F485755

General Info

Members Datasets Scaffolds Average Seq Length
921 296 1842 140

Family's Representative Sequence

Representative Sequence 3300005539|Ga0068853_100904271|Ga0068853_1009042712
Length 159
Sequence MASCAAVIAGSGPRWQASHMSLPPFHLAFPVDDLAAARAFYGDLLGCPEGRSADHWVDFDLHGHQIVAHLAPDAARARAVNPVDGEDVPVPHFGLVLPMDEWKGLAERLTSAGADFVIPPTIRFEGQPGEQATMFLLDPAGNALEFKAMANPANLFAKN

Samples

Sample ID Description Type Environment
1 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
6 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
7 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
8 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
68 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
69 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
70 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
79 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
91 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
92 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
103 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
106 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
108 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
109 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
174 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
175 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
176 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
177 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
178 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
179 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
180 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
181 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
182 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
183 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
184 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
185 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
186 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
187 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
188 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
189 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
190 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
191 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
192 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
193 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
194 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
195 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
196 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
197 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
198 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
199 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
200 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
201 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
202 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
203 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
204 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
205 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
206 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
207 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
208 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
209 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
210 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
211 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
212 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
213 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
214 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
215 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
216 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
217 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
218 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
219 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
220 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
221 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
222 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
223 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
224 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
225 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
226 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
227 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
228 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
229 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
230 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
231 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
232 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
233 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
234 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
235 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
236 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
237 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
238 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
239 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
240 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
241 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
242 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
243 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
244 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
245 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
246 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
247 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
248 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
249 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
250 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
251 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
252 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
253 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
254 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
255 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
256 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
257 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
258 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
259 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
260 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
261 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
262 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
263 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
264 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
265 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
266 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
267 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
268 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
269 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
270 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
271 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
272 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
273 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
274 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
275 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
276 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
277 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
278 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
279 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
280 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
281 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
282 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
283 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
284 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
285 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
286 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
287 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
288 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
289 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
290 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
291 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
292 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
293 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
294 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
295 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
296 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.46
Metatranscriptomes 0.33
Isolates 0.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.87
Nodule 0
Rhizoplane 6.08
Rhizosphere 91.75
Stem 0
Stem Tuber 0
Unclassified 0.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068853_100904271 3300005539 Bacteria 848
2 JGI24752J21851_1004793 3300001976 Bacteria 1770
3 JGI24752J21851_1007122 3300001976 Bacteria 1459
4 JGI24740J21852_10097384 3300001979 Bacteria 752
5 JGI24735J21928_10016411 3300002067 Bacteria 2297
6 JGI24744J21845_10065779 3300002077 Bacteria 662
7 JGI24034J26672_10005295 3300002239 Bacteria 1847
8 JGI24034J26672_10050962 3300002239 Bacteria 712
9 JGI24742J22300_10035664 3300002244 Bacteria 878
10 JGI25160J50197_1063431 3300003354 Bacteria 729
11 Ga0070658_10013180 3300005327 Bacteria 6632
12 Ga0070658_10081031 3300005327 Bacteria 2666
13 Ga0070658_10118946 3300005327 Bacteria 2194
14 Ga0070658_10227225 3300005327 Bacteria 1580
15 Ga0070658_10234253 3300005327 Bacteria 1555
16 Ga0070658_10477311 3300005327 Bacteria 1076
17 Ga0070658_10481859 3300005327 Bacteria 1071
18 Ga0070658_10854487 3300005327 Bacteria 791
19 Ga0070658_10943625 3300005327 Bacteria 750
20 Ga0070658_11157402 3300005327 Bacteria 673
21 Ga0070658_11595437 3300005327 Bacteria 565
22 Ga0070676_10011092 3300005328 Bacteria 4897
23 Ga0070676_10083989 3300005328 Bacteria 1938
24 Ga0070676_10409650 3300005328 Bacteria 945
25 Ga0070683_100031867 3300005329 Bacteria 4796
26 Ga0070683_100349196 3300005329 Bacteria 1409
27 Ga0070670_100001163 3300005331 Bacteria 20894
28 Ga0070670_100002964 3300005331 Bacteria 14060
29 Ga0070670_100054928 3300005331 Bacteria 3419
30 Ga0070670_100563099 3300005331 Bacteria 1017
31 Ga0068869_100058078 3300005334 Bacteria 2827
32 Ga0068869_100107868 3300005334 Bacteria 2115
33 Ga0068869_100237143 3300005334 Bacteria 1452
34 Ga0068869_100834556 3300005334 Bacteria 794
35 Ga0070666_10038142 3300005335 Bacteria 3196
36 Ga0070666_10182555 3300005335 Bacteria 1472
37 Ga0070666_10303627 3300005335 Bacteria 1137
38 Ga0070680_100008836 3300005336 Bacteria 7725
39 Ga0070680_100057207 3300005336 Bacteria 3188
40 Ga0070682_100480755 3300005337 Bacteria 958
41 Ga0070682_100498640 3300005337 Bacteria 943
42 Ga0070682_101155981 3300005337 Bacteria 651
43 Ga0068868_100001497 3300005338 Bacteria 16125
44 Ga0068868_100404195 3300005338 Bacteria 1179
45 Ga0068868_100523865 3300005338 Bacteria 1041
46 Ga0068868_101582934 3300005338 Unclassified 615
47 Ga0070660_100019229 3300005339 Bacteria 5000
48 Ga0070660_100035092 3300005339 Bacteria 3794
49 Ga0070660_100040092 3300005339 Bacteria 3562
50 Ga0070660_100040094 3300005339 Bacteria 3562
51 Ga0070660_100052355 3300005339 Bacteria 3147
52 Ga0070660_100363702 3300005339 Bacteria 1193
53 Ga0070660_100415537 3300005339 Bacteria 1113
54 Ga0070660_100450432 3300005339 Bacteria 1068
55 Ga0070660_100555193 3300005339 Unclassified 958
56 Ga0070660_100977397 3300005339 Bacteria 715
57 Ga0070660_101620357 3300005339 Bacteria 551
58 Ga0070687_100888591 3300005343 Bacteria 638
59 Ga0070661_100006747 3300005344 Bacteria 7915
60 Ga0070661_100044766 3300005344 Bacteria 3234
61 Ga0070661_100065230 3300005344 Bacteria 2675
62 Ga0070661_100067628 3300005344 Bacteria 2625
63 Ga0070661_100082362 3300005344 Bacteria 2376
64 Ga0070661_100083636 3300005344 Bacteria 2358
65 Ga0070661_100096016 3300005344 Bacteria 2199
66 Ga0070661_100570826 3300005344 Bacteria 912
67 Ga0070692_10001380 3300005345 Bacteria 8775
68 Ga0070692_10031380 3300005345 Bacteria 2663
69 Ga0070692_10296358 3300005345 Bacteria 986
70 Ga0070668_100004615 3300005347 Bacteria 10206
71 Ga0070668_100272882 3300005347 Bacteria 1410
72 Ga0070669_100045317 3300005353 Bacteria 3205
73 Ga0070669_100237490 3300005353 Bacteria 1447
74 Ga0070669_100238001 3300005353 Bacteria 1445
75 Ga0070669_100342088 3300005353 Bacteria 1212
76 Ga0070675_100016044 3300005354 Bacteria 5935
77 Ga0070675_100953311 3300005354 Bacteria 787
78 Ga0070671_100000793 3300005355 Bacteria 22759
79 Ga0070671_100000972 3300005355 Bacteria 20998
80 Ga0070671_100001688 3300005355 Bacteria 16743
81 Ga0070671_100003799 3300005355 Bacteria 11849
82 Ga0070671_100047523 3300005355 Bacteria 3569
83 Ga0070671_100050352 3300005355 Bacteria 3464
84 Ga0070671_100070534 3300005355 Bacteria 2915
85 Ga0070671_100117051 3300005355 Bacteria 2241
86 Ga0070671_100437947 3300005355 Bacteria 1120
87 Ga0070671_100852323 3300005355 Bacteria 795
88 Ga0070674_100011719 3300005356 Bacteria 5348
89 Ga0070674_100830581 3300005356 Bacteria 800
90 Ga0070673_100001888 3300005364 Bacteria 12565
91 Ga0070673_100002090 3300005364 Bacteria 12058
92 Ga0070673_100056133 3300005364 Bacteria 3106
93 Ga0070673_100071289 3300005364 Bacteria 2792
94 Ga0070673_100275887 3300005364 Bacteria 1473
95 Ga0070659_100014473 3300005366 Bacteria 5895
96 Ga0070659_100187166 3300005366 Bacteria 1701
97 Ga0070659_100205527 3300005366 Bacteria 1622
98 Ga0070659_100324837 3300005366 Bacteria 1287
99 Ga0070659_101142207 3300005366 Bacteria 687
100 Ga0070667_100004185 3300005367 Bacteria 12182
101 Ga0070667_100018962 3300005367 Bacteria 5704
102 Ga0070667_100046858 3300005367 Bacteria 3637
103 Ga0070667_100057375 3300005367 Bacteria 3291
104 Ga0070667_100064947 3300005367 Bacteria 3098
105 Ga0070667_100099818 3300005367 Bacteria 2506
106 Ga0070667_100109834 3300005367 Bacteria 2390
107 Ga0070667_100122712 3300005367 Bacteria 2261
108 Ga0070667_100146930 3300005367 Bacteria 2068
109 Ga0070667_100226212 3300005367 Bacteria 1667
110 Ga0070667_100229204 3300005367 Bacteria 1656
111 Ga0070667_100258291 3300005367 Bacteria 1559
112 Ga0070709_10047051 3300005434 Bacteria 2686
113 Ga0070714_100279712 3300005435 Bacteria 1550
114 Ga0070714_100360054 3300005435 Bacteria 1368
115 Ga0070713_100047407 3300005436 Bacteria 3531
116 Ga0070710_10285555 3300005437 Bacteria 1072
117 Ga0070711_100644312 3300005439 Bacteria 888
118 Ga0070708_100038518 3300005445 Bacteria 4177
119 Ga0070663_100005204 3300005455 Bacteria 7702
120 Ga0070663_100053013 3300005455 Bacteria 2895
121 Ga0070663_101403541 3300005455 Bacteria 618
122 Ga0070678_100002943 3300005456 Bacteria 9437
123 Ga0070678_100004841 3300005456 Bacteria 7690
124 Ga0070678_100012599 3300005456 Bacteria 5266
125 Ga0070678_100068315 3300005456 Bacteria 2649
126 Ga0070662_100008474 3300005457 Bacteria 6707
127 Ga0070662_100048845 3300005457 Bacteria 3050
128 Ga0070662_100171071 3300005457 Bacteria 1706
129 Ga0070662_100455958 3300005457 Bacteria 1062
130 Ga0070681_10007172 3300005458 Bacteria 10857
131 Ga0070681_10012441 3300005458 Bacteria 8442
132 Ga0070681_10075087 3300005458 Bacteria 3340
133 Ga0070681_11000886 3300005458 Bacteria 756
134 Ga0070681_11163130 3300005458 Bacteria 693
135 Ga0068867_100001732 3300005459 Bacteria 15201
136 Ga0068867_100554174 3300005459 Bacteria 996
137 Ga0068867_100931174 3300005459 Bacteria 784
138 Ga0068867_100956417 3300005459 Bacteria 774
139 Ga0070685_10198009 3300005466 Bacteria 1304
140 Ga0070685_10275000 3300005466 Bacteria 1125
141 Ga0070706_100519884 3300005467 Unclassified 1107
142 Ga0070698_100000765 3300005471 Bacteria 34807
143 Ga0070699_100000262 3300005518 Bacteria 50713
144 Ga0070699_101130955 3300005518 Bacteria 718
145 Ga0070679_100039042 3300005530 Bacteria 4719
146 Ga0070679_100177372 3300005530 Bacteria 2103
147 Ga0070679_100238249 3300005530 Bacteria 1778
148 Ga0070679_100989454 3300005530 Bacteria 785
149 Ga0070679_101362097 3300005530 Bacteria 655
150 Ga0070684_100221559 3300005535 Bacteria 1726
151 Ga0070684_100590815 3300005535 Bacteria 1032
152 Ga0070684_101806113 3300005535 Bacteria 577
153 Ga0068853_100091617 3300005539 Bacteria 2674
154 Ga0068853_100398968 3300005539 Bacteria 1287
155 Ga0070672_100005547 3300005543 Bacteria 8380
156 Ga0070672_100023744 3300005543 Bacteria 4524
157 Ga0070672_100150736 3300005543 Bacteria 1923
158 Ga0070672_100293052 3300005543 Bacteria 1378
159 Ga0070672_100345464 3300005543 Bacteria 1268
160 Ga0070672_100486428 3300005543 Bacteria 1066
161 Ga0070686_100775173 3300005544 Bacteria 771
162 Ga0070696_100293323 3300005546 Bacteria 1243
163 Ga0070696_100524023 3300005546 Bacteria 946
164 Ga0070693_100253015 3300005547 Bacteria 1168
165 Ga0070665_100000910 3300005548 Bacteria 37961
166 Ga0070665_100006465 3300005548 Bacteria 11928
167 Ga0070665_100015898 3300005548 Bacteria 7553
168 Ga0070665_100029794 3300005548 Bacteria 5492
169 Ga0070665_100513320 3300005548 Bacteria 1210
170 Ga0070665_100691402 3300005548 Bacteria 1033
171 Ga0070665_100804877 3300005548 Bacteria 953
172 Ga0070665_102117481 3300005548 Bacteria 567
173 Ga0068855_100077678 3300005563 Bacteria 3852
174 Ga0068855_100169174 3300005563 Bacteria 2476
175 Ga0068855_100263200 3300005563 Bacteria 1920
176 Ga0068855_100478391 3300005563 Bacteria 1356
177 Ga0070664_100022597 3300005564 Bacteria 5186
178 Ga0070664_100030779 3300005564 Bacteria 4479
179 Ga0070664_100033797 3300005564 Bacteria 4286
180 Ga0070664_100071617 3300005564 Bacteria 2971
181 Ga0070664_100241639 3300005564 Bacteria 1621
182 Ga0070664_100348749 3300005564 Bacteria 1346
183 Ga0070664_100615438 3300005564 Bacteria 1008
184 Ga0070664_100735661 3300005564 Unclassified 920
185 Ga0068857_100071098 3300005577 Bacteria 3100
186 Ga0068857_100127102 3300005577 Bacteria 2297
187 Ga0068857_100278068 3300005577 Bacteria 1539
188 Ga0068857_100513591 3300005577 Bacteria 1125
189 Ga0068857_101442493 3300005577 Bacteria 670
190 Ga0068857_101604778 3300005577 Bacteria 635
191 Ga0068854_100032959 3300005578 Bacteria 3609
192 Ga0068854_100185633 3300005578 Bacteria 1627
193 Ga0068854_100424761 3300005578 Bacteria 1105
194 Ga0068854_100917100 3300005578 Bacteria 771
195 Ga0068854_101218395 3300005578 Bacteria 675
196 Ga0068854_101375052 3300005578 Bacteria 637
197 Ga0068854_101903053 3300005578 Bacteria 547
198 Ga0068856_100051602 3300005614 Bacteria 4055
199 Ga0068856_100115287 3300005614 Bacteria 2686
200 Ga0068856_100147268 3300005614 Bacteria 2362
201 Ga0068856_100220283 3300005614 Bacteria 1913
202 Ga0068856_100265503 3300005614 Bacteria 1732
203 Ga0068856_100444262 3300005614 Bacteria 1317
204 Ga0068856_100969463 3300005614 Bacteria 869
205 Ga0068856_101419611 3300005614 Bacteria 708
206 Ga0068856_101548305 3300005614 Bacteria 676
207 Ga0068856_102066822 3300005614 Bacteria 580
208 Ga0068852_100062874 3300005616 Bacteria 3230
209 Ga0068852_100116363 3300005616 Bacteria 2439
210 Ga0068852_100152098 3300005616 Bacteria 2153
211 Ga0068852_100289640 3300005616 Bacteria 1581
212 Ga0068852_100318979 3300005616 Bacteria 1509
213 Ga0068859_100006261 3300005617 Bacteria 12072
214 Ga0068859_100146583 3300005617 Bacteria 2436
215 Ga0068859_100187986 3300005617 Bacteria 2149
216 Ga0068859_100578651 3300005617 Bacteria 1216
217 Ga0068859_101916153 3300005617 Bacteria 654
218 Ga0068864_100000986 3300005618 Bacteria 23851
219 Ga0068864_100001733 3300005618 Bacteria 17945
220 Ga0068864_100052318 3300005618 Bacteria 3519
221 Ga0068864_100062287 3300005618 Bacteria 3232
222 Ga0068864_100249505 3300005618 Bacteria 1647
223 Ga0068864_100263194 3300005618 Bacteria 1605
224 Ga0068861_100091162 3300005719 Bacteria 2406
225 Ga0068851_10485090 3300005834 Bacteria 739
226 Ga0068870_10791194 3300005840 Bacteria 662
227 Ga0068863_100002990 3300005841 Bacteria 16711
228 Ga0068863_100013454 3300005841 Bacteria 7891
229 Ga0068863_100034884 3300005841 Bacteria 4792
230 Ga0068863_100043383 3300005841 Bacteria 4270
231 Ga0068863_100111729 3300005841 Bacteria 2602
232 Ga0068863_100130988 3300005841 Bacteria 2395
233 Ga0068863_100157108 3300005841 Bacteria 2177
234 Ga0068863_100216037 3300005841 Bacteria 1847
235 Ga0068858_100001162 3300005842 Bacteria 27292
236 Ga0068858_100023008 3300005842 Bacteria 5811
237 Ga0068858_100076107 3300005842 Bacteria 3117
238 Ga0068858_100430246 3300005842 Bacteria 1270
239 Ga0068860_100009071 3300005843 Bacteria 9899
240 Ga0068860_100135411 3300005843 Bacteria 2365
241 Ga0068860_100557543 3300005843 Bacteria 1148
242 Ga0068860_100674349 3300005843 Bacteria 1042
243 Ga0068862_100054449 3300005844 Bacteria 3426
244 Ga0068862_100069918 3300005844 Bacteria 3030
245 Ga0068862_100078348 3300005844 Bacteria 2863
246 Ga0068862_100091265 3300005844 Bacteria 2653
247 Ga0068862_100320412 3300005844 Bacteria 1431
248 Ga0068862_100527239 3300005844 Bacteria 1125
249 Ga0081455_10542772 3300005937 Bacteria 771
250 Ga0070717_10079203 3300006028 Bacteria 2755
251 Ga0070716_100037550 3300006173 Bacteria 2678
252 Ga0070712_100036743 3300006175 Bacteria 3335
253 Ga0097621_100029577 3300006237 Bacteria 4328
254 Ga0097621_100074775 3300006237 Bacteria 2806
255 Ga0097621_100117517 3300006237 Bacteria 2253
256 Ga0068871_100009975 3300006358 Bacteria 6902
257 Ga0068871_100010746 3300006358 Bacteria 6695
258 Ga0068871_100478252 3300006358 Bacteria 1120
259 Ga0068871_100631193 3300006358 Bacteria 976
260 Ga0075428_101218564 3300006844 Bacteria 793
261 Ga0075434_100365116 3300006871 Bacteria 1465
262 Ga0075434_100980505 3300006871 Bacteria 859
263 Ga0068865_100021433 3300006881 Bacteria 4201
264 Ga0068865_100946878 3300006881 Bacteria 751
265 Ga0097620_100006262 3300006931 Bacteria 12072
266 Ga0097620_100146585 3300006931 Bacteria 2436
267 Ga0097620_100187983 3300006931 Bacteria 2149
268 Ga0097620_100578661 3300006931 Bacteria 1216
269 Ga0097620_101916242 3300006931 Bacteria 654
270 Ga0075435_100231040 3300007076 Bacteria 1571
271 Ga0075435_100801937 3300007076 Bacteria 820
272 Ga0105251_10000335 3300009011 Bacteria 47275
273 Ga0105244_10041105 3300009036 Bacteria 2397
274 Ga0105240_10011987 3300009093 Bacteria 12015
275 Ga0105240_10283880 3300009093 Bacteria 1901
276 Ga0105240_10625910 3300009093 Bacteria 1182
277 Ga0105240_10739741 3300009093 Bacteria 1070
278 Ga0105245_10602294 3300009098 Bacteria 1125
279 Ga0105247_10098395 3300009101 Bacteria 1867
280 Ga0114129_10507908 3300009147 Bacteria 1573
281 Ga0105243_10524966 3300009148 Bacteria 1126
282 Ga0105248_10003466 3300009177 Bacteria 17517
283 Ga0105248_10005736 3300009177 Bacteria 13632
284 Ga0105248_10005810 3300009177 Bacteria 13563
285 Ga0105248_10010048 3300009177 Bacteria 10423
286 Ga0105248_10018337 3300009177 Bacteria 7729
287 Ga0105248_10046857 3300009177 Bacteria 4847
288 Ga0105248_10139020 3300009177 Bacteria 2740
289 Ga0105248_10560192 3300009177 Bacteria 1289
290 Ga0105248_11202775 3300009177 Bacteria 857
291 Ga0105237_10084279 3300009545 Bacteria 3169
292 Ga0105237_10095600 3300009545 Bacteria 2961
293 Ga0105238_10081861 3300009551 Bacteria 3218
294 Ga0105249_10026756 3300009553 Bacteria 5202
295 Ga0105249_10499818 3300009553 Bacteria 1261
296 Ga0105239_10036916 3300010375 Bacteria 5360
297 Ga0105239_10588285 3300010375 Bacteria 1269
298 Ga0157373_10051882 3300013100 Bacteria 2920
299 Ga0157373_10062223 3300013100 Bacteria 2643
300 Ga0157373_10204862 3300013100 Bacteria 1391
301 Ga0157373_10268022 3300013100 Bacteria 1209
302 Ga0157373_10369852 3300013100 Bacteria 1024
303 Ga0157373_10679891 3300013100 Bacteria 753
304 Ga0157371_10034078 3300013102 Bacteria 3655
305 Ga0157371_10056506 3300013102 Bacteria 2784
306 Ga0157371_10131204 3300013102 Bacteria 1783
307 Ga0157371_10578626 3300013102 Bacteria 834
308 Ga0157370_10004637 3300013104 Bacteria 15715
309 Ga0157370_10042447 3300013104 Bacteria 4383
310 Ga0157370_10045732 3300013104 Bacteria 4199
311 Ga0157370_10408066 3300013104 Bacteria 1250
312 Ga0157370_10473031 3300013104 Bacteria 1152
313 Ga0157370_10717333 3300013104 Bacteria 912
314 Ga0157370_10718712 3300013104 Bacteria 911
315 Ga0157369_10051621 3300013105 Bacteria 4450
316 Ga0157369_10119233 3300013105 Bacteria 2800
317 Ga0157369_10280709 3300013105 Bacteria 1735
318 Ga0157369_10490324 3300013105 Bacteria 1271
319 Ga0157369_11968818 3300013105 Bacteria 593
320 Ga0157374_10010518 3300013296 Bacteria 7963
321 Ga0157374_10034304 3300013296 Bacteria 4633
322 Ga0157374_10043422 3300013296 Bacteria 4153
323 Ga0157374_10056847 3300013296 Bacteria 3653
324 Ga0157374_10121830 3300013296 Bacteria 2518
325 Ga0157378_10099823 3300013297 Bacteria 2649
326 Ga0157378_11573712 3300013297 Bacteria 703
327 Ga0163162_10104497 3300013306 Bacteria 2927
328 Ga0163162_10225459 3300013306 Bacteria 2004
329 Ga0163162_10249498 3300013306 Bacteria 1907
330 Ga0157372_10351270 3300013307 Bacteria 1718
331 Ga0157372_11073215 3300013307 Bacteria 932
332 Ga0157372_11277098 3300013307 Bacteria 847
333 Ga0157372_11444181 3300013307 Bacteria 793
334 Ga0157372_12783341 3300013307 Bacteria 561
335 Ga0157375_10002274 3300013308 Bacteria 16621
336 Ga0157375_10054662 3300013308 Bacteria 3933
337 Ga0157375_10114727 3300013308 Bacteria 2796
338 Ga0157375_10338089 3300013308 Bacteria 1671
339 Ga0157375_10559329 3300013308 Bacteria 1305
340 Ga0157375_11546363 3300013308 Bacteria 784
341 Ga0163163_10002274 3300014325 Bacteria 16195
342 Ga0163163_10109737 3300014325 Bacteria 2786
343 Ga0163163_10184828 3300014325 Bacteria 2132
344 Ga0182008_10740426 3300014497 Bacteria 565
345 Ga0157379_10005800 3300014968 Bacteria 10625
346 Ga0157379_10029978 3300014968 Bacteria 4838
347 Ga0157379_11620938 3300014968 Bacteria 632
348 Ga0157376_10901032 3300014969 Bacteria 902
349 Ga0206354_10676054 3300020081 Bacteria 2381
350 Ga0206353_10949703 3300020082 Bacteria 606
351 Ga0206353_11092190 3300020082 Bacteria 3339
352 Ga0213875_10007660 3300021388 Bacteria 5563
353 Ga0209674_108227 3300025226 Bacteria 1250
354 Ga0209758_1072672 3300025297 Bacteria 1075
355 Ga0207426_1011249 3300025302 Bacteria 3423
356 Ga0207697_10028269 3300025315 Bacteria 2293
357 Ga0207697_10094868 3300025315 Bacteria 1267
358 Ga0207656_10392721 3300025321 Bacteria 696
359 Ga0207655_1047734 3300025728 Bacteria 1764
360 Ga0207713_1009674 3300025735 Bacteria 5405
361 Ga0207682_10028810 3300025893 Bacteria 2218
362 Ga0207642_10067678 3300025899 Bacteria 1687
363 Ga0207688_10045821 3300025901 Bacteria 2440
364 Ga0207688_10081008 3300025901 Bacteria 1854
365 Ga0207688_10098892 3300025901 Bacteria 1683
366 Ga0207680_10002741 3300025903 Bacteria 8243
367 Ga0207680_10089398 3300025903 Bacteria 1955
368 Ga0207680_10226717 3300025903 Bacteria 1283
369 Ga0207680_11062527 3300025903 Bacteria 579
370 Ga0207647_10022449 3300025904 Bacteria 4191
371 Ga0207647_10029330 3300025904 Bacteria 3562
372 Ga0207647_10032655 3300025904 Bacteria 3341
373 Ga0207647_10191922 3300025904 Bacteria 1183
374 Ga0207699_10011896 3300025906 Bacteria 4411
375 Ga0207645_10016942 3300025907 Bacteria 4814
376 Ga0207645_10066063 3300025907 Bacteria 2312
377 Ga0207645_10544325 3300025907 Bacteria 787
378 Ga0207643_10438238 3300025908 Bacteria 830
379 Ga0207643_10604646 3300025908 Bacteria 706
380 Ga0207705_10001651 3300025909 Bacteria 17706
381 Ga0207705_10001757 3300025909 Bacteria 17137
382 Ga0207705_10004973 3300025909 Bacteria 9971
383 Ga0207705_10042223 3300025909 Bacteria 3274
384 Ga0207705_10055454 3300025909 Bacteria 2857
385 Ga0207705_10071498 3300025909 Bacteria 2515
386 Ga0207705_10113058 3300025909 Bacteria 2008
387 Ga0207705_10129904 3300025909 Bacteria 1874
388 Ga0207705_10231934 3300025909 Bacteria 1404
389 Ga0207684_10409557 3300025910 Unclassified 1165
390 Ga0207707_10008599 3300025912 Bacteria 8851
391 Ga0207707_10221444 3300025912 Bacteria 1647
392 Ga0207695_10003622 3300025913 Bacteria 21591
393 Ga0207695_10009386 3300025913 Bacteria 12100
394 Ga0207695_10019656 3300025913 Bacteria 7769
395 Ga0207695_10278208 3300025913 Bacteria 1568
396 Ga0207695_10971820 3300025913 Bacteria 729
397 Ga0207671_10027149 3300025914 Bacteria 4281
398 Ga0207671_10106232 3300025914 Bacteria 2131
399 Ga0207671_10250314 3300025914 Bacteria 1393
400 Ga0207693_10747288 3300025915 Bacteria 756
401 Ga0207663_10404391 3300025916 Bacteria 1045
402 Ga0207660_10000716 3300025917 Bacteria 22075
403 Ga0207660_10280967 3300025917 Bacteria 1321
404 Ga0207662_10071205 3300025918 Bacteria 2105
405 Ga0207662_10324804 3300025918 Bacteria 1028
406 Ga0207657_10001862 3300025919 Bacteria 22804
407 Ga0207657_10004412 3300025919 Bacteria 14886
408 Ga0207657_10005407 3300025919 Bacteria 13349
409 Ga0207657_10028803 3300025919 Bacteria 5060
410 Ga0207657_10036733 3300025919 Bacteria 4382
411 Ga0207657_10221157 3300025919 Bacteria 1517
412 Ga0207657_10389503 3300025919 Bacteria 1097
413 Ga0207657_10468509 3300025919 Bacteria 988
414 Ga0207657_10549443 3300025919 Bacteria 903
415 Ga0207657_10826782 3300025919 Bacteria 715
416 Ga0207649_10001822 3300025920 Bacteria 12167
417 Ga0207649_10008665 3300025920 Bacteria 5555
418 Ga0207649_10014331 3300025920 Bacteria 4437
419 Ga0207649_10357427 3300025920 Bacteria 1083
420 Ga0207649_10410283 3300025920 Bacteria 1015
421 Ga0207649_10510108 3300025920 Bacteria 916
422 Ga0207649_10522405 3300025920 Bacteria 905
423 Ga0207649_10663312 3300025920 Bacteria 807
424 Ga0207649_11014775 3300025920 Bacteria 653
425 Ga0207652_10020028 3300025921 Bacteria 5509
426 Ga0207652_10037712 3300025921 Bacteria 4091
427 Ga0207652_10078754 3300025921 Bacteria 2878
428 Ga0207652_10262857 3300025921 Bacteria 1557
429 Ga0207652_10714454 3300025921 Bacteria 893
430 Ga0207652_11386066 3300025921 Bacteria 606
431 Ga0207652_11530504 3300025921 Bacteria 571
432 Ga0207681_10012329 3300025923 Bacteria 5273
433 Ga0207681_11107598 3300025923 Bacteria 665
434 Ga0207694_10037860 3300025924 Bacteria 3707
435 Ga0207694_10048560 3300025924 Bacteria 3284
436 Ga0207694_10498587 3300025924 Bacteria 1019
437 Ga0207694_10766967 3300025924 Bacteria 814
438 Ga0207650_10046961 3300025925 Bacteria 3180
439 Ga0207650_10172339 3300025925 Bacteria 1720
440 Ga0207650_10634807 3300025925 Bacteria 900
441 Ga0207650_11303922 3300025925 Bacteria 618
442 Ga0207659_10788963 3300025926 Bacteria 816
443 Ga0207687_10359969 3300025927 Bacteria 1187
444 Ga0207700_10009950 3300025928 Bacteria 5971
445 Ga0207664_10100613 3300025929 Bacteria 2387
446 Ga0207664_10279346 3300025929 Bacteria 1465
447 Ga0207644_10000151 3300025931 Bacteria 49728
448 Ga0207644_10000649 3300025931 Bacteria 21990
449 Ga0207644_10001389 3300025931 Bacteria 15624
450 Ga0207644_10004701 3300025931 Bacteria 8871
451 Ga0207644_10021169 3300025931 Bacteria 4427
452 Ga0207644_10030859 3300025931 Bacteria 3730
453 Ga0207644_10100570 3300025931 Bacteria 2171
454 Ga0207644_10559982 3300025931 Bacteria 947
455 Ga0207644_10830715 3300025931 Bacteria 773
456 Ga0207690_10018310 3300025932 Bacteria 4294
457 Ga0207690_10052211 3300025932 Bacteria 2737
458 Ga0207690_10064432 3300025932 Bacteria 2502
459 Ga0207690_10200996 3300025932 Bacteria 1513
460 Ga0207690_10805982 3300025932 Bacteria 776
461 Ga0207706_10004393 3300025933 Bacteria 13254
462 Ga0207706_10069237 3300025933 Bacteria 3104
463 Ga0207706_10132039 3300025933 Bacteria 2196
464 Ga0207706_10181350 3300025933 Bacteria 1849
465 Ga0207706_10288268 3300025933 Bacteria 1431
466 Ga0207706_11033272 3300025933 Bacteria 689
467 Ga0207669_10026990 3300025937 Bacteria 3134
468 Ga0207669_10072719 3300025937 Bacteria 2166
469 Ga0207669_10767828 3300025937 Bacteria 797
470 Ga0207665_10069898 3300025939 Bacteria 2395
471 Ga0207691_10001996 3300025940 Bacteria 19962
472 Ga0207691_10026345 3300025940 Bacteria 5457
473 Ga0207691_10029225 3300025940 Bacteria 5156
474 Ga0207691_10066394 3300025940 Bacteria 3264
475 Ga0207691_10301192 3300025940 Bacteria 1377
476 Ga0207691_10473289 3300025940 Bacteria 1065
477 Ga0207691_11053579 3300025940 Bacteria 678
478 Ga0207711_10000665 3300025941 Bacteria 34189
479 Ga0207711_10001841 3300025941 Bacteria 19341
480 Ga0207711_10003496 3300025941 Bacteria 13599
481 Ga0207711_10037093 3300025941 Bacteria 4138
482 Ga0207711_10052553 3300025941 Bacteria 3492
483 Ga0207711_10057003 3300025941 Bacteria 3358
484 Ga0207711_10083753 3300025941 Bacteria 2790
485 Ga0207711_10140678 3300025941 Bacteria 2171
486 Ga0207711_10464874 3300025941 Bacteria 1178
487 Ga0207689_10104873 3300025942 Bacteria 2323
488 Ga0207689_10260218 3300025942 Bacteria 1435
489 Ga0207661_10080700 3300025944 Bacteria 2685
490 Ga0207661_10149882 3300025944 Bacteria 2015
491 Ga0207661_10452092 3300025944 Bacteria 1170
492 Ga0207679_10033704 3300025945 Bacteria 3606
493 Ga0207679_10047680 3300025945 Bacteria 3114
494 Ga0207679_10091447 3300025945 Bacteria 2355
495 Ga0207679_10103374 3300025945 Bacteria 2232
496 Ga0207679_10318946 3300025945 Bacteria 1345
497 Ga0207679_10800828 3300025945 Bacteria 859
498 Ga0207679_11446791 3300025945 Bacteria 630
499 Ga0207667_10002838 3300025949 Bacteria 21514
500 Ga0207667_10102503 3300025949 Bacteria 2952
501 Ga0207667_10170865 3300025949 Bacteria 2234
502 Ga0207667_10219579 3300025949 Bacteria 1948
503 Ga0207667_10309834 3300025949 Bacteria 1613
504 Ga0207667_10373513 3300025949 Bacteria 1453
505 Ga0207667_10377703 3300025949 Bacteria 1444
506 Ga0207667_10568249 3300025949 Bacteria 1146
507 Ga0207667_10584366 3300025949 Bacteria 1127
508 Ga0207651_10003650 3300025960 Bacteria 7592
509 Ga0207651_10007905 3300025960 Bacteria 5697
510 Ga0207651_10110897 3300025960 Bacteria 2059
511 Ga0207651_10164399 3300025960 Bacteria 1743
512 Ga0207651_10243868 3300025960 Bacteria 1466
513 Ga0207668_10000173 3300025972 Bacteria 44042
514 Ga0207668_10500359 3300025972 Bacteria 1045
515 Ga0207668_10966172 3300025972 Bacteria 760
516 Ga0207640_10048934 3300025981 Bacteria 2735
517 Ga0207640_10394456 3300025981 Bacteria 1125
518 Ga0207658_10004820 3300025986 Bacteria 9331
519 Ga0207658_10006623 3300025986 Bacteria 7892
520 Ga0207658_10007841 3300025986 Bacteria 7270
521 Ga0207658_10022630 3300025986 Bacteria 4378
522 Ga0207658_10033351 3300025986 Bacteria 3673
523 Ga0207658_10071181 3300025986 Bacteria 2633
524 Ga0207658_10090608 3300025986 Bacteria 2370
525 Ga0207658_10113431 3300025986 Bacteria 2147
526 Ga0207658_10127338 3300025986 Bacteria 2040
527 Ga0207658_10155469 3300025986 Bacteria 1868
528 Ga0207658_10225291 3300025986 Bacteria 1579
529 Ga0207658_10672646 3300025986 Bacteria 934
530 Ga0207677_10003316 3300026023 Bacteria 8519
531 Ga0207677_10084645 3300026023 Bacteria 2286
532 Ga0207677_10553412 3300026023 Bacteria 1003
533 Ga0207677_10901826 3300026023 Bacteria 797
534 Ga0207703_10011355 3300026035 Bacteria 6930
535 Ga0207703_10018273 3300026035 Bacteria 5475
536 Ga0207703_10111851 3300026035 Bacteria 2332
537 Ga0207703_10188157 3300026035 Bacteria 1826
538 Ga0207703_10604042 3300026035 Bacteria 1038
539 Ga0207639_10006754 3300026041 Bacteria 7806
540 Ga0207639_10195051 3300026041 Bacteria 1733
541 Ga0207639_10348219 3300026041 Bacteria 1323
542 Ga0207639_10567008 3300026041 Bacteria 1044
543 Ga0207678_10003157 3300026067 Bacteria 14905
544 Ga0207678_10068962 3300026067 Bacteria 3033
545 Ga0207678_10144526 3300026067 Bacteria 2030
546 Ga0207702_10026932 3300026078 Bacteria 4774
547 Ga0207702_10058374 3300026078 Bacteria 3284
548 Ga0207702_10097301 3300026078 Bacteria 2590
549 Ga0207702_10160670 3300026078 Bacteria 2052
550 Ga0207702_10265610 3300026078 Bacteria 1617
551 Ga0207702_10451189 3300026078 Bacteria 1248
552 Ga0207702_10514984 3300026078 Bacteria 1167
553 Ga0207702_11283895 3300026078 Bacteria 726
554 Ga0207702_11508894 3300026078 Bacteria 666
555 Ga0207641_10000761 3300026088 Bacteria 34699
556 Ga0207641_10004390 3300026088 Bacteria 12225
557 Ga0207641_10036841 3300026088 Bacteria 4083
558 Ga0207641_10055173 3300026088 Bacteria 3373
559 Ga0207641_10155161 3300026088 Bacteria 2076
560 Ga0207641_10197593 3300026088 Bacteria 1852
561 Ga0207641_10814286 3300026088 Bacteria 924
562 Ga0207648_10011142 3300026089 Bacteria 8483
563 Ga0207648_10898006 3300026089 Bacteria 828
564 Ga0207676_10001742 3300026095 Bacteria 15995
565 Ga0207676_10006122 3300026095 Bacteria 8494
566 Ga0207676_10052846 3300026095 Bacteria 3178
567 Ga0207676_10537512 3300026095 Bacteria 1115
568 Ga0207676_11152192 3300026095 Bacteria 767
569 Ga0207674_10000780 3300026116 Bacteria 41514
570 Ga0207674_10017182 3300026116 Bacteria 7896
571 Ga0207674_10051387 3300026116 Bacteria 4206
572 Ga0207674_10141174 3300026116 Bacteria 2368
573 Ga0207674_11309866 3300026116 Bacteria 694
574 Ga0207675_100410585 3300026118 Bacteria 1336
575 Ga0207675_100789859 3300026118 Bacteria 962
576 Ga0207683_10001537 3300026121 Bacteria 20804
577 Ga0207683_10026854 3300026121 Bacteria 4973
578 Ga0207683_10029747 3300026121 Bacteria 4730
579 Ga0207683_10055457 3300026121 Bacteria 3475
580 Ga0207698_10001098 3300026142 Bacteria 15752
581 Ga0207698_10002330 3300026142 Bacteria 11245
582 Ga0207698_10060309 3300026142 Bacteria 2950
583 Ga0207698_10112608 3300026142 Bacteria 2284
584 Ga0207698_10219926 3300026142 Bacteria 1715
585 Ga0207698_10306042 3300026142 Bacteria 1482
586 Ga0207698_11132332 3300026142 Bacteria 796
587 Ga0207698_12100698 3300026142 Bacteria 578
588 Ga0209983_1010376 3300027665 Bacteria 1905
589 Ga0209971_1010041 3300027682 Bacteria 2239
590 Ga0209974_10014334 3300027876 Bacteria 2639
591 Ga0268266_10000458 3300028379 Bacteria 59553
592 Ga0268266_10067414 3300028379 Bacteria 3097
593 Ga0268266_10123788 3300028379 Bacteria 2304
594 Ga0268266_10221055 3300028379 Bacteria 1741
595 Ga0268266_10330060 3300028379 Bacteria 1429
596 Ga0268266_10401402 3300028379 Bacteria 1296
597 Ga0268266_11907974 3300028379 Bacteria 568
598 Ga0268265_10017100 3300028380 Bacteria 4997
599 Ga0268265_10075957 3300028380 Bacteria 2634
600 Ga0268265_10232066 3300028380 Bacteria 1622
601 Ga0268265_10232999 3300028380 Bacteria 1620
602 Ga0268265_10446062 3300028380 Bacteria 1207
603 Ga0268264_10005231 3300028381 Bacteria 10985
604 Ga0268264_10027608 3300028381 Bacteria 4640
605 Ga0268264_10164968 3300028381 Bacteria 1999
606 Ga0268264_10340022 3300028381 Bacteria 1425
607 Ga0316177_1004466 3300030731 Bacteria 1443
608 Ga0314311_1096903 3300030733 Bacteria 1050
609 Ga0307408_100399446 3300031548 Bacteria 1180
610 Ga0307405_10195890 3300031731 Bacteria 1463
611 Ga0307405_10682425 3300031731 Bacteria 848
612 Ga0307405_11274682 3300031731 Bacteria 638
613 Ga0307413_10039626 3300031824 Bacteria 2741
614 Ga0307413_10063695 3300031824 Bacteria 2287
615 Ga0307413_10591001 3300031824 Bacteria 907
616 Ga0307413_11068286 3300031824 Bacteria 695
617 Ga0307410_10016242 3300031852 Bacteria 4436
618 Ga0307410_10430570 3300031852 Bacteria 1072
619 Ga0307406_10068963 3300031901 Bacteria 2310
620 Ga0307407_10059637 3300031903 Bacteria 2223
621 Ga0307407_10211703 3300031903 Bacteria 1305
622 Ga0307412_10019409 3300031911 Bacteria 4117
623 Ga0307412_10098939 3300031911 Bacteria 2058
624 Ga0307412_10163434 3300031911 Bacteria 1657
625 Ga0307412_10517668 3300031911 Bacteria 996
626 Ga0307409_100067190 3300031995 Bacteria 2830
627 Ga0307409_100862900 3300031995 Bacteria 917
628 Ga0307409_102454183 3300031995 Bacteria 550
629 Ga0307416_100028695 3300032002 Bacteria 4144
630 Ga0307416_100192745 3300032002 Bacteria 1924
631 Ga0307416_100955484 3300032002 Bacteria 959
632 Ga0307414_11098383 3300032004 Bacteria 734
633 Ga0307411_10071449 3300032005 Bacteria 2352
634 Ga0307411_10074715 3300032005 Bacteria 2311
635 Ga0307411_10144168 3300032005 Bacteria 1760
636 Ga0307411_10215942 3300032005 Bacteria 1484
637 Ga0307411_10738043 3300032005 Bacteria 861
638 Ga0307411_11408926 3300032005 Bacteria 638
639 Ga0307415_100048767 3300032126 Bacteria 2859
640 Ga0307415_100145448 3300032126 Bacteria 1816
641 Ga0307415_100331497 3300032126 Bacteria 1273
642 Ga0307415_100411661 3300032126 Bacteria 1157
643 Ga0307415_100442219 3300032126 Bacteria 1122
644 Ga0307415_100902782 3300032126 Bacteria 814
645 Ga0373926_0350211 3300035083 Bacteria 580
646 Ga0373944_0052010 3300035089 Bacteria 1293
647 Ga0373936_0221819 3300035113 Bacteria 839
648 Ga0373945_0152898 3300035116 Bacteria 936
649 Ga0373954_0279617 3300035118 Bacteria 823
650 Ga0373960_0093235 3300035121 Bacteria 966
651 Ga0373943_0003948 3300035170 Bacteria 6752
652 Ga0373943_0027483 3300035170 Bacteria 2674
653 Ga0373946_0104112 3300035171 Bacteria 1276
654 Ga0373946_0260977 3300035171 Bacteria 848
655 Ga0373924_0368036 3300035410 Bacteria 641
656 Ga0373931_1022078 3300035691 Bacteria 560
657 Ga0373935_0304130 3300035692 Bacteria 1128
658 Ga0373927_0000731 3300035695 Bacteria 25089
659 Ga0373927_0118279 3300035695 Bacteria 1729
660 Ga0373933_0499859 3300035724 Bacteria 797
661 Ga0373947_0094992 3300035725 Bacteria 1865
662 Ga0373937_0123631 3300036401 Bacteria 2413
663 Ga0373925_0000049 3300037068 Bacteria 128065
664 Ga0373925_0022221 3300037068 Bacteria 4626
665 Ga0373925_0398992 3300037068 Bacteria 1122
666 Ga0373925_1004330 3300037068 Bacteria 687
667 Ga0395899_0012487 3300037312 Bacteria 6507
668 Ga0395899_0015520 3300037312 Bacteria 5808
669 Ga0395899_0030703 3300037312 Bacteria 4040
670 Ga0395899_0045248 3300037312 Bacteria 3279
671 Ga0395899_0048351 3300037312 Bacteria 3165
672 Ga0395899_0144360 3300037312 Bacteria 1691
673 Ga0395899_0167164 3300037312 Bacteria 1551
674 Ga0395899_0205111 3300037312 Bacteria 1372
675 Ga0395899_0207801 3300037312 Bacteria 1362
676 Ga0395899_0476335 3300037312 Bacteria 813
677 Ga0395900_0004336 3300037418 Bacteria 15050
678 Ga0395900_0012216 3300037418 Bacteria 8779
679 Ga0395900_0028449 3300037418 Bacteria 5724
680 Ga0395900_0030718 3300037418 Bacteria 5516
681 Ga0395900_0063319 3300037418 Bacteria 3801
682 Ga0395900_0120631 3300037418 Bacteria 2690
683 Ga0395900_0122242 3300037418 Bacteria 2671
684 Ga0395900_0126939 3300037418 Bacteria 2616
685 Ga0395900_0177463 3300037418 Bacteria 2166
686 Ga0395900_0204584 3300037418 Bacteria 1995
687 Ga0395900_0212574 3300037418 Bacteria 1952
688 Ga0395900_0269027 3300037418 Bacteria 1700
689 Ga0395900_0271183 3300037418 Bacteria 1691
690 Ga0395900_0346987 3300037418 Bacteria 1458
691 Ga0395900_0430479 3300037418 Bacteria 1279
692 Ga0395900_0748659 3300037418 Bacteria 907
693 Ga0395900_0821281 3300037418 Bacteria 856
694 Ga0395900_0991424 3300037418 Bacteria 760
695 Ga0395900_1168379 3300037418 Bacteria 686
696 Ga0395900_1719915 3300037418 Bacteria 538
697 Ga0395898_0043630 3300037466 Bacteria 4418
698 Ga0395898_0048674 3300037466 Bacteria 4155
699 Ga0395898_0059373 3300037466 Bacteria 3721
700 Ga0395898_0067707 3300037466 Bacteria 3456
701 Ga0395898_0075376 3300037466 Bacteria 3258
702 Ga0395898_0192711 3300037466 Bacteria 1947
703 Ga0395898_0244209 3300037466 Bacteria 1712
704 Ga0395898_0560812 3300037466 Bacteria 1084
705 Ga0395898_0607847 3300037466 Bacteria 1036
706 Ga0395898_0621973 3300037466 Bacteria 1022
707 Ga0395898_0724079 3300037466 Bacteria 936
708 Ga0395898_0850526 3300037466 Bacteria 851
709 Ga0395898_1012692 3300037466 Bacteria 766
710 Ga0395898_1126303 3300037466 Bacteria 717
711 Ga0395905_0000358 3300037471 Bacteria 64883
712 Ga0395905_0001605 3300037471 Bacteria 26873
713 Ga0395905_0004499 3300037471 Bacteria 14448
714 Ga0395905_0006735 3300037471 Bacteria 11506
715 Ga0395905_0019572 3300037471 Bacteria 6416
716 Ga0395905_0020469 3300037471 Bacteria 6268
717 Ga0395905_0025444 3300037471 Bacteria 5582
718 Ga0395905_0028161 3300037471 Bacteria 5295
719 Ga0395905_0033571 3300037471 Bacteria 4819
720 Ga0395905_0039750 3300037471 Bacteria 4414
721 Ga0395905_0062723 3300037471 Bacteria 3476
722 Ga0395905_0067338 3300037471 Bacteria 3354
723 Ga0395905_0069739 3300037471 Bacteria 3292
724 Ga0395905_0070316 3300037471 Bacteria 3279
725 Ga0395905_0137927 3300037471 Bacteria 2295
726 Ga0395905_0202876 3300037471 Bacteria 1859
727 Ga0395905_0224195 3300037471 Bacteria 1759
728 Ga0395905_0249093 3300037471 Bacteria 1659
729 Ga0395905_0327895 3300037471 Bacteria 1421
730 Ga0395905_0351733 3300037471 Bacteria 1365
731 Ga0395905_0359527 3300037471 Bacteria 1348
732 Ga0395905_0362340 3300037471 Bacteria 1342
733 Ga0395905_0816355 3300037471 Bacteria 835
734 Ga0395905_0958621 3300037471 Bacteria 758
735 Ga0395905_1050657 3300037471 Bacteria 717
736 Ga0395905_1398556 3300037471 Bacteria 604
737 Ga0395905_1809280 3300037471 Bacteria 516
738 Ga0436364_1351302 3300037853 Bacteria 15199
739 Ga0395901_0002513 3300038443 Bacteria 18561
740 Ga0395901_0007314 3300038443 Bacteria 11145
741 Ga0395901_0029288 3300038443 Bacteria 5667
742 Ga0395901_0029488 3300038443 Bacteria 5650
743 Ga0395901_0033899 3300038443 Bacteria 5272
744 Ga0395901_0130753 3300038443 Bacteria 2638
745 Ga0395901_0172269 3300038443 Bacteria 2271
746 Ga0395901_0265058 3300038443 Bacteria 1787
747 Ga0395901_0267747 3300038443 Bacteria 1777
748 Ga0395901_0310635 3300038443 Bacteria 1633
749 Ga0395901_0548859 3300038443 Bacteria 1171
750 Ga0395901_0738365 3300038443 Bacteria 978
751 Ga0395901_0863037 3300038443 Bacteria 889
752 Ga0395901_1022260 3300038443 Bacteria 801
753 Ga0395901_1035959 3300038443 Bacteria 794
754 Ga0395901_1942481 3300038443 Bacteria 535
755 Ga0395901_1947777 3300038443 Bacteria 534
756 Ga0436361_0623722 3300039447 Bacteria 1479
757 Ga0439447_127122 3300041407 Bacteria 585
758 Ga0439448_0006164 3300042005 Bacteria 3442
759 Ga0439448_0017512 3300042005 Bacteria 2189
760 Ga0450891_032249 3300042129 Bacteria 545
761 Ga0439458_0000203 3300042157 Bacteria 13755
762 Ga0439458_0020102 3300042157 Bacteria 1541
763 Ga0439434_0066276 3300042435 Bacteria 1133
764 Ga0439464_0000800 3300042439 Bacteria 6895
765 Ga0439460_0097687 3300042461 Bacteria 940
766 Ga0451577_0201135 3300042876 Bacteria 1799
767 Ga0466969_0209685 3300044656 Bacteria 888
768 Ga0466965_0204308 3300044683 Bacteria 1049
769 Ga0466966_0026655 3300044684 Bacteria 3772
770 Ga0466961_0009466 3300044693 Bacteria 6204
771 Ga0466961_0050618 3300044693 Bacteria 2653
772 Ga0466961_0145234 3300044693 Bacteria 1484
773 Ga0466963_0012301 3300044694 Bacteria 5234
774 Ga0466963_0139033 3300044694 Bacteria 1681
775 Ga0466964_0009459 3300044706 Bacteria 3671
776 Ga0453684_0622147 3300044712 Bacteria 1181
777 Ga0466971_0003808 3300044719 Bacteria 6457
778 Ga0466971_0179510 3300044719 Bacteria 995
779 Ga0466968_0040982 3300044735 Bacteria 1953
780 Ga0466970_0021309 3300044765 Bacteria 3375
781 Ga0466957_0006652 3300044842 Bacteria 6536
782 Ga0466957_0048041 3300044842 Bacteria 2594
783 Ga0466957_0056738 3300044842 Bacteria 2395
784 Ga0466957_0232999 3300044842 Bacteria 1220
785 Ga0466957_0249773 3300044842 Bacteria 1179
786 Ga0466959_0010161 3300045049 Bacteria 6717
787 Ga0466959_0510183 3300045049 Bacteria 812
788 Ga0466958_0048093 3300045836 Bacteria 2576
789 Ga0466958_0050040 3300045836 Bacteria 2529
790 Ga0466958_0081317 3300045836 Bacteria 1993
791 Ga0466967_0049769 3300045976 Bacteria 3667
792 Ga0466967_0637198 3300045976 Bacteria 1053
793 Ga0466967_0893586 3300045976 Bacteria 883
794 Ga0466967_1026603 3300045976 Bacteria 821
795 Ga0495590_0001393 3300046457 Bacteria 10494
796 Ga0495653_0264908 3300046463 Bacteria 1134
797 Ga0495584_0020975 3300046491 Bacteria 3318
798 Ga0495596_0029912 3300046500 Bacteria 2182
799 Ga0495610_0241604 3300046512 Bacteria 720
800 Ga0495620_0181943 3300046515 Bacteria 812
801 Ga0495663_0042480 3300046525 Bacteria 1386
802 Ga0495663_0180859 3300046525 Bacteria 730
803 Ga0495663_0183592 3300046525 Bacteria 725
804 Ga0495642_0004018 3300046528 Bacteria 5748
805 Ga0495642_0155544 3300046528 Bacteria 990
806 Ga0495642_0163083 3300046528 Bacteria 967
807 Ga0495642_0344142 3300046528 Bacteria 655
808 Ga0495652_0940127 3300046529 Bacteria 568
809 Ga0495598_0005020 3300046537 Bacteria 2905
810 Ga0495621_0001404 3300046539 Bacteria 6237
811 Ga0495597_0005194 3300046542 Bacteria 6931
812 Ga0495645_0140477 3300046543 Bacteria 1685
813 Ga0495622_0000042 3300046557 Bacteria 115943
814 Ga0495622_0085720 3300046557 Bacteria 1449
815 Ga0495668_0054769 3300046616 Bacteria 2203
816 Ga0495668_0090623 3300046616 Bacteria 1675
817 Ga0495668_0186820 3300046616 Bacteria 1135
818 Ga0495668_0233774 3300046616 Bacteria 1007
819 Ga0495625_0409614 3300046660 Bacteria 845
820 Ga0495625_0419305 3300046660 Bacteria 833
821 Ga0495661_0227914 3300046665 Bacteria 962
822 Ga0495647_0184325 3300046681 Bacteria 909
823 Ga0495658_0090989 3300046683 Bacteria 1807
824 Ga0495669_0001085 3300046684 Bacteria 11270
825 Ga0495669_0001756 3300046684 Bacteria 8850
826 Ga0495669_0003643 3300046684 Bacteria 6343
827 Ga0495669_0015865 3300046684 Bacteria 3225
828 Ga0495669_0030167 3300046684 Bacteria 2380
829 Ga0495669_0047397 3300046684 Bacteria 1919
830 Ga0495669_0075660 3300046684 Bacteria 1541
831 Ga0495624_0136366 3300046690 Bacteria 1504
832 Ga0495670_0000431 3300046691 Bacteria 20088
833 Ga0495649_0127579 3300046694 Bacteria 1343
834 Ga0495649_0184313 3300046694 Bacteria 1088
835 Ga0495589_0182375 3300046794 Bacteria 995
836 Ga0495660_0527010 3300046810 Bacteria 502
837 Ga0495672_0456296 3300047320 Bacteria 575
838 Ga0495683_0004604 3300047323 Bacteria 7784
839 Ga0495687_082864 3300047443 Bacteria 1251
840 Ga0495677_0044007 3300047445 Bacteria 1637
841 Ga0495685_017321 3300047447 Bacteria 2467
842 Ga0495681_0216572 3300047470 Bacteria 770
843 Ga0496100_0003268 3300048903 Bacteria 8421
844 Ga0496100_0071981 3300048903 Bacteria 2310
845 Ga0496100_0441094 3300048903 Bacteria 997
846 Ga0496100_0708679 3300048903 Bacteria 786
847 Ga0496101_0037791 3300048904 Bacteria 3427
848 Ga0496101_0041852 3300048904 Bacteria 3269
849 Ga0496102_0034543 3300048905 Bacteria 4548
850 Ga0496102_0178565 3300048905 Bacteria 2000
851 Ga0496102_0364666 3300048905 Bacteria 1360
852 Ga0496102_0431144 3300048905 Bacteria 1238
853 Ga0496103_0002066 3300048906 Bacteria 12846
854 Ga0496103_0111205 3300048906 Bacteria 1740
855 Ga0496103_0387894 3300048906 Bacteria 897
856 Ga0496104_0016916 3300048907 Bacteria 6634
857 Ga0496104_0106578 3300048907 Bacteria 2686
858 Ga0496106_0003858 3300048909 Bacteria 11175
859 Ga0496106_0012730 3300048909 Bacteria 6213
860 Ga0496106_0184427 3300048909 Bacteria 1657
861 Ga0496107_0015735 3300048910 Bacteria 5304
862 Ga0496107_0018516 3300048910 Bacteria 4905
863 Ga0496107_0028751 3300048910 Bacteria 3951
864 Ga0496107_0117700 3300048910 Bacteria 1956
865 Ga0496107_0299443 3300048910 Bacteria 1197
866 Ga0496107_0786699 3300048910 Bacteria 697
867 Ga0496107_0856388 3300048910 Bacteria 664
868 Ga0496107_0982368 3300048910 Bacteria 613
869 Ga0496108_0027081 3300048911 Bacteria 4729
870 Ga0496108_0033736 3300048911 Bacteria 4251
871 Ga0496108_0050284 3300048911 Bacteria 3489
872 Ga0496108_0231965 3300048911 Bacteria 1605
873 Ga0496109_0008000 3300048912 Bacteria 8964
874 Ga0496109_0016123 3300048912 Bacteria 6530
875 Ga0496109_0063309 3300048912 Bacteria 3383
876 Ga0496109_0427595 3300048912 Bacteria 1251
877 Ga0496110_0027424 3300048913 Bacteria 4883
878 Ga0496110_0059196 3300048913 Bacteria 3375
879 Ga0496110_0102130 3300048913 Bacteria 2571
880 Ga0496110_0663879 3300048913 Bacteria 943
881 Ga0496110_0973487 3300048913 Bacteria 755
882 Ga0496111_0005460 3300048914 Bacteria 8149
883 Ga0496111_0013862 3300048914 Bacteria 5498
884 Ga0496111_0075397 3300048914 Bacteria 2457
885 Ga0496111_0113632 3300048914 Bacteria 1995
886 Ga0496112_0011714 3300048915 Bacteria 8025
887 Ga0496112_0026210 3300048915 Bacteria 5606
888 Ga0496112_0027102 3300048915 Bacteria 5523
889 Ga0496112_0100855 3300048915 Bacteria 2856
890 Ga0496112_0305629 3300048915 Bacteria 1536
891 Ga0496112_0471189 3300048915 Bacteria 1193
892 Ga0496113_0000515 3300048916 Bacteria 19121
893 Ga0496113_0015615 3300048916 Bacteria 5227
894 Ga0496113_0038796 3300048916 Bacteria 3503
895 Ga0496113_0430883 3300048916 Bacteria 1059
896 Ga0496114_0000006 3300048917 Bacteria 472921
897 Ga0496114_0022477 3300048917 Bacteria 5141
898 Ga0496115_0366825 3300048918 Bacteria 1173
899 Ga0496117_0318133 3300048920 Bacteria 816
900 Ga0496118_0013646 3300048921 Bacteria 7669
901 Ga0496119_0297482 3300048922 Bacteria 797
902 Ga0496121_0021494 3300048924 Bacteria 6317
903 Ga0496122_0019617 3300048925 Bacteria 6165
904 Ga0496124_0058448 3300048927 Bacteria 3243
905 Ga0496125_0003648 3300048928 Bacteria 18421
906 Ga0496125_0093417 3300048928 Bacteria 2245
907 Ga0501067_0006738 3300049583 Bacteria 6370
908 Ga0501069_0583703 3300049585 Bacteria 670
909 Ga0501035_0015188 3300049822 Bacteria 7108
910 nmdc:mga04h51_477557_c1 3300050495 Bacteria 530
911 nmdc:mga0n895_50939_c1 3300050512 Bacteria 4061
912 nmdc:mga0rr50_573477_c1 3300050513 Bacteria 961
913 Ga0495655_0002253 3300053083 Bacteria 3046
914 Ga0495655_0121669 3300053083 Bacteria 795
915 Ga0500643_005098 3300053087 Bacteria 5741
916 Ga0500643_005423 3300053087 Bacteria 5497
917 Ga0500595_017620 3300053119 Bacteria 2632
918 Ga0466962_0007787 3300061719 Bacteria 5134
919 Ga0466962_0467546 3300061719 Bacteria 636
920 2746084853 2744054900 Bacteria 8399525
921 2746099516 2744054901 Bacteria 8397047
922 Ga0068853_100904271
923 JGI24752J21851_1004793
924 JGI24752J21851_1007122
925 JGI24740J21852_10097384
926 JGI24735J21928_10016411
927 JGI24744J21845_10065779
928 JGI24034J26672_10005295
929 JGI24034J26672_10050962
930 JGI24742J22300_10035664
931 JGI25160J50197_1063431
932 Ga0070658_10013180
933 Ga0070658_10081031
934 Ga0070658_10118946
935 Ga0070658_10227225
936 Ga0070658_10234253
937 Ga0070658_10477311
938 Ga0070658_10481859
939 Ga0070658_10854487
940 Ga0070658_10943625
941 Ga0070658_11157402
942 Ga0070658_11595437
943 Ga0070676_10011092
944 Ga0070676_10083989
945 Ga0070676_10409650
946 Ga0070683_100031867
947 Ga0070683_100349196
948 Ga0070670_100001163
949 Ga0070670_100002964
950 Ga0070670_100054928
951 Ga0070670_100563099
952 Ga0068869_100058078
953 Ga0068869_100107868
954 Ga0068869_100237143
955 Ga0068869_100834556
956 Ga0070666_10038142
957 Ga0070666_10182555
958 Ga0070666_10303627
959 Ga0070680_100008836
960 Ga0070680_100057207
961 Ga0070682_100480755
962 Ga0070682_100498640
963 Ga0070682_101155981
964 Ga0068868_100001497
965 Ga0068868_100404195
966 Ga0068868_100523865
967 Ga0068868_101582934
968 Ga0070660_100019229
969 Ga0070660_100035092
970 Ga0070660_100040092
971 Ga0070660_100040094
972 Ga0070660_100052355
973 Ga0070660_100363702
974 Ga0070660_100415537
975 Ga0070660_100450432
976 Ga0070660_100555193
977 Ga0070660_100977397
978 Ga0070660_101620357
979 Ga0070687_100888591
980 Ga0070661_100006747
981 Ga0070661_100044766
982 Ga0070661_100065230
983 Ga0070661_100067628
984 Ga0070661_100082362
985 Ga0070661_100083636
986 Ga0070661_100096016
987 Ga0070661_100570826
988 Ga0070692_10001380
989 Ga0070692_10031380
990 Ga0070692_10296358
991 Ga0070668_100004615
992 Ga0070668_100272882
993 Ga0070669_100045317
994 Ga0070669_100237490
995 Ga0070669_100238001
996 Ga0070669_100342088
997 Ga0070675_100016044
998 Ga0070675_100953311
999 Ga0070671_100000793
1000 Ga0070671_100000972
1001 Ga0070671_100001688
1002 Ga0070671_100003799
1003 Ga0070671_100047523
1004 Ga0070671_100050352
1005 Ga0070671_100070534
1006 Ga0070671_100117051
1007 Ga0070671_100437947
1008 Ga0070671_100852323
1009 Ga0070674_100011719
1010 Ga0070674_100830581
1011 Ga0070673_100001888
1012 Ga0070673_100002090
1013 Ga0070673_100056133
1014 Ga0070673_100071289
1015 Ga0070673_100275887
1016 Ga0070659_100014473
1017 Ga0070659_100187166
1018 Ga0070659_100205527
1019 Ga0070659_100324837
1020 Ga0070659_101142207
1021 Ga0070667_100004185
1022 Ga0070667_100018962
1023 Ga0070667_100046858
1024 Ga0070667_100057375
1025 Ga0070667_100064947
1026 Ga0070667_100099818
1027 Ga0070667_100109834
1028 Ga0070667_100122712
1029 Ga0070667_100146930
1030 Ga0070667_100226212
1031 Ga0070667_100229204
1032 Ga0070667_100258291
1033 Ga0070709_10047051
1034 Ga0070714_100279712
1035 Ga0070714_100360054
1036 Ga0070713_100047407
1037 Ga0070710_10285555
1038 Ga0070711_100644312
1039 Ga0070708_100038518
1040 Ga0070663_100005204
1041 Ga0070663_100053013
1042 Ga0070663_101403541
1043 Ga0070678_100002943
1044 Ga0070678_100004841
1045 Ga0070678_100012599
1046 Ga0070678_100068315
1047 Ga0070662_100008474
1048 Ga0070662_100048845
1049 Ga0070662_100171071
1050 Ga0070662_100455958
1051 Ga0070681_10007172
1052 Ga0070681_10012441
1053 Ga0070681_10075087
1054 Ga0070681_11000886
1055 Ga0070681_11163130
1056 Ga0068867_100001732
1057 Ga0068867_100554174
1058 Ga0068867_100931174
1059 Ga0068867_100956417
1060 Ga0070685_10198009
1061 Ga0070685_10275000
1062 Ga0070706_100519884
1063 Ga0070698_100000765
1064 Ga0070699_100000262
1065 Ga0070699_101130955
1066 Ga0070679_100039042
1067 Ga0070679_100177372
1068 Ga0070679_100238249
1069 Ga0070679_100989454
1070 Ga0070679_101362097
1071 Ga0070684_100221559
1072 Ga0070684_100590815
1073 Ga0070684_101806113
1074 Ga0068853_100091617
1075 Ga0068853_100398968
1076 Ga0070672_100005547
1077 Ga0070672_100023744
1078 Ga0070672_100150736
1079 Ga0070672_100293052
1080 Ga0070672_100345464
1081 Ga0070672_100486428
1082 Ga0070686_100775173
1083 Ga0070696_100293323
1084 Ga0070696_100524023
1085 Ga0070693_100253015
1086 Ga0070665_100000910
1087 Ga0070665_100006465
1088 Ga0070665_100015898
1089 Ga0070665_100029794
1090 Ga0070665_100513320
1091 Ga0070665_100691402
1092 Ga0070665_100804877
1093 Ga0070665_102117481
1094 Ga0068855_100077678
1095 Ga0068855_100169174
1096 Ga0068855_100263200
1097 Ga0068855_100478391
1098 Ga0070664_100022597
1099 Ga0070664_100030779
1100 Ga0070664_100033797
1101 Ga0070664_100071617
1102 Ga0070664_100241639
1103 Ga0070664_100348749
1104 Ga0070664_100615438
1105 Ga0070664_100735661
1106 Ga0068857_100071098
1107 Ga0068857_100127102
1108 Ga0068857_100278068
1109 Ga0068857_100513591
1110 Ga0068857_101442493
1111 Ga0068857_101604778
1112 Ga0068854_100032959
1113 Ga0068854_100185633
1114 Ga0068854_100424761
1115 Ga0068854_100917100
1116 Ga0068854_101218395
1117 Ga0068854_101375052
1118 Ga0068854_101903053
1119 Ga0068856_100051602
1120 Ga0068856_100115287
1121 Ga0068856_100147268
1122 Ga0068856_100220283
1123 Ga0068856_100265503
1124 Ga0068856_100444262
1125 Ga0068856_100969463
1126 Ga0068856_101419611
1127 Ga0068856_101548305
1128 Ga0068856_102066822
1129 Ga0068852_100062874
1130 Ga0068852_100116363
1131 Ga0068852_100152098
1132 Ga0068852_100289640
1133 Ga0068852_100318979
1134 Ga0068859_100006261
1135 Ga0068859_100146583
1136 Ga0068859_100187986
1137 Ga0068859_100578651
1138 Ga0068859_101916153
1139 Ga0068864_100000986
1140 Ga0068864_100001733
1141 Ga0068864_100052318
1142 Ga0068864_100062287
1143 Ga0068864_100249505
1144 Ga0068864_100263194
1145 Ga0068861_100091162
1146 Ga0068851_10485090
1147 Ga0068870_10791194
1148 Ga0068863_100002990
1149 Ga0068863_100013454
1150 Ga0068863_100034884
1151 Ga0068863_100043383
1152 Ga0068863_100111729
1153 Ga0068863_100130988
1154 Ga0068863_100157108
1155 Ga0068863_100216037
1156 Ga0068858_100001162
1157 Ga0068858_100023008
1158 Ga0068858_100076107
1159 Ga0068858_100430246
1160 Ga0068860_100009071
1161 Ga0068860_100135411
1162 Ga0068860_100557543
1163 Ga0068860_100674349
1164 Ga0068862_100054449
1165 Ga0068862_100069918
1166 Ga0068862_100078348
1167 Ga0068862_100091265
1168 Ga0068862_100320412
1169 Ga0068862_100527239
1170 Ga0081455_10542772
1171 Ga0070717_10079203
1172 Ga0070716_100037550
1173 Ga0070712_100036743
1174 Ga0097621_100029577
1175 Ga0097621_100074775
1176 Ga0097621_100117517
1177 Ga0068871_100009975
1178 Ga0068871_100010746
1179 Ga0068871_100478252
1180 Ga0068871_100631193
1181 Ga0075428_101218564
1182 Ga0075434_100365116
1183 Ga0075434_100980505
1184 Ga0068865_100021433
1185 Ga0068865_100946878
1186 Ga0097620_100006262
1187 Ga0097620_100146585
1188 Ga0097620_100187983
1189 Ga0097620_100578661
1190 Ga0097620_101916242
1191 Ga0075435_100231040
1192 Ga0075435_100801937
1193 Ga0105251_10000335
1194 Ga0105244_10041105
1195 Ga0105240_10011987
1196 Ga0105240_10283880
1197 Ga0105240_10625910
1198 Ga0105240_10739741
1199 Ga0105245_10602294
1200 Ga0105247_10098395
1201 Ga0114129_10507908
1202 Ga0105243_10524966
1203 Ga0105248_10003466
1204 Ga0105248_10005736
1205 Ga0105248_10005810
1206 Ga0105248_10010048
1207 Ga0105248_10018337
1208 Ga0105248_10046857
1209 Ga0105248_10139020
1210 Ga0105248_10560192
1211 Ga0105248_11202775
1212 Ga0105237_10084279
1213 Ga0105237_10095600
1214 Ga0105238_10081861
1215 Ga0105249_10026756
1216 Ga0105249_10499818
1217 Ga0105239_10036916
1218 Ga0105239_10588285
1219 Ga0157373_10051882
1220 Ga0157373_10062223
1221 Ga0157373_10204862
1222 Ga0157373_10268022
1223 Ga0157373_10369852
1224 Ga0157373_10679891
1225 Ga0157371_10034078
1226 Ga0157371_10056506
1227 Ga0157371_10131204
1228 Ga0157371_10578626
1229 Ga0157370_10004637
1230 Ga0157370_10042447
1231 Ga0157370_10045732
1232 Ga0157370_10408066
1233 Ga0157370_10473031
1234 Ga0157370_10717333
1235 Ga0157370_10718712
1236 Ga0157369_10051621
1237 Ga0157369_10119233
1238 Ga0157369_10280709
1239 Ga0157369_10490324
1240 Ga0157369_11968818
1241 Ga0157374_10010518
1242 Ga0157374_10034304
1243 Ga0157374_10043422
1244 Ga0157374_10056847
1245 Ga0157374_10121830
1246 Ga0157378_10099823
1247 Ga0157378_11573712
1248 Ga0163162_10104497
1249 Ga0163162_10225459
1250 Ga0163162_10249498
1251 Ga0157372_10351270
1252 Ga0157372_11073215
1253 Ga0157372_11277098
1254 Ga0157372_11444181
1255 Ga0157372_12783341
1256 Ga0157375_10002274
1257 Ga0157375_10054662
1258 Ga0157375_10114727
1259 Ga0157375_10338089
1260 Ga0157375_10559329
1261 Ga0157375_11546363
1262 Ga0163163_10002274
1263 Ga0163163_10109737
1264 Ga0163163_10184828
1265 Ga0182008_10740426
1266 Ga0157379_10005800
1267 Ga0157379_10029978
1268 Ga0157379_11620938
1269 Ga0157376_10901032
1270 Ga0206354_10676054
1271 Ga0206353_10949703
1272 Ga0206353_11092190
1273 Ga0213875_10007660
1274 Ga0209674_108227
1275 Ga0209758_1072672
1276 Ga0207426_1011249
1277 Ga0207697_10028269
1278 Ga0207697_10094868
1279 Ga0207656_10392721
1280 Ga0207655_1047734
1281 Ga0207713_1009674
1282 Ga0207682_10028810
1283 Ga0207642_10067678
1284 Ga0207688_10045821
1285 Ga0207688_10081008
1286 Ga0207688_10098892
1287 Ga0207680_10002741
1288 Ga0207680_10089398
1289 Ga0207680_10226717
1290 Ga0207680_11062527
1291 Ga0207647_10022449
1292 Ga0207647_10029330
1293 Ga0207647_10032655
1294 Ga0207647_10191922
1295 Ga0207699_10011896
1296 Ga0207645_10016942
1297 Ga0207645_10066063
1298 Ga0207645_10544325
1299 Ga0207643_10438238
1300 Ga0207643_10604646
1301 Ga0207705_10001651
1302 Ga0207705_10001757
1303 Ga0207705_10004973
1304 Ga0207705_10042223
1305 Ga0207705_10055454
1306 Ga0207705_10071498
1307 Ga0207705_10113058
1308 Ga0207705_10129904
1309 Ga0207705_10231934
1310 Ga0207684_10409557
1311 Ga0207707_10008599
1312 Ga0207707_10221444
1313 Ga0207695_10003622
1314 Ga0207695_10009386
1315 Ga0207695_10019656
1316 Ga0207695_10278208
1317 Ga0207695_10971820
1318 Ga0207671_10027149
1319 Ga0207671_10106232
1320 Ga0207671_10250314
1321 Ga0207693_10747288
1322 Ga0207663_10404391
1323 Ga0207660_10000716
1324 Ga0207660_10280967
1325 Ga0207662_10071205
1326 Ga0207662_10324804
1327 Ga0207657_10001862
1328 Ga0207657_10004412
1329 Ga0207657_10005407
1330 Ga0207657_10028803
1331 Ga0207657_10036733
1332 Ga0207657_10221157
1333 Ga0207657_10389503
1334 Ga0207657_10468509
1335 Ga0207657_10549443
1336 Ga0207657_10826782
1337 Ga0207649_10001822
1338 Ga0207649_10008665
1339 Ga0207649_10014331
1340 Ga0207649_10357427
1341 Ga0207649_10410283
1342 Ga0207649_10510108
1343 Ga0207649_10522405
1344 Ga0207649_10663312
1345 Ga0207649_11014775
1346 Ga0207652_10020028
1347 Ga0207652_10037712
1348 Ga0207652_10078754
1349 Ga0207652_10262857
1350 Ga0207652_10714454
1351 Ga0207652_11386066
1352 Ga0207652_11530504
1353 Ga0207681_10012329
1354 Ga0207681_11107598
1355 Ga0207694_10037860
1356 Ga0207694_10048560
1357 Ga0207694_10498587
1358 Ga0207694_10766967
1359 Ga0207650_10046961
1360 Ga0207650_10172339
1361 Ga0207650_10634807
1362 Ga0207650_11303922
1363 Ga0207659_10788963
1364 Ga0207687_10359969
1365 Ga0207700_10009950
1366 Ga0207664_10100613
1367 Ga0207664_10279346
1368 Ga0207644_10000151
1369 Ga0207644_10000649
1370 Ga0207644_10001389
1371 Ga0207644_10004701
1372 Ga0207644_10021169
1373 Ga0207644_10030859
1374 Ga0207644_10100570
1375 Ga0207644_10559982
1376 Ga0207644_10830715
1377 Ga0207690_10018310
1378 Ga0207690_10052211
1379 Ga0207690_10064432
1380 Ga0207690_10200996
1381 Ga0207690_10805982
1382 Ga0207706_10004393
1383 Ga0207706_10069237
1384 Ga0207706_10132039
1385 Ga0207706_10181350
1386 Ga0207706_10288268
1387 Ga0207706_11033272
1388 Ga0207669_10026990
1389 Ga0207669_10072719
1390 Ga0207669_10767828
1391 Ga0207665_10069898
1392 Ga0207691_10001996
1393 Ga0207691_10026345
1394 Ga0207691_10029225
1395 Ga0207691_10066394
1396 Ga0207691_10301192
1397 Ga0207691_10473289
1398 Ga0207691_11053579
1399 Ga0207711_10000665
1400 Ga0207711_10001841
1401 Ga0207711_10003496
1402 Ga0207711_10037093
1403 Ga0207711_10052553
1404 Ga0207711_10057003
1405 Ga0207711_10083753
1406 Ga0207711_10140678
1407 Ga0207711_10464874
1408 Ga0207689_10104873
1409 Ga0207689_10260218
1410 Ga0207661_10080700
1411 Ga0207661_10149882
1412 Ga0207661_10452092
1413 Ga0207679_10033704
1414 Ga0207679_10047680
1415 Ga0207679_10091447
1416 Ga0207679_10103374
1417 Ga0207679_10318946
1418 Ga0207679_10800828
1419 Ga0207679_11446791
1420 Ga0207667_10002838
1421 Ga0207667_10102503
1422 Ga0207667_10170865
1423 Ga0207667_10219579
1424 Ga0207667_10309834
1425 Ga0207667_10373513
1426 Ga0207667_10377703
1427 Ga0207667_10568249
1428 Ga0207667_10584366
1429 Ga0207651_10003650
1430 Ga0207651_10007905
1431 Ga0207651_10110897
1432 Ga0207651_10164399
1433 Ga0207651_10243868
1434 Ga0207668_10000173
1435 Ga0207668_10500359
1436 Ga0207668_10966172
1437 Ga0207640_10048934
1438 Ga0207640_10394456
1439 Ga0207658_10004820
1440 Ga0207658_10006623
1441 Ga0207658_10007841
1442 Ga0207658_10022630
1443 Ga0207658_10033351
1444 Ga0207658_10071181
1445 Ga0207658_10090608
1446 Ga0207658_10113431
1447 Ga0207658_10127338
1448 Ga0207658_10155469
1449 Ga0207658_10225291
1450 Ga0207658_10672646
1451 Ga0207677_10003316
1452 Ga0207677_10084645
1453 Ga0207677_10553412
1454 Ga0207677_10901826
1455 Ga0207703_10011355
1456 Ga0207703_10018273
1457 Ga0207703_10111851
1458 Ga0207703_10188157
1459 Ga0207703_10604042
1460 Ga0207639_10006754
1461 Ga0207639_10195051
1462 Ga0207639_10348219
1463 Ga0207639_10567008
1464 Ga0207678_10003157
1465 Ga0207678_10068962
1466 Ga0207678_10144526
1467 Ga0207702_10026932
1468 Ga0207702_10058374
1469 Ga0207702_10097301
1470 Ga0207702_10160670
1471 Ga0207702_10265610
1472 Ga0207702_10451189
1473 Ga0207702_10514984
1474 Ga0207702_11283895
1475 Ga0207702_11508894
1476 Ga0207641_10000761
1477 Ga0207641_10004390
1478 Ga0207641_10036841
1479 Ga0207641_10055173
1480 Ga0207641_10155161
1481 Ga0207641_10197593
1482 Ga0207641_10814286
1483 Ga0207648_10011142
1484 Ga0207648_10898006
1485 Ga0207676_10001742
1486 Ga0207676_10006122
1487 Ga0207676_10052846
1488 Ga0207676_10537512
1489 Ga0207676_11152192
1490 Ga0207674_10000780
1491 Ga0207674_10017182
1492 Ga0207674_10051387
1493 Ga0207674_10141174
1494 Ga0207674_11309866
1495 Ga0207675_100410585
1496 Ga0207675_100789859
1497 Ga0207683_10001537
1498 Ga0207683_10026854
1499 Ga0207683_10029747
1500 Ga0207683_10055457
1501 Ga0207698_10001098
1502 Ga0207698_10002330
1503 Ga0207698_10060309
1504 Ga0207698_10112608
1505 Ga0207698_10219926
1506 Ga0207698_10306042
1507 Ga0207698_11132332
1508 Ga0207698_12100698
1509 Ga0209983_1010376
1510 Ga0209971_1010041
1511 Ga0209974_10014334
1512 Ga0268266_10000458
1513 Ga0268266_10067414
1514 Ga0268266_10123788
1515 Ga0268266_10221055
1516 Ga0268266_10330060
1517 Ga0268266_10401402
1518 Ga0268266_11907974
1519 Ga0268265_10017100
1520 Ga0268265_10075957
1521 Ga0268265_10232066
1522 Ga0268265_10232999
1523 Ga0268265_10446062
1524 Ga0268264_10005231
1525 Ga0268264_10027608
1526 Ga0268264_10164968
1527 Ga0268264_10340022
1528 Ga0316177_1004466
1529 Ga0314311_1096903
1530 Ga0307408_100399446
1531 Ga0307405_10195890
1532 Ga0307405_10682425
1533 Ga0307405_11274682
1534 Ga0307413_10039626
1535 Ga0307413_10063695
1536 Ga0307413_10591001
1537 Ga0307413_11068286
1538 Ga0307410_10016242
1539 Ga0307410_10430570
1540 Ga0307406_10068963
1541 Ga0307407_10059637
1542 Ga0307407_10211703
1543 Ga0307412_10019409
1544 Ga0307412_10098939
1545 Ga0307412_10163434
1546 Ga0307412_10517668
1547 Ga0307409_100067190
1548 Ga0307409_100862900
1549 Ga0307409_102454183
1550 Ga0307416_100028695
1551 Ga0307416_100192745
1552 Ga0307416_100955484
1553 Ga0307414_11098383
1554 Ga0307411_10071449
1555 Ga0307411_10074715
1556 Ga0307411_10144168
1557 Ga0307411_10215942
1558 Ga0307411_10738043
1559 Ga0307411_11408926
1560 Ga0307415_100048767
1561 Ga0307415_100145448
1562 Ga0307415_100331497
1563 Ga0307415_100411661
1564 Ga0307415_100442219
1565 Ga0307415_100902782
1566 Ga0373926_0350211
1567 Ga0373944_0052010
1568 Ga0373936_0221819
1569 Ga0373945_0152898
1570 Ga0373954_0279617
1571 Ga0373960_0093235
1572 Ga0373943_0003948
1573 Ga0373943_0027483
1574 Ga0373946_0104112
1575 Ga0373946_0260977
1576 Ga0373924_0368036
1577 Ga0373931_1022078
1578 Ga0373935_0304130
1579 Ga0373927_0000731
1580 Ga0373927_0118279
1581 Ga0373933_0499859
1582 Ga0373947_0094992
1583 Ga0373937_0123631
1584 Ga0373925_0000049
1585 Ga0373925_0022221
1586 Ga0373925_0398992
1587 Ga0373925_1004330
1588 Ga0395899_0012487
1589 Ga0395899_0015520
1590 Ga0395899_0030703
1591 Ga0395899_0045248
1592 Ga0395899_0048351
1593 Ga0395899_0144360
1594 Ga0395899_0167164
1595 Ga0395899_0205111
1596 Ga0395899_0207801
1597 Ga0395899_0476335
1598 Ga0395900_0004336
1599 Ga0395900_0012216
1600 Ga0395900_0028449
1601 Ga0395900_0030718
1602 Ga0395900_0063319
1603 Ga0395900_0120631
1604 Ga0395900_0122242
1605 Ga0395900_0126939
1606 Ga0395900_0177463
1607 Ga0395900_0204584
1608 Ga0395900_0212574
1609 Ga0395900_0269027
1610 Ga0395900_0271183
1611 Ga0395900_0346987
1612 Ga0395900_0430479
1613 Ga0395900_0748659
1614 Ga0395900_0821281
1615 Ga0395900_0991424
1616 Ga0395900_1168379
1617 Ga0395900_1719915
1618 Ga0395898_0043630
1619 Ga0395898_0048674
1620 Ga0395898_0059373
1621 Ga0395898_0067707
1622 Ga0395898_0075376
1623 Ga0395898_0192711
1624 Ga0395898_0244209
1625 Ga0395898_0560812
1626 Ga0395898_0607847
1627 Ga0395898_0621973
1628 Ga0395898_0724079
1629 Ga0395898_0850526
1630 Ga0395898_1012692
1631 Ga0395898_1126303
1632 Ga0395905_0000358
1633 Ga0395905_0001605
1634 Ga0395905_0004499
1635 Ga0395905_0006735
1636 Ga0395905_0019572
1637 Ga0395905_0020469
1638 Ga0395905_0025444
1639 Ga0395905_0028161
1640 Ga0395905_0033571
1641 Ga0395905_0039750
1642 Ga0395905_0062723
1643 Ga0395905_0067338
1644 Ga0395905_0069739
1645 Ga0395905_0070316
1646 Ga0395905_0137927
1647 Ga0395905_0202876
1648 Ga0395905_0224195
1649 Ga0395905_0249093
1650 Ga0395905_0327895
1651 Ga0395905_0351733
1652 Ga0395905_0359527
1653 Ga0395905_0362340
1654 Ga0395905_0816355
1655 Ga0395905_0958621
1656 Ga0395905_1050657
1657 Ga0395905_1398556
1658 Ga0395905_1809280
1659 Ga0436364_1351302
1660 Ga0395901_0002513
1661 Ga0395901_0007314
1662 Ga0395901_0029288
1663 Ga0395901_0029488
1664 Ga0395901_0033899
1665 Ga0395901_0130753
1666 Ga0395901_0172269
1667 Ga0395901_0265058
1668 Ga0395901_0267747
1669 Ga0395901_0310635
1670 Ga0395901_0548859
1671 Ga0395901_0738365
1672 Ga0395901_0863037
1673 Ga0395901_1022260
1674 Ga0395901_1035959
1675 Ga0395901_1942481
1676 Ga0395901_1947777
1677 Ga0436361_0623722
1678 Ga0439447_127122
1679 Ga0439448_0006164
1680 Ga0439448_0017512
1681 Ga0450891_032249
1682 Ga0439458_0000203
1683 Ga0439458_0020102
1684 Ga0439434_0066276
1685 Ga0439464_0000800
1686 Ga0439460_0097687
1687 Ga0451577_0201135
1688 Ga0466969_0209685
1689 Ga0466965_0204308
1690 Ga0466966_0026655
1691 Ga0466961_0009466
1692 Ga0466961_0050618
1693 Ga0466961_0145234
1694 Ga0466963_0012301
1695 Ga0466963_0139033
1696 Ga0466964_0009459
1697 Ga0453684_0622147
1698 Ga0466971_0003808
1699 Ga0466971_0179510
1700 Ga0466968_0040982
1701 Ga0466970_0021309
1702 Ga0466957_0006652
1703 Ga0466957_0048041
1704 Ga0466957_0056738
1705 Ga0466957_0232999
1706 Ga0466957_0249773
1707 Ga0466959_0010161
1708 Ga0466959_0510183
1709 Ga0466958_0048093
1710 Ga0466958_0050040
1711 Ga0466958_0081317
1712 Ga0466967_0049769
1713 Ga0466967_0637198
1714 Ga0466967_0893586
1715 Ga0466967_1026603
1716 Ga0495590_0001393
1717 Ga0495653_0264908
1718 Ga0495584_0020975
1719 Ga0495596_0029912
1720 Ga0495610_0241604
1721 Ga0495620_0181943
1722 Ga0495663_0042480
1723 Ga0495663_0180859
1724 Ga0495663_0183592
1725 Ga0495642_0004018
1726 Ga0495642_0155544
1727 Ga0495642_0163083
1728 Ga0495642_0344142
1729 Ga0495652_0940127
1730 Ga0495598_0005020
1731 Ga0495621_0001404
1732 Ga0495597_0005194
1733 Ga0495645_0140477
1734 Ga0495622_0000042
1735 Ga0495622_0085720
1736 Ga0495668_0054769
1737 Ga0495668_0090623
1738 Ga0495668_0186820
1739 Ga0495668_0233774
1740 Ga0495625_0409614
1741 Ga0495625_0419305
1742 Ga0495661_0227914
1743 Ga0495647_0184325
1744 Ga0495658_0090989
1745 Ga0495669_0001085
1746 Ga0495669_0001756
1747 Ga0495669_0003643
1748 Ga0495669_0015865
1749 Ga0495669_0030167
1750 Ga0495669_0047397
1751 Ga0495669_0075660
1752 Ga0495624_0136366
1753 Ga0495670_0000431
1754 Ga0495649_0127579
1755 Ga0495649_0184313
1756 Ga0495589_0182375
1757 Ga0495660_0527010
1758 Ga0495672_0456296
1759 Ga0495683_0004604
1760 Ga0495687_082864
1761 Ga0495677_0044007
1762 Ga0495685_017321
1763 Ga0495681_0216572
1764 Ga0496100_0003268
1765 Ga0496100_0071981
1766 Ga0496100_0441094
1767 Ga0496100_0708679
1768 Ga0496101_0037791
1769 Ga0496101_0041852
1770 Ga0496102_0034543
1771 Ga0496102_0178565
1772 Ga0496102_0364666
1773 Ga0496102_0431144
1774 Ga0496103_0002066
1775 Ga0496103_0111205
1776 Ga0496103_0387894
1777 Ga0496104_0016916
1778 Ga0496104_0106578
1779 Ga0496106_0003858
1780 Ga0496106_0012730
1781 Ga0496106_0184427
1782 Ga0496107_0015735
1783 Ga0496107_0018516
1784 Ga0496107_0028751
1785 Ga0496107_0117700
1786 Ga0496107_0299443
1787 Ga0496107_0786699
1788 Ga0496107_0856388
1789 Ga0496107_0982368
1790 Ga0496108_0027081
1791 Ga0496108_0033736
1792 Ga0496108_0050284
1793 Ga0496108_0231965
1794 Ga0496109_0008000
1795 Ga0496109_0016123
1796 Ga0496109_0063309
1797 Ga0496109_0427595
1798 Ga0496110_0027424
1799 Ga0496110_0059196
1800 Ga0496110_0102130
1801 Ga0496110_0663879
1802 Ga0496110_0973487
1803 Ga0496111_0005460
1804 Ga0496111_0013862
1805 Ga0496111_0075397
1806 Ga0496111_0113632
1807 Ga0496112_0011714
1808 Ga0496112_0026210
1809 Ga0496112_0027102
1810 Ga0496112_0100855
1811 Ga0496112_0305629
1812 Ga0496112_0471189
1813 Ga0496113_0000515
1814 Ga0496113_0015615
1815 Ga0496113_0038796
1816 Ga0496113_0430883
1817 Ga0496114_0000006
1818 Ga0496114_0022477
1819 Ga0496115_0366825
1820 Ga0496117_0318133
1821 Ga0496118_0013646
1822 Ga0496119_0297482
1823 Ga0496121_0021494
1824 Ga0496122_0019617
1825 Ga0496124_0058448
1826 Ga0496125_0003648
1827 Ga0496125_0093417
1828 Ga0501067_0006738
1829 Ga0501069_0583703
1830 Ga0501035_0015188
1831 nmdc:mga04h51_477557_c1
1832 nmdc:mga0n895_50939_c1
1833 nmdc:mga0rr50_573477_c1
1834 Ga0495655_0002253
1835 Ga0495655_0121669
1836 Ga0500643_005098
1837 Ga0500643_005423
1838 Ga0500595_017620
1839 Ga0466962_0007787
1840 Ga0466962_0467546
1841 2746084853
1842 2746099516

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

24

146

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
4nb0-assembly1.cif.gz_A crystal structure of fosb from staphylococcus aureus with bs-cys9 disulfide at 1.62 angstrom resolution 0.8649 1 126
4nb2-assembly1.cif.gz_B crystal structure of fosb from staphylococcus aureus at 1.89 angstrom resolution - apo structure 0.8242 1 135
3rri-assembly1.cif.gz_A crystal structure of glyoxalase/bleomycin resistance protein/dioxygenase from alicyclobacillus acidocaldarius 0.816 3 136
4nb2-assembly1.cif.gz_A crystal structure of fosb from staphylococcus aureus at 1.89 angstrom resolution - apo structure 0.8149 1 138
2p7k-assembly1.cif.gz_B crystal structure of genomically encoded fosfomycin resistance protein, fosx, from listeria monocytogenes (hexagonal form) 0.8133 1 128
ID Description Score Start End Superfamily
af_Q2FYM3_1_61_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8407 7 52 3.10.180.10
af_K7TTV6_114_219_2.40.330.10 Mainly Beta;Beta Barrel;At1g16640 B3 domain;DNA-binding pseudobarrel domain 0.8208 111 127 2.40.330.10
2p7kA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8135 1 128 3.10.180.10
4nazA01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8032 1 135 3.10.180.10
3rriB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7949 3 132 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A375CAY3-F1-model_v4 deleted 0.9786 2 138
AF-B1G047-F1-model_v4 Glyoxalase/bleomycin resistance protein/dioxygenase 0.9748 2 138 GO:0051213
AF-A0A0C4YJM0-F1-model_v4 Putative dioxygenase 0.9726 5 138 GO:0051213
AF-A0A7C4E557-F1-model_v4 Glyoxalase 0.9712 2 138
AF-A0A401K0W1-F1-model_v4 Glyoxalase 0.9694 2 138

Map