F485745

General Info

Members Datasets Scaffolds Average Seq Length
920 413 907 253

Family's Representative Sequence

Representative Sequence 3300053092|Ga0500583_0063513|Ga0500583_0063513_734_1492
Length 247
Sequence MQRLKDTLPPLAVIGLLIVMXXAAVVATRSMIFPTPWGVVAGTFELLKDGTLWRHIGASLLRVGTGFGLAVCVAVPLGLWMGWVRGAYYTLNPVFQILRPISPIAWIPIAILWFGVGNASPIYLIFISSVFPMIVQTTAGVHTIEKRYLRAAENFGVSRATLFKQVVIPAVVGMRIGLGVAWLVVVAAEMIALRSGLGYMIMDSRNAGNRYDLVIAGMIIIGVIGLSLDGLMRMLEKAKWVRWRYAH

Samples

Sample ID Description Type Environment
1 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
2 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
3 2643221556 Massilia sp. Root1485 Isolate Unclassified
4 2643221585 Pelomonas sp. Root662 Isolate Unclassified
5 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
6 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
7 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
8 2643221656 Pelomonas sp. Root405 Isolate Unclassified
9 2643221684 Massilia sp. Root133 Isolate Unclassified
10 2738541337 Pelomonas sp. BT06 Isolate Unclassified
11 2842711865 Duganella sp. R-73148 Isolate Unclassified
12 2857558681 Duganella sp. R-74565 Isolate Unclassified
13 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
14 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
15 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
16 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
17 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
18 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
19 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
20 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
21 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
22 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
23 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
24 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
25 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
26 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
27 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
28 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
29 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
30 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
31 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
32 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
33 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
34 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
35 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
36 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
37 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
38 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
39 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
40 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
41 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
42 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
43 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
44 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
45 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
46 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
47 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
48 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
49 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
50 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
51 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
52 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
53 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
54 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
55 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
56 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
57 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
58 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
59 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
60 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
61 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
62 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
63 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
64 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
65 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
66 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
67 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
68 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
69 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
70 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
71 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
72 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
73 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
74 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
75 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
76 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
77 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
78 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
79 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
80 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
81 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
82 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
83 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
84 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
85 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
86 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
87 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
88 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
89 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
90 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
91 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
92 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
93 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
94 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
95 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
96 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
97 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
98 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
99 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
100 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
101 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
102 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
103 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
104 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
105 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
106 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
107 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
108 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
109 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
110 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
111 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
112 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
113 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
114 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
115 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
116 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
117 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
118 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
119 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
120 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
121 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
122 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
123 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
124 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
125 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
126 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
127 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
128 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
129 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
130 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
131 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
132 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
133 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
134 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
135 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
136 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
137 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
138 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
139 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
140 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
141 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
142 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
143 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
144 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
147 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
149 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
150 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
151 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
153 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
154 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
155 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
156 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
158 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
159 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
160 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
161 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
162 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
163 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
164 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
165 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
166 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
167 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
168 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
219 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
221 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
223 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
224 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
225 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
229 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
230 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
231 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
232 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
233 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
234 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
235 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
236 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
237 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
238 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
239 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
240 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
241 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
242 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
243 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
244 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
245 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
246 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
247 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
248 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
249 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
250 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
251 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
252 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
253 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
254 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
255 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
256 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
257 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
258 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
259 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
260 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
261 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
262 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
263 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
264 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
265 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
266 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
267 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
268 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
269 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
270 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
271 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
272 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
273 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
274 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
275 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
276 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
277 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
278 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
279 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
280 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
281 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
282 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
283 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
284 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
285 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
286 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
287 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
288 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
289 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
290 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
291 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
292 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
293 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
294 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
295 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
296 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
297 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
298 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
299 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
300 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
301 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
302 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
303 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
304 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
305 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
306 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
307 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
308 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
309 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
310 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
311 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
312 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
313 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
314 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
315 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
316 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
317 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
318 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
319 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
320 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
321 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
322 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
323 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
324 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
325 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
326 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
327 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
328 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
329 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
330 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
331 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
332 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
333 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
334 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
335 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
336 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
337 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
338 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
339 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
340 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
341 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
342 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
343 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
344 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
345 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
346 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
347 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
348 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
349 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
350 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
351 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
352 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
353 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
354 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
355 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
356 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
357 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
358 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
359 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
360 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
361 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
362 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
363 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
364 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
365 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
366 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
367 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
368 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
369 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
370 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
371 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
372 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
373 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
374 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
375 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
376 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
377 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
378 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
379 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
380 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
381 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
382 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
383 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
384 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
385 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
386 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
387 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
388 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
389 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
390 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
391 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
392 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
393 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
394 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
395 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
396 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
397 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
398 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
399 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
400 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
401 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
402 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
403 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
404 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
405 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
406 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
407 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
408 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
409 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
410 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
411 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
412 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
413 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.37
Metatranscriptomes 0.22
Isolates 1.41

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.61
Nodule 0
Rhizoplane 1.63
Rhizosphere 81.41
Stem 0
Stem Tuber 0
Unclassified 4.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25154J39366_1001224 3300002738 Bacteria 9678
2 JGI25158J39367_1000466 3300002739 Bacteria 8290
3 JGI25158J39367_1000534 3300002739 Bacteria 7656
4 JGI25152J39213_1000105 3300002773 Bacteria 58863
5 JGI25150J39212_1000943 3300002774 Bacteria 9322
6 JGI25150J39212_1001335 3300002774 Bacteria 7006
7 JGI25159J45721_1000922 3300002987 Bacteria 12782
8 JGI25159J45721_1001932 3300002987 Bacteria 8269
9 JGI25159J45721_1002414 3300002987 Bacteria 7107
10 JGI25406J46586_10010080 3300003203 Bacteria 4209
11 JGI25153J46596_10001671 3300003215 Bacteria 13152
12 rootL2_10025624 3300003322 Bacteria 5565
13 JGI25160J50197_1002498 3300003354 Bacteria 8550
14 JGI25161J50226_1000852 3300003374 Bacteria 11337
15 JGI25161J50226_1001208 3300003374 Bacteria 8453
16 Ga0055539_1000424 3300003752 Bacteria 15400
17 Ga0055533_1000053 3300003756 Bacteria 199478
18 Ga0055525_1000004 3300003759 Bacteria 888039
19 Ga0055535_1000231 3300003761 Bacteria 58583
20 Ga0055529_1000146 3300003763 Bacteria 100947
21 Ga0055529_1000385 3300003763 Bacteria 47717
22 Ga0055529_1000410 3300003763 Bacteria 45041
23 Ga0055526_1000121 3300003771 Bacteria 68852
24 Ga0055526_1000136 3300003771 Bacteria 65004
25 Ga0055526_1000152 3300003771 Bacteria 61430
26 Ga0055526_1003133 3300003771 Bacteria 10714
27 Ga0055537_1000099 3300003773 Bacteria 65218
28 Ga0055537_1001156 3300003773 Bacteria 11287
29 Ga0055524_1000222 3300003775 Bacteria 60317
30 Ga0055524_1002051 3300003775 Bacteria 10710
31 Ga0055524_1017502 3300003775 Bacteria 2527
32 Ga0055534_1000023 3300003784 Bacteria 135301
33 Ga0055534_1001189 3300003784 Bacteria 10935
34 Ga0055528_1000119 3300003790 Bacteria 62428
35 Ga0055528_1002187 3300003790 Bacteria 10689
36 Ga0055530_10000125 3300003791 Bacteria 66757
37 Ga0055530_10009012 3300003791 Bacteria 3897
38 Ga0055530_10009038 3300003791 Bacteria 3885
39 Ga0055531_10000019 3300003794 Bacteria 170825
40 Ga0055531_10000577 3300003794 Bacteria 31960
41 Ga0055531_10011253 3300003794 Bacteria 4341
42 Ga0055543_1000072 3300004625 Bacteria 88781
43 Ga0055543_1001583 3300004625 Bacteria 8778
44 Ga0065165_1000039 3300005262 Bacteria 208372
45 Ga0065165_1000269 3300005262 Bacteria 88841
46 Ga0065707_10110726 3300005295 Bacteria 2419
47 Ga0065707_10134002 3300005295 Bacteria 1872
48 Ga0065707_10137714 3300005295 Bacteria 1816
49 Ga0070658_10015986 3300005327 Bacteria 6003
50 Ga0070658_10397369 3300005327 Bacteria 1184
51 Ga0070676_10343378 3300005328 Bacteria 1024
52 Ga0070676_10345944 3300005328 Bacteria 1021
53 Ga0070683_100023859 3300005329 Bacteria 5475
54 Ga0070683_100305645 3300005329 Bacteria 1513
55 Ga0070670_100017935 3300005331 Bacteria 6075
56 Ga0070670_100062682 3300005331 Bacteria 3192
57 Ga0068869_100282140 3300005334 Bacteria 1336
58 Ga0070666_10004170 3300005335 Bacteria 8774
59 Ga0070680_100015253 3300005336 Bacteria 6020
60 Ga0070680_100229986 3300005336 Bacteria 1566
61 Ga0068868_100516988 3300005338 Bacteria 1048
62 Ga0070660_100105712 3300005339 Bacteria 2234
63 Ga0070689_100007082 3300005340 Bacteria 7810
64 Ga0070691_10105251 3300005341 Bacteria 1405
65 Ga0070691_10315439 3300005341 Bacteria 858
66 Ga0070661_100005584 3300005344 Bacteria 8668
67 Ga0070692_10005578 3300005345 Bacteria 5383
68 Ga0070668_100042596 3300005347 Bacteria 3480
69 Ga0070669_100060057 3300005353 Bacteria 2792
70 Ga0070669_100259013 3300005353 Bacteria 1387
71 Ga0070675_100053133 3300005354 Bacteria 3332
72 Ga0070675_100058423 3300005354 Bacteria 3181
73 Ga0070675_100181916 3300005354 Bacteria 1818
74 Ga0070671_100030234 3300005355 Bacteria 4470
75 Ga0070671_100438432 3300005355 Bacteria 1120
76 Ga0070674_100362137 3300005356 Bacteria 1174
77 Ga0070673_100200178 3300005364 Bacteria 1720
78 Ga0070659_100024389 3300005366 Bacteria 4636
79 Ga0070659_100037190 3300005366 Bacteria 3795
80 Ga0070659_100262255 3300005366 Bacteria 1434
81 Ga0070659_100321020 3300005366 Bacteria 1294
82 Ga0070667_100161787 3300005367 Bacteria 1972
83 Ga0070701_10004672 3300005438 Bacteria 5578
84 Ga0070701_10132198 3300005438 Bacteria 1419
85 Ga0070701_10469717 3300005438 Bacteria 811
86 Ga0070711_100162786 3300005439 Bacteria 1693
87 Ga0070705_100018660 3300005440 Bacteria 3639
88 Ga0070705_100098734 3300005440 Bacteria 1838
89 Ga0070700_100078129 3300005441 Bacteria 2130
90 Ga0070700_100353671 3300005441 Unclassified 1090
91 Ga0070694_100010085 3300005444 Bacteria 5811
92 Ga0070694_100061184 3300005444 Bacteria 2569
93 Ga0070694_100428894 3300005444 Bacteria 1040
94 Ga0070678_100010891 3300005456 Bacteria 5578
95 Ga0070678_100012871 3300005456 Bacteria 5219
96 Ga0070678_100103578 3300005456 Bacteria 2211
97 Ga0070662_100254393 3300005457 Bacteria 1413
98 Ga0070662_100438393 3300005457 Bacteria 1083
99 Ga0070681_10176741 3300005458 Bacteria 2057
100 Ga0070681_10194675 3300005458 Bacteria 1946
101 Ga0068867_100030441 3300005459 Bacteria 3894
102 Ga0068867_100668330 3300005459 Bacteria 913
103 Ga0068867_100789963 3300005459 Bacteria 845
104 Ga0070685_10468655 3300005466 Bacteria 886
105 Ga0070707_100298740 3300005468 Bacteria 1565
106 Ga0070698_100097943 3300005471 Bacteria 2908
107 Ga0070698_100582505 3300005471 Bacteria 1059
108 Ga0070679_100154176 3300005530 Bacteria 2273
109 Ga0070679_100493908 3300005530 Bacteria 1168
110 Ga0070684_100015656 3300005535 Bacteria 6185
111 Ga0070684_100045432 3300005535 Bacteria 3803
112 Ga0070697_100190836 3300005536 Bacteria 1739
113 Ga0070697_100778027 3300005536 Bacteria 846
114 Ga0068853_100028936 3300005539 Bacteria 4664
115 Ga0070672_100022151 3300005543 Bacteria 4661
116 Ga0070672_100154663 3300005543 Bacteria 1899
117 Ga0070672_100185099 3300005543 Bacteria 1737
118 Ga0070672_100422105 3300005543 Bacteria 1146
119 Ga0070686_100035917 3300005544 Bacteria 3064
120 Ga0070686_100042747 3300005544 Bacteria 2840
121 Ga0070686_100087855 3300005544 Unclassified 2073
122 Ga0070695_100484018 3300005545 Bacteria 954
123 Ga0070693_100017268 3300005547 Bacteria 3748
124 Ga0070693_100053573 3300005547 Bacteria 2317
125 Ga0070665_100003603 3300005548 Bacteria 16402
126 Ga0070665_100027519 3300005548 Bacteria 5727
127 Ga0070665_100299575 3300005548 Bacteria 1611
128 Ga0070704_100021477 3300005549 Bacteria 4186
129 Ga0070704_100034212 3300005549 Bacteria 3443
130 Ga0070704_100214547 3300005549 Bacteria 1561
131 Ga0070704_100438648 3300005549 Bacteria 1122
132 Ga0068855_100000063 3300005563 Bacteria 131058
133 Ga0068855_100009185 3300005563 Bacteria 11938
134 Ga0068855_100113713 3300005563 Bacteria 3105
135 Ga0068855_100164904 3300005563 Bacteria 2512
136 Ga0070664_100010472 3300005564 Bacteria 7516
137 Ga0070664_100014575 3300005564 Bacteria 6413
138 Ga0070664_100014919 3300005564 Bacteria 6339
139 Ga0070664_100089497 3300005564 Bacteria 2663
140 Ga0068857_100096315 3300005577 Bacteria 2652
141 Ga0068857_100521350 3300005577 Bacteria 1117
142 Ga0068854_100056508 3300005578 Bacteria 2829
143 Ga0068856_100003740 3300005614 Bacteria 15249
144 Ga0068856_100036785 3300005614 Bacteria 4801
145 Ga0070702_100000568 3300005615 Bacteria 13456
146 Ga0068852_100002933 3300005616 Bacteria 11850
147 Ga0068852_100012151 3300005616 Bacteria 6522
148 Ga0068859_100000441 3300005617 Bacteria 41723
149 Ga0068859_100003795 3300005617 Bacteria 15414
150 Ga0068859_100022271 3300005617 Bacteria 6353
151 Ga0068859_100025928 3300005617 Bacteria 5880
152 Ga0068859_100191375 3300005617 Bacteria 2130
153 Ga0068859_100459198 3300005617 Bacteria 1370
154 Ga0068859_100561160 3300005617 Bacteria 1236
155 Ga0068864_100048705 3300005618 Bacteria 3644
156 Ga0068864_100334450 3300005618 Unclassified 1426
157 Ga0068866_10163789 3300005718 Bacteria 1299
158 Ga0068861_100000008 3300005719 Bacteria 85041
159 Ga0068861_100115257 3300005719 Bacteria 2159
160 Ga0068861_100144959 3300005719 Bacteria 1942
161 Ga0068861_100424961 3300005719 Bacteria 1185
162 Ga0068861_100589324 3300005719 Bacteria 1019
163 Ga0068851_10010122 3300005834 Bacteria 4394
164 Ga0068863_100012404 3300005841 Bacteria 8228
165 Ga0068863_100014402 3300005841 Bacteria 7616
166 Ga0068863_100048554 3300005841 Bacteria 4025
167 Ga0068863_100216891 3300005841 Bacteria 1843
168 Ga0068858_100002170 3300005842 Bacteria 19909
169 Ga0068858_100064087 3300005842 Bacteria 3401
170 Ga0068858_100301281 3300005842 Bacteria 1529
171 Ga0068858_100742802 3300005842 Bacteria 956
172 Ga0068860_100011984 3300005843 Bacteria 8541
173 Ga0068860_100107393 3300005843 Bacteria 2667
174 Ga0068860_100204460 3300005843 Bacteria 1914
175 Ga0068860_100219936 3300005843 Bacteria 1844
176 Ga0068860_100924484 3300005843 Bacteria 889
177 Ga0068862_100020814 3300005844 Bacteria 5480
178 Ga0068862_100040994 3300005844 Bacteria 3938
179 Ga0068862_100350855 3300005844 Bacteria 1369
180 Ga0068862_100363470 3300005844 Bacteria 1346
181 Ga0081455_10002207 3300005937 Bacteria 23184
182 Ga0081455_10012865 3300005937 Bacteria 8308
183 Ga0081538_10030003 3300005981 Bacteria 3701
184 Ga0081539_10000028 3300005985 Bacteria 328182
185 Ga0070716_100061539 3300006173 Bacteria 2173
186 Ga0097621_100000841 3300006237 Bacteria 21627
187 Ga0097621_100022866 3300006237 Bacteria 4857
188 Ga0097621_100030587 3300006237 Bacteria 4263
189 Ga0097621_100541583 3300006237 Bacteria 1059
190 Ga0075370_10002481 3300006353 Bacteria 8555
191 Ga0068871_100000019 3300006358 Bacteria 86487
192 Ga0068871_100028262 3300006358 Bacteria 4395
193 Ga0068871_100031654 3300006358 Bacteria 4173
194 Ga0075428_100078847 3300006844 Bacteria 3595
195 Ga0075428_100092983 3300006844 Bacteria 3288
196 Ga0075428_100108639 3300006844 Bacteria 3023
197 Ga0075428_100448540 3300006844 Bacteria 1382
198 Ga0075428_100511036 3300006844 Bacteria 1285
199 Ga0075428_100609356 3300006844 Bacteria 1166
200 Ga0075428_100734809 3300006844 Bacteria 1051
201 Ga0075430_100010028 3300006846 Bacteria 8016
202 Ga0075430_100010127 3300006846 Bacteria 7977
203 Ga0075431_100003452 3300006847 Bacteria 15337
204 Ga0075433_10000411 3300006852 Bacteria 27322
205 Ga0075433_10003752 3300006852 Bacteria 11756
206 Ga0075433_10005518 3300006852 Bacteria 9933
207 Ga0075433_10036020 3300006852 Bacteria 4259
208 Ga0075433_10037238 3300006852 Bacteria 4195
209 Ga0075433_10105012 3300006852 Bacteria 2503
210 Ga0075434_100001953 3300006871 Bacteria 17878
211 Ga0075434_100154989 3300006871 Bacteria 2310
212 Ga0075434_100324508 3300006871 Bacteria 1560
213 Ga0075429_100008741 3300006880 Bacteria 8807
214 Ga0075429_100034820 3300006880 Bacteria 4376
215 Ga0075429_100036067 3300006880 Bacteria 4301
216 Ga0075429_100120324 3300006880 Bacteria 2295
217 Ga0068865_100080691 3300006881 Bacteria 2334
218 Ga0068865_100106730 3300006881 Bacteria 2059
219 Ga0068865_100129906 3300006881 Bacteria 1886
220 Ga0068865_100244313 3300006881 Bacteria 1414
221 Ga0068865_100524776 3300006881 Bacteria 991
222 Ga0097620_100000441 3300006931 Bacteria 41723
223 Ga0097620_100003795 3300006931 Bacteria 15414
224 Ga0097620_100022271 3300006931 Bacteria 6353
225 Ga0097620_100025927 3300006931 Bacteria 5880
226 Ga0097620_100191380 3300006931 Bacteria 2130
227 Ga0097620_100459183 3300006931 Bacteria 1370
228 Ga0097620_100561214 3300006931 Bacteria 1236
229 Ga0075435_100015509 3300007076 Bacteria 5730
230 Ga0099795_10000067 3300007788 Bacteria 18331
231 Ga0105244_10012434 3300009036 Bacteria 5029
232 Ga0105240_10001628 3300009093 Bacteria 38096
233 Ga0105240_10007565 3300009093 Bacteria 15741
234 Ga0105240_10021958 3300009093 Bacteria 8477
235 Ga0105240_10131188 3300009093 Bacteria 3006
236 Ga0105240_10406884 3300009093 Bacteria 1531
237 Ga0105240_10443349 3300009093 Bacteria 1454
238 Ga0111539_10002045 3300009094 Bacteria 26976
239 Ga0111539_10002579 3300009094 Bacteria 23990
240 Ga0111539_10007328 3300009094 Bacteria 14125
241 Ga0111539_10013501 3300009094 Bacteria 10208
242 Ga0111539_10028444 3300009094 Bacteria 6819
243 Ga0111539_10149002 3300009094 Bacteria 2739
244 Ga0111539_10423880 3300009094 Bacteria 1550
245 Ga0111539_10441345 3300009094 Unclassified 1515
246 Ga0105245_10588831 3300009098 Bacteria 1138
247 Ga0105247_10000867 3300009101 Bacteria 22861
248 Ga0105247_10072183 3300009101 Bacteria 2160
249 Ga0105247_10126455 3300009101 Bacteria 1662
250 Ga0114129_10003612 3300009147 Bacteria 21750
251 Ga0114129_10009126 3300009147 Bacteria 14136
252 Ga0114129_10036200 3300009147 Bacteria 6971
253 Ga0114129_10055243 3300009147 Bacteria 5566
254 Ga0114129_10141465 3300009147 Bacteria 3297
255 Ga0114129_10263567 3300009147 Bacteria 2308
256 Ga0114129_10361398 3300009147 Bacteria 1921
257 Ga0114129_10398002 3300009147 Bacteria 1815
258 Ga0105243_10006083 3300009148 Bacteria 9331
259 Ga0105243_10052843 3300009148 Bacteria 3220
260 Ga0105243_10222627 3300009148 Bacteria 1669
261 Ga0105241_10024325 3300009174 Bacteria 4498
262 Ga0105241_10135604 3300009174 Bacteria 1998
263 Ga0105241_10148882 3300009174 Bacteria 1913
264 Ga0105242_10035918 3300009176 Bacteria 3973
265 Ga0105242_10199411 3300009176 Bacteria 1777
266 Ga0105248_10005552 3300009177 Bacteria 13858
267 Ga0105237_10090329 3300009545 Bacteria 3052
268 Ga0105237_10210934 3300009545 Bacteria 1942
269 Ga0105238_10005735 3300009551 Bacteria 12278
270 Ga0105238_10022723 3300009551 Bacteria 6392
271 Ga0105238_10144024 3300009551 Bacteria 2360
272 Ga0105238_10172259 3300009551 Bacteria 2141
273 Ga0105238_10244762 3300009551 Bacteria 1771
274 Ga0105249_10123845 3300009553 Bacteria 2460
275 Ga0105249_10239636 3300009553 Bacteria 1793
276 Ga0105249_10443150 3300009553 Bacteria 1336
277 Ga0105249_10719240 3300009553 Unclassified 1059
278 Ga0099796_10000050 3300010159 Bacteria 21279
279 Ga0105239_10003698 3300010375 Bacteria 18630
280 Ga0105239_10048257 3300010375 Bacteria 4669
281 Ga0105239_10448154 3300010375 Bacteria 1464
282 Ga0157373_10106539 3300013100 Bacteria 1971
283 Ga0157371_10379110 3300013102 Bacteria 1032
284 Ga0157370_10449027 3300013104 Bacteria 1185
285 Ga0157369_10007931 3300013105 Bacteria 12208
286 Ga0157369_10021678 3300013105 Bacteria 7184
287 Ga0157369_10041753 3300013105 Bacteria 5006
288 Ga0157369_10051231 3300013105 Bacteria 4467
289 Ga0157374_10078646 3300013296 Bacteria 3124
290 Ga0157374_10084191 3300013296 Bacteria 3023
291 Ga0157374_10519622 3300013296 Bacteria 1196
292 Ga0157378_10109210 3300013297 Bacteria 2534
293 Ga0163162_10000021 3300013306 Bacteria 214873
294 Ga0163162_10089481 3300013306 Bacteria 3159
295 Ga0157372_10006490 3300013307 Bacteria 12448
296 Ga0157372_10089173 3300013307 Bacteria 3503
297 Ga0157372_10346842 3300013307 Bacteria 1730
298 Ga0157372_10386870 3300013307 Bacteria 1630
299 Ga0157375_10012567 3300013308 Bacteria 7514
300 Ga0157375_10313699 3300013308 Unclassified 1732
301 Ga0157375_10707575 3300013308 Bacteria 1161
302 Ga0163163_10023119 3300014325 Bacteria 5896
303 Ga0157377_10000030 3300014745 Bacteria 124439
304 Ga0157379_10146708 3300014968 Bacteria 2128
305 Ga0157379_10165118 3300014968 Bacteria 1998
306 Ga0157376_10010196 3300014969 Bacteria 6861
307 Ga0213872_10000733 3300021361 Bacteria 24466
308 Ga0213872_10001492 3300021361 Bacteria 15102
309 Ga0213872_10032703 3300021361 Bacteria 2383
310 Ga0209436_100049 3300025208 Bacteria 66162
311 Ga0209436_100093 3300025208 Bacteria 44019
312 Ga0209436_112250 3300025208 Bacteria 1465
313 Ga0209674_100039 3300025226 Bacteria 402292
314 Ga0209563_100013 3300025230 Bacteria 941463
315 Ga0209563_100080 3300025230 Bacteria 199504
316 Ga0209437_108461 3300025233 Bacteria 1644
317 Ga0209258_100305 3300025242 Bacteria 78801
318 Ga0209258_100419 3300025242 Bacteria 50513
319 Ga0207425_1000001 3300025245 Bacteria 2525432
320 Ga0207425_1000033 3300025245 Bacteria 245540
321 Ga0207425_1000536 3300025245 Bacteria 22859
322 Ga0209646_1000010 3300025246 Bacteria 573803
323 Ga0209646_1000249 3300025246 Bacteria 54511
324 Ga0209026_1000011 3300025250 Bacteria 507291
325 Ga0209677_100086 3300025253 Bacteria 112759
326 Ga0209677_100160 3300025253 Bacteria 60301
327 Ga0209759_1000034 3300025256 Bacteria 271209
328 Ga0209129_1000003 3300025258 Bacteria 903689
329 Ga0209129_1001164 3300025258 Bacteria 15177
330 Ga0209233_1000104 3300025261 Bacteria 272675
331 Ga0209565_1000003 3300025263 Bacteria 1099648
332 Ga0209565_1000162 3300025263 Bacteria 89049
333 Ga0209565_1000305 3300025263 Bacteria 45984
334 Ga0209565_1000474 3300025263 Bacteria 29679
335 Ga0209565_1003162 3300025263 Bacteria 5477
336 Ga0209455_1000037 3300025272 Bacteria 464097
337 Ga0209455_1000053 3300025272 Bacteria 365949
338 Ga0209673_1000003 3300025273 Bacteria 980859
339 Ga0209673_1018570 3300025273 Bacteria 2523
340 Ga0209130_1000084 3300025284 Bacteria 160070
341 Ga0209130_1000236 3300025284 Bacteria 71244
342 Ga0209130_1001409 3300025284 Bacteria 16043
343 Ga0209675_1000003 3300025291 Bacteria 1003982
344 Ga0209675_1001160 3300025291 Bacteria 16000
345 Ga0209025_1002882 3300025294 Bacteria 17233
346 Ga0209564_1000009 3300025295 Bacteria 950196
347 Ga0209564_1000012 3300025295 Bacteria 792078
348 Ga0209564_1000068 3300025295 Bacteria 311171
349 Ga0209564_1000748 3300025295 Bacteria 45984
350 Ga0209564_1006494 3300025295 Bacteria 6289
351 Ga0209758_1000041 3300025297 Bacteria 410328
352 Ga0209758_1001010 3300025297 Bacteria 37319
353 Ga0209050_1000010 3300025298 Bacteria 980454
354 Ga0209050_1000011 3300025298 Bacteria 914037
355 Ga0209050_1001581 3300025298 Bacteria 23591
356 Ga0209256_1000255 3300025299 Bacteria 94783
357 Ga0209256_1000295 3300025299 Bacteria 87239
358 Ga0209256_1000402 3300025299 Bacteria 68470
359 Ga0207426_1002123 3300025302 Bacteria 13591
360 Ga0207426_1016115 3300025302 Bacteria 2693
361 Ga0209051_1008346 3300025303 Bacteria 5495
362 Ga0209051_1013496 3300025303 Bacteria 3886
363 Ga0209257_1000003 3300025304 Bacteria 1702593
364 Ga0209257_1000009 3300025304 Bacteria 1205047
365 Ga0209257_1000117 3300025304 Bacteria 227328
366 Ga0209257_1006037 3300025304 Bacteria 8085
367 Ga0207642_10086036 3300025899 Bacteria 1540
368 Ga0207710_10000520 3300025900 Bacteria 23614
369 Ga0207645_10004509 3300025907 Bacteria 10291
370 Ga0207643_10009264 3300025908 Bacteria 5290
371 Ga0207643_10050180 3300025908 Bacteria 2366
372 Ga0207705_10270853 3300025909 Bacteria 1298
373 Ga0207705_10354108 3300025909 Bacteria 1131
374 Ga0207684_10483051 3300025910 Bacteria 1062
375 Ga0207654_10001508 3300025911 Bacteria 12274
376 Ga0207654_10136592 3300025911 Bacteria 1558
377 Ga0207654_10347936 3300025911 Bacteria 1020
378 Ga0207707_10274620 3300025912 Bacteria 1460
379 Ga0207695_10000003 3300025913 Bacteria 1368691
380 Ga0207695_10102135 3300025913 Bacteria 2861
381 Ga0207695_10526231 3300025913 Bacteria 1064
382 Ga0207663_10026383 3300025916 Bacteria 3372
383 Ga0207660_10069659 3300025917 Bacteria 2555
384 Ga0207660_10117847 3300025917 Bacteria 2008
385 Ga0207657_10043116 3300025919 Bacteria 3976
386 Ga0207657_10050430 3300025919 Bacteria 3623
387 Ga0207649_10010529 3300025920 Bacteria 5084
388 Ga0207652_10124500 3300025921 Bacteria 2296
389 Ga0207652_10442566 3300025921 Bacteria 1172
390 Ga0207646_10594937 3300025922 Bacteria 993
391 Ga0207694_10000005 3300025924 Bacteria 823704
392 Ga0207694_10005647 3300025924 Bacteria 9597
393 Ga0207694_10057255 3300025924 Bacteria 3030
394 Ga0207694_10145650 3300025924 Bacteria 1906
395 Ga0207650_10029590 3300025925 Bacteria 3939
396 Ga0207650_10053235 3300025925 Bacteria 2999
397 Ga0207650_10064382 3300025925 Bacteria 2744
398 Ga0207659_10274022 3300025926 Bacteria 1377
399 Ga0207644_10013538 3300025931 Bacteria 5441
400 Ga0207644_10017860 3300025931 Bacteria 4797
401 Ga0207644_10132998 3300025931 Bacteria 1907
402 Ga0207644_10489317 3300025931 Bacteria 1014
403 Ga0207690_10043019 3300025932 Bacteria 2970
404 Ga0207690_10139473 3300025932 Bacteria 1785
405 Ga0207706_10045942 3300025933 Bacteria 3867
406 Ga0207706_10115444 3300025933 Bacteria 2361
407 Ga0207706_10195689 3300025933 Bacteria 1773
408 Ga0207706_10241782 3300025933 Bacteria 1578
409 Ga0207706_10279300 3300025933 Bacteria 1457
410 Ga0207686_10030730 3300025934 Bacteria 3184
411 Ga0207686_10102739 3300025934 Bacteria 1911
412 Ga0207709_10034206 3300025935 Bacteria 2993
413 Ga0207669_10154207 3300025937 Bacteria 1613
414 Ga0207704_10021405 3300025938 Bacteria 3443
415 Ga0207704_10092790 3300025938 Bacteria 1988
416 Ga0207704_10106185 3300025938 Bacteria 1886
417 Ga0207665_10422426 3300025939 Bacteria 1019
418 Ga0207691_10005747 3300025940 Bacteria 12000
419 Ga0207691_10006707 3300025940 Bacteria 11105
420 Ga0207691_10021117 3300025940 Bacteria 6151
421 Ga0207691_10046396 3300025940 Bacteria 3993
422 Ga0207691_10235335 3300025940 Bacteria 1585
423 Ga0207691_10293541 3300025940 Bacteria 1398
424 Ga0207711_10008227 3300025941 Bacteria 8732
425 Ga0207711_10160469 3300025941 Bacteria 2034
426 Ga0207711_10399152 3300025941 Bacteria 1277
427 Ga0207689_10101624 3300025942 Bacteria 2362
428 Ga0207661_10008898 3300025944 Bacteria 7188
429 Ga0207661_10410466 3300025944 Bacteria 1229
430 Ga0207679_10009038 3300025945 Bacteria 6367
431 Ga0207667_10000041 3300025949 Bacteria 272265
432 Ga0207667_10004608 3300025949 Bacteria 16907
433 Ga0207651_10138514 3300025960 Bacteria 1876
434 Ga0207712_10076109 3300025961 Bacteria 2428
435 Ga0207712_10083361 3300025961 Bacteria 2333
436 Ga0207712_10218653 3300025961 Bacteria 1522
437 Ga0207668_10037273 3300025972 Bacteria 3253
438 Ga0207668_10192992 3300025972 Bacteria 1615
439 Ga0207640_10076416 3300025981 Bacteria 2273
440 Ga0207658_10019359 3300025986 Bacteria 4707
441 Ga0207658_10432985 3300025986 Bacteria 1162
442 Ga0207677_10139141 3300026023 Unclassified 1856
443 Ga0207703_10005109 3300026035 Bacteria 10616
444 Ga0207703_10416986 3300026035 Bacteria 1249
445 Ga0207703_10458875 3300026035 Bacteria 1191
446 Ga0207639_10116592 3300026041 Bacteria 2187
447 Ga0207639_10151373 3300026041 Bacteria 1943
448 Ga0207678_10090939 3300026067 Bacteria 2608
449 Ga0207678_10165557 3300026067 Bacteria 1888
450 Ga0207678_10333065 3300026067 Bacteria 1307
451 Ga0207708_10086901 3300026075 Bacteria 2407
452 Ga0207702_10075642 3300026078 Bacteria 2909
453 Ga0207702_10196720 3300026078 Bacteria 1866
454 Ga0207702_10297543 3300026078 Bacteria 1531
455 Ga0207641_10002059 3300026088 Bacteria 19097
456 Ga0207641_10094874 3300026088 Bacteria 2617
457 Ga0207641_10247621 3300026088 Bacteria 1663
458 Ga0207641_10449365 3300026088 Bacteria 1245
459 Ga0207641_10608306 3300026088 Bacteria 1071
460 Ga0207648_10013121 3300026089 Bacteria 7724
461 Ga0207648_10092179 3300026089 Bacteria 2649
462 Ga0207648_10168452 3300026089 Bacteria 1936
463 Ga0207676_10177679 3300026095 Bacteria 1861
464 Ga0207674_10010607 3300026116 Bacteria 10425
465 Ga0207674_10067102 3300026116 Bacteria 3612
466 Ga0207674_10114241 3300026116 Bacteria 2672
467 Ga0207674_10393732 3300026116 Bacteria 1339
468 Ga0207674_10660920 3300026116 Bacteria 1009
469 Ga0207675_100000105 3300026118 Bacteria 67191
470 Ga0207675_100008556 3300026118 Bacteria 9626
471 Ga0207675_100032293 3300026118 Bacteria 4876
472 Ga0207675_100152227 3300026118 Bacteria 2202
473 Ga0207675_100900754 3300026118 Bacteria 901
474 Ga0207675_100925587 3300026118 Bacteria 888
475 Ga0207683_10069401 3300026121 Bacteria 3112
476 Ga0207683_10127741 3300026121 Bacteria 2286
477 Ga0207698_10004816 3300026142 Bacteria 8264
478 Ga0207698_10007532 3300026142 Bacteria 6822
479 Ga0210000_1028632 3300027462 Bacteria 867
480 Ga0209179_1000051 3300027512 Bacteria 22662
481 Ga0209982_1006246 3300027552 Bacteria 1731
482 Ga0209588_1019505 3300027671 Bacteria 2117
483 Ga0209971_1016335 3300027682 Bacteria 1760
484 Ga0209998_10021740 3300027717 Bacteria 1379
485 Ga0207428_10000336 3300027907 Bacteria 61182
486 Ga0207428_10027041 3300027907 Bacteria 4778
487 Ga0207428_10166364 3300027907 Bacteria 1672
488 Ga0207428_10372081 3300027907 Bacteria 1049
489 Ga0268266_10004864 3300028379 Bacteria 12745
490 Ga0268266_10104295 3300028379 Bacteria 2503
491 Ga0268265_10000554 3300028380 Bacteria 38099
492 Ga0268265_10043693 3300028380 Bacteria 3333
493 Ga0268265_10083441 3300028380 Bacteria 2530
494 Ga0268264_10010310 3300028381 Bacteria 7732
495 Ga0268264_10075873 3300028381 Bacteria 2859
496 Ga0268264_10193905 3300028381 Bacteria 1854
497 Ga0268264_10508480 3300028381 Bacteria 1176
498 Ga0268264_10909220 3300028381 Bacteria 884
499 Ga0307517_10138605 3300028786 Bacteria 1718
500 Ga0307515_10000358 3300028794 Bacteria 112133
501 Ga0307515_10003592 3300028794 Bacteria 32598
502 Ga0307515_10068791 3300028794 Bacteria 4856
503 Ga0307515_10098920 3300028794 Bacteria 3547
504 Ga0307511_10000260 3300030521 Bacteria 54540
505 Ga0307511_10022959 3300030521 Bacteria 5829
506 Ga0265770_1000368 3300030878 Bacteria 6101
507 Ga0265760_10000354 3300031090 Bacteria 12825
508 Ga0265340_10001593 3300031247 Bacteria 13018
509 Ga0265316_10010858 3300031344 Bacteria 8269
510 Ga0307513_10060565 3300031456 Bacteria 4013
511 Ga0307509_10031569 3300031507 Bacteria 5849
512 Ga0307408_100000076 3300031548 Bacteria 110987
513 Ga0307408_100000936 3300031548 Bacteria 22717
514 Ga0307408_100001516 3300031548 Bacteria 17276
515 Ga0307408_100001827 3300031548 Bacteria 15510
516 Ga0307408_100036171 3300031548 Bacteria 3470
517 Ga0307408_100049655 3300031548 Bacteria 3014
518 Ga0307408_100408391 3300031548 Bacteria 1168
519 Ga0265314_10027975 3300031711 Bacteria 4212
520 Ga0307516_10000678 3300031730 Bacteria 46164
521 Ga0307516_10144758 3300031730 Bacteria 2142
522 Ga0307405_10006554 3300031731 Bacteria 5736
523 Ga0307405_10062255 3300031731 Bacteria 2362
524 Ga0307413_10046651 3300031824 Bacteria 2578
525 Ga0307410_10007781 3300031852 Bacteria 5892
526 Ga0307406_10000321 3300031901 Bacteria 27859
527 Ga0307406_10010098 3300031901 Bacteria 5318
528 Ga0307406_10010348 3300031901 Bacteria 5257
529 Ga0307407_10017795 3300031903 Bacteria 3577
530 Ga0307407_10035454 3300031903 Bacteria 2741
531 Ga0307412_10003280 3300031911 Bacteria 8981
532 Ga0307412_10296339 3300031911 Bacteria 1276
533 Ga0307412_10609069 3300031911 Bacteria 926
534 Ga0307409_100022869 3300031995 Bacteria 4317
535 Ga0307409_100050842 3300031995 Bacteria 3168
536 Ga0307409_100061382 3300031995 Bacteria 2937
537 Ga0307416_100226811 3300032002 Bacteria 1797
538 Ga0307416_100325315 3300032002 Bacteria 1542
539 Ga0307414_10295198 3300032004 Bacteria 1368
540 Ga0307411_10000884 3300032005 Bacteria 11352
541 Ga0307411_10002614 3300032005 Bacteria 8050
542 Ga0307411_10009738 3300032005 Bacteria 5076
543 Ga0307411_10011406 3300032005 Bacteria 4796
544 Ga0307411_10110195 3300032005 Bacteria 1968
545 Ga0307411_10749658 3300032005 Bacteria 855
546 Ga0307415_100015070 3300032126 Bacteria 4566
547 Ga0307415_100117423 3300032126 Bacteria 1987
548 Ga0373959_0004980 3300034820 Bacteria 2167
549 Ga0373940_0001957 3300035088 Bacteria 3888
550 Ga0373939_0000534 3300035114 Bacteria 9569
551 Ga0373939_0017039 3300035114 Bacteria 1925
552 Ga0373943_0016546 3300035170 Bacteria 3365
553 Ga0373955_0259144 3300035172 Bacteria 1044
554 Ga0373931_0000993 3300035691 Bacteria 11992
555 Ga0373925_0019837 3300037068 Bacteria 4891
556 Ga0373925_0135356 3300037068 Bacteria 1925
557 Ga0395900_0188225 3300037418 Bacteria 2094
558 Ga0395900_0280209 3300037418 Bacteria 1659
559 Ga0395898_0017815 3300037466 Bacteria 7248
560 Ga0395898_0263165 3300037466 Bacteria 1645
561 Ga0395901_0025595 3300038443 Bacteria 6057
562 Ga0436361_0136250 3300039447 Bacteria 5625
563 Ga0436361_0264437 3300039447 Bacteria 60444
564 Ga0436361_1082582 3300039447 Bacteria 32081
565 Ga0451847_0648660 3300041503 Bacteria 1039
566 Ga0451849_0265266 3300041505 Bacteria 6000
567 Ga0451853_0496377 3300041512 Bacteria 8699
568 Ga0451853_0713182 3300041512 Bacteria 1248
569 Ga0439431_0001940 3300041997 Bacteria 4581
570 Ga0439445_0005008 3300042004 Bacteria 3008
571 Ga0439445_0005678 3300042004 Bacteria 2851
572 Ga0439448_0002316 3300042005 Bacteria 5154
573 Ga0439432_001055 3300042006 Bacteria 10477
574 Ga0439449_0032722 3300042007 Bacteria 1938
575 Ga0439455_0001981 3300042012 Bacteria 3617
576 Ga0439462_0004063 3300042015 Bacteria 3549
577 Ga0450911_014669 3300042115 Bacteria 1040
578 Ga0450912_001028 3300042116 Bacteria 1596
579 Ga0450888_002547 3300042126 Bacteria 1809
580 Ga0450890_001913 3300042127 Bacteria 2947
581 Ga0450891_000388 3300042129 Bacteria 4601
582 Ga0450892_000867 3300042130 Bacteria 3288
583 Ga0450898_000813 3300042134 Bacteria 3864
584 Ga0450903_005968 3300042138 Bacteria 2033
585 Ga0450889_000728 3300042144 Bacteria 3537
586 Ga0439458_0005193 3300042157 Bacteria 2932
587 Ga0439458_0032609 3300042157 Bacteria 1246
588 Ga0439434_0001142 3300042435 Bacteria 7677
589 Ga0450893_0019236 3300042532 Bacteria 1167
590 Ga0451577_0005324 3300042876 Bacteria 13223
591 Ga0466969_0000005 3300044656 Bacteria 167170
592 Ga0466969_0005826 3300044656 Bacteria 6548
593 Ga0466969_0058212 3300044656 Bacteria 1881
594 Ga0466972_0000106 3300044658 Bacteria 72246
595 Ga0466982_0015008 3300044672 Bacteria 4221
596 Ga0453683_0002236 3300044673 Bacteria 15304
597 Ga0466965_0000091 3300044683 Bacteria 26412
598 Ga0466965_0001063 3300044683 Bacteria 10654
599 Ga0466965_0041189 3300044683 Bacteria 2275
600 Ga0466966_0000955 3300044684 Bacteria 18511
601 Ga0466966_0001186 3300044684 Bacteria 16728
602 Ga0466966_0028121 3300044684 Bacteria 3663
603 Ga0466961_0010937 3300044693 Bacteria 5797
604 Ga0466961_0017431 3300044693 Bacteria 4613
605 Ga0466961_0056893 3300044693 Bacteria 2491
606 Ga0466961_0164015 3300044693 Bacteria 1384
607 Ga0466963_0027954 3300044694 Bacteria 3616
608 Ga0466963_0213204 3300044694 Bacteria 1352
609 Ga0466963_0265594 3300044694 Bacteria 1205
610 Ga0466964_0001409 3300044706 Bacteria 8206
611 Ga0466964_0002828 3300044706 Bacteria 6253
612 Ga0466964_0003102 3300044706 Bacteria 6046
613 Ga0466964_0013712 3300044706 Bacteria 3075
614 Ga0466964_0018958 3300044706 Bacteria 2643
615 Ga0453684_0010080 3300044712 Bacteria 16237
616 Ga0466971_0000535 3300044719 Bacteria 15053
617 Ga0466971_0009762 3300044719 Bacteria 4190
618 Ga0466968_0006005 3300044735 Bacteria 4556
619 Ga0466968_0021144 3300044735 Bacteria 2633
620 Ga0466968_0192889 3300044735 Bacteria 951
621 Ga0466970_0002673 3300044765 Bacteria 8600
622 Ga0466970_0006799 3300044765 Bacteria 5726
623 Ga0466970_0083921 3300044765 Bacteria 1724
624 Ga0466970_0132273 3300044765 Bacteria 1371
625 Ga0466970_0140398 3300044765 Bacteria 1330
626 Ga0466957_0002468 3300044842 Bacteria 9934
627 Ga0466957_0015984 3300044842 Bacteria 4386
628 Ga0466960_0113285 3300044901 Bacteria 1412
629 Ga0466959_0010650 3300045049 Bacteria 6584
630 Ga0466959_0013362 3300045049 Bacteria 5952
631 Ga0466959_0068087 3300045049 Bacteria 2580
632 Ga0451576_0021732 3300045051 Bacteria 6967
633 Ga0451576_0058062 3300045051 Bacteria 4044
634 Ga0466958_0275115 3300045836 Bacteria 1079
635 Ga0466967_0013916 3300045976 Bacteria 6241
636 Ga0466967_0014787 3300045976 Bacteria 6096
637 Ga0495617_005190 3300046452 Bacteria 4649
638 Ga0495627_018520 3300046453 Bacteria 2346
639 Ga0495603_0282698 3300046455 Bacteria 954
640 Ga0495590_0000001 3300046457 Bacteria 762984
641 Ga0495590_0010101 3300046457 Bacteria 3563
642 Ga0495590_0035151 3300046457 Bacteria 1750
643 Ga0495638_0000086 3300046460 Bacteria 152781
644 Ga0495638_0000350 3300046460 Bacteria 57915
645 Ga0495638_0014595 3300046460 Bacteria 5302
646 Ga0495638_0014709 3300046460 Bacteria 5278
647 Ga0495638_0019958 3300046460 Bacteria 4431
648 Ga0495638_0020072 3300046460 Bacteria 4417
649 Ga0495638_0028670 3300046460 Bacteria 3592
650 Ga0495638_0176500 3300046460 Bacteria 1222
651 Ga0495650_0000118 3300046471 Bacteria 187358
652 Ga0495650_0000891 3300046471 Bacteria 35192
653 Ga0495650_0001458 3300046471 Bacteria 22665
654 Ga0495605_0000168 3300046474 Bacteria 82889
655 Ga0495605_0019305 3300046474 Bacteria 3644
656 Ga0495605_0122918 3300046474 Bacteria 1175
657 Ga0495639_0007427 3300046475 Bacteria 4705
658 Ga0495584_0000010 3300046491 Bacteria 225095
659 Ga0495584_0028771 3300046491 Bacteria 2817
660 Ga0495584_0040472 3300046491 Bacteria 2353
661 Ga0495584_0067677 3300046491 Bacteria 1794
662 Ga0495584_0246846 3300046491 Bacteria 907
663 Ga0495585_0000004 3300046492 Bacteria 348260
664 Ga0495585_0001618 3300046492 Bacteria 17318
665 Ga0495585_0010200 3300046492 Bacteria 5608
666 Ga0495585_0023561 3300046492 Bacteria 3532
667 Ga0495596_0001315 3300046500 Bacteria 14321
668 Ga0495596_0120301 3300046500 Bacteria 1019
669 Ga0495607_0000958 3300046501 Bacteria 26666
670 Ga0495607_0002458 3300046501 Bacteria 15061
671 Ga0495607_0023658 3300046501 Bacteria 3842
672 Ga0495607_0043655 3300046501 Bacteria 2649
673 Ga0495607_0212527 3300046501 Bacteria 951
674 Ga0495583_0000084 3300046506 Bacteria 165375
675 Ga0495583_0000532 3300046506 Bacteria 53953
676 Ga0495583_0019922 3300046506 Bacteria 3490
677 Ga0495606_0000064 3300046507 Bacteria 183631
678 Ga0495606_0000451 3300046507 Bacteria 67193
679 Ga0495606_0001143 3300046507 Bacteria 37675
680 Ga0495606_0002544 3300046507 Bacteria 20979
681 Ga0495606_0004112 3300046507 Bacteria 14780
682 Ga0495606_0007012 3300046507 Bacteria 10225
683 Ga0495606_0012451 3300046507 Bacteria 6818
684 Ga0495606_0141829 3300046507 Bacteria 1418
685 Ga0495606_0202092 3300046507 Bacteria 1131
686 Ga0495610_0002903 3300046512 Bacteria 13870
687 Ga0495610_0011359 3300046512 Bacteria 5452
688 Ga0495610_0049968 3300046512 Bacteria 2044
689 Ga0495610_0111048 3300046512 Bacteria 1214
690 Ga0495616_0000344 3300046513 Bacteria 36907
691 Ga0495616_0001031 3300046513 Bacteria 19971
692 Ga0495616_0011373 3300046513 Bacteria 5105
693 Ga0495616_0035441 3300046513 Bacteria 2582
694 Ga0495616_0119360 3300046513 Bacteria 1219
695 Ga0495631_0007133 3300046518 Bacteria 5711
696 Ga0495631_0010371 3300046518 Bacteria 4612
697 Ga0495631_0023975 3300046518 Bacteria 2822
698 Ga0495632_0006637 3300046519 Bacteria 7402
699 Ga0495632_0034251 3300046519 Bacteria 2601
700 Ga0495637_0002319 3300046520 Bacteria 10530
701 Ga0495643_0000123 3300046522 Bacteria 124936
702 Ga0495643_0000603 3300046522 Bacteria 43324
703 Ga0495643_0004621 3300046522 Bacteria 9584
704 Ga0495643_0079979 3300046522 Bacteria 1702
705 Ga0495643_0080583 3300046522 Bacteria 1694
706 Ga0495644_0026437 3300046523 Bacteria 2202
707 Ga0495648_0000001 3300046524 Bacteria 696872
708 Ga0495648_0000007 3300046524 Bacteria 347305
709 Ga0495648_0002814 3300046524 Bacteria 15649
710 Ga0495648_0015680 3300046524 Bacteria 5489
711 Ga0495642_0000715 3300046528 Bacteria 16522
712 Ga0495642_0006269 3300046528 Bacteria 4564
713 Ga0495642_0014751 3300046528 Bacteria 3031
714 Ga0495654_0120518 3300046530 Bacteria 1188
715 Ga0495654_0169673 3300046530 Bacteria 952
716 Ga0495609_0000250 3300046538 Bacteria 50865
717 Ga0495609_0000444 3300046538 Bacteria 34134
718 Ga0495609_0002728 3300046538 Bacteria 10651
719 Ga0495609_0010584 3300046538 Bacteria 4420
720 Ga0495609_0012550 3300046538 Bacteria 4017
721 Ga0495609_0023686 3300046538 Bacteria 2820
722 Ga0495597_0000208 3300046542 Bacteria 53439
723 Ga0495597_0000419 3300046542 Bacteria 36574
724 Ga0495597_0038714 3300046542 Bacteria 2136
725 Ga0495597_0049354 3300046542 Bacteria 1860
726 Ga0495597_0053297 3300046542 Bacteria 1779
727 Ga0495597_0110686 3300046542 Bacteria 1151
728 Ga0495597_0121928 3300046542 Bacteria 1086
729 Ga0495622_0000028 3300046557 Bacteria 133197
730 Ga0495622_0000223 3300046557 Bacteria 44967
731 Ga0495622_0020952 3300046557 Bacteria 3044
732 Ga0495622_0032111 3300046557 Bacteria 2452
733 Ga0495633_0000272 3300046558 Bacteria 60512
734 Ga0495633_0000390 3300046558 Bacteria 46254
735 Ga0495633_0000528 3300046558 Bacteria 38185
736 Ga0495633_0000908 3300046558 Bacteria 25245
737 Ga0495633_0063448 3300046558 Bacteria 1729
738 Ga0495656_0000303 3300046615 Bacteria 17067
739 Ga0495668_0000006 3300046616 Bacteria 553404
740 Ga0495668_0000533 3300046616 Bacteria 47352
741 Ga0495668_0001777 3300046616 Bacteria 19707
742 Ga0495668_0014988 3300046616 Bacteria 4535
743 Ga0495668_0040073 3300046616 Bacteria 2613
744 Ga0495668_0049414 3300046616 Bacteria 2333
745 Ga0495668_0056455 3300046616 Bacteria 2167
746 Ga0495668_0111350 3300046616 Bacteria 1497
747 Ga0495611_0004369 3300046648 Bacteria 6126
748 Ga0495611_0157734 3300046648 Bacteria 1060
749 Ga0495625_0000318 3300046660 Bacteria 73498
750 Ga0495625_0000480 3300046660 Bacteria 59788
751 Ga0495625_0018179 3300046660 Bacteria 5494
752 Ga0495625_0020750 3300046660 Bacteria 5065
753 Ga0495625_0045672 3300046660 Bacteria 3164
754 Ga0495625_0050310 3300046660 Bacteria 2991
755 Ga0495625_0069597 3300046660 Bacteria 2472
756 Ga0495625_0180154 3300046660 Bacteria 1406
757 Ga0495659_0005351 3300046664 Bacteria 4037
758 Ga0495661_0002540 3300046665 Bacteria 14001
759 Ga0495661_0005328 3300046665 Bacteria 9150
760 Ga0495661_0024111 3300046665 Bacteria 3940
761 Ga0495661_0034274 3300046665 Bacteria 3195
762 Ga0495661_0162676 3300046665 Bacteria 1196
763 Ga0495588_0064020 3300046674 Bacteria 1907
764 Ga0495588_0165978 3300046674 Bacteria 1167
765 Ga0495588_0232553 3300046674 Bacteria 972
766 Ga0495670_0036579 3300046691 Bacteria 2446
767 Ga0495670_0064437 3300046691 Bacteria 1846
768 Ga0495670_0081718 3300046691 Bacteria 1646
769 Ga0495670_0135354 3300046691 Bacteria 1286
770 Ga0495671_0016085 3300046692 Bacteria 4000
771 Ga0495671_0017712 3300046692 Bacteria 3789
772 Ga0495649_0019717 3300046694 Bacteria 3786
773 Ga0495649_0027532 3300046694 Bacteria 3153
774 Ga0495649_0099329 3300046694 Bacteria 1548
775 Ga0495649_0146971 3300046694 Bacteria 1239
776 Ga0495649_0191458 3300046694 Bacteria 1065
777 Ga0495589_0000376 3300046794 Bacteria 34281
778 Ga0495589_0010597 3300046794 Bacteria 4794
779 Ga0495660_0035867 3300046810 Bacteria 2768
780 Ga0495660_0087708 3300046810 Bacteria 1622
781 Ga0495581_0015444 3300047315 Bacteria 4433
782 Ga0495604_0020386 3300047317 Bacteria 5295
783 Ga0495672_0000429 3300047320 Bacteria 50347
784 Ga0495672_0083853 3300047320 Bacteria 1769
785 Ga0495672_0091994 3300047320 Bacteria 1663
786 Ga0495680_0293573 3300047322 Bacteria 1143
787 Ga0495683_0023317 3300047323 Bacteria 3180
788 Ga0495687_000054 3300047443 Bacteria 194607
789 Ga0495687_000779 3300047443 Bacteria 34361
790 Ga0495687_000817 3300047443 Bacteria 33358
791 Ga0495687_064590 3300047443 Bacteria 1493
792 Ga0495677_0000012 3300047445 Bacteria 146763
793 Ga0495677_0006316 3300047445 Bacteria 4476
794 Ga0495677_0037851 3300047445 Bacteria 1762
795 Ga0495677_0040610 3300047445 Bacteria 1701
796 Ga0495677_0111423 3300047445 Bacteria 1040
797 Ga0495679_016243 3300047446 Bacteria 2697
798 Ga0495685_027116 3300047447 Bacteria 1970
799 Ga0495681_0009145 3300047470 Bacteria 6132
800 Ga0495681_0059052 3300047470 Bacteria 1775
801 Ga0495686_0020170 3300047472 Bacteria 4447
802 Ga0495686_0130037 3300047472 Bacteria 1494
803 Ga0495686_0131234 3300047472 Bacteria 1485
804 Ga0495626_0002106 3300048091 Bacteria 14464
805 Ga0495626_0025644 3300048091 Bacteria 2880
806 Ga0495626_0079012 3300048091 Bacteria 1464
807 Ga0496100_0282290 3300048903 Bacteria 1238
808 Ga0496102_0002316 3300048905 Bacteria 16258
809 Ga0496102_0091702 3300048905 Bacteria 2813
810 Ga0496102_0176673 3300048905 Bacteria 2011
811 Ga0496103_0108383 3300048906 Bacteria 1763
812 Ga0496104_0012260 3300048907 Bacteria 7703
813 Ga0496105_0000979 3300048908 Bacteria 19645
814 Ga0496109_0166548 3300048912 Bacteria 2067
815 Ga0496111_0189330 3300048914 Bacteria 1530
816 Ga0496112_0045626 3300048915 Bacteria 4297
817 Ga0496113_0215457 3300048916 Bacteria 1529
818 Ga0496114_0014851 3300048917 Bacteria 6258
819 Ga0496114_0173236 3300048917 Bacteria 1882
820 Ga0496115_0008139 3300048918 Bacteria 7746
821 Ga0496115_0009205 3300048918 Bacteria 7332
822 Ga0496121_0006502 3300048924 Bacteria 14456
823 Ga0496122_0018277 3300048925 Bacteria 6489
824 Ga0496123_0015723 3300048926 Bacteria 6190
825 Ga0496124_0028236 3300048927 Bacteria 5022
826 Ga0496124_0059867 3300048927 Bacteria 3197
827 Ga0496125_0023876 3300048928 Bacteria 5634
828 Ga0495678_000313 3300049459 Bacteria 51964
829 Ga0495678_004914 3300049459 Bacteria 7554
830 Ga0495682_0000775 3300049460 Bacteria 20330
831 Ga0495682_0013628 3300049460 Bacteria 3092
832 Ga0495682_0123480 3300049460 Bacteria 927
833 Ga0501034_0150550 3300049571 Bacteria 2303
834 Ga0501034_0173737 3300049571 Bacteria 2121
835 Ga0501042_0161158 3300049578 Bacteria 1619
836 Ga0501042_0377206 3300049578 Bacteria 1027
837 Ga0501068_0001338 3300049584 Bacteria 13060
838 Ga0501070_0017362 3300049586 Bacteria 6041
839 Ga0501071_0009268 3300049587 Bacteria 6549
840 Ga0501073_0006004 3300049589 Bacteria 9060
841 Ga0501073_0103726 3300049589 Bacteria 1974
842 Ga0501077_0239070 3300049593 Bacteria 1154
843 Ga0501080_0009316 3300049742 Bacteria 8952
844 Ga0501081_0109829 3300049743 Bacteria 1957
845 Ga0501083_0063536 3300049744 Bacteria 2462
846 Ga0501262_003322 3300049759 Bacteria 1839
847 nmdc:mga03683_171805_c1 3300050489 Bacteria 985
848 nmdc:mga0yw44_128417_c1 3300050492 Bacteria 1639
849 nmdc:mga0k408_11650_c1 3300050493 Bacteria 4792
850 nmdc:mga07m45_11077_c2 3300050496 Bacteria 2359
851 nmdc:mga07m45_3734_c1 3300050496 Bacteria 7370
852 nmdc:mga05p37_142741_c1 3300050507 Bacteria 2933
853 nmdc:mga05p37_164319_c1 3300050507 Bacteria 2710
854 nmdc:mga05p37_189147_c1 3300050507 Bacteria 2501
855 nmdc:mga05p37_210095_c1 3300050507 Bacteria 2353
856 nmdc:mga05p37_21554_c2 3300050507 Bacteria 5798
857 nmdc:mga05p37_26674_c1 3300050507 Bacteria 7026
858 nmdc:mga05p37_37384_c1 3300050507 Bacteria 5952
859 nmdc:mga05p37_9416_c1 3300050507 Bacteria 11564
860 nmdc:mga09592_209928_c1 3300050508 Bacteria 1687
861 nmdc:mga09592_215924_c1 3300050508 Bacteria 1662
862 nmdc:mga09592_8693_c1 3300050508 Bacteria 8261
863 nmdc:mga0qj67_18796_c1 3300050509 Bacteria 5270
864 nmdc:mga0qj67_205445_c1 3300050509 Bacteria 1600
865 nmdc:mga0qj67_67446_c1 3300050509 Bacteria 2851
866 nmdc:mga0qj67_75031_c1 3300050509 Bacteria 2703
867 nmdc:mga06r32_127585_c1 3300050510 Bacteria 2514
868 nmdc:mga06r32_17606_c1 3300050510 Bacteria 6526
869 nmdc:mga06r32_252069_c1 3300050510 Bacteria 1753
870 nmdc:mga06r32_35663_c1 3300050510 Bacteria 2983
871 nmdc:mga06r32_4475_c1 3300050510 Bacteria 12519
872 nmdc:mga06r32_699547_c1 3300050510 Bacteria 979
873 nmdc:mga08y16_39163_c1 3300050511 Bacteria 4973
874 nmdc:mga08y16_480949_c1 3300050511 Bacteria 1264
875 nmdc:mga08y16_617137_c1 3300050511 Bacteria 1092
876 nmdc:mga08y16_6759_c1 3300050511 Bacteria 12033
877 nmdc:mga08y16_824_c1 3300050511 Bacteria 29748
878 nmdc:mga08y16_86496_c1 3300050511 Bacteria 3267
879 nmdc:mga0n895_172594_c1 3300050512 Bacteria 2194
880 nmdc:mga0n895_205490_c1 3300050512 Bacteria 2000
881 nmdc:mga0n895_35708_c1 3300050512 Bacteria 4794
882 nmdc:mga0rr50_3726_c1 3300050513 Bacteria 8831
883 nmdc:mga0a205_10890_c1 3300050515 Bacteria 8368
884 nmdc:mga0a205_13539_c1 3300050515 Bacteria 7598
885 nmdc:mga0a205_50861_c1 3300050515 Bacteria 4000
886 nmdc:mga0a205_65721_c1 3300050515 Bacteria 3505
887 nmdc:mga0a205_68177_c1 3300050515 Bacteria 3436
888 nmdc:mga0a205_7269_c1 3300050515 Bacteria 10016
889 Ga0500583_0063513 3300053092 Bacteria 1749
890 Ga0500651_0328442 3300053093 Bacteria 872
891 Ga0500641_0011703 3300053096 Bacteria 3190
892 Ga0500555_012434 3300053103 Bacteria 2451
893 Ga0500591_095109 3300053115 Bacteria 1289
894 Ga0500655_005441 3300053133 Bacteria 2298
895 Ga0500658_0002068 3300053134 Bacteria 7807
896 Ga0500658_0029713 3300053134 Bacteria 2128
897 Ga0500561_0066041 3300053137 Bacteria 1025
898 Ga0500564_028213 3300053138 Bacteria 2585
899 Ga0500586_000049 3300053145 Bacteria 20851
900 Ga0500588_0000373 3300053146 Bacteria 6929
901 Ga0500622_0002411 3300053156 Bacteria 13511
902 Ga0500636_0003904 3300053177 Bacteria 8406
903 Ga0500611_006847 3300053727 Bacteria 1683
904 Ga0501084_0292993 3300054114 Bacteria 1374
905 Ga0466962_0007150 3300061719 Bacteria 5347
906 Ga0466962_0012908 3300061719 Bacteria 4017
907 Ga0466962_0024933 3300061719 Bacteria 2871

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053093 Ga0500651_0328442 Ga0500651_0328442_32_700 208
2 3300046660 Ga0495625_0018179 Ga0495625_0018179_1258_2076 227
3 3300037466 Ga0395898_0017815 Ga0395898_0017815_743_1561 230
4 3300038443 Ga0395901_0025595 Ga0395901_0025595_1646_2464 230
5 3300053138 Ga0500564_028213 Ga0500564_028213_1531_2349 230
6 3300053177 Ga0500636_0003904 Ga0500636_0003904_2708_3526 230
7 3300044656 Ga0466969_0058212 Ga0466969_0058212_471_1304 231
8 3300044683 Ga0466965_0001063 Ga0466965_0001063_4433_5266 231
9 3300044684 Ga0466966_0001186 Ga0466966_0001186_10624_11457 231
10 3300044694 Ga0466963_0265594 Ga0466963_0265594_312_1145 231
11 3300044842 Ga0466957_0002468 Ga0466957_0002468_6610_7443 231
12 3300061719 Ga0466962_0012908 Ga0466962_0012908_1347_2180 231
13 3300044694 Ga0466963_0027954 Ga0466963_0027954_1166_1984 233
14 3300044842 Ga0466957_0015984 Ga0466957_0015984_373_1191 233
15 3300045976 Ga0466967_0013916 Ga0466967_0013916_658_1476 233
16 3300005614 Ga0068856_100003740 Ga0068856_1000037406 234
17 3300025242 Ga0209258_100419 Ga0209258_10041912 234
18 3300025246 Ga0209646_1000249 Ga0209646_100024938 234
19 3300025250 Ga0209026_1000011 Ga0209026_1000011392 234
20 3300025253 Ga0209677_100160 Ga0209677_10016024 234
21 3300025256 Ga0209759_1000034 Ga0209759_100003484 234
22 3300026116 Ga0207674_10010607 Ga0207674_100106078 234
23 3300045051 Ga0451576_0058062 Ga0451576_0058062_1011_1820 234
24 3300046507 Ga0495606_0007012 Ga0495606_0007012_7918_8736 234
25 3300046794 Ga0495589_0010597 Ga0495589_0010597_992_1810 234
26 3300050496 nmdc:mga07m45_11077_c2 nmdc:mga07m45_11077_c2_1249_2064 235
27 3300003752 Ga0055539_1000424 Ga0055539_100042410 236
28 3300003756 Ga0055533_1000053 Ga0055533_1000053160 236
29 3300025226 Ga0209674_100039 Ga0209674_10003934 236
30 3300025230 Ga0209563_100080 Ga0209563_10008034 236
31 3300025253 Ga0209677_100086 Ga0209677_10008634 236
32 3300026088 Ga0207641_10608306 Ga0207641_106083062 236
33 3300048906 Ga0496103_0108383 Ga0496103_0108383_620_1471 236
34 3300044658 Ga0466972_0000106 Ga0466972_0000106_30637_31422 237
35 3300003761 Ga0055535_1000231 Ga0055535_100023141 239
36 3300003763 Ga0055529_1000385 Ga0055529_100038527 239
37 3300003763 Ga0055529_1000410 Ga0055529_10004106 239
38 3300005366 Ga0070659_100321020 Ga0070659_1003210202 239
39 3300006237 Ga0097621_100000841 Ga0097621_10000084125 239
40 3300006358 Ga0068871_100000019 Ga0068871_10000001978 239
41 3300025242 Ga0209258_100305 Ga0209258_10030524 239
42 3300025272 Ga0209455_1000053 Ga0209455_100005325 239
43 3300044765 Ga0466970_0140398 Ga0466970_0140398_209_988 239
44 3300046660 Ga0495625_0020750 Ga0495625_0020750_3422_4201 239
45 3300006353 Ga0075370_10002481 Ga0075370_100024817 240
46 3300013296 Ga0157374_10519622 Ga0157374_105196222 240
47 3300028794 Ga0307515_10068791 Ga0307515_100687914 240
48 3300031456 Ga0307513_10060565 Ga0307513_100605652 240
49 3300003759 Ga0055525_1000004 Ga0055525_1000004589 241
50 3300005338 Ga0068868_100516988 Ga0068868_1005169882 241
51 3300025230 Ga0209563_100013 Ga0209563_100013588 241
52 3300042157 Ga0439458_0032609 Ga0439458_0032609_348_1127 241
53 3300049586 Ga0501070_0017362 Ga0501070_0017362_3329_4108 241
54 3300053137 Ga0500561_0066041 Ga0500561_0066041_104_862 241
55 3300005564 Ga0070664_100014919 Ga0070664_1000149197 242
56 3300009176 Ga0105242_10035918 Ga0105242_100359184 242
57 3300025924 Ga0207694_10057255 Ga0207694_100572552 242
58 3300046616 Ga0495668_0056455 Ga0495668_0056455_1067_1849 242
59 3300005366 Ga0070659_100262255 Ga0070659_1002622552 244
60 3300025933 Ga0207706_10279300 Ga0207706_102793002 244
61 3300025944 Ga0207661_10410466 Ga0207661_104104662 244
62 3300005334 Ga0068869_100282140 Ga0068869_1002821401 245
63 3300005340 Ga0070689_100007082 Ga0070689_1000070827 245
64 3300005438 Ga0070701_10132198 Ga0070701_101321982 245
65 3300005440 Ga0070705_100018660 Ga0070705_1000186603 245
66 3300005444 Ga0070694_100010085 Ga0070694_1000100852 245
67 3300005466 Ga0070685_10468655 Ga0070685_104686551 245
68 3300005544 Ga0070686_100035917 Ga0070686_1000359172 245
69 3300005615 Ga0070702_100000568 Ga0070702_1000005682 245
70 3300005617 Ga0068859_100022271 Ga0068859_1000222715 245
71 3300005618 Ga0068864_100048705 Ga0068864_1000487054 245
72 3300005842 Ga0068858_100742802 Ga0068858_1007428022 245
73 3300005843 Ga0068860_100011984 Ga0068860_1000119847 245
74 3300005844 Ga0068862_100020814 Ga0068862_1000208144 245
75 3300005844 Ga0068862_100363470 Ga0068862_1003634702 245
76 3300006881 Ga0068865_100524776 Ga0068865_1005247761 245
77 3300006931 Ga0097620_100022271 Ga0097620_1000222715 245
78 3300009093 Ga0105240_10007565 Ga0105240_1000756510 245
79 3300009148 Ga0105243_10006083 Ga0105243_100060833 245
80 3300009545 Ga0105237_10090329 Ga0105237_100903292 245
81 3300009551 Ga0105238_10172259 Ga0105238_101722593 245
82 3300013297 Ga0157378_10109210 Ga0157378_101092102 245
83 3300013307 Ga0157372_10346842 Ga0157372_103468421 245
84 3300014745 Ga0157377_10000030 Ga0157377_1000003037 245
85 3300005563 Ga0068855_100009185 Ga0068855_10000918510 246
86 3300005617 Ga0068859_100459198 Ga0068859_1004591982 246
87 3300006931 Ga0097620_100459183 Ga0097620_1004591832 246
88 3300009101 Ga0105247_10072183 Ga0105247_100721833 246
89 3300025949 Ga0207667_10004608 Ga0207667_100046082 246
90 3300039447 Ga0436361_0264437 Ga0436361_0264437_52618_53433 246
91 3300044693 Ga0466961_0010937 Ga0466961_0010937_5046_5786 246
92 3300005539 Ga0068853_100028936 Ga0068853_1000289363 247
93 3300009093 Ga0105240_10406884 Ga0105240_104068842 247
94 3300009174 Ga0105241_10135604 Ga0105241_101356043 247
95 3300026078 Ga0207702_10196720 Ga0207702_101967203 247
96 3300031507 Ga0307509_10031569 Ga0307509_100315693 247
97 3300046460 Ga0495638_0176500 Ga0495638_0176500_391_1149 247
98 3300046491 Ga0495584_0028771 Ga0495584_0028771_327_1085 247
99 3300046660 Ga0495625_0180154 Ga0495625_0180154_347_1105 247
100 3300053092 Ga0500583_0063513 Ga0500583_0063513_734_1492 247
101 3300053134 Ga0500658_0029713 Ga0500658_0029713_157_915 247
102 3300005471 Ga0070698_100097943 Ga0070698_1000979431 248
103 3300006844 Ga0075428_100511036 Ga0075428_1005110362 248
104 3300006844 Ga0075428_100734809 Ga0075428_1007348092 248
105 3300006880 Ga0075429_100034820 Ga0075429_1000348202 248
106 3300006880 Ga0075429_100120324 Ga0075429_1001203243 248
107 3300009147 Ga0114129_10003612 Ga0114129_100036128 248
108 3300009147 Ga0114129_10263567 Ga0114129_102635672 248
109 3300013100 Ga0157373_10106539 Ga0157373_101065392 248
110 3300031911 Ga0307412_10609069 Ga0307412_106090691 248
111 3300050507 nmdc:mga05p37_164319_c1 nmdc:mga05p37_164319_c1_712_1467 248
112 3300050507 nmdc:mga05p37_189147_c1 nmdc:mga05p37_189147_c1_1736_2491 248
113 3300050507 nmdc:mga05p37_9416_c1 nmdc:mga05p37_9416_c1_5460_6215 248
114 3300050508 nmdc:mga09592_215924_c1 nmdc:mga09592_215924_c1_123_878 248
115 iso_pu_bacteria 2643221554 2643787890 248
116 iso_pu_bacteria 2842711865 2842717789 248
117 iso_pu_bacteria 2857558681 2857563809 248
118 3300005438 Ga0070701_10004672 Ga0070701_100046723 249
119 3300005549 Ga0070704_100214547 Ga0070704_1002145473 249
120 3300005617 Ga0068859_100025928 Ga0068859_1000259285 249
121 3300005719 Ga0068861_100424961 Ga0068861_1004249611 249
122 3300005842 Ga0068858_100064087 Ga0068858_1000640875 249
123 3300006931 Ga0097620_100025927 Ga0097620_1000259275 249
124 3300009101 Ga0105247_10126455 Ga0105247_101264552 249
125 3300009545 Ga0105237_10210934 Ga0105237_102109342 249
126 3300009553 Ga0105249_10239636 Ga0105249_102396362 249
127 3300013105 Ga0157369_10021678 Ga0157369_100216786 249
128 3300025961 Ga0207712_10076109 Ga0207712_100761093 249
129 3300041503 Ga0451847_0648660 Ga0451847_0648660_163_921 249
130 3300046691 Ga0495670_0036579 Ga0495670_0036579_479_1228 249
131 3300048905 Ga0496102_0176673 Ga0496102_0176673_947_1696 249
132 iso_pu_bacteria 2643221544 2643744597 249
133 iso_pu_bacteria 2643221585 2643934601 249
134 iso_pu_bacteria 2643221639 2644219131 249
135 iso_pu_bacteria 2643221646 2644255645 249
136 iso_pu_bacteria 2643221656 2644316087 249
137 iso_pu_bacteria 2738541337 2739054111 249
138 3300005327 Ga0070658_10015986 Ga0070658_100159867 250
139 3300005327 Ga0070658_10397369 Ga0070658_103973692 250
140 3300005329 Ga0070683_100023859 Ga0070683_1000238596 250
141 3300005339 Ga0070660_100105712 Ga0070660_1001057123 250
142 3300005344 Ga0070661_100005584 Ga0070661_1000055844 250
143 3300005355 Ga0070671_100030234 Ga0070671_1000302345 250
144 3300005366 Ga0070659_100024389 Ga0070659_1000243895 250
145 3300005367 Ga0070667_100161787 Ga0070667_1001617873 250
146 3300005456 Ga0070678_100012871 Ga0070678_1000128712 250
147 3300005459 Ga0068867_100030441 Ga0068867_1000304413 250
148 3300005535 Ga0070684_100045432 Ga0070684_1000454323 250
149 3300005547 Ga0070693_100053573 Ga0070693_1000535734 250
150 3300005564 Ga0070664_100014575 Ga0070664_1000145754 250
151 3300005577 Ga0068857_100096315 Ga0068857_1000963152 250
152 3300005578 Ga0068854_100056508 Ga0068854_1000565082 250
153 3300005616 Ga0068852_100012151 Ga0068852_1000121517 250
154 3300005617 Ga0068859_100003795 Ga0068859_1000037952 250
155 3300005834 Ga0068851_10010122 Ga0068851_100101223 250
156 3300005841 Ga0068863_100048554 Ga0068863_1000485544 250
157 3300006237 Ga0097621_100022866 Ga0097621_1000228664 250
158 3300006358 Ga0068871_100028262 Ga0068871_1000282625 250
159 3300006931 Ga0097620_100003795 Ga0097620_10000379514 250
160 3300009093 Ga0105240_10131188 Ga0105240_101311884 250
161 3300009148 Ga0105243_10052843 Ga0105243_100528433 250
162 3300009177 Ga0105248_10005552 Ga0105248_100055528 250
163 3300009551 Ga0105238_10022723 Ga0105238_100227237 250
164 3300013105 Ga0157369_10041753 Ga0157369_100417536 250
165 3300013296 Ga0157374_10084191 Ga0157374_100841912 250
166 3300013307 Ga0157372_10089173 Ga0157372_100891734 250
167 3300025303 Ga0209051_1008346 Ga0209051_10083465 250
168 3300025304 Ga0209257_1000117 Ga0209257_100011781 250
169 3300025909 Ga0207705_10270853 Ga0207705_102708531 250
170 3300025909 Ga0207705_10354108 Ga0207705_103541082 250
171 3300025911 Ga0207654_10136592 Ga0207654_101365922 250
172 3300025913 Ga0207695_10526231 Ga0207695_105262312 250
173 3300025919 Ga0207657_10050430 Ga0207657_100504305 250
174 3300025920 Ga0207649_10010529 Ga0207649_100105293 250
175 3300025931 Ga0207644_10017860 Ga0207644_100178604 250
176 3300025931 Ga0207644_10132998 Ga0207644_101329983 250
177 3300025932 Ga0207690_10043019 Ga0207690_100430194 250
178 3300025933 Ga0207706_10115444 Ga0207706_101154443 250
179 3300025935 Ga0207709_10034206 Ga0207709_100342063 250
180 3300025940 Ga0207691_10006707 Ga0207691_100067077 250
181 3300025941 Ga0207711_10008227 Ga0207711_100082277 250
182 3300025941 Ga0207711_10160469 Ga0207711_101604693 250
183 3300025944 Ga0207661_10008898 Ga0207661_100088987 250
184 3300025945 Ga0207679_10009038 Ga0207679_100090387 250
185 3300025981 Ga0207640_10076416 Ga0207640_100764164 250
186 3300025986 Ga0207658_10432985 Ga0207658_104329852 250
187 3300026035 Ga0207703_10416986 Ga0207703_104169862 250
188 3300026041 Ga0207639_10151373 Ga0207639_101513732 250
189 3300026067 Ga0207678_10333065 Ga0207678_103330652 250
190 3300026078 Ga0207702_10075642 Ga0207702_100756423 250
191 3300026088 Ga0207641_10247621 Ga0207641_102476213 250
192 3300026089 Ga0207648_10168452 Ga0207648_101684522 250
193 3300026116 Ga0207674_10114241 Ga0207674_101142414 250
194 3300026118 Ga0207675_100900754 Ga0207675_1009007541 250
195 3300026142 Ga0207698_10004816 Ga0207698_100048165 250
196 3300028794 Ga0307515_10098920 Ga0307515_100989204 250
197 3300032005 Ga0307411_10002614 Ga0307411_100026142 250
198 3300034820 Ga0373959_0004980 Ga0373959_0004980_910_1671 250
199 3300035088 Ga0373940_0001957 Ga0373940_0001957_2907_3668 250
200 3300035114 Ga0373939_0000534 Ga0373939_0000534_71_832 250
201 3300035691 Ga0373931_0000993 Ga0373931_0000993_1455_2216 250
202 3300037068 Ga0373925_0019837 Ga0373925_0019837_2380_3171 250
203 3300041512 Ga0451853_0713182 Ga0451853_0713182_380_1141 250
204 3300044656 Ga0466969_0000005 Ga0466969_0000005_95913_96677 250
205 3300044693 Ga0466961_0056893 Ga0466961_0056893_11_775 250
206 3300044765 Ga0466970_0083921 Ga0466970_0083921_524_1288 250
207 3300050492 nmdc:mga0yw44_128417_c1 nmdc:mga0yw44_128417_c1_167_922 250
208 3300053096 Ga0500641_0011703 Ga0500641_0011703_1710_2462 250
209 iso_pu_bacteria 2643221654 2644303223 250
210 3300005536 Ga0070697_100778027 Ga0070697_1007780271 251
211 3300005544 Ga0070686_100087855 Ga0070686_1000878552 251
212 3300005545 Ga0070695_100484018 Ga0070695_1004840182 251
213 3300005842 Ga0068858_100301281 Ga0068858_1003012812 251
214 3300006852 Ga0075433_10005518 Ga0075433_1000551810 251
215 3300006880 Ga0075429_100036067 Ga0075429_1000360674 251
216 3300013308 Ga0157375_10313699 Ga0157375_103136992 251
217 3300025910 Ga0207684_10483051 Ga0207684_104830512 251
218 3300026023 Ga0207677_10139141 Ga0207677_101391412 251
219 3300026035 Ga0207703_10458875 Ga0207703_104588752 251
220 3300031731 Ga0307405_10006554 Ga0307405_100065545 251
221 3300031852 Ga0307410_10007781 Ga0307410_100077815 251
222 3300031901 Ga0307406_10010348 Ga0307406_100103486 251
223 3300031903 Ga0307407_10017795 Ga0307407_100177955 251
224 3300031911 Ga0307412_10003280 Ga0307412_100032803 251
225 3300031995 Ga0307409_100022869 Ga0307409_1000228695 251
226 3300032004 Ga0307414_10295198 Ga0307414_102951982 251
227 3300032005 Ga0307411_10011406 Ga0307411_100114063 251
228 3300032126 Ga0307415_100015070 Ga0307415_1000150706 251
229 3300046694 Ga0495649_0191458 Ga0495649_0191458_121_876 251
230 3300050509 nmdc:mga0qj67_67446_c1 nmdc:mga0qj67_67446_c1_911_1669 251
231 3300050510 nmdc:mga06r32_127585_c1 nmdc:mga06r32_127585_c1_970_1728 251
232 3300050515 nmdc:mga0a205_65721_c1 nmdc:mga0a205_65721_c1_1657_2415 251
233 3300002738 JGI25154J39366_1001224 JGI25154J39366_10012248 252
234 3300002739 JGI25158J39367_1000466 JGI25158J39367_10004664 252
235 3300002739 JGI25158J39367_1000534 JGI25158J39367_10005345 252
236 3300002773 JGI25152J39213_1000105 JGI25152J39213_100010512 252
237 3300002774 JGI25150J39212_1000943 JGI25150J39212_10009438 252
238 3300002774 JGI25150J39212_1001335 JGI25150J39212_10013358 252
239 3300002987 JGI25159J45721_1000922 JGI25159J45721_10009226 252
240 3300002987 JGI25159J45721_1001932 JGI25159J45721_10019325 252
241 3300002987 JGI25159J45721_1002414 JGI25159J45721_10024146 252
242 3300003203 JGI25406J46586_10010080 JGI25406J46586_100100805 252
243 3300003215 JGI25153J46596_10001671 JGI25153J46596_100016712 252
244 3300003322 rootL2_10025624 rootL2_100256244 252
245 3300003354 JGI25160J50197_1002498 JGI25160J50197_10024986 252
246 3300003374 JGI25161J50226_1000852 JGI25161J50226_100085210 252
247 3300003374 JGI25161J50226_1001208 JGI25161J50226_10012086 252
248 3300003763 Ga0055529_1000146 Ga0055529_100014656 252
249 3300003771 Ga0055526_1000121 Ga0055526_100012136 252
250 3300003771 Ga0055526_1000136 Ga0055526_100013622 252
251 3300003771 Ga0055526_1000152 Ga0055526_100015238 252
252 3300003771 Ga0055526_1003133 Ga0055526_10031339 252
253 3300003773 Ga0055537_1000099 Ga0055537_10000992 252
254 3300003773 Ga0055537_1001156 Ga0055537_100115610 252
255 3300003775 Ga0055524_1000222 Ga0055524_100022243 252
256 3300003775 Ga0055524_1002051 Ga0055524_10020519 252
257 3300003775 Ga0055524_1017502 Ga0055524_10175023 252
258 3300003784 Ga0055534_1000023 Ga0055534_1000023111 252
259 3300003784 Ga0055534_1001189 Ga0055534_10011897 252
260 3300003790 Ga0055528_1000119 Ga0055528_100011961 252
261 3300003790 Ga0055528_1002187 Ga0055528_10021876 252
262 3300003791 Ga0055530_10000125 Ga0055530_1000012535 252
263 3300003791 Ga0055530_10009012 Ga0055530_100090122 252
264 3300003791 Ga0055530_10009038 Ga0055530_100090385 252
265 3300003794 Ga0055531_10000019 Ga0055531_1000001935 252
266 3300003794 Ga0055531_10000577 Ga0055531_1000057730 252
267 3300003794 Ga0055531_10011253 Ga0055531_100112532 252
268 3300004625 Ga0055543_1000072 Ga0055543_100007210 252
269 3300004625 Ga0055543_1001583 Ga0055543_10015832 252
270 3300005262 Ga0065165_1000039 Ga0065165_1000039187 252
271 3300005262 Ga0065165_1000269 Ga0065165_100026910 252
272 3300005295 Ga0065707_10110726 Ga0065707_101107261 252
273 3300005295 Ga0065707_10134002 Ga0065707_101340022 252
274 3300005295 Ga0065707_10137714 Ga0065707_101377143 252
275 3300005328 Ga0070676_10343378 Ga0070676_103433782 252
276 3300005328 Ga0070676_10345944 Ga0070676_103459441 252
277 3300005329 Ga0070683_100305645 Ga0070683_1003056452 252
278 3300005331 Ga0070670_100017935 Ga0070670_1000179354 252
279 3300005331 Ga0070670_100062682 Ga0070670_1000626822 252
280 3300005335 Ga0070666_10004170 Ga0070666_100041704 252
281 3300005336 Ga0070680_100015253 Ga0070680_1000152536 252
282 3300005336 Ga0070680_100229986 Ga0070680_1002299862 252
283 3300005341 Ga0070691_10105251 Ga0070691_101052512 252
284 3300005341 Ga0070691_10315439 Ga0070691_103154391 252
285 3300005345 Ga0070692_10005578 Ga0070692_100055782 252
286 3300005347 Ga0070668_100042596 Ga0070668_1000425964 252
287 3300005353 Ga0070669_100060057 Ga0070669_1000600572 252
288 3300005353 Ga0070669_100259013 Ga0070669_1002590132 252
289 3300005354 Ga0070675_100053133 Ga0070675_1000531334 252
290 3300005354 Ga0070675_100058423 Ga0070675_1000584234 252
291 3300005354 Ga0070675_100181916 Ga0070675_1001819162 252
292 3300005355 Ga0070671_100438432 Ga0070671_1004384322 252
293 3300005356 Ga0070674_100362137 Ga0070674_1003621372 252
294 3300005364 Ga0070673_100200178 Ga0070673_1002001783 252
295 3300005366 Ga0070659_100037190 Ga0070659_1000371902 252
296 3300005438 Ga0070701_10469717 Ga0070701_104697171 252
297 3300005439 Ga0070711_100162786 Ga0070711_1001627861 252
298 3300005440 Ga0070705_100098734 Ga0070705_1000987342 252
299 3300005441 Ga0070700_100078129 Ga0070700_1000781292 252
300 3300005441 Ga0070700_100353671 Ga0070700_1003536712 252
301 3300005444 Ga0070694_100061184 Ga0070694_1000611842 252
302 3300005444 Ga0070694_100428894 Ga0070694_1004288941 252
303 3300005456 Ga0070678_100010891 Ga0070678_1000108914 252
304 3300005456 Ga0070678_100103578 Ga0070678_1001035781 252
305 3300005457 Ga0070662_100254393 Ga0070662_1002543932 252
306 3300005457 Ga0070662_100438393 Ga0070662_1004383931 252
307 3300005458 Ga0070681_10176741 Ga0070681_101767413 252
308 3300005458 Ga0070681_10194675 Ga0070681_101946752 252
309 3300005459 Ga0068867_100668330 Ga0068867_1006683301 252
310 3300005459 Ga0068867_100789963 Ga0068867_1007899631 252
311 3300005468 Ga0070707_100298740 Ga0070707_1002987401 252
312 3300005471 Ga0070698_100582505 Ga0070698_1005825051 252
313 3300005530 Ga0070679_100154176 Ga0070679_1001541762 252
314 3300005530 Ga0070679_100493908 Ga0070679_1004939082 252
315 3300005535 Ga0070684_100015656 Ga0070684_1000156564 252
316 3300005536 Ga0070697_100190836 Ga0070697_1001908362 252
317 3300005543 Ga0070672_100022151 Ga0070672_1000221516 252
318 3300005543 Ga0070672_100154663 Ga0070672_1001546632 252
319 3300005543 Ga0070672_100185099 Ga0070672_1001850992 252
320 3300005543 Ga0070672_100422105 Ga0070672_1004221052 252
321 3300005544 Ga0070686_100042747 Ga0070686_1000427472 252
322 3300005547 Ga0070693_100017268 Ga0070693_1000172681 252
323 3300005548 Ga0070665_100003603 Ga0070665_1000036035 252
324 3300005548 Ga0070665_100027519 Ga0070665_1000275194 252
325 3300005548 Ga0070665_100299575 Ga0070665_1002995752 252
326 3300005549 Ga0070704_100021477 Ga0070704_1000214772 252
327 3300005549 Ga0070704_100034212 Ga0070704_1000342121 252
328 3300005549 Ga0070704_100438648 Ga0070704_1004386482 252
329 3300005563 Ga0068855_100000063 Ga0068855_10000006350 252
330 3300005563 Ga0068855_100113713 Ga0068855_1001137133 252
331 3300005563 Ga0068855_100164904 Ga0068855_1001649043 252
332 3300005564 Ga0070664_100010472 Ga0070664_1000104728 252
333 3300005564 Ga0070664_100089497 Ga0070664_1000894972 252
334 3300005577 Ga0068857_100521350 Ga0068857_1005213502 252
335 3300005614 Ga0068856_100036785 Ga0068856_1000367852 252
336 3300005616 Ga0068852_100002933 Ga0068852_10000293311 252
337 3300005617 Ga0068859_100000441 Ga0068859_10000044117 252
338 3300005617 Ga0068859_100191375 Ga0068859_1001913752 252
339 3300005617 Ga0068859_100561160 Ga0068859_1005611601 252
340 3300005618 Ga0068864_100334450 Ga0068864_1003344502 252
341 3300005718 Ga0068866_10163789 Ga0068866_101637892 252
342 3300005719 Ga0068861_100000008 Ga0068861_10000000819 252
343 3300005719 Ga0068861_100115257 Ga0068861_1001152572 252
344 3300005719 Ga0068861_100144959 Ga0068861_1001449593 252
345 3300005719 Ga0068861_100589324 Ga0068861_1005893242 252
346 3300005841 Ga0068863_100012404 Ga0068863_1000124048 252
347 3300005841 Ga0068863_100014402 Ga0068863_1000144022 252
348 3300005841 Ga0068863_100216891 Ga0068863_1002168912 252
349 3300005842 Ga0068858_100002170 Ga0068858_10000217012 252
350 3300005843 Ga0068860_100107393 Ga0068860_1001073932 252
351 3300005843 Ga0068860_100204460 Ga0068860_1002044602 252
352 3300005843 Ga0068860_100219936 Ga0068860_1002199363 252
353 3300005843 Ga0068860_100924484 Ga0068860_1009244842 252
354 3300005844 Ga0068862_100040994 Ga0068862_1000409943 252
355 3300005844 Ga0068862_100350855 Ga0068862_1003508552 252
356 3300005937 Ga0081455_10002207 Ga0081455_100022075 252
357 3300005937 Ga0081455_10012865 Ga0081455_100128652 252
358 3300005981 Ga0081538_10030003 Ga0081538_100300035 252
359 3300005985 Ga0081539_10000028 Ga0081539_10000028197 252
360 3300006173 Ga0070716_100061539 Ga0070716_1000615393 252
361 3300006237 Ga0097621_100030587 Ga0097621_1000305874 252
362 3300006237 Ga0097621_100541583 Ga0097621_1005415832 252
363 3300006358 Ga0068871_100031654 Ga0068871_1000316542 252
364 3300006844 Ga0075428_100078847 Ga0075428_1000788472 252
365 3300006844 Ga0075428_100092983 Ga0075428_1000929832 252
366 3300006844 Ga0075428_100108639 Ga0075428_1001086393 252
367 3300006844 Ga0075428_100448540 Ga0075428_1004485402 252
368 3300006844 Ga0075428_100609356 Ga0075428_1006093562 252
369 3300006846 Ga0075430_100010028 Ga0075430_1000100284 252
370 3300006846 Ga0075430_100010127 Ga0075430_1000101277 252
371 3300006847 Ga0075431_100003452 Ga0075431_10000345212 252
372 3300006852 Ga0075433_10000411 Ga0075433_1000041116 252
373 3300006852 Ga0075433_10003752 Ga0075433_100037522 252
374 3300006852 Ga0075433_10036020 Ga0075433_100360202 252
375 3300006852 Ga0075433_10037238 Ga0075433_100372384 252
376 3300006852 Ga0075433_10105012 Ga0075433_101050123 252
377 3300006871 Ga0075434_100001953 Ga0075434_10000195314 252
378 3300006871 Ga0075434_100154989 Ga0075434_1001549892 252
379 3300006871 Ga0075434_100324508 Ga0075434_1003245082 252
380 3300006880 Ga0075429_100008741 Ga0075429_1000087412 252
381 3300006881 Ga0068865_100080691 Ga0068865_1000806911 252
382 3300006881 Ga0068865_100106730 Ga0068865_1001067302 252
383 3300006881 Ga0068865_100129906 Ga0068865_1001299063 252
384 3300006881 Ga0068865_100244313 Ga0068865_1002443132 252
385 3300006931 Ga0097620_100000441 Ga0097620_10000044118 252
386 3300006931 Ga0097620_100191380 Ga0097620_1001913802 252
387 3300006931 Ga0097620_100561214 Ga0097620_1005612141 252
388 3300007076 Ga0075435_100015509 Ga0075435_1000155093 252
389 3300007788 Ga0099795_10000067 Ga0099795_100000673 252
390 3300009036 Ga0105244_10012434 Ga0105244_100124342 252
391 3300009093 Ga0105240_10001628 Ga0105240_1000162815 252
392 3300009093 Ga0105240_10021958 Ga0105240_1002195812 252
393 3300009093 Ga0105240_10443349 Ga0105240_104433492 252
394 3300009094 Ga0111539_10002045 Ga0111539_1000204513 252
395 3300009094 Ga0111539_10002579 Ga0111539_1000257920 252
396 3300009094 Ga0111539_10007328 Ga0111539_1000732812 252
397 3300009094 Ga0111539_10013501 Ga0111539_100135015 252
398 3300009094 Ga0111539_10028444 Ga0111539_100284442 252
399 3300009094 Ga0111539_10149002 Ga0111539_101490022 252
400 3300009094 Ga0111539_10423880 Ga0111539_104238802 252
401 3300009094 Ga0111539_10441345 Ga0111539_104413452 252
402 3300009098 Ga0105245_10588831 Ga0105245_105888312 252
403 3300009101 Ga0105247_10000867 Ga0105247_100008675 252
404 3300009147 Ga0114129_10009126 Ga0114129_1000912612 252
405 3300009147 Ga0114129_10036200 Ga0114129_100362005 252
406 3300009147 Ga0114129_10055243 Ga0114129_100552434 252
407 3300009147 Ga0114129_10141465 Ga0114129_101414653 252
408 3300009147 Ga0114129_10361398 Ga0114129_103613981 252
409 3300009147 Ga0114129_10398002 Ga0114129_103980022 252
410 3300009148 Ga0105243_10222627 Ga0105243_102226272 252
411 3300009174 Ga0105241_10024325 Ga0105241_100243253 252
412 3300009174 Ga0105241_10148882 Ga0105241_101488822 252
413 3300009176 Ga0105242_10199411 Ga0105242_101994112 252
414 3300009551 Ga0105238_10005735 Ga0105238_1000573511 252
415 3300009551 Ga0105238_10144024 Ga0105238_101440242 252
416 3300009551 Ga0105238_10244762 Ga0105238_102447623 252
417 3300009553 Ga0105249_10123845 Ga0105249_101238454 252
418 3300009553 Ga0105249_10443150 Ga0105249_104431502 252
419 3300009553 Ga0105249_10719240 Ga0105249_107192402 252
420 3300010159 Ga0099796_10000050 Ga0099796_1000005017 252
421 3300010375 Ga0105239_10003698 Ga0105239_100036986 252
422 3300010375 Ga0105239_10048257 Ga0105239_100482575 252
423 3300010375 Ga0105239_10448154 Ga0105239_104481542 252
424 3300013102 Ga0157371_10379110 Ga0157371_103791102 252
425 3300013104 Ga0157370_10449027 Ga0157370_104490272 252
426 3300013105 Ga0157369_10007931 Ga0157369_100079317 252
427 3300013105 Ga0157369_10051231 Ga0157369_100512315 252
428 3300013296 Ga0157374_10078646 Ga0157374_100786462 252
429 3300013306 Ga0163162_10000021 Ga0163162_1000002129 252
430 3300013306 Ga0163162_10089481 Ga0163162_100894814 252
431 3300013307 Ga0157372_10006490 Ga0157372_100064906 252
432 3300013307 Ga0157372_10386870 Ga0157372_103868703 252
433 3300013308 Ga0157375_10012567 Ga0157375_100125676 252
434 3300013308 Ga0157375_10707575 Ga0157375_107075752 252
435 3300014325 Ga0163163_10023119 Ga0163163_100231195 252
436 3300014968 Ga0157379_10146708 Ga0157379_101467084 252
437 3300014968 Ga0157379_10165118 Ga0157379_101651183 252
438 3300014969 Ga0157376_10010196 Ga0157376_100101966 252
439 3300021361 Ga0213872_10000733 Ga0213872_1000073320 252
440 3300021361 Ga0213872_10001492 Ga0213872_100014923 252
441 3300021361 Ga0213872_10032703 Ga0213872_100327033 252
442 3300025208 Ga0209436_100049 Ga0209436_10004925 252
443 3300025208 Ga0209436_100093 Ga0209436_10009321 252
444 3300025208 Ga0209436_112250 Ga0209436_1122502 252
445 3300025233 Ga0209437_108461 Ga0209437_1084612 252
446 3300025245 Ga0207425_1000001 Ga0207425_1000001107 252
447 3300025245 Ga0207425_1000033 Ga0207425_1000033167 252
448 3300025245 Ga0207425_1000536 Ga0207425_100053618 252
449 3300025246 Ga0209646_1000010 Ga0209646_100001030 252
450 3300025258 Ga0209129_1000003 Ga0209129_1000003107 252
451 3300025258 Ga0209129_1001164 Ga0209129_10011646 252
452 3300025261 Ga0209233_1000104 Ga0209233_100010491 252
453 3300025263 Ga0209565_1000003 Ga0209565_1000003222 252
454 3300025263 Ga0209565_1000162 Ga0209565_100016268 252
455 3300025263 Ga0209565_1000305 Ga0209565_100030522 252
456 3300025263 Ga0209565_1000474 Ga0209565_10004746 252
457 3300025263 Ga0209565_1003162 Ga0209565_10031625 252
458 3300025272 Ga0209455_1000037 Ga0209455_1000037298 252
459 3300025273 Ga0209673_1000003 Ga0209673_1000003108 252
460 3300025273 Ga0209673_1018570 Ga0209673_10185703 252
461 3300025284 Ga0209130_1000084 Ga0209130_1000084145 252
462 3300025284 Ga0209130_1000236 Ga0209130_100023657 252
463 3300025284 Ga0209130_1001409 Ga0209130_100140912 252
464 3300025291 Ga0209675_1000003 Ga0209675_1000003816 252
465 3300025291 Ga0209675_1001160 Ga0209675_100116014 252
466 3300025294 Ga0209025_1002882 Ga0209025_100288210 252
467 3300025295 Ga0209564_1000009 Ga0209564_1000009179 252
468 3300025295 Ga0209564_1000012 Ga0209564_1000012625 252
469 3300025295 Ga0209564_1000068 Ga0209564_100006860 252
470 3300025295 Ga0209564_1000748 Ga0209564_100074822 252
471 3300025295 Ga0209564_1006494 Ga0209564_10064945 252
472 3300025297 Ga0209758_1000041 Ga0209758_100004155 252
473 3300025297 Ga0209758_1001010 Ga0209758_10010102 252
474 3300025298 Ga0209050_1000010 Ga0209050_100001035 252
475 3300025298 Ga0209050_1000011 Ga0209050_1000011318 252
476 3300025298 Ga0209050_1001581 Ga0209050_100158113 252
477 3300025299 Ga0209256_1000255 Ga0209256_100025574 252
478 3300025299 Ga0209256_1000295 Ga0209256_100029561 252
479 3300025299 Ga0209256_1000402 Ga0209256_100040245 252
480 3300025302 Ga0207426_1002123 Ga0207426_10021236 252
481 3300025302 Ga0207426_1016115 Ga0207426_10161152 252
482 3300025303 Ga0209051_1013496 Ga0209051_10134963 252
483 3300025304 Ga0209257_1000003 Ga0209257_10000031090 252
484 3300025304 Ga0209257_1000009 Ga0209257_10000091081 252
485 3300025304 Ga0209257_1006037 Ga0209257_10060378 252
486 3300025899 Ga0207642_10086036 Ga0207642_100860362 252
487 3300025900 Ga0207710_10000520 Ga0207710_1000052013 252
488 3300025907 Ga0207645_10004509 Ga0207645_100045096 252
489 3300025908 Ga0207643_10009264 Ga0207643_100092645 252
490 3300025908 Ga0207643_10050180 Ga0207643_100501803 252
491 3300025911 Ga0207654_10001508 Ga0207654_100015086 252
492 3300025911 Ga0207654_10347936 Ga0207654_103479362 252
493 3300025912 Ga0207707_10274620 Ga0207707_102746202 252
494 3300025913 Ga0207695_10000003 Ga0207695_100000031190 252
495 3300025913 Ga0207695_10102135 Ga0207695_101021354 252
496 3300025916 Ga0207663_10026383 Ga0207663_100263834 252
497 3300025917 Ga0207660_10069659 Ga0207660_100696592 252
498 3300025917 Ga0207660_10117847 Ga0207660_101178473 252
499 3300025919 Ga0207657_10043116 Ga0207657_100431164 252
500 3300025921 Ga0207652_10124500 Ga0207652_101245002 252
501 3300025921 Ga0207652_10442566 Ga0207652_104425662 252
502 3300025922 Ga0207646_10594937 Ga0207646_105949371 252
503 3300025924 Ga0207694_10000005 Ga0207694_10000005709 252
504 3300025924 Ga0207694_10005647 Ga0207694_100056475 252
505 3300025924 Ga0207694_10145650 Ga0207694_101456502 252
506 3300025925 Ga0207650_10029590 Ga0207650_100295903 252
507 3300025925 Ga0207650_10053235 Ga0207650_100532352 252
508 3300025925 Ga0207650_10064382 Ga0207650_100643823 252
509 3300025926 Ga0207659_10274022 Ga0207659_102740221 252
510 3300025931 Ga0207644_10013538 Ga0207644_100135386 252
511 3300025931 Ga0207644_10489317 Ga0207644_104893171 252
512 3300025932 Ga0207690_10139473 Ga0207690_101394732 252
513 3300025933 Ga0207706_10045942 Ga0207706_100459424 252
514 3300025933 Ga0207706_10195689 Ga0207706_101956892 252
515 3300025933 Ga0207706_10241782 Ga0207706_102417822 252
516 3300025934 Ga0207686_10030730 Ga0207686_100307305 252
517 3300025934 Ga0207686_10102739 Ga0207686_101027392 252
518 3300025937 Ga0207669_10154207 Ga0207669_101542072 252
519 3300025938 Ga0207704_10021405 Ga0207704_100214052 252
520 3300025938 Ga0207704_10092790 Ga0207704_100927901 252
521 3300025938 Ga0207704_10106185 Ga0207704_101061851 252
522 3300025939 Ga0207665_10422426 Ga0207665_104224261 252
523 3300025940 Ga0207691_10005747 Ga0207691_100057474 252
524 3300025940 Ga0207691_10021117 Ga0207691_100211174 252
525 3300025940 Ga0207691_10046396 Ga0207691_100463964 252
526 3300025940 Ga0207691_10235335 Ga0207691_102353352 252
527 3300025940 Ga0207691_10293541 Ga0207691_102935412 252
528 3300025941 Ga0207711_10399152 Ga0207711_103991521 252
529 3300025942 Ga0207689_10101624 Ga0207689_101016241 252
530 3300025949 Ga0207667_10000041 Ga0207667_10000041240 252
531 3300025960 Ga0207651_10138514 Ga0207651_101385143 252
532 3300025961 Ga0207712_10083361 Ga0207712_100833614 252
533 3300025961 Ga0207712_10218653 Ga0207712_102186532 252
534 3300025972 Ga0207668_10037273 Ga0207668_100372732 252
535 3300025972 Ga0207668_10192992 Ga0207668_101929922 252
536 3300025986 Ga0207658_10019359 Ga0207658_100193595 252
537 3300026035 Ga0207703_10005109 Ga0207703_100051095 252
538 3300026041 Ga0207639_10116592 Ga0207639_101165924 252
539 3300026067 Ga0207678_10090939 Ga0207678_100909394 252
540 3300026067 Ga0207678_10165557 Ga0207678_101655573 252
541 3300026075 Ga0207708_10086901 Ga0207708_100869012 252
542 3300026078 Ga0207702_10297543 Ga0207702_102975432 252
543 3300026088 Ga0207641_10002059 Ga0207641_1000205910 252
544 3300026088 Ga0207641_10094874 Ga0207641_100948742 252
545 3300026088 Ga0207641_10449365 Ga0207641_104493652 252
546 3300026089 Ga0207648_10013121 Ga0207648_100131215 252
547 3300026089 Ga0207648_10092179 Ga0207648_100921792 252
548 3300026095 Ga0207676_10177679 Ga0207676_101776793 252
549 3300026116 Ga0207674_10067102 Ga0207674_100671024 252
550 3300026116 Ga0207674_10393732 Ga0207674_103937321 252
551 3300026116 Ga0207674_10660920 Ga0207674_106609202 252
552 3300026118 Ga0207675_100000105 Ga0207675_10000010517 252
553 3300026118 Ga0207675_100008556 Ga0207675_10000855611 252
554 3300026118 Ga0207675_100032293 Ga0207675_1000322934 252
555 3300026118 Ga0207675_100152227 Ga0207675_1001522272 252
556 3300026118 Ga0207675_100925587 Ga0207675_1009255871 252
557 3300026121 Ga0207683_10069401 Ga0207683_100694014 252
558 3300026121 Ga0207683_10127741 Ga0207683_101277412 252
559 3300026142 Ga0207698_10007532 Ga0207698_100075322 252
560 3300027462 Ga0210000_1028632 Ga0210000_10286321 252
561 3300027512 Ga0209179_1000051 Ga0209179_100005116 252
562 3300027552 Ga0209982_1006246 Ga0209982_10062462 252
563 3300027671 Ga0209588_1019505 Ga0209588_10195052 252
564 3300027682 Ga0209971_1016335 Ga0209971_10163352 252
565 3300027717 Ga0209998_10021740 Ga0209998_100217402 252
566 3300027907 Ga0207428_10000336 Ga0207428_1000033649 252
567 3300027907 Ga0207428_10027041 Ga0207428_100270413 252
568 3300027907 Ga0207428_10166364 Ga0207428_101663643 252
569 3300027907 Ga0207428_10372081 Ga0207428_103720812 252
570 3300028379 Ga0268266_10004864 Ga0268266_100048644 252
571 3300028379 Ga0268266_10104295 Ga0268266_101042953 252
572 3300028380 Ga0268265_10000554 Ga0268265_1000055410 252
573 3300028380 Ga0268265_10043693 Ga0268265_100436932 252
574 3300028380 Ga0268265_10083441 Ga0268265_100834412 252
575 3300028381 Ga0268264_10010310 Ga0268264_100103105 252
576 3300028381 Ga0268264_10075873 Ga0268264_100758735 252
577 3300028381 Ga0268264_10193905 Ga0268264_101939053 252
578 3300028381 Ga0268264_10508480 Ga0268264_105084802 252
579 3300028381 Ga0268264_10909220 Ga0268264_109092202 252
580 3300028786 Ga0307517_10138605 Ga0307517_101386052 252
581 3300028794 Ga0307515_10000358 Ga0307515_10000358102 252
582 3300028794 Ga0307515_10003592 Ga0307515_1000359218 252
583 3300030521 Ga0307511_10000260 Ga0307511_1000026043 252
584 3300030521 Ga0307511_10022959 Ga0307511_100229595 252
585 3300030878 Ga0265770_1000368 Ga0265770_10003684 252
586 3300031090 Ga0265760_10000354 Ga0265760_100003542 252
587 3300031247 Ga0265340_10001593 Ga0265340_100015939 252
588 3300031344 Ga0265316_10010858 Ga0265316_100108583 252
589 3300031548 Ga0307408_100000076 Ga0307408_10000007686 252
590 3300031548 Ga0307408_100000936 Ga0307408_10000093612 252
591 3300031548 Ga0307408_100001516 Ga0307408_10000151613 252
592 3300031548 Ga0307408_100001827 Ga0307408_1000018276 252
593 3300031548 Ga0307408_100036171 Ga0307408_1000361714 252
594 3300031548 Ga0307408_100049655 Ga0307408_1000496553 252
595 3300031548 Ga0307408_100408391 Ga0307408_1004083912 252
596 3300031711 Ga0265314_10027975 Ga0265314_100279757 252
597 3300031730 Ga0307516_10000678 Ga0307516_100006789 252
598 3300031730 Ga0307516_10144758 Ga0307516_101447582 252
599 3300031731 Ga0307405_10062255 Ga0307405_100622552 252
600 3300031824 Ga0307413_10046651 Ga0307413_100466512 252
601 3300031901 Ga0307406_10000321 Ga0307406_100003217 252
602 3300031901 Ga0307406_10010098 Ga0307406_100100984 252
603 3300031903 Ga0307407_10035454 Ga0307407_100354543 252
604 3300031911 Ga0307412_10296339 Ga0307412_102963392 252
605 3300031995 Ga0307409_100050842 Ga0307409_1000508424 252
606 3300031995 Ga0307409_100061382 Ga0307409_1000613823 252
607 3300032002 Ga0307416_100226811 Ga0307416_1002268113 252
608 3300032002 Ga0307416_100325315 Ga0307416_1003253152 252
609 3300032005 Ga0307411_10000884 Ga0307411_100008847 252
610 3300032005 Ga0307411_10009738 Ga0307411_100097385 252
611 3300032005 Ga0307411_10110195 Ga0307411_101101952 252
612 3300032005 Ga0307411_10749658 Ga0307411_107496581 252
613 3300032126 Ga0307415_100117423 Ga0307415_1001174233 252
614 3300035114 Ga0373939_0017039 Ga0373939_0017039_772_1530 252
615 3300035170 Ga0373943_0016546 Ga0373943_0016546_276_1034 252
616 3300035172 Ga0373955_0259144 Ga0373955_0259144_239_997 252
617 3300037068 Ga0373925_0135356 Ga0373925_0135356_506_1264 252
618 3300037418 Ga0395900_0188225 Ga0395900_0188225_308_1087 252
619 3300037418 Ga0395900_0280209 Ga0395900_0280209_792_1574 252
620 3300037466 Ga0395898_0263165 Ga0395898_0263165_82_864 252
621 3300039447 Ga0436361_0136250 Ga0436361_0136250_2224_2982 252
622 3300039447 Ga0436361_1082582 Ga0436361_1082582_1949_2707 252
623 3300041505 Ga0451849_0265266 Ga0451849_0265266_417_1253 252
624 3300041512 Ga0451853_0496377 Ga0451853_0496377_161_997 252
625 3300041997 Ga0439431_0001940 Ga0439431_0001940_2137_2958 252
626 3300042004 Ga0439445_0005008 Ga0439445_0005008_325_1146 252
627 3300042004 Ga0439445_0005678 Ga0439445_0005678_543_1313 252
628 3300042005 Ga0439448_0002316 Ga0439448_0002316_1771_2553 252
629 3300042006 Ga0439432_001055 Ga0439432_001055_82_903 252
630 3300042007 Ga0439449_0032722 Ga0439449_0032722_61_831 252
631 3300042012 Ga0439455_0001981 Ga0439455_0001981_1529_2311 252
632 3300042015 Ga0439462_0004063 Ga0439462_0004063_1813_2634 252
633 3300042115 Ga0450911_014669 Ga0450911_014669_92_874 252
634 3300042116 Ga0450912_001028 Ga0450912_001028_462_1232 252
635 3300042126 Ga0450888_002547 Ga0450888_002547_552_1358 252
636 3300042127 Ga0450890_001913 Ga0450890_001913_808_1614 252
637 3300042129 Ga0450891_000388 Ga0450891_000388_318_1124 252
638 3300042130 Ga0450892_000867 Ga0450892_000867_432_1238 252
639 3300042134 Ga0450898_000813 Ga0450898_000813_1693_2466 252
640 3300042138 Ga0450903_005968 Ga0450903_005968_676_1482 252
641 3300042144 Ga0450889_000728 Ga0450889_000728_2415_3221 252
642 3300042157 Ga0439458_0005193 Ga0439458_0005193_922_1704 252
643 3300042435 Ga0439434_0001142 Ga0439434_0001142_4653_5474 252
644 3300042532 Ga0450893_0019236 Ga0450893_0019236_134_940 252
645 3300042876 Ga0451577_0005324 Ga0451577_0005324_2292_3053 252
646 3300044656 Ga0466969_0005826 Ga0466969_0005826_3043_3801 252
647 3300044672 Ga0466982_0015008 Ga0466982_0015008_2979_3737 252
648 3300044673 Ga0453683_0002236 Ga0453683_0002236_5955_6716 252
649 3300044683 Ga0466965_0000091 Ga0466965_0000091_20328_21113 252
650 3300044683 Ga0466965_0041189 Ga0466965_0041189_835_1617 252
651 3300044684 Ga0466966_0000955 Ga0466966_0000955_10308_11066 252
652 3300044684 Ga0466966_0028121 Ga0466966_0028121_1757_2539 252
653 3300044693 Ga0466961_0017431 Ga0466961_0017431_1327_2169 252
654 3300044693 Ga0466961_0164015 Ga0466961_0164015_241_1023 252
655 3300044694 Ga0466963_0213204 Ga0466963_0213204_159_941 252
656 3300044706 Ga0466964_0001409 Ga0466964_0001409_4969_5727 252
657 3300044706 Ga0466964_0002828 Ga0466964_0002828_327_1109 252
658 3300044706 Ga0466964_0003102 Ga0466964_0003102_2241_3026 252
659 3300044706 Ga0466964_0013712 Ga0466964_0013712_1987_2772 252
660 3300044706 Ga0466964_0018958 Ga0466964_0018958_1258_2100 252
661 3300044712 Ga0453684_0010080 Ga0453684_0010080_9459_10220 252
662 3300044719 Ga0466971_0000535 Ga0466971_0000535_9250_10008 252
663 3300044719 Ga0466971_0009762 Ga0466971_0009762_3196_4038 252
664 3300044735 Ga0466968_0006005 Ga0466968_0006005_1768_2553 252
665 3300044735 Ga0466968_0021144 Ga0466968_0021144_354_1112 252
666 3300044735 Ga0466968_0192889 Ga0466968_0192889_94_879 252
667 3300044765 Ga0466970_0002673 Ga0466970_0002673_2640_3398 252
668 3300044765 Ga0466970_0006799 Ga0466970_0006799_3782_4540 252
669 3300044765 Ga0466970_0132273 Ga0466970_0132273_306_1100 252
670 3300044901 Ga0466960_0113285 Ga0466960_0113285_395_1180 252
671 3300045049 Ga0466959_0010650 Ga0466959_0010650_3437_4279 252
672 3300045049 Ga0466959_0013362 Ga0466959_0013362_1926_2684 252
673 3300045049 Ga0466959_0068087 Ga0466959_0068087_1360_2118 252
674 3300045051 Ga0451576_0021732 Ga0451576_0021732_2374_3135 252
675 3300045836 Ga0466958_0275115 Ga0466958_0275115_275_1069 252
676 3300045976 Ga0466967_0014787 Ga0466967_0014787_551_1333 252
677 3300046452 Ga0495617_005190 Ga0495617_005190_3265_4023 252
678 3300046453 Ga0495627_018520 Ga0495627_018520_916_1674 252
679 3300046455 Ga0495603_0282698 Ga0495603_0282698_13_771 252
680 3300046457 Ga0495590_0000001 Ga0495590_0000001_554807_555565 252
681 3300046457 Ga0495590_0010101 Ga0495590_0010101_108_908 252
682 3300046457 Ga0495590_0035151 Ga0495590_0035151_52_810 252
683 3300046460 Ga0495638_0000086 Ga0495638_0000086_6759_7517 252
684 3300046460 Ga0495638_0000350 Ga0495638_0000350_30500_31270 252
685 3300046460 Ga0495638_0014595 Ga0495638_0014595_1476_2234 252
686 3300046460 Ga0495638_0014709 Ga0495638_0014709_3490_4248 252
687 3300046460 Ga0495638_0019958 Ga0495638_0019958_1402_2160 252
688 3300046460 Ga0495638_0020072 Ga0495638_0020072_152_910 252
689 3300046460 Ga0495638_0028670 Ga0495638_0028670_859_1617 252
690 3300046471 Ga0495650_0000118 Ga0495650_0000118_90932_91690 252
691 3300046471 Ga0495650_0000891 Ga0495650_0000891_582_1340 252
692 3300046471 Ga0495650_0001458 Ga0495650_0001458_4851_5609 252
693 3300046474 Ga0495605_0000168 Ga0495605_0000168_75021_75779 252
694 3300046474 Ga0495605_0019305 Ga0495605_0019305_1308_2090 252
695 3300046474 Ga0495605_0122918 Ga0495605_0122918_400_1158 252
696 3300046475 Ga0495639_0007427 Ga0495639_0007427_3830_4588 252
697 3300046491 Ga0495584_0000010 Ga0495584_0000010_160540_161298 252
698 3300046491 Ga0495584_0040472 Ga0495584_0040472_861_1619 252
699 3300046491 Ga0495584_0067677 Ga0495584_0067677_993_1751 252
700 3300046491 Ga0495584_0246846 Ga0495584_0246846_63_821 252
701 3300046492 Ga0495585_0000004 Ga0495585_0000004_81088_81846 252
702 3300046492 Ga0495585_0001618 Ga0495585_0001618_6452_7210 252
703 3300046492 Ga0495585_0010200 Ga0495585_0010200_416_1174 252
704 3300046492 Ga0495585_0023561 Ga0495585_0023561_1952_2710 252
705 3300046500 Ga0495596_0001315 Ga0495596_0001315_18_776 252
706 3300046500 Ga0495596_0120301 Ga0495596_0120301_14_772 252
707 3300046501 Ga0495607_0000958 Ga0495607_0000958_15329_16111 252
708 3300046501 Ga0495607_0002458 Ga0495607_0002458_13942_14700 252
709 3300046501 Ga0495607_0023658 Ga0495607_0023658_2545_3303 252
710 3300046501 Ga0495607_0043655 Ga0495607_0043655_821_1579 252
711 3300046501 Ga0495607_0212527 Ga0495607_0212527_30_788 252
712 3300046506 Ga0495583_0000084 Ga0495583_0000084_23641_24399 252
713 3300046506 Ga0495583_0000532 Ga0495583_0000532_6978_7736 252
714 3300046506 Ga0495583_0019922 Ga0495583_0019922_480_1238 252
715 3300046507 Ga0495606_0000064 Ga0495606_0000064_13916_14674 252
716 3300046507 Ga0495606_0000451 Ga0495606_0000451_13898_14656 252
717 3300046507 Ga0495606_0001143 Ga0495606_0001143_36032_36790 252
718 3300046507 Ga0495606_0002544 Ga0495606_0002544_17845_18603 252
719 3300046507 Ga0495606_0004112 Ga0495606_0004112_8930_9691 252
720 3300046507 Ga0495606_0012451 Ga0495606_0012451_3670_4428 252
721 3300046507 Ga0495606_0141829 Ga0495606_0141829_538_1299 252
722 3300046507 Ga0495606_0202092 Ga0495606_0202092_254_1012 252
723 3300046512 Ga0495610_0002903 Ga0495610_0002903_11494_12252 252
724 3300046512 Ga0495610_0011359 Ga0495610_0011359_4642_5400 252
725 3300046512 Ga0495610_0049968 Ga0495610_0049968_694_1452 252
726 3300046512 Ga0495610_0111048 Ga0495610_0111048_404_1162 252
727 3300046513 Ga0495616_0000344 Ga0495616_0000344_17685_18443 252
728 3300046513 Ga0495616_0001031 Ga0495616_0001031_3901_4683 252
729 3300046513 Ga0495616_0011373 Ga0495616_0011373_2551_3309 252
730 3300046513 Ga0495616_0035441 Ga0495616_0035441_95_874 252
731 3300046513 Ga0495616_0119360 Ga0495616_0119360_297_1076 252
732 3300046518 Ga0495631_0007133 Ga0495631_0007133_3688_4449 252
733 3300046518 Ga0495631_0010371 Ga0495631_0010371_1703_2461 252
734 3300046518 Ga0495631_0023975 Ga0495631_0023975_421_1179 252
735 3300046519 Ga0495632_0006637 Ga0495632_0006637_1810_2568 252
736 3300046519 Ga0495632_0034251 Ga0495632_0034251_1099_1908 252
737 3300046520 Ga0495637_0002319 Ga0495637_0002319_6007_6765 252
738 3300046522 Ga0495643_0000123 Ga0495643_0000123_65329_66087 252
739 3300046522 Ga0495643_0000603 Ga0495643_0000603_33885_34643 252
740 3300046522 Ga0495643_0004621 Ga0495643_0004621_3048_3827 252
741 3300046522 Ga0495643_0079979 Ga0495643_0079979_69_827 252
742 3300046522 Ga0495643_0080583 Ga0495643_0080583_567_1325 252
743 3300046523 Ga0495644_0026437 Ga0495644_0026437_411_1169 252
744 3300046524 Ga0495648_0000001 Ga0495648_0000001_207492_208250 252
745 3300046524 Ga0495648_0000007 Ga0495648_0000007_21789_22547 252
746 3300046524 Ga0495648_0002814 Ga0495648_0002814_11176_11955 252
747 3300046524 Ga0495648_0015680 Ga0495648_0015680_4128_4886 252
748 3300046528 Ga0495642_0000715 Ga0495642_0000715_7581_8339 252
749 3300046528 Ga0495642_0006269 Ga0495642_0006269_3762_4520 252
750 3300046528 Ga0495642_0014751 Ga0495642_0014751_52_810 252
751 3300046530 Ga0495654_0120518 Ga0495654_0120518_30_788 252
752 3300046530 Ga0495654_0169673 Ga0495654_0169673_86_844 252
753 3300046538 Ga0495609_0000250 Ga0495609_0000250_37340_38098 252
754 3300046538 Ga0495609_0000444 Ga0495609_0000444_22797_23579 252
755 3300046538 Ga0495609_0002728 Ga0495609_0002728_6744_7502 252
756 3300046538 Ga0495609_0010584 Ga0495609_0010584_1075_1833 252
757 3300046538 Ga0495609_0012550 Ga0495609_0012550_2604_3362 252
758 3300046538 Ga0495609_0023686 Ga0495609_0023686_826_1584 252
759 3300046542 Ga0495597_0000208 Ga0495597_0000208_13668_14426 252
760 3300046542 Ga0495597_0000419 Ga0495597_0000419_655_1413 252
761 3300046542 Ga0495597_0038714 Ga0495597_0038714_281_1039 252
762 3300046542 Ga0495597_0049354 Ga0495597_0049354_639_1397 252
763 3300046542 Ga0495597_0053297 Ga0495597_0053297_381_1175 252
764 3300046542 Ga0495597_0110686 Ga0495597_0110686_157_915 252
765 3300046542 Ga0495597_0121928 Ga0495597_0121928_154_912 252
766 3300046557 Ga0495622_0000028 Ga0495622_0000028_58139_58897 252
767 3300046557 Ga0495622_0000223 Ga0495622_0000223_33957_34715 252
768 3300046557 Ga0495622_0020952 Ga0495622_0020952_393_1151 252
769 3300046557 Ga0495622_0032111 Ga0495622_0032111_551_1309 252
770 3300046558 Ga0495633_0000272 Ga0495633_0000272_7025_7783 252
771 3300046558 Ga0495633_0000390 Ga0495633_0000390_10624_11382 252
772 3300046558 Ga0495633_0000528 Ga0495633_0000528_3447_4205 252
773 3300046558 Ga0495633_0000908 Ga0495633_0000908_2183_2941 252
774 3300046558 Ga0495633_0063448 Ga0495633_0063448_772_1566 252
775 3300046615 Ga0495656_0000303 Ga0495656_0000303_467_1225 252
776 3300046616 Ga0495668_0000006 Ga0495668_0000006_353598_354356 252
777 3300046616 Ga0495668_0000533 Ga0495668_0000533_29150_29908 252
778 3300046616 Ga0495668_0001777 Ga0495668_0001777_9928_10686 252
779 3300046616 Ga0495668_0014988 Ga0495668_0014988_943_1701 252
780 3300046616 Ga0495668_0040073 Ga0495668_0040073_14_772 252
781 3300046616 Ga0495668_0049414 Ga0495668_0049414_243_1037 252
782 3300046616 Ga0495668_0111350 Ga0495668_0111350_524_1282 252
783 3300046648 Ga0495611_0004369 Ga0495611_0004369_431_1189 252
784 3300046648 Ga0495611_0157734 Ga0495611_0157734_57_815 252
785 3300046660 Ga0495625_0000318 Ga0495625_0000318_40819_41577 252
786 3300046660 Ga0495625_0000480 Ga0495625_0000480_48201_48959 252
787 3300046660 Ga0495625_0045672 Ga0495625_0045672_538_1296 252
788 3300046660 Ga0495625_0050310 Ga0495625_0050310_797_1555 252
789 3300046660 Ga0495625_0069597 Ga0495625_0069597_1246_2004 252
790 3300046664 Ga0495659_0005351 Ga0495659_0005351_735_1493 252
791 3300046665 Ga0495661_0002540 Ga0495661_0002540_10530_11312 252
792 3300046665 Ga0495661_0005328 Ga0495661_0005328_435_1196 252
793 3300046665 Ga0495661_0024111 Ga0495661_0024111_2800_3558 252
794 3300046665 Ga0495661_0034274 Ga0495661_0034274_2064_2822 252
795 3300046665 Ga0495661_0162676 Ga0495661_0162676_401_1159 252
796 3300046674 Ga0495588_0064020 Ga0495588_0064020_961_1719 252
797 3300046674 Ga0495588_0165978 Ga0495588_0165978_47_805 252
798 3300046674 Ga0495588_0232553 Ga0495588_0232553_14_772 252
799 3300046691 Ga0495670_0064437 Ga0495670_0064437_633_1391 252
800 3300046691 Ga0495670_0081718 Ga0495670_0081718_679_1437 252
801 3300046691 Ga0495670_0135354 Ga0495670_0135354_371_1129 252
802 3300046692 Ga0495671_0016085 Ga0495671_0016085_824_1585 252
803 3300046692 Ga0495671_0017712 Ga0495671_0017712_2950_3708 252
804 3300046694 Ga0495649_0019717 Ga0495649_0019717_504_1262 252
805 3300046694 Ga0495649_0027532 Ga0495649_0027532_1350_2108 252
806 3300046694 Ga0495649_0099329 Ga0495649_0099329_143_901 252
807 3300046694 Ga0495649_0146971 Ga0495649_0146971_20_778 252
808 3300046794 Ga0495589_0000376 Ga0495589_0000376_22944_23726 252
809 3300046810 Ga0495660_0035867 Ga0495660_0035867_1625_2383 252
810 3300046810 Ga0495660_0087708 Ga0495660_0087708_11_790 252
811 3300047315 Ga0495581_0015444 Ga0495581_0015444_2976_3734 252
812 3300047317 Ga0495604_0020386 Ga0495604_0020386_2244_3005 252
813 3300047320 Ga0495672_0000429 Ga0495672_0000429_38933_39691 252
814 3300047320 Ga0495672_0083853 Ga0495672_0083853_972_1730 252
815 3300047320 Ga0495672_0091994 Ga0495672_0091994_363_1121 252
816 3300047322 Ga0495680_0293573 Ga0495680_0293573_205_963 252
817 3300047323 Ga0495683_0023317 Ga0495683_0023317_1294_2052 252
818 3300047443 Ga0495687_000054 Ga0495687_000054_10556_11338 252
819 3300047443 Ga0495687_000779 Ga0495687_000779_24331_25089 252
820 3300047443 Ga0495687_000817 Ga0495687_000817_8219_8977 252
821 3300047443 Ga0495687_064590 Ga0495687_064590_633_1391 252
822 3300047445 Ga0495677_0000012 Ga0495677_0000012_10556_11338 252
823 3300047445 Ga0495677_0006316 Ga0495677_0006316_2553_3311 252
824 3300047445 Ga0495677_0037851 Ga0495677_0037851_17_775 252
825 3300047445 Ga0495677_0040610 Ga0495677_0040610_251_1009 252
826 3300047445 Ga0495677_0111423 Ga0495677_0111423_173_931 252
827 3300047446 Ga0495679_016243 Ga0495679_016243_1840_2598 252
828 3300047447 Ga0495685_027116 Ga0495685_027116_1003_1761 252
829 3300047470 Ga0495681_0009145 Ga0495681_0009145_2825_3583 252
830 3300047470 Ga0495681_0059052 Ga0495681_0059052_199_957 252
831 3300047472 Ga0495686_0020170 Ga0495686_0020170_3464_4222 252
832 3300047472 Ga0495686_0130037 Ga0495686_0130037_561_1319 252
833 3300047472 Ga0495686_0131234 Ga0495686_0131234_250_1008 252
834 3300048091 Ga0495626_0002106 Ga0495626_0002106_10556_11338 252
835 3300048091 Ga0495626_0025644 Ga0495626_0025644_742_1500 252
836 3300048091 Ga0495626_0079012 Ga0495626_0079012_168_926 252
837 3300048903 Ga0496100_0282290 Ga0496100_0282290_22_780 252
838 3300048905 Ga0496102_0002316 Ga0496102_0002316_6697_7455 252
839 3300048905 Ga0496102_0091702 Ga0496102_0091702_921_1679 252
840 3300048907 Ga0496104_0012260 Ga0496104_0012260_1268_2026 252
841 3300048908 Ga0496105_0000979 Ga0496105_0000979_4687_5445 252
842 3300048912 Ga0496109_0166548 Ga0496109_0166548_100_882 252
843 3300048914 Ga0496111_0189330 Ga0496111_0189330_489_1268 252
844 3300048915 Ga0496112_0045626 Ga0496112_0045626_2010_2768 252
845 3300048916 Ga0496113_0215457 Ga0496113_0215457_404_1183 252
846 3300048917 Ga0496114_0014851 Ga0496114_0014851_890_1648 252
847 3300048917 Ga0496114_0173236 Ga0496114_0173236_167_925 252
848 3300048918 Ga0496115_0008139 Ga0496115_0008139_4783_5544 252
849 3300048918 Ga0496115_0009205 Ga0496115_0009205_5834_6592 252
850 3300048924 Ga0496121_0006502 Ga0496121_0006502_789_1547 252
851 3300048925 Ga0496122_0018277 Ga0496122_0018277_5633_6412 252
852 3300048926 Ga0496123_0015723 Ga0496123_0015723_2209_2988 252
853 3300048927 Ga0496124_0028236 Ga0496124_0028236_3610_4368 252
854 3300048927 Ga0496124_0059867 Ga0496124_0059867_1040_1798 252
855 3300048928 Ga0496125_0023876 Ga0496125_0023876_916_1674 252
856 3300049459 Ga0495678_000313 Ga0495678_000313_40795_41553 252
857 3300049459 Ga0495678_004914 Ga0495678_004914_4472_5230 252
858 3300049460 Ga0495682_0000775 Ga0495682_0000775_12316_13086 252
859 3300049460 Ga0495682_0013628 Ga0495682_0013628_2151_2909 252
860 3300049460 Ga0495682_0123480 Ga0495682_0123480_70_828 252
861 3300049571 Ga0501034_0150550 Ga0501034_0150550_360_1118 252
862 3300049571 Ga0501034_0173737 Ga0501034_0173737_1015_1773 252
863 3300049578 Ga0501042_0161158 Ga0501042_0161158_802_1563 252
864 3300049578 Ga0501042_0377206 Ga0501042_0377206_47_805 252
865 3300049584 Ga0501068_0001338 Ga0501068_0001338_12166_12945 252
866 3300049587 Ga0501071_0009268 Ga0501071_0009268_1600_2379 252
867 3300049589 Ga0501073_0006004 Ga0501073_0006004_30_809 252
868 3300049589 Ga0501073_0103726 Ga0501073_0103726_548_1306 252
869 3300049593 Ga0501077_0239070 Ga0501077_0239070_90_869 252
870 3300049742 Ga0501080_0009316 Ga0501080_0009316_8048_8827 252
871 3300049743 Ga0501081_0109829 Ga0501081_0109829_1083_1844 252
872 3300049744 Ga0501083_0063536 Ga0501083_0063536_455_1234 252
873 3300049759 Ga0501262_003322 Ga0501262_003322_683_1471 252
874 3300050489 nmdc:mga03683_171805_c1 nmdc:mga03683_171805_c1_136_939 252
875 3300050493 nmdc:mga0k408_11650_c1 nmdc:mga0k408_11650_c1_3762_4685 252
876 3300050496 nmdc:mga07m45_3734_c1 nmdc:mga07m45_3734_c1_3487_4299 252
877 3300050507 nmdc:mga05p37_142741_c1 nmdc:mga05p37_142741_c1_869_1630 252
878 3300050507 nmdc:mga05p37_210095_c1 nmdc:mga05p37_210095_c1_507_1268 252
879 3300050507 nmdc:mga05p37_21554_c2 nmdc:mga05p37_21554_c2_2359_3120 252
880 3300050507 nmdc:mga05p37_26674_c1 nmdc:mga05p37_26674_c1_2842_3603 252
881 3300050507 nmdc:mga05p37_37384_c1 nmdc:mga05p37_37384_c1_820_1578 252
882 3300050508 nmdc:mga09592_209928_c1 nmdc:mga09592_209928_c1_112_870 252
883 3300050508 nmdc:mga09592_8693_c1 nmdc:mga09592_8693_c1_3228_3989 252
884 3300050509 nmdc:mga0qj67_18796_c1 nmdc:mga0qj67_18796_c1_3112_3873 252
885 3300050509 nmdc:mga0qj67_205445_c1 nmdc:mga0qj67_205445_c1_180_938 252
886 3300050509 nmdc:mga0qj67_75031_c1 nmdc:mga0qj67_75031_c1_637_1395 252
887 3300050510 nmdc:mga06r32_17606_c1 nmdc:mga06r32_17606_c1_2054_2815 252
888 3300050510 nmdc:mga06r32_252069_c1 nmdc:mga06r32_252069_c1_710_1468 252
889 3300050510 nmdc:mga06r32_35663_c1 nmdc:mga06r32_35663_c1_1102_1860 252
890 3300050510 nmdc:mga06r32_4475_c1 nmdc:mga06r32_4475_c1_10361_11122 252
891 3300050510 nmdc:mga06r32_699547_c1 nmdc:mga06r32_699547_c1_21_782 252
892 3300050511 nmdc:mga08y16_39163_c1 nmdc:mga08y16_39163_c1_3469_4230 252
893 3300050511 nmdc:mga08y16_480949_c1 nmdc:mga08y16_480949_c1_45_803 252
894 3300050511 nmdc:mga08y16_617137_c1 nmdc:mga08y16_617137_c1_16_774 252
895 3300050511 nmdc:mga08y16_6759_c1 nmdc:mga08y16_6759_c1_947_1708 252
896 3300050511 nmdc:mga08y16_824_c1 nmdc:mga08y16_824_c1_2577_3335 252
897 3300050511 nmdc:mga08y16_86496_c1 nmdc:mga08y16_86496_c1_1956_2714 252
898 3300050512 nmdc:mga0n895_172594_c1 nmdc:mga0n895_172594_c1_971_1732 252
899 3300050512 nmdc:mga0n895_205490_c1 nmdc:mga0n895_205490_c1_404_1165 252
900 3300050512 nmdc:mga0n895_35708_c1 nmdc:mga0n895_35708_c1_2004_2765 252
901 3300050513 nmdc:mga0rr50_3726_c1 nmdc:mga0rr50_3726_c1_1014_1772 252
902 3300050515 nmdc:mga0a205_10890_c1 nmdc:mga0a205_10890_c1_1409_2170 252
903 3300050515 nmdc:mga0a205_13539_c1 nmdc:mga0a205_13539_c1_3850_4611 252
904 3300050515 nmdc:mga0a205_50861_c1 nmdc:mga0a205_50861_c1_1215_1976 252
905 3300050515 nmdc:mga0a205_68177_c1 nmdc:mga0a205_68177_c1_1225_1986 252
906 3300050515 nmdc:mga0a205_7269_c1 nmdc:mga0a205_7269_c1_9081_9839 252
907 3300053103 Ga0500555_012434 Ga0500555_012434_878_1636 252
908 3300053115 Ga0500591_095109 Ga0500591_095109_409_1167 252
909 3300053133 Ga0500655_005441 Ga0500655_005441_1415_2185 252
910 3300053134 Ga0500658_0002068 Ga0500658_0002068_4852_5622 252
911 3300053145 Ga0500586_000049 Ga0500586_000049_9569_10327 252
912 3300053146 Ga0500588_0000373 Ga0500588_0000373_3473_4231 252
913 3300053156 Ga0500622_0002411 Ga0500622_0002411_7176_7934 252
914 3300053727 Ga0500611_006847 Ga0500611_006847_49_807 252
915 3300054114 Ga0501084_0292993 Ga0501084_0292993_519_1298 252
916 3300061719 Ga0466962_0007150 Ga0466962_0007150_944_1702 252
917 3300061719 Ga0466962_0024933 Ga0466962_0024933_770_1552 252
918 iso_pu_bacteria 2643221556 2643800361 252
919 iso_pu_bacteria 2643221684 2644470270 252
920 iso_pu_bacteria 8047673197 8047678658 252

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

74

241

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tui-assembly2.cif.gz_E inward facing conformations of the metni methionine abc transporter: cy5 native crystal form 0.8104 52 240
3dhw-assembly1.cif.gz_B crystal structure of methionine importer metni 0.7722 55 236
7ahh-assembly1.cif.gz_B opua inhibited inward-facing, sbd docked 0.7711 16 240
3dhw-assembly1.cif.gz_A crystal structure of methionine importer metni 0.76 55 236
8hps-assembly1.cif.gz_A lpqy-sugabc in state 5 0.7542 33 242
ID Description Score Start End Superfamily
af_P75851_53_247_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9575 48 241 1.10.3720.10
af_Q47539_71_268_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9474 49 241 1.10.3720.10
af_P75851_53_247_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9433 48 241 1.10.3720.10
af_Q57856_64_258_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9397 59 242 1.10.3720.10
af_Q2G1I4_54_251_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9269 50 248 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A3E1S0H6-F1-model_v4 deleted 0.9805 1 252
AF-A0A4Q7XHW9-F1-model_v4 deleted 0.9695 1 252
AF-A0A7Y6NKH6-F1-model_v4 ABC transporter permease 0.9643 4 252 GO:0005886
GO:0055085
AF-A0A7X3G667-F1-model_v4 ABC transporter permease subunit 0.963 2 252 GO:0005886
GO:0055085
AF-A0A2Z5G2Z7-F1-model_v4 ABC-type nitrate/sulfonate/bicarbonate transport system, permease component 0.962 52 249 GO:0005886
GO:0055085

Feature Viewer

pLDDT pTM Quality
90.24 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map