710423 231
669 3300025919 Ga0207657_10084649 Ga0207657_100846492 231
670 3300025920 Ga0207649_10024546 Ga0207649_100245463 231
671 3300025921 Ga0207652_10000427 Ga0207652_1000042737 231
672 3300025921 Ga0207652_10123680 Ga0207652_101236804 231
673 3300025922 Ga0207646_10005737 Ga0207646_100057376 231
674 3300025922 Ga0207646_10032750 Ga0207646_100327505 231
675 3300025922 Ga0207646_10125665 Ga0207646_101256651 231
676 3300025923 Ga0207681_10005504 Ga0207681_100055047 231
677 3300025923 Ga0207681_10679801 Ga0207681_106798011 231
678 3300025924 Ga0207694_10004209 Ga0207694_100042098 231
679 3300025924 Ga0207694_10070744 Ga0207694_100707444 231
680 3300025925 Ga0207650_10000028 Ga0207650_100000287 231
681 3300025925 Ga0207650_10103447 Ga0207650_101034472 231
682 3300025925 Ga0207650_10194481 Ga0207650_101944811 231
683 3300025925 Ga0207650_10304601 Ga0207650_103046012 231
684 3300025925 Ga0207650_10480823 Ga0207650_104808232 231
685 3300025926 Ga0207659_10049731 Ga0207659_100497312 231
686 3300025926 Ga0207659_10293103 Ga0207659_102931032 231
687 3300025927 Ga0207687_10053920 Ga0207687_100539203 231
688 3300025927 Ga0207687_10315948 Ga0207687_103159482 231
689 3300025931 Ga0207644_10003226 Ga0207644_100032266 231
690 3300025931 Ga0207644_10650219 Ga0207644_106502192 231
691 3300025932 Ga0207690_10003154 Ga0207690_100031545 231
692 3300025932 Ga0207690_10930261 Ga0207690_109302611 231
693 3300025933 Ga0207706_10050740 Ga0207706_100507404 231
694 3300025933 Ga0207706_10352273 Ga0207706_103522732 231
695 3300025933 Ga0207706_10388538 Ga0207706_103885381 231
696 3300025933 Ga0207706_10408407 Ga0207706_104084072 231
697 3300025934 Ga0207686_10010563 Ga0207686_100105634 231
698 3300025934 Ga0207686_10121904 Ga0207686_101219043 231
699 3300025935 Ga0207709_10034818 Ga0207709_100348183 231
700 3300025935 Ga0207709_10045264 Ga0207709_100452642 231
701 3300025935 Ga0207709_10053093 Ga0207709_100530932 231
702 3300025935 Ga0207709_10101498 Ga0207709_101014981 231
703 3300025935 Ga0207709_10875139 Ga0207709_108751391 231
704 3300025936 Ga0207670_10002963 Ga0207670_100029635 231
705 3300025937 Ga0207669_10141252 Ga0207669_101412522 231
706 3300025938 Ga0207704_10010523 Ga0207704_100105234 231
707 3300025938 Ga0207704_10566315 Ga0207704_105663151 231
708 3300025939 Ga0207665_10160343 Ga0207665_101603432 231
709 3300025940 Ga0207691_10032538 Ga0207691_100325384 231
710 3300025940 Ga0207691_10201269 Ga0207691_102012692 231
711 3300025941 Ga0207711_10087939 Ga0207711_100879394 231
712 3300025941 Ga0207711_10208116 Ga0207711_102081162 231
713 3300025941 Ga0207711_10217021 Ga0207711_102170212 231
714 3300025941 Ga0207711_10230622 Ga0207711_102306223 231
715 3300025941 Ga0207711_10536294 Ga0207711_105362941 231
716 3300025942 Ga0207689_10037371 Ga0207689_100373713 231
717 3300025942 Ga0207689_10042361 Ga0207689_100423614 231
718 3300025942 Ga0207689_10080358 Ga0207689_100803584 231
719 3300025942 Ga0207689_10131493 Ga0207689_101314932 231
720 3300025942 Ga0207689_10756769 Ga0207689_107567691 231
721 3300025945 Ga0207679_10057001 Ga0207679_100570012 231
722 3300025945 Ga0207679_10397717 Ga0207679_103977172 231
723 3300025945 Ga0207679_10961693 Ga0207679_109616931 231
724 3300025949 Ga0207667_10281602 Ga0207667_102816022 231
725 3300025961 Ga0207712_10020659 Ga0207712_100206593 231
726 3300025961 Ga0207712_10064063 Ga0207712_100640633 231
727 3300025981 Ga0207640_10088859 Ga0207640_100888591 231
728 3300025981 Ga0207640_10451175 Ga0207640_104511752 231
729 3300025986 Ga0207658_10133133 Ga0207658_101331331 231
730 3300026023 Ga0207677_10273050 Ga0207677_102730502 231
731 3300026035 Ga0207703_10080321 Ga0207703_100803215 231
732 3300026035 Ga0207703_10086633 Ga0207703_100866332 231
733 3300026035 Ga0207703_10088339 Ga0207703_100883394 231
734 3300026035 Ga0207703_10411899 Ga0207703_104118991 231
735 3300026041 Ga0207639_10013858 Ga0207639_100138584 231
736 3300026041 Ga0207639_10071514 Ga0207639_100715141 231
737 3300026041 Ga0207639_10132216 Ga0207639_101322161 231
738 3300026041 Ga0207639_10798569 Ga0207639_107985692 231
739 3300026075 Ga0207708_10008557 Ga0207708_100085574 231
740 3300026075 Ga0207708_10011438 Ga0207708_100114384 231
741 3300026075 Ga0207708_10020009 Ga0207708_100200094 231
742 3300026075 Ga0207708_10054210 Ga0207708_100542105 231
743 3300026075 Ga0207708_10185355 Ga0207708_101853552 231
744 3300026075 Ga0207708_10309400 Ga0207708_103094002 231
745 3300026075 Ga0207708_10459200 Ga0207708_104592002 231
746 3300026078 Ga0207702_10003231 Ga0207702_100032318 231
747 3300026088 Ga0207641_10060418 Ga0207641_100604182 231
748 3300026088 Ga0207641_10239501 Ga0207641_102395011 231
749 3300026088 Ga0207641_10538699 Ga0207641_105386992 231
750 3300026088 Ga0207641_10865173 Ga0207641_108651732 231
751 3300026089 Ga0207648_10050189 Ga0207648_100501894 231
752 3300026089 Ga0207648_10052615 Ga0207648_100526155 231
753 3300026089 Ga0207648_10079277 Ga0207648_100792772 231
754 3300026089 Ga0207648_10565020 Ga0207648_105650202 231
755 3300026089 Ga0207648_10705433 Ga0207648_107054331 231
756 3300026095 Ga0207676_10029900 Ga0207676_100299006 231
757 3300026095 Ga0207676_10040297 Ga0207676_100402973 231
758 3300026095 Ga0207676_10044163 Ga0207676_100441636 231
759 3300026095 Ga0207676_10128702 Ga0207676_101287022 231
760 3300026095 Ga0207676_10226274 Ga0207676_102262741 231
761 3300026095 Ga0207676_10748236 Ga0207676_107482362 231
762 3300026116 Ga0207674_10006877 Ga0207674_100068777 231
763 3300026116 Ga0207674_10215525 Ga0207674_102155252 231
764 3300026116 Ga0207674_10781764 Ga0207674_107817642 231
765 3300026118 Ga0207675_100014977 Ga0207675_1000149774 231
766 3300026118 Ga0207675_100017801 Ga0207675_1000178017 231
767 3300026118 Ga0207675_100057101 Ga0207675_1000571012 231
768 3300026118 Ga0207675_100116020 Ga0207675_1001160201 231
769 3300026118 Ga0207675_100215370 Ga0207675_1002153702 231
770 3300026118 Ga0207675_100232587 Ga0207675_1002325872 231
771 3300026118 Ga0207675_100284789 Ga0207675_1002847892 231
772 3300026142 Ga0207698_10267356 Ga0207698_102673562 231
773 3300026142 Ga0207698_10425608 Ga0207698_104256082 231
774 3300026142 Ga0207698_10500083 Ga0207698_105000832 231
775 3300026142 Ga0207698_10741452 Ga0207698_107414522 231
776 3300027907 Ga0207428_10008641 Ga0207428_100086415 231
777 3300027907 Ga0207428_10029137 Ga0207428_100291372 231
778 3300027907 Ga0207428_10291965 Ga0207428_102919652 231
779 3300028380 Ga0268265_10016285 Ga0268265_100162852 231
780 3300028380 Ga0268265_10428950 Ga0268265_104289502 231
781 3300028380 Ga0268265_11026802 Ga0268265_110268021 231
782 3300028381 Ga0268264_10067613 Ga0268264_100676133 231
783 3300028381 Ga0268264_10073195 Ga0268264_100731952 231
784 3300028381 Ga0268264_10073340 Ga0268264_100733402 231
785 3300028381 Ga0268264_10094740 Ga0268264_100947404 231
786 3300028381 Ga0268264_10221688 Ga0268264_102216882 231
787 3300031456 Ga0307513_10006106 Ga0307513_100061068 231
788 3300031548 Ga0307408_100097520 Ga0307408_1000975202 231
789 3300031548 Ga0307408_100218128 Ga0307408_1002181282 231
790 3300031731 Ga0307405_10664672 Ga0307405_106646721 231
791 3300031852 Ga0307410_10460867 Ga0307410_104608672 231
792 3300031903 Ga0307407_10092030 Ga0307407_100920302 231
793 3300031911 Ga0307412_10094052 Ga0307412_100940523 231
794 3300031911 Ga0307412_10162625 Ga0307412_101626251 231
795 3300031995 Ga0307409_100541704 Ga0307409_1005417042 231
796 3300032002 Ga0307416_100169744 Ga0307416_1001697442 231
797 3300032002 Ga0307416_100303153 Ga0307416_1003031532 231
798 3300032005 Ga0307411_10220409 Ga0307411_102204092 231
799 3300032126 Ga0307415_100061990 Ga0307415_1000619902 231
800 3300032126 Ga0307415_100103517 Ga0307415_1001035172 231
801 3300035091 Ga0373951_0003684 Ga0373951_0003684_2690_3385 231
802 3300035115 Ga0373941_0014628 Ga0373941_0014628_1196_1891 231
803 3300035241 Ga0373961_0015753 Ga0373961_0015753_957_1652 231
804 3300037312 Ga0395899_0366668 Ga0395899_0366668_247_942 231
805 3300037418 Ga0395900_0449590 Ga0395900_0449590_158_853 231
806 3300037418 Ga0395900_0701935 Ga0395900_0701935_173_868 231
807 3300037466 Ga0395898_0243037 Ga0395898_0243037_22_717 231
808 3300037466 Ga0395898_0536086 Ga0395898_0536086_371_1066 231
809 3300037471 Ga0395905_0056292 Ga0395905_0056292_817_1512 231
810 3300037471 Ga0395905_0090677 Ga0395905_0090677_1367_2062 231
811 3300037471 Ga0395905_0181892 Ga0395905_0181892_168_863 231
812 3300037853 Ga0436364_0946147 Ga0436364_0946147_340_1035 231
813 3300038443 Ga0395901_0079524 Ga0395901_0079524_888_1583 231
814 3300038443 Ga0395901_0307224 Ga0395901_0307224_482_1177 231
815 3300038443 Ga0395901_0451249 Ga0395901_0451249_130_825 231
816 3300038699 Ga0242422_00217 Ga0242422_00217_681_1376 231
817 3300039437 Ga0436365_0668830 Ga0436365_0668830_3350_4054 231
818 3300039437 Ga0436365_1324789 Ga0436365_1324789_3430_4134 231
819 3300042000 Ga0439437_004698 Ga0439437_004698_27_722 231
820 3300042012 Ga0439455_0024392 Ga0439455_0024392_571_1266 231
821 3300042015 Ga0439462_0018632 Ga0439462_0018632_11_706 231
822 3300044712 Ga0453684_0135319 Ga0453684_0135319_1296_1991 231
823 3300045051 Ga0451576_0042679 Ga0451576_0042679_2662_3357 231
824 3300045051 Ga0451576_0123757 Ga0451576_0123757_795_1490 231
825 3300045051 Ga0451576_0467571 Ga0451576_0467571_528_1223 231
826 3300046476 Ga0495662_0049709 Ga0495662_0049709_80_775 231
827 3300046539 Ga0495621_0035293 Ga0495621_0035293_361_1056 231
828 3300046684 Ga0495669_0209013 Ga0495669_0209013_145_840 231
829 3300046690 Ga0495624_0279216 Ga0495624_0279216_157_852 231
830 3300047320 Ga0495672_0108240 Ga0495672_0108240_592_1287 231
831 3300048903 Ga0496100_0337786 Ga0496100_0337786_179_874 231
832 3300048905 Ga0496102_0219944 Ga0496102_0219944_114_809 231
833 3300048905 Ga0496102_0544190 Ga0496102_0544190_46_741 231
834 3300048906 Ga0496103_0102110 Ga0496103_0102110_625_1320 231
835 3300048907 Ga0496104_0128970 Ga0496104_0128970_911_1606 231
836 3300048907 Ga0496104_0606617 Ga0496104_0606617_280_975 231
837 3300048909 Ga0496106_0123767 Ga0496106_0123767_142_837 231
838 3300048911 Ga0496108_0047160 Ga0496108_0047160_1497_2192 231
839 3300048911 Ga0496108_0108888 Ga0496108_0108888_814_1509 231
840 3300048911 Ga0496108_0220303 Ga0496108_0220303_131_826 231
841 3300048912 Ga0496109_0450319 Ga0496109_0450319_25_720 231
842 3300048913 Ga0496110_0277632 Ga0496110_0277632_41_736 231
843 3300048915 Ga0496112_0706399 Ga0496112_0706399_19_714 231
844 3300048916 Ga0496113_0069556 Ga0496113_0069556_1093_1788 231
845 3300048916 Ga0496113_0620813 Ga0496113_0620813_65_760 231
846 3300049514 Ga0501291_002976 Ga0501291_002976_1119_1814 231
847 3300049515 Ga0501292_008452 Ga0501292_008452_602_1297 231
848 3300049521 Ga0501298_000210 Ga0501298_000210_204_899 231
849 3300049568 Ga0501031_0491202 Ga0501031_0491202_16_711 231
850 3300049572 Ga0501036_0609701 Ga0501036_0609701_65_760 231
851 3300049574 Ga0501038_0039911 Ga0501038_0039911_1318_2013 231
852 3300049575 Ga0501039_0306734 Ga0501039_0306734_391_1086 231
853 3300049580 Ga0501046_0523599 Ga0501046_0523599_27_722 231
854 3300049582 Ga0501048_0172078 Ga0501048_0172078_565_1260 231
855 3300049649 Ga0501198_004864 Ga0501198_004864_175_870 231
856 3300049649 Ga0501198_012550 Ga0501198_012550_206_901 231
857 3300049660 Ga0501216_008119 Ga0501216_008119_36_731 231
858 3300049661 Ga0501217_001526 Ga0501217_001526_3280_3975 231
859 3300049661 Ga0501217_042366 Ga0501217_042366_369_1064 231
860 3300049663 Ga0501223_004673 Ga0501223_004673_286_981 231
861 3300049665 Ga0501227_000676 Ga0501227_000676_4127_4822 231
862 3300049665 Ga0501227_013089 Ga0501227_013089_564_1259 231
863 3300049668 Ga0501233_001251 Ga0501233_001251_88_783 231
864 3300049668 Ga0501233_082490 Ga0501233_082490_78_773 231
865 3300049669 Ga0501235_027812 Ga0501235_027812_326_1021 231
866 3300049673 Ga0501240_007538 Ga0501240_007538_387_1082 231
867 3300049675 Ga0501243_004136 Ga0501243_004136_920_1615 231
868 3300049679 Ga0501249_029095 Ga0501249_029095_28_723 231
869 3300049680 Ga0501250_005082 Ga0501250_005082_618_1313 231
870 3300049686 Ga0501257_048050 Ga0501257_048050_75_770 231
871 3300049689 Ga0501260_005348 Ga0501260_005348_311_1006 231
872 3300049704 Ga0501221_029838 Ga0501221_029838_245_940 231
873 3300049705 Ga0501225_0005103 Ga0501225_0005103_2886_3581 231
874 3300049705 Ga0501225_0008807 Ga0501225_0008807_1045_1740 231
875 3300049705 Ga0501225_0043454 Ga0501225_0043454_529_1224 231
876 3300049706 Ga0501229_005706 Ga0501229_005706_495_1190 231
877 3300049707 Ga0501234_005684 Ga0501234_005684_642_1337 231
878 3300049743 Ga0501081_0217249 Ga0501081_0217249_151_846 231
879 3300049765 Ga0501268_002066 Ga0501268_002066_567_1262 231
880 3300049770 Ga0501273_002856 Ga0501273_002856_957_1652 231
881 3300049779 Ga0501283_000878 Ga0501283_000878_100_795 231
882 3300049824 Ga0501045_0137018 Ga0501045_0137018_608_1303 231
883 3300049851 Ga0501212_005060 Ga0501212_005060_613_1308 231
884 3300049851 Ga0501212_009563 Ga0501212_009563_140_835 231
885 3300050507 nmdc:mga05p37_1016194_c1 nmdc:mga05p37_1016194_c1_87_782 231
886 3300050507 nmdc:mga05p37_128116_c1 nmdc:mga05p37_128116_c1_217_912 231
887 3300050507 nmdc:mga05p37_240436_c1 nmdc:mga05p37_240436_c1_772_1467 231
888 3300050507 nmdc:mga05p37_24636_c1 nmdc:mga05p37_24636_c1_2114_2809 231
889 3300050507 nmdc:mga05p37_400677_c1 nmdc:mga05p37_400677_c1_228_923 231
890 3300050507 nmdc:mga05p37_62370_c1 nmdc:mga05p37_62370_c1_2405_3100 231
891 3300050507 nmdc:mga05p37_9408_c1 nmdc:mga05p37_9408_c1_7183_7878 231
892 3300050508 nmdc:mga09592_290034_c1 nmdc:mga09592_290034_c1_208_903 231
893 3300050508 nmdc:mga09592_490396_c1 nmdc:mga09592_490396_c1_210_905 231
894 3300050509 nmdc:mga0qj67_19355_c1 nmdc:mga0qj67_19355_c1_433_1128 231
895 3300050509 nmdc:mga0qj67_40806_c1 nmdc:mga0qj67_40806_c1_2605_3300 231
896 3300050510 nmdc:mga06r32_1057685_c1 nmdc:mga06r32_1057685_c1_40_735 231
897 3300050510 nmdc:mga06r32_119210_c1 nmdc:mga06r32_119210_c1_441_1136 231
898 3300050510 nmdc:mga06r32_34611_c1 nmdc:mga06r32_34611_c1_620_1315 231
899 3300050510 nmdc:mga06r32_400396_c1 nmdc:mga06r32_400396_c1_260_955 231
900 3300050511 nmdc:mga08y16_257168_c1 nmdc:mga08y16_257168_c1_484_1179 231
901 3300050511 nmdc:mga08y16_512728_c1 nmdc:mga08y16_512728_c1_372_1067 231
902 3300050511 nmdc:mga08y16_55017_c1 nmdc:mga08y16_55017_c1_1839_2534 231
903 3300050512 nmdc:mga0n895_218271_c1 nmdc:mga0n895_218271_c1_947_1642 231
904 3300050512 nmdc:mga0n895_236290_c1 nmdc:mga0n895_236290_c1_364_1059 231
905 3300050512 nmdc:mga0n895_237760_c1 nmdc:mga0n895_237760_c1_264_959 231
906 3300050512 nmdc:mga0n895_534629_c1 nmdc:mga0n895_534629_c1_385_1080 231
907 3300050512 nmdc:mga0n895_94842_c1 nmdc:mga0n895_94842_c1_1732_2427 231
908 3300050513 nmdc:mga0rr50_66420_c1 nmdc:mga0rr50_66420_c1_1377_2072 231
909 3300050513 nmdc:mga0rr50_8964_c1 nmdc:mga0rr50_8964_c1_3663_4358 231
910 3300050514 nmdc:mga08x19_383877_c1 nmdc:mga08x19_383877_c1_40_735 231
911 3300050515 nmdc:mga0a205_149264_c1 nmdc:mga0a205_149264_c1_452_1147 231
912 3300050515 nmdc:mga0a205_22736_c1 nmdc:mga0a205_22736_c1_4280_4975 231
913 3300050515 nmdc:mga0a205_323544_c1 nmdc:mga0a205_323544_c1_490_1185 231
914 3300050515 nmdc:mga0a205_32992_c2 nmdc:mga0a205_32992_c2_1102_1797 231
915 3300050515 nmdc:mga0a205_55769_c1 nmdc:mga0a205_55769_c1_1021_1716 231
916 3300053083 Ga0495655_0004445 Ga0495655_0004445_1075_1770 231
917 3300053153 Ga0500616_0003846 Ga0500616_0003846_8278_8973 231
918 3300054114 Ga0501084_0139680 Ga0501084_0139680_400_1095 231
919 3300059511 Ga0587091_033311 Ga0587091_033311_94_789 231
920 3300059513 Ga0587094_020417 Ga0587094_020417_74_769 231
921 3300061734 Ga0530510_0109649 Ga0530510_0109649_39_734 231

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00687

Ribosomal_L1

Ribosomal protein L1p/L10e family

30

215

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4v9h-assembly1.cif.gz_BC crystal structure of the ribosome bound to elongation factor g in the guanosine triphosphatase state 0.9622 3 225
4v8y-assembly1.cif.gz_CL cryo-em reconstruction of the 80s-eif5b-met-itrnamet eukaryotic translation initiation complex 0.9619 3 225
5npm-assembly1.cif.gz_A crystal structure of mutant ribosomal protein tthl1 lacking 8 n-terminal residues in complex with 80nt 23s rna from thermus thermophilus 0.9616 19 227
4qg3-assembly1.cif.gz_A crystal structure of mutant ribosomal protein g219v tthl1 in complex with 80nt 23s rna from thermus thermophilus 0.9592 3 227
4v5f-assembly1.cif.gz_BC error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9584 3 225
ID Description Score Start End Superfamily
af_Q60E59_194_280_3.40.50.790 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Ribosomal protein L1/L10, domain II 0.9837 74 159 3.40.50.790
af_P9WHC7_16_229_3.30.190.20 Alpha Beta;2-Layer Sandwich;Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase;Ribosomal protein L1/L10, rRNA-binding domain 0.9753 16 228 3.30.190.20
af_I1L5L1_126_340_3.30.190.20 Alpha Beta;2-Layer Sandwich;Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase;Ribosomal protein L1/L10, rRNA-binding domain 0.9692 19 230 3.30.190.20
af_P9WHC7_16_229_3.30.190.20 Alpha Beta;2-Layer Sandwich;Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase;Ribosomal protein L1/L10, rRNA-binding domain 0.9663 16 228 3.30.190.20
af_Q60E59_194_280_3.40.50.790 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Ribosomal protein L1/L10, domain II 0.9617 74 159 3.40.50.790
ID Description Score Start End GO Terms
AF-A0A3D0ZF81-F1-model_v4 Ribosomal protein 0.9824 75 229 GO:0000049
GO:0003735
GO:0006412
GO:0006417
GO:0015934
GO:0019843
AF-A0A7C2WPR6-F1-model_v4 Ribosomal protein 0.9806 66 229 GO:0003735
GO:0006412
GO:0006417
GO:0015934
GO:0019843
AF-A0A523D245-F1-model_v4 Ribosomal protein 0.9803 48 229 GO:0003735
GO:0006412
GO:0006417
GO:0015934
GO:0019843
AF-A0A5B9PBB2-F1-model_v4 Large ribosomal subunit protein uL1 0.9795 1 225 GO:0000049
GO:0003735
GO:0006412
GO:0006417
GO:0015934
GO:0019843
AF-A0A4Q6EU90-F1-model_v4 deleted 0.9786 70 229

Feature Viewer

pLDDT pTM Quality
90.35 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map