F485666
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 918 | 339 | 915 | 312 |
Family's Representative Sequence
| Representative Sequence | 3300005834|Ga0068851_10016011|Ga0068851_100160111 |
| Length | 344 |
| Sequence | MKILKTFSLLFHLTIFVSFKTFNHRSTFMTQKKIIAVFGATGAQGGGLARAILSDPHSEFSVRVVTRAVHSDKAKALEAMGAELVNADVDNPKEIRKALQGAYGAFFVTFFWAHYSPELENKHAEDFAKAAKEAGLKHVIWSTLEDTRKWYPLDDDRMPTLHDNYKVPHFDGKGASDHYFTDNGVPTTFLMASFYWENMIYFGMGPKRGDDGKLTFTLPMADKKMGGIGAEDIGRCAYGIFKKGTELVGKYVGIAGEQLTGEQMAHHLSKSLGEEVKYNAITPATFRSFGFPGADDLGNMFQFYAEQEKYLDDARDPKISKQLNPQLKNFDAWLKDNAKLIPLE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221601 | Kitasatospora sp. Root187 | Isolate | Unclassified |
| 2 | 2643221631 | Kitasatospora sp. Root107 | Isolate | Unclassified |
| 3 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
| 4 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 5 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 6 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 7 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 9 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 17 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 21 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 40 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 48 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 53 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 55 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 56 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 57 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 58 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 59 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 60 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 61 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 62 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 63 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 64 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 65 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 66 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 67 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 68 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 69 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 73 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 74 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 75 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 76 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 77 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 78 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 79 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 80 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 82 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 112 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 113 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 166 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 170 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 171 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 172 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 173 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 174 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 175 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 176 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 177 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 178 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 179 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 180 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 181 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 182 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 183 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 184 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 185 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 186 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 187 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 188 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 189 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 190 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 191 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 192 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 193 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 194 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 195 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 196 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 197 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 198 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 199 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 200 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 201 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 202 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 203 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 204 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 205 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 206 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 207 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 208 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 209 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 210 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 211 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 212 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 213 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 214 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 215 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 216 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 217 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 218 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 219 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 220 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 221 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 222 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 223 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 224 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 225 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 226 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 227 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 228 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 229 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 230 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 231 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 232 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 233 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 234 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 235 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 236 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 270 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 271 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 272 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 273 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 274 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 275 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 276 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 277 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 278 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 279 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 288 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 292 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 296 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 302 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 303 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 304 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 305 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 306 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 307 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 308 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 309 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 310 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 311 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 312 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 316 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 317 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 318 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 321 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 322 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 323 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 324 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 325 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 326 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 327 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 328 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 329 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 333 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 334 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 335 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 336 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 337 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 338 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 339 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.46 |
| Metatranscriptomes | 0.22 |
| Isolates | 0.33 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.76 |
| Nodule | 0 |
| Rhizoplane | 1.63 |
| Rhizosphere | 96.62 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.98 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24751J29686_10000335 | 3300002459 | Bacteria | 17022 |
| 2 | JGI25406J46586_10023135 | 3300003203 | Bacteria | 2460 |
| 3 | rootH1_10004495 | 3300003323 | Bacteria | 36666 |
| 4 | rootH1_10155694 | 3300003323 | Bacteria | 1652 |
| 5 | Ga0065714_10019946 | 3300005288 | Bacteria | 1173 |
| 6 | Ga0065712_10000781 | 3300005290 | Bacteria | 14555 |
| 7 | Ga0065715_10155878 | 3300005293 | Bacteria | 1670 |
| 8 | Ga0065707_10091080 | 3300005295 | Bacteria | 4010 |
| 9 | Ga0065707_10118341 | 3300005295 | Bacteria | 2188 |
| 10 | Ga0070658_10001806 | 3300005327 | Bacteria | 17989 |
| 11 | Ga0070676_10015570 | 3300005328 | Bacteria | 4196 |
| 12 | Ga0070676_10113135 | 3300005328 | Bacteria | 1693 |
| 13 | Ga0070683_100005550 | 3300005329 | Bacteria | 10535 |
| 14 | Ga0070683_100020750 | 3300005329 | Bacteria | 5852 |
| 15 | Ga0070683_100132805 | 3300005329 | Bacteria | 2356 |
| 16 | Ga0070683_100236805 | 3300005329 | Bacteria | 1736 |
| 17 | Ga0070690_100003963 | 3300005330 | Bacteria | 8179 |
| 18 | Ga0070690_100040289 | 3300005330 | Unclassified | 2954 |
| 19 | Ga0070670_100012132 | 3300005331 | Bacteria | 7371 |
| 20 | Ga0070670_100018444 | 3300005331 | Bacteria | 5987 |
| 21 | Ga0070670_100025152 | 3300005331 | Bacteria | 5122 |
| 22 | Ga0070670_100052931 | 3300005331 | Bacteria | 3487 |
| 23 | Ga0070670_100064587 | 3300005331 | Bacteria | 3140 |
| 24 | Ga0070670_100083934 | 3300005331 | Bacteria | 2737 |
| 25 | Ga0070670_100206539 | 3300005331 | Unclassified | 1707 |
| 26 | Ga0070670_100248776 | 3300005331 | Bacteria | 1548 |
| 27 | Ga0070670_100251733 | 3300005331 | Bacteria | 1539 |
| 28 | Ga0070670_100302109 | 3300005331 | Bacteria | 1400 |
| 29 | Ga0068869_100024944 | 3300005334 | Bacteria | 4147 |
| 30 | Ga0068869_100066941 | 3300005334 | Bacteria | 2648 |
| 31 | Ga0068869_100087483 | 3300005334 | Unclassified | 2337 |
| 32 | Ga0068869_100386438 | 3300005334 | Bacteria | 1148 |
| 33 | Ga0070666_10001316 | 3300005335 | Bacteria | 15045 |
| 34 | Ga0070666_10005429 | 3300005335 | Bacteria | 7817 |
| 35 | Ga0070666_10021319 | 3300005335 | Bacteria | 4200 |
| 36 | Ga0070666_10029682 | 3300005335 | Bacteria | 3597 |
| 37 | Ga0070666_10089305 | 3300005335 | Unclassified | 2115 |
| 38 | Ga0070680_100006966 | 3300005336 | Bacteria | 8616 |
| 39 | Ga0070680_100043075 | 3300005336 | Bacteria | 3665 |
| 40 | Ga0070680_100425293 | 3300005336 | Bacteria | 1133 |
| 41 | Ga0070682_100006403 | 3300005337 | Bacteria | 6613 |
| 42 | Ga0070682_100095781 | 3300005337 | Unclassified | 1950 |
| 43 | Ga0068868_100008292 | 3300005338 | Bacteria | 7442 |
| 44 | Ga0068868_100015287 | 3300005338 | Bacteria | 5675 |
| 45 | Ga0068868_100158765 | 3300005338 | Bacteria | 1866 |
| 46 | Ga0070660_100031268 | 3300005339 | Bacteria | 3997 |
| 47 | Ga0070660_100192229 | 3300005339 | Bacteria | 1653 |
| 48 | Ga0070689_100031031 | 3300005340 | Bacteria | 4060 |
| 49 | Ga0070689_100073946 | 3300005340 | Bacteria | 2666 |
| 50 | Ga0070689_100174977 | 3300005340 | Bacteria | 1740 |
| 51 | Ga0070687_100001102 | 3300005343 | Bacteria | 9291 |
| 52 | Ga0070687_100059306 | 3300005343 | Unclassified | 2014 |
| 53 | Ga0070661_100009793 | 3300005344 | Bacteria | 6645 |
| 54 | Ga0070661_100013569 | 3300005344 | Bacteria | 5721 |
| 55 | Ga0070661_100085471 | 3300005344 | Bacteria | 2331 |
| 56 | Ga0070661_100142381 | 3300005344 | Bacteria | 1808 |
| 57 | Ga0070668_100000951 | 3300005347 | Bacteria | 20217 |
| 58 | Ga0070668_100023794 | 3300005347 | Bacteria | 4636 |
| 59 | Ga0070668_100113597 | 3300005347 | Bacteria | 2158 |
| 60 | Ga0070668_100271460 | 3300005347 | Bacteria | 1414 |
| 61 | Ga0070669_100037947 | 3300005353 | Bacteria | 3496 |
| 62 | Ga0070669_100053889 | 3300005353 | Bacteria | 2945 |
| 63 | Ga0070669_100092951 | 3300005353 | Bacteria | 2265 |
| 64 | Ga0070669_100210329 | 3300005353 | Bacteria | 1534 |
| 65 | Ga0070669_100242384 | 3300005353 | Bacteria | 1433 |
| 66 | Ga0070675_100008620 | 3300005354 | Bacteria | 7918 |
| 67 | Ga0070675_100011460 | 3300005354 | Bacteria | 6942 |
| 68 | Ga0070675_100033681 | 3300005354 | Unclassified | 4154 |
| 69 | Ga0070675_100099784 | 3300005354 | Bacteria | 2445 |
| 70 | Ga0070675_100116193 | 3300005354 | Bacteria | 2269 |
| 71 | Ga0070675_100340387 | 3300005354 | Bacteria | 1328 |
| 72 | Ga0070671_100011830 | 3300005355 | Bacteria | 7020 |
| 73 | Ga0070671_100116251 | 3300005355 | Bacteria | 2249 |
| 74 | Ga0070671_100380375 | 3300005355 | Bacteria | 1206 |
| 75 | Ga0070674_100007915 | 3300005356 | Bacteria | 6291 |
| 76 | Ga0070674_100069510 | 3300005356 | Unclassified | 2484 |
| 77 | Ga0070674_100149299 | 3300005356 | Bacteria | 1762 |
| 78 | Ga0070673_100002269 | 3300005364 | Bacteria | 11656 |
| 79 | Ga0070673_100091941 | 3300005364 | Bacteria | 2481 |
| 80 | Ga0070673_100113975 | 3300005364 | Unclassified | 2246 |
| 81 | Ga0070673_100165222 | 3300005364 | Bacteria | 1885 |
| 82 | Ga0070673_100315594 | 3300005364 | Bacteria | 1379 |
| 83 | Ga0070688_100032273 | 3300005365 | Unclassified | 3156 |
| 84 | Ga0070688_100037566 | 3300005365 | Bacteria | 2951 |
| 85 | Ga0070688_100381889 | 3300005365 | Bacteria | 1038 |
| 86 | Ga0070659_100025517 | 3300005366 | Bacteria | 4540 |
| 87 | Ga0070659_100025984 | 3300005366 | Bacteria | 4504 |
| 88 | Ga0070659_100118369 | 3300005366 | Bacteria | 2143 |
| 89 | Ga0070659_100181859 | 3300005366 | Bacteria | 1726 |
| 90 | Ga0070667_100005498 | 3300005367 | Bacteria | 10581 |
| 91 | Ga0070667_100005708 | 3300005367 | Bacteria | 10398 |
| 92 | Ga0070667_100137970 | 3300005367 | Bacteria | 2133 |
| 93 | Ga0070667_100178526 | 3300005367 | Bacteria | 1877 |
| 94 | Ga0070667_100205033 | 3300005367 | Bacteria | 1750 |
| 95 | Ga0070667_100218193 | 3300005367 | Unclassified | 1697 |
| 96 | Ga0070667_100228292 | 3300005367 | Bacteria | 1659 |
| 97 | Ga0070667_100264626 | 3300005367 | Bacteria | 1540 |
| 98 | Ga0070667_100320443 | 3300005367 | Bacteria | 1399 |
| 99 | Ga0070708_100282992 | 3300005445 | Bacteria | 1561 |
| 100 | Ga0070663_100119781 | 3300005455 | Bacteria | 1987 |
| 101 | Ga0070663_100259117 | 3300005455 | Bacteria | 1379 |
| 102 | Ga0070678_100095547 | 3300005456 | Unclassified | 2290 |
| 103 | Ga0070662_100226440 | 3300005457 | Bacteria | 1494 |
| 104 | Ga0070662_100228348 | 3300005457 | Bacteria | 1488 |
| 105 | Ga0070662_100262169 | 3300005457 | Bacteria | 1392 |
| 106 | Ga0070681_10073654 | 3300005458 | Bacteria | 3377 |
| 107 | Ga0070681_10105715 | 3300005458 | Bacteria | 2757 |
| 108 | Ga0070681_10123298 | 3300005458 | Bacteria | 2524 |
| 109 | Ga0070681_10127861 | 3300005458 | Bacteria | 2474 |
| 110 | Ga0070681_10257086 | 3300005458 | Bacteria | 1658 |
| 111 | Ga0068867_100116337 | 3300005459 | Unclassified | 2060 |
| 112 | Ga0068867_100450975 | 3300005459 | Bacteria | 1096 |
| 113 | Ga0070685_10007265 | 3300005466 | Bacteria | 5664 |
| 114 | Ga0070685_10033897 | 3300005466 | Unclassified | 2872 |
| 115 | Ga0070685_10044525 | 3300005466 | Bacteria | 2541 |
| 116 | Ga0070706_100265778 | 3300005467 | Unclassified | 1601 |
| 117 | Ga0070707_100000032 | 3300005468 | Bacteria | 118776 |
| 118 | Ga0070698_100001998 | 3300005471 | Bacteria | 22644 |
| 119 | Ga0070698_100003211 | 3300005471 | Bacteria | 18007 |
| 120 | Ga0070699_100119960 | 3300005518 | Unclassified | 2312 |
| 121 | Ga0070699_100259085 | 3300005518 | Unclassified | 1555 |
| 122 | Ga0070679_100002339 | 3300005530 | Bacteria | 17152 |
| 123 | Ga0070679_100004116 | 3300005530 | Bacteria | 13409 |
| 124 | Ga0070679_100013309 | 3300005530 | Bacteria | 7876 |
| 125 | Ga0070679_100016964 | 3300005530 | Bacteria | 7039 |
| 126 | Ga0070679_100024167 | 3300005530 | Bacteria | 5954 |
| 127 | Ga0070679_100076615 | 3300005530 | Bacteria | 3333 |
| 128 | Ga0070679_100525512 | 3300005530 | Bacteria | 1127 |
| 129 | Ga0070684_100012839 | 3300005535 | Bacteria | 6729 |
| 130 | Ga0070684_100411356 | 3300005535 | Bacteria | 1248 |
| 131 | Ga0068853_100011024 | 3300005539 | Bacteria | 7331 |
| 132 | Ga0068853_100045604 | 3300005539 | Bacteria | 3755 |
| 133 | Ga0068853_100131745 | 3300005539 | Bacteria | 2239 |
| 134 | Ga0068853_100216381 | 3300005539 | Bacteria | 1748 |
| 135 | Ga0068853_100412894 | 3300005539 | Bacteria | 1265 |
| 136 | Ga0070672_100005846 | 3300005543 | Bacteria | 8207 |
| 137 | Ga0070672_100030941 | 3300005543 | Bacteria | 4026 |
| 138 | Ga0070672_100047244 | 3300005543 | Unclassified | 3339 |
| 139 | Ga0070672_100090118 | 3300005543 | Bacteria | 2472 |
| 140 | Ga0070672_100106674 | 3300005543 | Bacteria | 2279 |
| 141 | Ga0070672_100256135 | 3300005543 | Unclassified | 1475 |
| 142 | Ga0070686_100004512 | 3300005544 | Bacteria | 7676 |
| 143 | Ga0070686_100005546 | 3300005544 | Bacteria | 6981 |
| 144 | Ga0070686_100042469 | 3300005544 | Bacteria | 2848 |
| 145 | Ga0070693_100012709 | 3300005547 | Bacteria | 4268 |
| 146 | Ga0070665_100051291 | 3300005548 | Bacteria | 4138 |
| 147 | Ga0070665_100186816 | 3300005548 | Unclassified | 2073 |
| 148 | Ga0070665_100258668 | 3300005548 | Bacteria | 1742 |
| 149 | Ga0070665_100304326 | 3300005548 | Bacteria | 1597 |
| 150 | Ga0070665_100523045 | 3300005548 | Bacteria | 1198 |
| 151 | Ga0068855_100000014 | 3300005563 | Bacteria | 232720 |
| 152 | Ga0068855_100043250 | 3300005563 | Bacteria | 5336 |
| 153 | Ga0068855_100173463 | 3300005563 | Bacteria | 2441 |
| 154 | Ga0068855_100213568 | 3300005563 | Bacteria | 2167 |
| 155 | Ga0070664_100000492 | 3300005564 | Bacteria | 29880 |
| 156 | Ga0070664_100022854 | 3300005564 | Bacteria | 5158 |
| 157 | Ga0070664_100139951 | 3300005564 | Bacteria | 2130 |
| 158 | Ga0070664_100195286 | 3300005564 | Bacteria | 1804 |
| 159 | Ga0068857_100032403 | 3300005577 | Bacteria | 4620 |
| 160 | Ga0068857_100034845 | 3300005577 | Bacteria | 4454 |
| 161 | Ga0068857_100266590 | 3300005577 | Bacteria | 1573 |
| 162 | Ga0068857_100286052 | 3300005577 | Unclassified | 1517 |
| 163 | Ga0068857_100539105 | 3300005577 | Unclassified | 1098 |
| 164 | Ga0068854_100064759 | 3300005578 | Bacteria | 2656 |
| 165 | Ga0068854_100085130 | 3300005578 | Bacteria | 2341 |
| 166 | Ga0068854_100127144 | 3300005578 | Bacteria | 1942 |
| 167 | Ga0068854_100235901 | 3300005578 | Bacteria | 1454 |
| 168 | Ga0068854_100360405 | 3300005578 | Bacteria | 1193 |
| 169 | Ga0068856_100089457 | 3300005614 | Bacteria | 3062 |
| 170 | Ga0068856_100395590 | 3300005614 | Bacteria | 1401 |
| 171 | Ga0068852_100023253 | 3300005616 | Bacteria | 4985 |
| 172 | Ga0068852_100046341 | 3300005616 | Bacteria | 3704 |
| 173 | Ga0068859_100006459 | 3300005617 | Bacteria | 11893 |
| 174 | Ga0068859_100017217 | 3300005617 | Bacteria | 7257 |
| 175 | Ga0068859_100114918 | 3300005617 | Bacteria | 2756 |
| 176 | Ga0068859_100180101 | 3300005617 | Bacteria | 2196 |
| 177 | Ga0068859_100341549 | 3300005617 | Bacteria | 1591 |
| 178 | Ga0068864_100000781 | 3300005618 | Bacteria | 26753 |
| 179 | Ga0068864_100008888 | 3300005618 | Bacteria | 8282 |
| 180 | Ga0068864_100051164 | 3300005618 | Bacteria | 3557 |
| 181 | Ga0068866_10011514 | 3300005718 | Bacteria | 3829 |
| 182 | Ga0068861_100029438 | 3300005719 | Bacteria | 4018 |
| 183 | Ga0068861_100093705 | 3300005719 | Unclassified | 2375 |
| 184 | Ga0068861_100339685 | 3300005719 | Unclassified | 1314 |
| 185 | Ga0068861_100373493 | 3300005719 | Bacteria | 1257 |
| 186 | Ga0068851_10016011 | 3300005834 | Unclassified | 3581 |
| 187 | Ga0068851_10079402 | 3300005834 | Unclassified | 1711 |
| 188 | Ga0068863_100000221 | 3300005841 | Bacteria | 60285 |
| 189 | Ga0068863_100022837 | 3300005841 | Bacteria | 5977 |
| 190 | Ga0068863_100126403 | 3300005841 | Bacteria | 2439 |
| 191 | Ga0068863_100186873 | 3300005841 | Unclassified | 1990 |
| 192 | Ga0068858_100013096 | 3300005842 | Bacteria | 7821 |
| 193 | Ga0068858_100026396 | 3300005842 | Bacteria | 5398 |
| 194 | Ga0068858_100082124 | 3300005842 | Unclassified | 2995 |
| 195 | Ga0068860_100006424 | 3300005843 | Bacteria | 11803 |
| 196 | Ga0068860_100018722 | 3300005843 | Bacteria | 6730 |
| 197 | Ga0068860_100188187 | 3300005843 | Unclassified | 1997 |
| 198 | Ga0068860_100302272 | 3300005843 | Bacteria | 1568 |
| 199 | Ga0068860_100378000 | 3300005843 | Bacteria | 1398 |
| 200 | Ga0068862_100011917 | 3300005844 | Bacteria | 7182 |
| 201 | Ga0068862_100221636 | 3300005844 | Bacteria | 1712 |
| 202 | Ga0068862_100288606 | 3300005844 | Bacteria | 1506 |
| 203 | Ga0081455_10007011 | 3300005937 | Bacteria | 11975 |
| 204 | Ga0081455_10093709 | 3300005937 | Unclassified | 2427 |
| 205 | Ga0081455_10285818 | 3300005937 | Bacteria | 1189 |
| 206 | Ga0081539_10004015 | 3300005985 | Bacteria | 16914 |
| 207 | Ga0081539_10004448 | 3300005985 | Bacteria | 15475 |
| 208 | Ga0070715_10132209 | 3300006163 | Unclassified | 1202 |
| 209 | Ga0070716_100059682 | 3300006173 | Bacteria | 2200 |
| 210 | Ga0097621_100000554 | 3300006237 | Bacteria | 26269 |
| 211 | Ga0097621_100019149 | 3300006237 | Bacteria | 5247 |
| 212 | Ga0097621_100021327 | 3300006237 | Bacteria | 5009 |
| 213 | Ga0097621_100021395 | 3300006237 | Bacteria | 5002 |
| 214 | Ga0097621_100021757 | 3300006237 | Bacteria | 4968 |
| 215 | Ga0097621_100039645 | 3300006237 | Bacteria | 3784 |
| 216 | Ga0097621_100062570 | 3300006237 | Unclassified | 3056 |
| 217 | Ga0068871_100001750 | 3300006358 | Bacteria | 14634 |
| 218 | Ga0068871_100002575 | 3300006358 | Bacteria | 12387 |
| 219 | Ga0068871_100003879 | 3300006358 | Bacteria | 10310 |
| 220 | Ga0068871_100023121 | 3300006358 | Bacteria | 4801 |
| 221 | Ga0068871_100037217 | 3300006358 | Bacteria | 3880 |
| 222 | Ga0068871_100069994 | 3300006358 | Bacteria | 2883 |
| 223 | Ga0068871_100107602 | 3300006358 | Bacteria | 2342 |
| 224 | Ga0075428_100064824 | 3300006844 | Unclassified | 4001 |
| 225 | Ga0075428_100148569 | 3300006844 | Bacteria | 2547 |
| 226 | Ga0075428_100151035 | 3300006844 | Unclassified | 2523 |
| 227 | Ga0075430_100005824 | 3300006846 | Bacteria | 10398 |
| 228 | Ga0075430_100007274 | 3300006846 | Bacteria | 9345 |
| 229 | Ga0075431_100002400 | 3300006847 | Bacteria | 18025 |
| 230 | Ga0075431_100095188 | 3300006847 | Bacteria | 3074 |
| 231 | Ga0075431_100134669 | 3300006847 | Bacteria | 2547 |
| 232 | Ga0075431_100243672 | 3300006847 | Bacteria | 1828 |
| 233 | Ga0075431_100363120 | 3300006847 | Bacteria | 1454 |
| 234 | Ga0075431_100431028 | 3300006847 | Bacteria | 1316 |
| 235 | Ga0075433_10224420 | 3300006852 | Bacteria | 1668 |
| 236 | Ga0075433_10252385 | 3300006852 | Bacteria | 1565 |
| 237 | Ga0075434_100063233 | 3300006871 | Bacteria | 3684 |
| 238 | Ga0075429_100050163 | 3300006880 | Bacteria | 3631 |
| 239 | Ga0075429_100091904 | 3300006880 | Bacteria | 2647 |
| 240 | Ga0075429_100094474 | 3300006880 | Bacteria | 2608 |
| 241 | Ga0075429_100108399 | 3300006880 | Unclassified | 2427 |
| 242 | Ga0068865_100056511 | 3300006881 | Bacteria | 2735 |
| 243 | Ga0068865_100124073 | 3300006881 | Bacteria | 1925 |
| 244 | Ga0068865_100260300 | 3300006881 | Bacteria | 1373 |
| 245 | Ga0097620_100006459 | 3300006931 | Bacteria | 11893 |
| 246 | Ga0097620_100017217 | 3300006931 | Bacteria | 7257 |
| 247 | Ga0097620_100114917 | 3300006931 | Bacteria | 2756 |
| 248 | Ga0097620_100180104 | 3300006931 | Bacteria | 2196 |
| 249 | Ga0097620_100309232 | 3300006931 | Bacteria | 1674 |
| 250 | Ga0097620_100341549 | 3300006931 | Bacteria | 1591 |
| 251 | Ga0099794_10022038 | 3300007265 | Bacteria | 2901 |
| 252 | Ga0105240_10028359 | 3300009093 | Bacteria | 7314 |
| 253 | Ga0105240_10043874 | 3300009093 | Bacteria | 5686 |
| 254 | Ga0105240_10064765 | 3300009093 | Bacteria | 4540 |
| 255 | Ga0105240_10169230 | 3300009093 | Unclassified | 2589 |
| 256 | Ga0105240_10244183 | 3300009093 | Bacteria | 2080 |
| 257 | Ga0111539_10000536 | 3300009094 | Bacteria | 48260 |
| 258 | Ga0111539_10031210 | 3300009094 | Bacteria | 6475 |
| 259 | Ga0111539_10076633 | 3300009094 | Bacteria | 3937 |
| 260 | Ga0111539_10277409 | 3300009094 | Bacteria | 1951 |
| 261 | Ga0111539_10489102 | 3300009094 | Unclassified | 1433 |
| 262 | Ga0111539_10675418 | 3300009094 | Unclassified | 1203 |
| 263 | Ga0105245_10001786 | 3300009098 | Bacteria | 19580 |
| 264 | Ga0105245_10043077 | 3300009098 | Bacteria | 4027 |
| 265 | Ga0105247_10001541 | 3300009101 | Bacteria | 16441 |
| 266 | Ga0114129_10014027 | 3300009147 | Bacteria | 11414 |
| 267 | Ga0114129_10093237 | 3300009147 | Bacteria | 4171 |
| 268 | Ga0114129_10176339 | 3300009147 | Bacteria | 2911 |
| 269 | Ga0114129_10194413 | 3300009147 | Unclassified | 2752 |
| 270 | Ga0114129_10381086 | 3300009147 | Bacteria | 1863 |
| 271 | Ga0114129_10558725 | 3300009147 | Bacteria | 1487 |
| 272 | Ga0105243_10232472 | 3300009148 | Bacteria | 1636 |
| 273 | Ga0105241_10004396 | 3300009174 | Bacteria | 10420 |
| 274 | Ga0105241_10166884 | 3300009174 | Bacteria | 1815 |
| 275 | Ga0105242_10003021 | 3300009176 | Bacteria | 13152 |
| 276 | Ga0105242_10006100 | 3300009176 | Bacteria | 9291 |
| 277 | Ga0105242_10022569 | 3300009176 | Bacteria | 4952 |
| 278 | Ga0105242_10069023 | 3300009176 | Unclassified | 2927 |
| 279 | Ga0105242_10098613 | 3300009176 | Bacteria | 2471 |
| 280 | Ga0105248_10000048 | 3300009177 | Bacteria | 154635 |
| 281 | Ga0105248_10015185 | 3300009177 | Bacteria | 8486 |
| 282 | Ga0105248_10057845 | 3300009177 | Bacteria | 4353 |
| 283 | Ga0105248_10185968 | 3300009177 | Bacteria | 2341 |
| 284 | Ga0105248_10442529 | 3300009177 | Bacteria | 1464 |
| 285 | Ga0105248_10448313 | 3300009177 | Bacteria | 1454 |
| 286 | Ga0105237_10009302 | 3300009545 | Bacteria | 10530 |
| 287 | Ga0105237_10093453 | 3300009545 | Unclassified | 2997 |
| 288 | Ga0105238_10459933 | 3300009551 | Bacteria | 1270 |
| 289 | Ga0105249_10013169 | 3300009553 | Bacteria | 7297 |
| 290 | Ga0105249_10021095 | 3300009553 | Bacteria | 5830 |
| 291 | Ga0105249_10058553 | 3300009553 | Bacteria | 3531 |
| 292 | Ga0105249_10060141 | 3300009553 | Unclassified | 3485 |
| 293 | Ga0105239_10012617 | 3300010375 | Bacteria | 9403 |
| 294 | Ga0105239_10205151 | 3300010375 | Bacteria | 2209 |
| 295 | Ga0105246_10042738 | 3300011119 | Bacteria | 3070 |
| 296 | Ga0157373_10007196 | 3300013100 | Bacteria | 8299 |
| 297 | Ga0157373_10025876 | 3300013100 | Bacteria | 4240 |
| 298 | Ga0157373_10217816 | 3300013100 | Bacteria | 1347 |
| 299 | Ga0157373_10341215 | 3300013100 | Bacteria | 1068 |
| 300 | Ga0157371_10015347 | 3300013102 | Bacteria | 5749 |
| 301 | Ga0157371_10030981 | 3300013102 | Bacteria | 3855 |
| 302 | Ga0157371_10079361 | 3300013102 | Bacteria | 2325 |
| 303 | Ga0157371_10185743 | 3300013102 | Bacteria | 1487 |
| 304 | Ga0157370_10005480 | 3300013104 | Bacteria | 14234 |
| 305 | Ga0157370_10011127 | 3300013104 | Bacteria | 9432 |
| 306 | Ga0157370_10013214 | 3300013104 | Bacteria | 8513 |
| 307 | Ga0157370_10029120 | 3300013104 | Bacteria | 5425 |
| 308 | Ga0157370_10102080 | 3300013104 | Bacteria | 2686 |
| 309 | Ga0157370_10121961 | 3300013104 | Bacteria | 2434 |
| 310 | Ga0157370_10248094 | 3300013104 | Bacteria | 1647 |
| 311 | Ga0157370_10509787 | 3300013104 | Bacteria | 1104 |
| 312 | Ga0157369_10186487 | 3300013105 | Bacteria | 2181 |
| 313 | Ga0157369_10305621 | 3300013105 | Bacteria | 1654 |
| 314 | Ga0157374_10005430 | 3300013296 | Bacteria | 10708 |
| 315 | Ga0157374_10022899 | 3300013296 | Bacteria | 5579 |
| 316 | Ga0157374_10024433 | 3300013296 | Bacteria | 5419 |
| 317 | Ga0157374_10053519 | 3300013296 | Bacteria | 3763 |
| 318 | Ga0157374_10136846 | 3300013296 | Bacteria | 2375 |
| 319 | Ga0157374_10161837 | 3300013296 | Bacteria | 2180 |
| 320 | Ga0157374_10162036 | 3300013296 | Unclassified | 2178 |
| 321 | Ga0157374_10196769 | 3300013296 | Bacteria | 1973 |
| 322 | Ga0157374_10208221 | 3300013296 | Bacteria | 1917 |
| 323 | Ga0157378_10000437 | 3300013297 | Bacteria | 40470 |
| 324 | Ga0157378_10001754 | 3300013297 | Bacteria | 19460 |
| 325 | Ga0157378_10002581 | 3300013297 | Bacteria | 16118 |
| 326 | Ga0157378_10003439 | 3300013297 | Bacteria | 14041 |
| 327 | Ga0157378_10087958 | 3300013297 | Bacteria | 2819 |
| 328 | Ga0157378_10091891 | 3300013297 | Bacteria | 2760 |
| 329 | Ga0157378_10284743 | 3300013297 | Unclassified | 1594 |
| 330 | Ga0163162_10000523 | 3300013306 | Bacteria | 35637 |
| 331 | Ga0163162_10005980 | 3300013306 | Bacteria | 11778 |
| 332 | Ga0163162_10124903 | 3300013306 | Unclassified | 2679 |
| 333 | Ga0163162_10286741 | 3300013306 | Bacteria | 1778 |
| 334 | Ga0163162_10635131 | 3300013306 | Bacteria | 1192 |
| 335 | Ga0157372_10015460 | 3300013307 | Bacteria | 8181 |
| 336 | Ga0157372_10055142 | 3300013307 | Bacteria | 4437 |
| 337 | Ga0157372_10067718 | 3300013307 | Bacteria | 4013 |
| 338 | Ga0157372_10192125 | 3300013307 | Bacteria | 2364 |
| 339 | Ga0157372_10334192 | 3300013307 | Bacteria | 1765 |
| 340 | Ga0157372_10479819 | 3300013307 | Bacteria | 1450 |
| 341 | Ga0157372_10651318 | 3300013307 | Unclassified | 1227 |
| 342 | Ga0157375_10000262 | 3300013308 | Bacteria | 47771 |
| 343 | Ga0157375_10001301 | 3300013308 | Bacteria | 21494 |
| 344 | Ga0157375_10035272 | 3300013308 | Bacteria | 4773 |
| 345 | Ga0157375_10122921 | 3300013308 | Bacteria | 2707 |
| 346 | Ga0157375_10260729 | 3300013308 | Bacteria | 1895 |
| 347 | Ga0157375_10310801 | 3300013308 | Bacteria | 1740 |
| 348 | Ga0157375_10392539 | 3300013308 | Bacteria | 1554 |
| 349 | Ga0157375_10438695 | 3300013308 | Unclassified | 1472 |
| 350 | Ga0157375_10640445 | 3300013308 | Bacteria | 1220 |
| 351 | Ga0163163_10001342 | 3300014325 | Bacteria | 20762 |
| 352 | Ga0163163_10008192 | 3300014325 | Bacteria | 9270 |
| 353 | Ga0163163_10008479 | 3300014325 | Bacteria | 9135 |
| 354 | Ga0163163_10108304 | 3300014325 | Bacteria | 2806 |
| 355 | Ga0163163_10116640 | 3300014325 | Bacteria | 2701 |
| 356 | Ga0163163_10232956 | 3300014325 | Bacteria | 1891 |
| 357 | Ga0163163_10378901 | 3300014325 | Unclassified | 1472 |
| 358 | Ga0163163_10435545 | 3300014325 | Bacteria | 1370 |
| 359 | Ga0157380_10010459 | 3300014326 | Bacteria | 6675 |
| 360 | Ga0157380_10035103 | 3300014326 | Bacteria | 3872 |
| 361 | Ga0157380_10050034 | 3300014326 | Unclassified | 3299 |
| 362 | Ga0157380_10127011 | 3300014326 | Bacteria | 2169 |
| 363 | Ga0157380_10205732 | 3300014326 | Bacteria | 1750 |
| 364 | Ga0157380_10247718 | 3300014326 | Unclassified | 1611 |
| 365 | Ga0157380_10426794 | 3300014326 | Bacteria | 1266 |
| 366 | Ga0157377_10016681 | 3300014745 | Unclassified | 3782 |
| 367 | Ga0157377_10030983 | 3300014745 | Bacteria | 2903 |
| 368 | Ga0157377_10083580 | 3300014745 | Bacteria | 1871 |
| 369 | Ga0157379_10000264 | 3300014968 | Bacteria | 41186 |
| 370 | Ga0157379_10135713 | 3300014968 | Unclassified | 2217 |
| 371 | Ga0157379_10167729 | 3300014968 | Unclassified | 1982 |
| 372 | Ga0157379_10263715 | 3300014968 | Unclassified | 1566 |
| 373 | Ga0157379_10268109 | 3300014968 | Bacteria | 1552 |
| 374 | Ga0157376_10041099 | 3300014969 | Unclassified | 3784 |
| 375 | Ga0157376_10056318 | 3300014969 | Bacteria | 3284 |
| 376 | Ga0157376_10081417 | 3300014969 | Unclassified | 2780 |
| 377 | Ga0157376_10101092 | 3300014969 | Bacteria | 2519 |
| 378 | Ga0157376_10207736 | 3300014969 | Bacteria | 1806 |
| 379 | Ga0163161_10018613 | 3300017792 | Bacteria | 4868 |
| 380 | Ga0163161_10030173 | 3300017792 | Unclassified | 3856 |
| 381 | Ga0163161_10083804 | 3300017792 | Bacteria | 2350 |
| 382 | Ga0213872_10047235 | 3300021361 | Unclassified | 1958 |
| 383 | Ga0213871_10004166 | 3300021441 | Unclassified | 2869 |
| 384 | Ga0207697_10086919 | 3300025315 | Bacteria | 1322 |
| 385 | Ga0207656_10000483 | 3300025321 | Bacteria | 13166 |
| 386 | Ga0207688_10252598 | 3300025901 | Unclassified | 1068 |
| 387 | Ga0207680_10001546 | 3300025903 | Bacteria | 10833 |
| 388 | Ga0207680_10011290 | 3300025903 | Bacteria | 4509 |
| 389 | Ga0207680_10026291 | 3300025903 | Bacteria | 3225 |
| 390 | Ga0207680_10130427 | 3300025903 | Bacteria | 1656 |
| 391 | Ga0207647_10010393 | 3300025904 | Bacteria | 6574 |
| 392 | Ga0207647_10135566 | 3300025904 | Unclassified | 1445 |
| 393 | Ga0207645_10018735 | 3300025907 | Bacteria | 4547 |
| 394 | Ga0207645_10029340 | 3300025907 | Bacteria | 3547 |
| 395 | Ga0207643_10017411 | 3300025908 | Bacteria | 3929 |
| 396 | Ga0207705_10000623 | 3300025909 | Bacteria | 29594 |
| 397 | Ga0207705_10072838 | 3300025909 | Bacteria | 2492 |
| 398 | Ga0207684_10157635 | 3300025910 | Bacteria | 1954 |
| 399 | Ga0207654_10028106 | 3300025911 | Bacteria | 3064 |
| 400 | Ga0207654_10172482 | 3300025911 | Bacteria | 1405 |
| 401 | Ga0207707_10019903 | 3300025912 | Bacteria | 5858 |
| 402 | Ga0207707_10096788 | 3300025912 | Bacteria | 2579 |
| 403 | Ga0207695_10005932 | 3300025913 | Bacteria | 16010 |
| 404 | Ga0207695_10029463 | 3300025913 | Bacteria | 6064 |
| 405 | Ga0207695_10034212 | 3300025913 | Bacteria | 5531 |
| 406 | Ga0207695_10134545 | 3300025913 | Unclassified | 2426 |
| 407 | Ga0207660_10033757 | 3300025917 | Bacteria | 3542 |
| 408 | Ga0207660_10067556 | 3300025917 | Bacteria | 2590 |
| 409 | Ga0207660_10071945 | 3300025917 | Bacteria | 2517 |
| 410 | Ga0207660_10387918 | 3300025917 | Bacteria | 1123 |
| 411 | Ga0207662_10002985 | 3300025918 | Bacteria | 8615 |
| 412 | Ga0207662_10058259 | 3300025918 | Unclassified | 2312 |
| 413 | Ga0207657_10010235 | 3300025919 | Bacteria | 9367 |
| 414 | Ga0207657_10025421 | 3300025919 | Bacteria | 5462 |
| 415 | Ga0207657_10119828 | 3300025919 | Bacteria | 2165 |
| 416 | Ga0207649_10002503 | 3300025920 | Bacteria | 10263 |
| 417 | Ga0207649_10025152 | 3300025920 | Bacteria | 3468 |
| 418 | Ga0207649_10233776 | 3300025920 | Bacteria | 1316 |
| 419 | Ga0207652_10002089 | 3300025921 | Bacteria | 17168 |
| 420 | Ga0207652_10005426 | 3300025921 | Bacteria | 10345 |
| 421 | Ga0207652_10021177 | 3300025921 | Bacteria | 5365 |
| 422 | Ga0207652_10121649 | 3300025921 | Bacteria | 2323 |
| 423 | Ga0207652_10170678 | 3300025921 | Bacteria | 1952 |
| 424 | Ga0207652_10349652 | 3300025921 | Bacteria | 1334 |
| 425 | Ga0207646_10000032 | 3300025922 | Bacteria | 216397 |
| 426 | Ga0207646_10524475 | 3300025922 | Bacteria | 1066 |
| 427 | Ga0207681_10108322 | 3300025923 | Unclassified | 2016 |
| 428 | Ga0207681_10322777 | 3300025923 | Bacteria | 1228 |
| 429 | Ga0207650_10000510 | 3300025925 | Bacteria | 32441 |
| 430 | Ga0207650_10031978 | 3300025925 | Bacteria | 3805 |
| 431 | Ga0207650_10067621 | 3300025925 | Bacteria | 2681 |
| 432 | Ga0207650_10085894 | 3300025925 | Bacteria | 2394 |
| 433 | Ga0207650_10090549 | 3300025925 | Bacteria | 2336 |
| 434 | Ga0207650_10102126 | 3300025925 | Unclassified | 2209 |
| 435 | Ga0207650_10115851 | 3300025925 | Bacteria | 2080 |
| 436 | Ga0207650_10148330 | 3300025925 | Bacteria | 1849 |
| 437 | Ga0207650_10177790 | 3300025925 | Bacteria | 1695 |
| 438 | Ga0207650_10268623 | 3300025925 | Bacteria | 1386 |
| 439 | Ga0207659_10000173 | 3300025926 | Bacteria | 38585 |
| 440 | Ga0207659_10002371 | 3300025926 | Bacteria | 11213 |
| 441 | Ga0207659_10020599 | 3300025926 | Bacteria | 4362 |
| 442 | Ga0207659_10029299 | 3300025926 | Unclassified | 3751 |
| 443 | Ga0207659_10286541 | 3300025926 | Unclassified | 1348 |
| 444 | Ga0207644_10002882 | 3300025931 | Bacteria | 11083 |
| 445 | Ga0207644_10015078 | 3300025931 | Bacteria | 5185 |
| 446 | Ga0207690_10073407 | 3300025932 | Bacteria | 2366 |
| 447 | Ga0207690_10147506 | 3300025932 | Bacteria | 1741 |
| 448 | Ga0207690_10209824 | 3300025932 | Bacteria | 1484 |
| 449 | Ga0207690_10263057 | 3300025932 | Unclassified | 1337 |
| 450 | Ga0207690_10425887 | 3300025932 | Bacteria | 1063 |
| 451 | Ga0207706_10052994 | 3300025933 | Bacteria | 3581 |
| 452 | Ga0207706_10077398 | 3300025933 | Bacteria | 2925 |
| 453 | Ga0207706_10112705 | 3300025933 | Bacteria | 2393 |
| 454 | Ga0207686_10000884 | 3300025934 | Bacteria | 18109 |
| 455 | Ga0207686_10171732 | 3300025934 | Unclassified | 1529 |
| 456 | Ga0207670_10004333 | 3300025936 | Bacteria | 7624 |
| 457 | Ga0207670_10029226 | 3300025936 | Bacteria | 3509 |
| 458 | Ga0207670_10120701 | 3300025936 | Bacteria | 1905 |
| 459 | Ga0207670_10351037 | 3300025936 | Bacteria | 1168 |
| 460 | Ga0207704_10015131 | 3300025938 | Bacteria | 3922 |
| 461 | Ga0207704_10091665 | 3300025938 | Bacteria | 1998 |
| 462 | Ga0207691_10019398 | 3300025940 | Bacteria | 6435 |
| 463 | Ga0207691_10019513 | 3300025940 | Bacteria | 6415 |
| 464 | Ga0207691_10028488 | 3300025940 | Bacteria | 5231 |
| 465 | Ga0207691_10121889 | 3300025940 | Bacteria | 2310 |
| 466 | Ga0207691_10197390 | 3300025940 | Bacteria | 1752 |
| 467 | Ga0207711_10000648 | 3300025941 | Bacteria | 34717 |
| 468 | Ga0207711_10267390 | 3300025941 | Bacteria | 1573 |
| 469 | Ga0207711_10305515 | 3300025941 | Bacteria | 1468 |
| 470 | Ga0207689_10002805 | 3300025942 | Bacteria | 16095 |
| 471 | Ga0207689_10040689 | 3300025942 | Bacteria | 3846 |
| 472 | Ga0207689_10088810 | 3300025942 | Unclassified | 2539 |
| 473 | Ga0207689_10244290 | 3300025942 | Bacteria | 1484 |
| 474 | Ga0207661_10001069 | 3300025944 | Bacteria | 18229 |
| 475 | Ga0207661_10036520 | 3300025944 | Bacteria | 3836 |
| 476 | Ga0207661_10120313 | 3300025944 | Bacteria | 2234 |
| 477 | Ga0207661_10244550 | 3300025944 | Bacteria | 1593 |
| 478 | Ga0207679_10013567 | 3300025945 | Bacteria | 5340 |
| 479 | Ga0207679_10021225 | 3300025945 | Bacteria | 4398 |
| 480 | Ga0207679_10036606 | 3300025945 | Bacteria | 3481 |
| 481 | Ga0207679_10320840 | 3300025945 | Unclassified | 1341 |
| 482 | Ga0207667_10000049 | 3300025949 | Bacteria | 235027 |
| 483 | Ga0207667_10019413 | 3300025949 | Bacteria | 7590 |
| 484 | Ga0207667_10081514 | 3300025949 | Bacteria | 3352 |
| 485 | Ga0207667_10198753 | 3300025949 | Bacteria | 2057 |
| 486 | Ga0207667_10213407 | 3300025949 | Bacteria | 1978 |
| 487 | Ga0207667_10253002 | 3300025949 | Unclassified | 1802 |
| 488 | Ga0207651_10022287 | 3300025960 | Bacteria | 3869 |
| 489 | Ga0207651_10040387 | 3300025960 | Bacteria | 3086 |
| 490 | Ga0207651_10148977 | 3300025960 | Unclassified | 1819 |
| 491 | Ga0207651_10294905 | 3300025960 | Unclassified | 1346 |
| 492 | Ga0207712_10002170 | 3300025961 | Bacteria | 12828 |
| 493 | Ga0207712_10013251 | 3300025961 | Bacteria | 5285 |
| 494 | Ga0207668_10000663 | 3300025972 | Bacteria | 21145 |
| 495 | Ga0207668_10032610 | 3300025972 | Bacteria | 3444 |
| 496 | Ga0207668_10083168 | 3300025972 | Unclassified | 2328 |
| 497 | Ga0207640_10012544 | 3300025981 | Bacteria | 4831 |
| 498 | Ga0207640_10058766 | 3300025981 | Bacteria | 2535 |
| 499 | Ga0207640_10069819 | 3300025981 | Bacteria | 2360 |
| 500 | Ga0207640_10187764 | 3300025981 | Bacteria | 1555 |
| 501 | Ga0207658_10010785 | 3300025986 | Bacteria | 6217 |
| 502 | Ga0207658_10056336 | 3300025986 | Bacteria | 2917 |
| 503 | Ga0207658_10132733 | 3300025986 | Bacteria | 2003 |
| 504 | Ga0207658_10153660 | 3300025986 | Bacteria | 1878 |
| 505 | Ga0207658_10195617 | 3300025986 | Bacteria | 1684 |
| 506 | Ga0207658_10257330 | 3300025986 | Unclassified | 1486 |
| 507 | Ga0207677_10028007 | 3300026023 | Bacteria | 3558 |
| 508 | Ga0207677_10038103 | 3300026023 | Bacteria | 3148 |
| 509 | Ga0207703_10013004 | 3300026035 | Bacteria | 6485 |
| 510 | Ga0207703_10019904 | 3300026035 | Bacteria | 5246 |
| 511 | Ga0207639_10005388 | 3300026041 | Bacteria | 8651 |
| 512 | Ga0207639_10007679 | 3300026041 | Bacteria | 7362 |
| 513 | Ga0207639_10086260 | 3300026041 | Bacteria | 2499 |
| 514 | Ga0207639_10091546 | 3300026041 | Bacteria | 2435 |
| 515 | Ga0207639_10093975 | 3300026041 | Bacteria | 2406 |
| 516 | Ga0207639_10257563 | 3300026041 | Bacteria | 1524 |
| 517 | Ga0207678_10170339 | 3300026067 | Unclassified | 1859 |
| 518 | Ga0207708_10096778 | 3300026075 | Bacteria | 2281 |
| 519 | Ga0207702_10051789 | 3300026078 | Bacteria | 3471 |
| 520 | Ga0207641_10000561 | 3300026088 | Bacteria | 41567 |
| 521 | Ga0207641_10001235 | 3300026088 | Bacteria | 25590 |
| 522 | Ga0207641_10015720 | 3300026088 | Bacteria | 6201 |
| 523 | Ga0207641_10035180 | 3300026088 | Bacteria | 4171 |
| 524 | Ga0207641_10161340 | 3300026088 | Bacteria | 2038 |
| 525 | Ga0207648_10002623 | 3300026089 | Bacteria | 19251 |
| 526 | Ga0207648_10303428 | 3300026089 | Bacteria | 1432 |
| 527 | Ga0207676_10026191 | 3300026095 | Bacteria | 4335 |
| 528 | Ga0207676_10049325 | 3300026095 | Bacteria | 3274 |
| 529 | Ga0207676_10082344 | 3300026095 | Bacteria | 2617 |
| 530 | Ga0207676_10379983 | 3300026095 | Unclassified | 1315 |
| 531 | Ga0207674_10033423 | 3300026116 | Bacteria | 5385 |
| 532 | Ga0207674_10061864 | 3300026116 | Bacteria | 3782 |
| 533 | Ga0207674_10212617 | 3300026116 | Bacteria | 1883 |
| 534 | Ga0207674_10529904 | 3300026116 | Unclassified | 1138 |
| 535 | Ga0207675_100049100 | 3300026118 | Bacteria | 3939 |
| 536 | Ga0207675_100077458 | 3300026118 | Bacteria | 3115 |
| 537 | Ga0207675_100429753 | 3300026118 | Bacteria | 1305 |
| 538 | Ga0207683_10020712 | 3300026121 | Bacteria | 5627 |
| 539 | Ga0207683_10124392 | 3300026121 | Bacteria | 2317 |
| 540 | Ga0207683_10287154 | 3300026121 | Unclassified | 1504 |
| 541 | Ga0207698_10018072 | 3300026142 | Bacteria | 4797 |
| 542 | Ga0207698_10052775 | 3300026142 | Bacteria | 3117 |
| 543 | Ga0207698_10327836 | 3300026142 | Bacteria | 1437 |
| 544 | Ga0209974_10005581 | 3300027876 | Bacteria | 4420 |
| 545 | Ga0207428_10000031 | 3300027907 | Bacteria | 235245 |
| 546 | Ga0268266_10191970 | 3300028379 | Bacteria | 1865 |
| 547 | Ga0268266_10209886 | 3300028379 | Unclassified | 1785 |
| 548 | Ga0268266_10269806 | 3300028379 | Bacteria | 1579 |
| 549 | Ga0268266_10280572 | 3300028379 | Bacteria | 1549 |
| 550 | Ga0268266_10476697 | 3300028379 | Bacteria | 1189 |
| 551 | Ga0268265_10062858 | 3300028380 | Bacteria | 2854 |
| 552 | Ga0268265_10097521 | 3300028380 | Bacteria | 2365 |
| 553 | Ga0268265_10219681 | 3300028380 | Unclassified | 1662 |
| 554 | Ga0268264_10007005 | 3300028381 | Bacteria | 9459 |
| 555 | Ga0268264_10030284 | 3300028381 | Bacteria | 4436 |
| 556 | Ga0268264_10059906 | 3300028381 | Bacteria | 3191 |
| 557 | Ga0268264_10316568 | 3300028381 | Bacteria | 1474 |
| 558 | Ga0268264_10454451 | 3300028381 | Bacteria | 1242 |
| 559 | Ga0265337_1001644 | 3300028556 | Bacteria | 10866 |
| 560 | Ga0265326_10013130 | 3300028558 | Bacteria | 2426 |
| 561 | Ga0265318_10000195 | 3300028577 | Bacteria | 53122 |
| 562 | Ga0265323_10005862 | 3300028653 | Bacteria | 5194 |
| 563 | Ga0265322_10001230 | 3300028654 | Bacteria | 8712 |
| 564 | Ga0307515_10000092 | 3300028794 | Bacteria | 212425 |
| 565 | Ga0265338_10077849 | 3300028800 | Bacteria | 2800 |
| 566 | Ga0265338_10169127 | 3300028800 | Bacteria | 1679 |
| 567 | Ga0265330_10009657 | 3300031235 | Unclassified | 4575 |
| 568 | Ga0265332_10036575 | 3300031238 | Bacteria | 2131 |
| 569 | Ga0265320_10000070 | 3300031240 | Bacteria | 90235 |
| 570 | Ga0265325_10005122 | 3300031241 | Bacteria | 8153 |
| 571 | Ga0265325_10033045 | 3300031241 | Bacteria | 2759 |
| 572 | Ga0265325_10135437 | 3300031241 | Bacteria | 1176 |
| 573 | Ga0265329_10000929 | 3300031242 | Bacteria | 14720 |
| 574 | Ga0265340_10000108 | 3300031247 | Bacteria | 40680 |
| 575 | Ga0265340_10003007 | 3300031247 | Bacteria | 9597 |
| 576 | Ga0265339_10034529 | 3300031249 | Bacteria | 2841 |
| 577 | Ga0265339_10087891 | 3300031249 | Bacteria | 1633 |
| 578 | Ga0265331_10003091 | 3300031250 | Bacteria | 10913 |
| 579 | Ga0265316_10006923 | 3300031344 | Bacteria | 10753 |
| 580 | Ga0265316_10080444 | 3300031344 | Unclassified | 2499 |
| 581 | Ga0265316_10100115 | 3300031344 | Bacteria | 2203 |
| 582 | Ga0307513_10125887 | 3300031456 | Bacteria | 2518 |
| 583 | Ga0307509_10107579 | 3300031507 | Bacteria | 2804 |
| 584 | Ga0307408_100040397 | 3300031548 | Bacteria | 3303 |
| 585 | Ga0307408_100040579 | 3300031548 | Bacteria | 3296 |
| 586 | Ga0265313_10001878 | 3300031595 | Bacteria | 19092 |
| 587 | Ga0265313_10039862 | 3300031595 | Bacteria | 2327 |
| 588 | Ga0316575_10001544 | 3300031665 | Bacteria | 7459 |
| 589 | Ga0316575_10002566 | 3300031665 | Bacteria | 6107 |
| 590 | Ga0316575_10012027 | 3300031665 | Bacteria | 3212 |
| 591 | Ga0316575_10052820 | 3300031665 | Bacteria | 1618 |
| 592 | Ga0316579_10057577 | 3300031691 | Bacteria | 1826 |
| 593 | Ga0316579_10073899 | 3300031691 | Bacteria | 1618 |
| 594 | Ga0265314_10000104 | 3300031711 | Bacteria | 127566 |
| 595 | Ga0265314_10050435 | 3300031711 | Bacteria | 2907 |
| 596 | Ga0265314_10054940 | 3300031711 | Bacteria | 2752 |
| 597 | Ga0265342_10000433 | 3300031712 | Bacteria | 45864 |
| 598 | Ga0265342_10001030 | 3300031712 | Bacteria | 27382 |
| 599 | Ga0316576_10003610 | 3300031727 | Bacteria | 9123 |
| 600 | Ga0316576_10006995 | 3300031727 | Bacteria | 7059 |
| 601 | Ga0316576_10008823 | 3300031727 | Bacteria | 6465 |
| 602 | Ga0316576_10048941 | 3300031727 | Bacteria | 3068 |
| 603 | Ga0316576_10052550 | 3300031727 | Bacteria | 2967 |
| 604 | Ga0316576_10127808 | 3300031727 | Bacteria | 1911 |
| 605 | Ga0316576_10198194 | 3300031727 | Bacteria | 1513 |
| 606 | Ga0316578_10002870 | 3300031728 | Bacteria | 7704 |
| 607 | Ga0316578_10003237 | 3300031728 | Bacteria | 7393 |
| 608 | Ga0316578_10007341 | 3300031728 | Bacteria | 5519 |
| 609 | Ga0316578_10161863 | 3300031728 | Bacteria | 1349 |
| 610 | Ga0316578_10172301 | 3300031728 | Bacteria | 1304 |
| 611 | Ga0307405_10050942 | 3300031731 | Bacteria | 2567 |
| 612 | Ga0316577_10021897 | 3300031733 | Unclassified | 3547 |
| 613 | Ga0316577_10074270 | 3300031733 | Bacteria | 1898 |
| 614 | Ga0307410_10013477 | 3300031852 | Bacteria | 4771 |
| 615 | Ga0307410_10017356 | 3300031852 | Bacteria | 4321 |
| 616 | Ga0307410_10040082 | 3300031852 | Bacteria | 3080 |
| 617 | Ga0307410_10123549 | 3300031852 | Bacteria | 1891 |
| 618 | Ga0307410_10299823 | 3300031852 | Bacteria | 1268 |
| 619 | Ga0307407_10045299 | 3300031903 | Bacteria | 2485 |
| 620 | Ga0307412_10232205 | 3300031911 | Bacteria | 1421 |
| 621 | Ga0307409_100085900 | 3300031995 | Bacteria | 2559 |
| 622 | Ga0307409_100306417 | 3300031995 | Bacteria | 1480 |
| 623 | Ga0307416_100027174 | 3300032002 | Bacteria | 4233 |
| 624 | Ga0307416_100056409 | 3300032002 | Bacteria | 3170 |
| 625 | Ga0307416_100135889 | 3300032002 | Bacteria | 2224 |
| 626 | Ga0307414_10367887 | 3300032004 | Bacteria | 1239 |
| 627 | Ga0307411_10038303 | 3300032005 | Unclassified | 3023 |
| 628 | Ga0307411_10042060 | 3300032005 | Bacteria | 2912 |
| 629 | Ga0307411_10189530 | 3300032005 | Unclassified | 1569 |
| 630 | Ga0307411_10235310 | 3300032005 | Bacteria | 1430 |
| 631 | Ga0307411_10308563 | 3300032005 | Bacteria | 1272 |
| 632 | Ga0307415_100030729 | 3300032126 | Bacteria | 3452 |
| 633 | Ga0307415_100240574 | 3300032126 | Bacteria | 1464 |
| 634 | Ga0316583_10003577 | 3300032133 | Bacteria | 5488 |
| 635 | Ga0316583_10004947 | 3300032133 | Bacteria | 4760 |
| 636 | Ga0316583_10008550 | 3300032133 | Bacteria | 3692 |
| 637 | Ga0316583_10021390 | 3300032133 | Bacteria | 2318 |
| 638 | Ga0316583_10026515 | 3300032133 | Bacteria | 2068 |
| 639 | Ga0316583_10035788 | 3300032133 | Bacteria | 1762 |
| 640 | Ga0316583_10040292 | 3300032133 | Bacteria | 1654 |
| 641 | Ga0316583_10048860 | 3300032133 | Bacteria | 1489 |
| 642 | Ga0316585_10008588 | 3300032137 | Unclassified | 2967 |
| 643 | Ga0316585_10052164 | 3300032137 | Bacteria | 1314 |
| 644 | Ga0316580_10000900 | 3300032139 | Bacteria | 7356 |
| 645 | Ga0316580_10001815 | 3300032139 | Bacteria | 5722 |
| 646 | Ga0316580_10056442 | 3300032139 | Bacteria | 1207 |
| 647 | Ga0316592_1006636 | 3300033524 | Bacteria | 2236 |
| 648 | Ga0316588_1040045 | 3300033528 | Bacteria | 1118 |
| 649 | Ga0373953_0095547 | 3300035117 | Bacteria | 1247 |
| 650 | Ga0373953_0148845 | 3300035117 | Archaea | 1003 |
| 651 | Ga0373955_0073320 | 3300035172 | Unclassified | 1919 |
| 652 | Ga0316574_0012270 | 3300035398 | Bacteria | 4900 |
| 653 | Ga0316574_0014180 | 3300035398 | Bacteria | 4597 |
| 654 | Ga0316574_0027730 | 3300035398 | Bacteria | 3412 |
| 655 | Ga0373947_0251800 | 3300035725 | Bacteria | 1168 |
| 656 | Ga0373937_0012246 | 3300036401 | Bacteria | 7536 |
| 657 | Ga0373937_0043557 | 3300036401 | Unclassified | 4098 |
| 658 | Ga0373937_0135290 | 3300036401 | Bacteria | 2304 |
| 659 | Ga0373937_0436749 | 3300036401 | Bacteria | 1243 |
| 660 | Ga0316582_0016664 | 3300036647 | Bacteria | 4231 |
| 661 | Ga0316582_0055855 | 3300036647 | Bacteria | 2518 |
| 662 | Ga0316584_0004299 | 3300036712 | Bacteria | 9415 |
| 663 | Ga0316584_0004621 | 3300036712 | Bacteria | 9123 |
| 664 | Ga0316584_0004631 | 3300036712 | Bacteria | 9112 |
| 665 | Ga0373925_0497364 | 3300037068 | Bacteria | 1001 |
| 666 | Ga0395899_0017367 | 3300037312 | Bacteria | 5481 |
| 667 | Ga0395900_0018883 | 3300037418 | Bacteria | 7032 |
| 668 | Ga0395900_0027156 | 3300037418 | Bacteria | 5861 |
| 669 | Ga0395900_0124498 | 3300037418 | Bacteria | 2644 |
| 670 | Ga0395898_0001959 | 3300037466 | Bacteria | 26028 |
| 671 | Ga0395898_0085750 | 3300037466 | Bacteria | 3036 |
| 672 | Ga0395898_0154787 | 3300037466 | Bacteria | 2193 |
| 673 | Ga0395905_0012005 | 3300037471 | Bacteria | 8354 |
| 674 | Ga0316581_0027607 | 3300037588 | Bacteria | 1697 |
| 675 | Ga0316581_0034851 | 3300037588 | Bacteria | 1524 |
| 676 | Ga0395901_0001045 | 3300038443 | Bacteria | 29867 |
| 677 | Ga0395901_0009760 | 3300038443 | Bacteria | 9734 |
| 678 | Ga0395901_0015422 | 3300038443 | Bacteria | 7781 |
| 679 | Ga0436365_0336651 | 3300039437 | Bacteria | 1798 |
| 680 | Ga0436360_0105708 | 3300039438 | Bacteria | 7936 |
| 681 | Ga0436361_0740991 | 3300039447 | Bacteria | 8130 |
| 682 | Ga0436362_0346855 | 3300039453 | Bacteria | 4746 |
| 683 | Ga0439449_0040168 | 3300042007 | Bacteria | 1739 |
| 684 | Ga0439435_0049817 | 3300042436 | Unclassified | 1196 |
| 685 | Ga0451577_0003018 | 3300042876 | Bacteria | 19168 |
| 686 | Ga0451577_0016447 | 3300042876 | Bacteria | 6852 |
| 687 | Ga0451577_0102493 | 3300042876 | Unclassified | 2558 |
| 688 | Ga0451577_0123283 | 3300042876 | Bacteria | 2321 |
| 689 | Ga0451577_0147235 | 3300042876 | Bacteria | 2118 |
| 690 | Ga0451577_0247500 | 3300042876 | Bacteria | 1613 |
| 691 | Ga0466972_0000009 | 3300044658 | Bacteria | 256374 |
| 692 | Ga0453683_0049204 | 3300044673 | Bacteria | 2643 |
| 693 | Ga0453683_0204881 | 3300044673 | Bacteria | 1252 |
| 694 | Ga0453684_0000220 | 3300044712 | Bacteria | 249922 |
| 695 | Ga0453684_0029795 | 3300044712 | Bacteria | 7733 |
| 696 | Ga0453684_0120717 | 3300044712 | Bacteria | 3165 |
| 697 | Ga0453684_0153749 | 3300044712 | Bacteria | 2730 |
| 698 | Ga0453684_0187841 | 3300044712 | Bacteria | 2420 |
| 699 | Ga0453684_0349268 | 3300044712 | Bacteria | 1668 |
| 700 | Ga0453684_0464060 | 3300044712 | Bacteria | 1407 |
| 701 | Ga0453684_0481969 | 3300044712 | Bacteria | 1376 |
| 702 | Ga0453684_0518598 | 3300044712 | Bacteria | 1317 |
| 703 | Ga0466957_0033462 | 3300044842 | Bacteria | 3084 |
| 704 | Ga0451576_0030100 | 3300045051 | Bacteria | 5805 |
| 705 | Ga0451576_0031338 | 3300045051 | Bacteria | 5670 |
| 706 | Ga0451576_0255094 | 3300045051 | Bacteria | 1833 |
| 707 | Ga0495592_0054446 | 3300046454 | Bacteria | 2964 |
| 708 | Ga0495629_0105738 | 3300046459 | Bacteria | 1963 |
| 709 | Ga0495629_0145201 | 3300046459 | Unclassified | 1650 |
| 710 | Ga0495629_0193814 | 3300046459 | Unclassified | 1406 |
| 711 | Ga0495651_0000090 | 3300046462 | Bacteria | 66511 |
| 712 | Ga0495651_0139011 | 3300046462 | Bacteria | 1764 |
| 713 | Ga0495580_0163858 | 3300046472 | Bacteria | 1538 |
| 714 | Ga0495662_0009490 | 3300046476 | Unclassified | 4773 |
| 715 | Ga0495664_0187534 | 3300046477 | Bacteria | 1254 |
| 716 | Ga0495585_0000525 | 3300046492 | Bacteria | 36200 |
| 717 | Ga0495618_0038745 | 3300046514 | Bacteria | 2997 |
| 718 | Ga0495618_0170044 | 3300046514 | Unclassified | 1387 |
| 719 | Ga0495630_0012249 | 3300046517 | Bacteria | 6221 |
| 720 | Ga0495630_0361005 | 3300046517 | Bacteria | 1112 |
| 721 | Ga0495643_0009334 | 3300046522 | Bacteria | 6104 |
| 722 | Ga0495640_0081835 | 3300046533 | Unclassified | 2146 |
| 723 | Ga0495640_0163101 | 3300046533 | Bacteria | 1427 |
| 724 | Ga0495587_0034140 | 3300046536 | Bacteria | 3069 |
| 725 | Ga0495587_0054565 | 3300046536 | Bacteria | 2355 |
| 726 | Ga0495587_0094614 | 3300046536 | Bacteria | 1725 |
| 727 | Ga0495598_0007722 | 3300046537 | Bacteria | 2479 |
| 728 | Ga0495645_0020717 | 3300046543 | Bacteria | 4748 |
| 729 | Ga0495667_0005808 | 3300046559 | Bacteria | 8363 |
| 730 | Ga0495667_0030382 | 3300046559 | Unclassified | 3630 |
| 731 | Ga0495656_0001607 | 3300046615 | Bacteria | 7396 |
| 732 | Ga0495656_0118129 | 3300046615 | Bacteria | 1248 |
| 733 | Ga0495634_0038710 | 3300046642 | Bacteria | 3250 |
| 734 | Ga0495635_0014765 | 3300046663 | Bacteria | 5464 |
| 735 | Ga0495657_0002664 | 3300046675 | Bacteria | 14920 |
| 736 | Ga0495657_0220443 | 3300046675 | Bacteria | 1150 |
| 737 | Ga0495599_0119314 | 3300046678 | Bacteria | 1640 |
| 738 | Ga0495599_0189701 | 3300046678 | Bacteria | 1265 |
| 739 | Ga0495658_0015758 | 3300046683 | Bacteria | 3882 |
| 740 | Ga0495658_0094565 | 3300046683 | Unclassified | 1775 |
| 741 | Ga0495658_0138528 | 3300046683 | Bacteria | 1487 |
| 742 | Ga0495669_0006927 | 3300046684 | Bacteria | 4748 |
| 743 | Ga0495613_0043195 | 3300046689 | Unclassified | 3334 |
| 744 | Ga0495670_0124712 | 3300046691 | Bacteria | 1340 |
| 745 | Ga0495670_0125443 | 3300046691 | Bacteria | 1336 |
| 746 | Ga0495670_0159165 | 3300046691 | Bacteria | 1186 |
| 747 | Ga0495600_0027708 | 3300046809 | Bacteria | 3662 |
| 748 | Ga0495600_0122883 | 3300046809 | Bacteria | 1688 |
| 749 | Ga0495581_0079809 | 3300047315 | Unclassified | 1894 |
| 750 | Ga0495604_0006369 | 3300047317 | Bacteria | 9362 |
| 751 | Ga0495604_0111219 | 3300047317 | Bacteria | 1997 |
| 752 | Ga0495604_0220447 | 3300047317 | Unclassified | 1306 |
| 753 | Ga0495636_0000016 | 3300047318 | Bacteria | 78995 |
| 754 | Ga0495674_0061772 | 3300047319 | Bacteria | 3264 |
| 755 | Ga0495674_0168095 | 3300047319 | Unclassified | 1831 |
| 756 | Ga0495680_0001014 | 3300047322 | Bacteria | 31192 |
| 757 | Ga0495680_0047511 | 3300047322 | Bacteria | 3376 |
| 758 | Ga0495675_0021392 | 3300047444 | Bacteria | 4118 |
| 759 | Ga0495675_0051785 | 3300047444 | Unclassified | 2607 |
| 760 | Ga0495684_0057463 | 3300047471 | Bacteria | 2965 |
| 761 | Ga0495684_0158850 | 3300047471 | Unclassified | 1687 |
| 762 | Ga0495602_0092839 | 3300048088 | Bacteria | 2499 |
| 763 | Ga0495602_0199484 | 3300048088 | Bacteria | 1528 |
| 764 | Ga0496101_0201633 | 3300048904 | Bacteria | 1538 |
| 765 | Ga0496102_0065747 | 3300048905 | Bacteria | 3324 |
| 766 | Ga0496104_0088030 | 3300048907 | Bacteria | 2966 |
| 767 | Ga0496105_0087649 | 3300048908 | Bacteria | 2572 |
| 768 | Ga0496106_0061170 | 3300048909 | Bacteria | 2856 |
| 769 | Ga0496107_0029175 | 3300048910 | Bacteria | 3924 |
| 770 | Ga0496108_0057265 | 3300048911 | Bacteria | 3275 |
| 771 | Ga0496108_0143849 | 3300048911 | Bacteria | 2055 |
| 772 | Ga0496108_0161989 | 3300048911 | Bacteria | 1934 |
| 773 | Ga0496109_0130602 | 3300048912 | Bacteria | 2344 |
| 774 | Ga0496109_0476539 | 3300048912 | Bacteria | 1178 |
| 775 | Ga0496112_0117533 | 3300048915 | Bacteria | 2629 |
| 776 | Ga0496112_0702373 | 3300048915 | Bacteria | 939 |
| 777 | Ga0496114_0058821 | 3300048917 | Bacteria | 3209 |
| 778 | Ga0496114_0135287 | 3300048917 | Bacteria | 2131 |
| 779 | Ga0501032_0128267 | 3300049569 | Unclassified | 1674 |
| 780 | Ga0501033_0045063 | 3300049570 | Unclassified | 3283 |
| 781 | Ga0501033_0226804 | 3300049570 | Bacteria | 1328 |
| 782 | Ga0501034_0010869 | 3300049571 | Bacteria | 9455 |
| 783 | Ga0501034_0011076 | 3300049571 | Bacteria | 9366 |
| 784 | Ga0501036_0006252 | 3300049572 | Bacteria | 9659 |
| 785 | Ga0501036_0115614 | 3300049572 | Unclassified | 2266 |
| 786 | Ga0501037_0014266 | 3300049573 | Bacteria | 5855 |
| 787 | Ga0501037_0038256 | 3300049573 | Bacteria | 3535 |
| 788 | Ga0501038_0069442 | 3300049574 | Bacteria | 2993 |
| 789 | Ga0501038_0090020 | 3300049574 | Bacteria | 2573 |
| 790 | Ga0501038_0112482 | 3300049574 | Unclassified | 2254 |
| 791 | Ga0501038_0116511 | 3300049574 | Bacteria | 2208 |
| 792 | Ga0501038_0247264 | 3300049574 | Bacteria | 1414 |
| 793 | Ga0501039_0016664 | 3300049575 | Bacteria | 5629 |
| 794 | Ga0501039_0022435 | 3300049575 | Unclassified | 4846 |
| 795 | Ga0501039_0084494 | 3300049575 | Bacteria | 2472 |
| 796 | Ga0501040_0001939 | 3300049576 | Bacteria | 13306 |
| 797 | Ga0501040_0028138 | 3300049576 | Bacteria | 3788 |
| 798 | Ga0501042_0014495 | 3300049578 | Bacteria | 5383 |
| 799 | Ga0501042_0095252 | 3300049578 | Bacteria | 2138 |
| 800 | Ga0501043_0150986 | 3300049579 | Bacteria | 1818 |
| 801 | Ga0501043_0166570 | 3300049579 | Unclassified | 1721 |
| 802 | Ga0501046_0018198 | 3300049580 | Bacteria | 5851 |
| 803 | Ga0501046_0062127 | 3300049580 | Bacteria | 2919 |
| 804 | Ga0501046_0158663 | 3300049580 | Unclassified | 1702 |
| 805 | Ga0501047_0034670 | 3300049581 | Unclassified | 4873 |
| 806 | Ga0501047_0137193 | 3300049581 | Bacteria | 2326 |
| 807 | Ga0501048_0009500 | 3300049582 | Bacteria | 7300 |
| 808 | Ga0501048_0046381 | 3300049582 | Bacteria | 3102 |
| 809 | Ga0501048_0210136 | 3300049582 | Bacteria | 1380 |
| 810 | Ga0501067_0000249 | 3300049583 | Bacteria | 29614 |
| 811 | Ga0501067_0043941 | 3300049583 | Bacteria | 2482 |
| 812 | Ga0501068_0270012 | 3300049584 | Unclassified | 1086 |
| 813 | Ga0501070_0209990 | 3300049586 | Bacteria | 1598 |
| 814 | Ga0501072_0022119 | 3300049588 | Bacteria | 4932 |
| 815 | Ga0501073_0031033 | 3300049589 | Bacteria | 3814 |
| 816 | Ga0501074_0059882 | 3300049590 | Bacteria | 2743 |
| 817 | Ga0501074_0095165 | 3300049590 | Bacteria | 2133 |
| 818 | Ga0501075_0008564 | 3300049591 | Bacteria | 7131 |
| 819 | Ga0501075_0093423 | 3300049591 | Bacteria | 2283 |
| 820 | Ga0501075_0430622 | 3300049591 | Bacteria | 1006 |
| 821 | Ga0501076_0008547 | 3300049592 | Bacteria | 7507 |
| 822 | Ga0501076_0033519 | 3300049592 | Bacteria | 4010 |
| 823 | Ga0501076_0181864 | 3300049592 | Bacteria | 1714 |
| 824 | Ga0501076_0301692 | 3300049592 | Bacteria | 1313 |
| 825 | Ga0501076_0305508 | 3300049592 | Bacteria | 1304 |
| 826 | Ga0501076_0441263 | 3300049592 | Unclassified | 1071 |
| 827 | Ga0501077_0009906 | 3300049593 | Bacteria | 5931 |
| 828 | Ga0501198_012893 | 3300049649 | Unclassified | 1260 |
| 829 | Ga0501202_029143 | 3300049652 | Unclassified | 1143 |
| 830 | Ga0501217_000055 | 3300049661 | Bacteria | 13339 |
| 831 | Ga0501222_004506 | 3300049662 | Unclassified | 1892 |
| 832 | Ga0501223_001899 | 3300049663 | Unclassified | 4708 |
| 833 | Ga0501233_004326 | 3300049668 | Unclassified | 2597 |
| 834 | Ga0501243_000975 | 3300049675 | Unclassified | 4027 |
| 835 | Ga0501259_001374 | 3300049688 | Unclassified | 4071 |
| 836 | Ga0501221_000337 | 3300049704 | Bacteria | 7125 |
| 837 | Ga0501225_0001107 | 3300049705 | Bacteria | 8457 |
| 838 | Ga0501225_0001987 | 3300049705 | Bacteria | 6389 |
| 839 | Ga0501245_000875 | 3300049708 | Unclassified | 3811 |
| 840 | Ga0501079_0010716 | 3300049741 | Bacteria | 6981 |
| 841 | Ga0501079_0060330 | 3300049741 | Bacteria | 2926 |
| 842 | Ga0501079_0146628 | 3300049741 | Bacteria | 1839 |
| 843 | Ga0501079_0158162 | 3300049741 | Bacteria | 1766 |
| 844 | Ga0501079_0188864 | 3300049741 | Bacteria | 1608 |
| 845 | Ga0501080_0004871 | 3300049742 | Bacteria | 11965 |
| 846 | Ga0501080_0014784 | 3300049742 | Bacteria | 7189 |
| 847 | Ga0501080_0064218 | 3300049742 | Bacteria | 3415 |
| 848 | Ga0501080_0395661 | 3300049742 | Bacteria | 1243 |
| 849 | Ga0501081_0007334 | 3300049743 | Bacteria | 7157 |
| 850 | Ga0501081_0012374 | 3300049743 | Bacteria | 5605 |
| 851 | Ga0501081_0135937 | 3300049743 | Bacteria | 1759 |
| 852 | Ga0501083_0006560 | 3300049744 | Bacteria | 8257 |
| 853 | Ga0501083_0062118 | 3300049744 | Bacteria | 2493 |
| 854 | Ga0501083_0267033 | 3300049744 | Bacteria | 1113 |
| 855 | Ga0501263_007208 | 3300049760 | Bacteria | 1304 |
| 856 | Ga0501268_023281 | 3300049765 | Bacteria | 1074 |
| 857 | Ga0501035_0035768 | 3300049822 | Unclassified | 4506 |
| 858 | Ga0501035_0133458 | 3300049822 | Bacteria | 2163 |
| 859 | Ga0501044_0002454 | 3300049823 | Bacteria | 21139 |
| 860 | Ga0501044_0044779 | 3300049823 | Bacteria | 4589 |
| 861 | Ga0501044_0101639 | 3300049823 | Unclassified | 2892 |
| 862 | Ga0501044_0250010 | 3300049823 | Bacteria | 1714 |
| 863 | Ga0501045_0002074 | 3300049824 | Bacteria | 13539 |
| 864 | Ga0501045_0039920 | 3300049824 | Bacteria | 3415 |
| 865 | Ga0501045_0043711 | 3300049824 | Bacteria | 3263 |
| 866 | Ga0501045_0051695 | 3300049824 | Bacteria | 2999 |
| 867 | nmdc:mga05p37_142569_c1 | 3300050507 | Bacteria | 2935 |
| 868 | nmdc:mga05p37_148017_c1 | 3300050507 | Bacteria | 2874 |
| 869 | nmdc:mga05p37_462788_c1 | 3300050507 | Unclassified | 1465 |
| 870 | nmdc:mga05p37_50876_c1 | 3300050507 | Bacteria | 5095 |
| 871 | nmdc:mga05p37_561131_c1 | 3300050507 | Bacteria | 1297 |
| 872 | nmdc:mga09592_275417_c1 | 3300050508 | Bacteria | 1460 |
| 873 | nmdc:mga09592_40794_c1 | 3300050508 | Bacteria | 3900 |
| 874 | nmdc:mga09592_72684_c1 | 3300050508 | Bacteria | 2921 |
| 875 | nmdc:mga09592_87369_c1 | 3300050508 | Bacteria | 2662 |
| 876 | nmdc:mga09592_99597_c1 | 3300050508 | Bacteria | 2488 |
| 877 | nmdc:mga0qj67_12488_c1 | 3300050509 | Bacteria | 6398 |
| 878 | nmdc:mga0qj67_2698_c1 | 3300050509 | Bacteria | 12729 |
| 879 | nmdc:mga0qj67_32779_c1 | 3300050509 | Bacteria | 4053 |
| 880 | nmdc:mga0qj67_53056_c1 | 3300050509 | Bacteria | 3209 |
| 881 | nmdc:mga06r32_354305_c1 | 3300050510 | Bacteria | 1452 |
| 882 | nmdc:mga06r32_418705_c1 | 3300050510 | Bacteria | 1321 |
| 883 | nmdc:mga06r32_47840_c1 | 3300050510 | Bacteria | 4087 |
| 884 | nmdc:mga06r32_54656_c1 | 3300050510 | Bacteria | 3829 |
| 885 | nmdc:mga06r32_55517_c1 | 3300050510 | Bacteria | 3799 |
| 886 | nmdc:mga06r32_8661_c1 | 3300050510 | Bacteria | 9168 |
| 887 | nmdc:mga08y16_115285_c1 | 3300050511 | Bacteria | 2797 |
| 888 | nmdc:mga08y16_22_c1 | 3300050511 | Bacteria | 250162 |
| 889 | nmdc:mga0rr50_145607_c2 | 3300050513 | Bacteria | 1563 |
| 890 | nmdc:mga08x19_185705_c1 | 3300050514 | Bacteria | 1421 |
| 891 | nmdc:mga0a205_119095_c1 | 3300050515 | Bacteria | 2539 |
| 892 | nmdc:mga0a205_90561_c1 | 3300050515 | Bacteria | 2956 |
| 893 | Ga0495601_0045849 | 3300053077 | Bacteria | 2751 |
| 894 | Ga0495601_0084683 | 3300053077 | Bacteria | 2037 |
| 895 | Ga0495595_0010711 | 3300053084 | Bacteria | 3819 |
| 896 | Ga0495619_0005570 | 3300053085 | Bacteria | 7989 |
| 897 | Ga0495619_0023411 | 3300053085 | Bacteria | 3959 |
| 898 | Ga0500644_0006740 | 3300053088 | Bacteria | 2959 |
| 899 | Ga0500583_0000027 | 3300053092 | Bacteria | 109138 |
| 900 | Ga0500583_0000598 | 3300053092 | Bacteria | 10793 |
| 901 | Ga0500566_0003670 | 3300053094 | Bacteria | 9165 |
| 902 | Ga0500589_038939 | 3300053147 | Unclassified | 2219 |
| 903 | Ga0500603_003764 | 3300053150 | Bacteria | 3247 |
| 904 | Ga0500603_038290 | 3300053150 | Bacteria | 1269 |
| 905 | Ga0501084_0159099 | 3300054114 | Unclassified | 1905 |
| 906 | Ga0501084_0214105 | 3300054114 | Bacteria | 1625 |
| 907 | Ga0501082_0004906 | 3300060353 | Bacteria | 11666 |
| 908 | Ga0501082_0015866 | 3300060353 | Bacteria | 6477 |
| 909 | Ga0501082_0042729 | 3300060353 | Bacteria | 3907 |
| 910 | Ga0530510_0002730 | 3300061734 | Bacteria | 12149 |
| 911 | Ga0530510_0033484 | 3300061734 | Bacteria | 3699 |
| 912 | Ga0530510_0086070 | 3300061734 | Bacteria | 2290 |
| 913 | Ga0530510_0104328 | 3300061734 | Bacteria | 2074 |
| 914 | Ga0530510_0138981 | 3300061734 | Bacteria | 1789 |
| 915 | Ga0530510_0140894 | 3300061734 | Bacteria | 1776 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049744 | Ga0501083_0062118 | Ga0501083_0062118_1574_2464 | 264 |
| 2 | 3300005618 | Ga0068864_100051164 | Ga0068864_1000511642 | 268 |
| 3 | 3300009177 | Ga0105248_10442529 | Ga0105248_104425291 | 271 |
| 4 | 3300025941 | Ga0207711_10305515 | Ga0207711_103055152 | 271 |
| 5 | 3300048911 | Ga0496108_0143849 | Ga0496108_0143849_1188_2039 | 272 |
| 6 | 3300005539 | Ga0068853_100011024 | Ga0068853_1000110244 | 274 |
| 7 | 3300026041 | Ga0207639_10007679 | Ga0207639_100076795 | 274 |
| 8 | 3300025922 | Ga0207646_10524475 | Ga0207646_105244751 | 275 |
| 9 | 3300026095 | Ga0207676_10049325 | Ga0207676_100493252 | 275 |
| 10 | 3300031595 | Ga0265313_10039862 | Ga0265313_100398621 | 275 |
| 11 | 3300005335 | Ga0070666_10005429 | Ga0070666_100054294 | 277 |
| 12 | 3300025903 | Ga0207680_10001546 | Ga0207680_100015464 | 277 |
| 13 | 3300025938 | Ga0207704_10015131 | Ga0207704_100151314 | 277 |
| 14 | 3300005458 | Ga0070681_10123298 | Ga0070681_101232982 | 278 |
| 15 | 3300025901 | Ga0207688_10252598 | Ga0207688_102525981 | 278 |
| 16 | 3300025912 | Ga0207707_10096788 | Ga0207707_100967882 | 278 |
| 17 | 3300025921 | Ga0207652_10021177 | Ga0207652_100211776 | 278 |
| 18 | 3300031691 | Ga0316579_10073899 | Ga0316579_100738992 | 278 |
| 19 | 3300031727 | Ga0316576_10006995 | Ga0316576_100069957 | 278 |
| 20 | 3300031728 | Ga0316578_10002870 | Ga0316578_100028702 | 278 |
| 21 | 3300031733 | Ga0316577_10074270 | Ga0316577_100742702 | 278 |
| 22 | 3300032139 | Ga0316580_10056442 | Ga0316580_100564422 | 278 |
| 23 | 3300036647 | Ga0316582_0016664 | Ga0316582_0016664_738_1691 | 278 |
| 24 | 3300036712 | Ga0316584_0004631 | Ga0316584_0004631_5623_6576 | 278 |
| 25 | 3300037588 | Ga0316581_0034851 | Ga0316581_0034851_91_1044 | 278 |
| 26 | 3300005937 | Ga0081455_10007011 | Ga0081455_100070119 | 280 |
| 27 | 3300048915 | Ga0496112_0702373 | Ga0496112_0702373_12_887 | 280 |
| 28 | 3300005617 | Ga0068859_100180101 | Ga0068859_1001801013 | 281 |
| 29 | 3300005844 | Ga0068862_100288606 | Ga0068862_1002886062 | 281 |
| 30 | 3300006931 | Ga0097620_100180104 | Ga0097620_1001801043 | 281 |
| 31 | 3300028380 | Ga0268265_10097521 | Ga0268265_100975214 | 281 |
| 32 | 3300031728 | Ga0316578_10161863 | Ga0316578_101618631 | 281 |
| 33 | 3300013306 | Ga0163162_10005980 | Ga0163162_1000598012 | 282 |
| 34 | 3300005329 | Ga0070683_100132805 | Ga0070683_1001328051 | 283 |
| 35 | 3300005337 | Ga0070682_100006403 | Ga0070682_1000064032 | 283 |
| 36 | 3300005339 | Ga0070660_100192229 | Ga0070660_1001922292 | 283 |
| 37 | 3300005344 | Ga0070661_100142381 | Ga0070661_1001423812 | 283 |
| 38 | 3300005364 | Ga0070673_100091941 | Ga0070673_1000919412 | 283 |
| 39 | 3300005366 | Ga0070659_100181859 | Ga0070659_1001818591 | 283 |
| 40 | 3300005457 | Ga0070662_100262169 | Ga0070662_1002621691 | 283 |
| 41 | 3300005535 | Ga0070684_100411356 | Ga0070684_1004113561 | 283 |
| 42 | 3300005539 | Ga0068853_100131745 | Ga0068853_1001317452 | 283 |
| 43 | 3300005563 | Ga0068855_100213568 | Ga0068855_1002135682 | 283 |
| 44 | 3300005564 | Ga0070664_100139951 | Ga0070664_1001399511 | 283 |
| 45 | 3300013100 | Ga0157373_10025876 | Ga0157373_100258765 | 283 |
| 46 | 3300013105 | Ga0157369_10305621 | Ga0157369_103056212 | 283 |
| 47 | 3300013296 | Ga0157374_10024433 | Ga0157374_100244332 | 283 |
| 48 | 3300013307 | Ga0157372_10479819 | Ga0157372_104798192 | 283 |
| 49 | 3300025919 | Ga0207657_10010235 | Ga0207657_100102351 | 283 |
| 50 | 3300025921 | Ga0207652_10349652 | Ga0207652_103496522 | 283 |
| 51 | 3300025944 | Ga0207661_10244550 | Ga0207661_102445502 | 283 |
| 52 | 3300025981 | Ga0207640_10058766 | Ga0207640_100587663 | 283 |
| 53 | 3300026041 | Ga0207639_10091546 | Ga0207639_100915462 | 283 |
| 54 | 3300026078 | Ga0207702_10051789 | Ga0207702_100517891 | 283 |
| 55 | 3300005578 | Ga0068854_100064759 | Ga0068854_1000647592 | 284 |
| 56 | 3300049574 | Ga0501038_0116511 | Ga0501038_0116511_864_1838 | 284 |
| 57 | 3300061734 | Ga0530510_0033484 | Ga0530510_0033484_214_1188 | 284 |
| 58 | 3300005347 | Ga0070668_100113597 | Ga0070668_1001135971 | 285 |
| 59 | 3300005353 | Ga0070669_100092951 | Ga0070669_1000929512 | 285 |
| 60 | 3300013296 | Ga0157374_10161837 | Ga0157374_101618372 | 286 |
| 61 | 3300013308 | Ga0157375_10310801 | Ga0157375_103108011 | 286 |
| 62 | 3300014968 | Ga0157379_10135713 | Ga0157379_101357132 | 286 |
| 63 | 3300025904 | Ga0207647_10135566 | Ga0207647_101355662 | 286 |
| 64 | 3300025945 | Ga0207679_10320840 | Ga0207679_103208402 | 286 |
| 65 | 3300026067 | Ga0207678_10170339 | Ga0207678_101703392 | 286 |
| 66 | 3300026116 | Ga0207674_10061864 | Ga0207674_100618641 | 286 |
| 67 | 3300031344 | Ga0265316_10080444 | Ga0265316_100804442 | 286 |
| 68 | 3300049591 | Ga0501075_0430622 | Ga0501075_0430622_12_905 | 286 |
| 69 | 3300050507 | nmdc:mga05p37_561131_c1 | nmdc:mga05p37_561131_c1_372_1274 | 286 |
| 70 | 3300013104 | Ga0157370_10121961 | Ga0157370_101219611 | 287 |
| 71 | 3300025949 | Ga0207667_10213407 | Ga0207667_102134072 | 287 |
| 72 | 3300005563 | Ga0068855_100043250 | Ga0068855_1000432505 | 288 |
| 73 | 3300049742 | Ga0501080_0395661 | Ga0501080_0395661_213_1163 | 288 |
| 74 | 3300005339 | Ga0070660_100031268 | Ga0070660_1000312684 | 289 |
| 75 | 3300014325 | Ga0163163_10435545 | Ga0163163_104355451 | 289 |
| 76 | 3300025919 | Ga0207657_10119828 | Ga0207657_101198281 | 289 |
| 77 | 3300032005 | Ga0307411_10308563 | Ga0307411_103085631 | 289 |
| 78 | 3300046675 | Ga0495657_0002664 | Ga0495657_0002664_104_1006 | 289 |
| 79 | 3300005329 | Ga0070683_100005550 | Ga0070683_10000555011 | 290 |
| 80 | 3300005344 | Ga0070661_100009793 | Ga0070661_1000097939 | 290 |
| 81 | 3300005366 | Ga0070659_100025984 | Ga0070659_1000259842 | 290 |
| 82 | 3300005535 | Ga0070684_100012839 | Ga0070684_1000128396 | 290 |
| 83 | 3300005539 | Ga0068853_100045604 | Ga0068853_1000456045 | 290 |
| 84 | 3300005564 | Ga0070664_100022854 | Ga0070664_1000228545 | 290 |
| 85 | 3300005578 | Ga0068854_100235901 | Ga0068854_1002359012 | 290 |
| 86 | 3300005843 | Ga0068860_100378000 | Ga0068860_1003780002 | 290 |
| 87 | 3300006844 | Ga0075428_100151035 | Ga0075428_1001510353 | 290 |
| 88 | 3300006846 | Ga0075430_100007274 | Ga0075430_1000072746 | 290 |
| 89 | 3300006847 | Ga0075431_100095188 | Ga0075431_1000951884 | 290 |
| 90 | 3300006880 | Ga0075429_100108399 | Ga0075429_1001083992 | 290 |
| 91 | 3300009147 | Ga0114129_10194413 | Ga0114129_101944132 | 290 |
| 92 | 3300013104 | Ga0157370_10013214 | Ga0157370_100132144 | 290 |
| 93 | 3300025920 | Ga0207649_10025152 | Ga0207649_100251524 | 290 |
| 94 | 3300025932 | Ga0207690_10209824 | Ga0207690_102098242 | 290 |
| 95 | 3300025944 | Ga0207661_10036520 | Ga0207661_100365204 | 290 |
| 96 | 3300026041 | Ga0207639_10005388 | Ga0207639_100053884 | 290 |
| 97 | 3300050507 | nmdc:mga05p37_462788_c1 | nmdc:mga05p37_462788_c1_390_1337 | 290 |
| 98 | 3300050508 | nmdc:mga09592_72684_c1 | nmdc:mga09592_72684_c1_1584_2531 | 290 |
| 99 | 3300050509 | nmdc:mga0qj67_32779_c1 | nmdc:mga0qj67_32779_c1_2263_3210 | 290 |
| 100 | 3300050510 | nmdc:mga06r32_54656_c1 | nmdc:mga06r32_54656_c1_547_1494 | 290 |
| 101 | 3300046477 | Ga0495664_0187534 | Ga0495664_0187534_76_1092 | 291 |
| 102 | 3300046517 | Ga0495630_0012249 | Ga0495630_0012249_3810_4826 | 291 |
| 103 | 3300046533 | Ga0495640_0163101 | Ga0495640_0163101_66_1082 | 291 |
| 104 | 3300047319 | Ga0495674_0061772 | Ga0495674_0061772_1548_2564 | 291 |
| 105 | 3300049586 | Ga0501070_0209990 | Ga0501070_0209990_184_1134 | 291 |
| 106 | 3300048904 | Ga0496101_0201633 | Ga0496101_0201633_512_1456 | 294 |
| 107 | 3300048905 | Ga0496102_0065747 | Ga0496102_0065747_1838_2782 | 294 |
| 108 | 3300048909 | Ga0496106_0061170 | Ga0496106_0061170_1363_2307 | 294 |
| 109 | 3300048910 | Ga0496107_0029175 | Ga0496107_0029175_1575_2519 | 294 |
| 110 | 3300048912 | Ga0496109_0476539 | Ga0496109_0476539_151_1095 | 294 |
| 111 | 3300049744 | Ga0501083_0267033 | Ga0501083_0267033_65_1012 | 294 |
| 112 | 3300005335 | Ga0070666_10001316 | Ga0070666_100013162 | 295 |
| 113 | 3300005564 | Ga0070664_100000492 | Ga0070664_10000049211 | 295 |
| 114 | 3300005618 | Ga0068864_100000781 | Ga0068864_1000007819 | 295 |
| 115 | 3300005985 | Ga0081539_10004015 | Ga0081539_1000401515 | 295 |
| 116 | 3300009093 | Ga0105240_10028359 | Ga0105240_100283594 | 295 |
| 117 | 3300009177 | Ga0105248_10015185 | Ga0105248_100151852 | 295 |
| 118 | 3300010375 | Ga0105239_10205151 | Ga0105239_102051512 | 295 |
| 119 | 3300013296 | Ga0157374_10208221 | Ga0157374_102082212 | 295 |
| 120 | 3300013306 | Ga0163162_10000523 | Ga0163162_1000052325 | 295 |
| 121 | 3300013308 | Ga0157375_10001301 | Ga0157375_100013016 | 295 |
| 122 | 3300014325 | Ga0163163_10232956 | Ga0163163_102329562 | 295 |
| 123 | 3300014969 | Ga0157376_10041099 | Ga0157376_100410992 | 295 |
| 124 | 3300026035 | Ga0207703_10013004 | Ga0207703_100130044 | 295 |
| 125 | 3300026088 | Ga0207641_10015720 | Ga0207641_100157203 | 295 |
| 126 | 3300032002 | Ga0307416_100135889 | Ga0307416_1001358892 | 295 |
| 127 | 3300035117 | Ga0373953_0095547 | Ga0373953_0095547_168_1088 | 295 |
| 128 | 3300042876 | Ga0451577_0016447 | Ga0451577_0016447_1241_2173 | 295 |
| 129 | 3300044712 | Ga0453684_0153749 | Ga0453684_0153749_742_1674 | 295 |
| 130 | 3300046459 | Ga0495629_0145201 | Ga0495629_0145201_691_1611 | 295 |
| 131 | 3300046459 | Ga0495629_0193814 | Ga0495629_0193814_58_978 | 295 |
| 132 | 3300046476 | Ga0495662_0009490 | Ga0495662_0009490_541_1461 | 295 |
| 133 | 3300046514 | Ga0495618_0170044 | Ga0495618_0170044_112_1032 | 295 |
| 134 | 3300046683 | Ga0495658_0094565 | Ga0495658_0094565_808_1728 | 295 |
| 135 | 3300046689 | Ga0495613_0043195 | Ga0495613_0043195_341_1261 | 295 |
| 136 | 3300047319 | Ga0495674_0168095 | Ga0495674_0168095_424_1344 | 295 |
| 137 | 3300047471 | Ga0495684_0158850 | Ga0495684_0158850_101_1021 | 295 |
| 138 | 3300009545 | Ga0105237_10093453 | Ga0105237_100934533 | 296 |
| 139 | 3300035117 | Ga0373953_0148845 | Ga0373953_0148845_65_988 | 296 |
| 140 | 3300036401 | Ga0373937_0043557 | Ga0373937_0043557_3113_4069 | 296 |
| 141 | 3300046454 | Ga0495592_0054446 | Ga0495592_0054446_57_998 | 296 |
| 142 | 3300046559 | Ga0495667_0030382 | Ga0495667_0030382_120_1076 | 296 |
| 143 | 3300047322 | Ga0495680_0047511 | Ga0495680_0047511_2292_3260 | 296 |
| 144 | 3300049580 | Ga0501046_0158663 | Ga0501046_0158663_311_1354 | 296 |
| 145 | 3300049592 | Ga0501076_0441263 | Ga0501076_0441263_133_1056 | 296 |
| 146 | 3300009093 | Ga0105240_10169230 | Ga0105240_101692302 | 297 |
| 147 | 3300009094 | Ga0111539_10076633 | Ga0111539_100766334 | 297 |
| 148 | 3300009098 | Ga0105245_10043077 | Ga0105245_100430773 | 297 |
| 149 | 3300013296 | Ga0157374_10005430 | Ga0157374_100054306 | 297 |
| 150 | 3300013297 | Ga0157378_10003439 | Ga0157378_100034398 | 297 |
| 151 | 3300014326 | Ga0157380_10010459 | Ga0157380_100104595 | 297 |
| 152 | 3300025907 | Ga0207645_10029340 | Ga0207645_100293402 | 297 |
| 153 | 3300025913 | Ga0207695_10134545 | Ga0207695_101345452 | 297 |
| 154 | 3300046472 | Ga0495580_0163858 | Ga0495580_0163858_366_1334 | 297 |
| 155 | 3300049571 | Ga0501034_0011076 | Ga0501034_0011076_3775_4728 | 297 |
| 156 | 3300049581 | Ga0501047_0137193 | Ga0501047_0137193_430_1383 | 297 |
| 157 | 3300049583 | Ga0501067_0043941 | Ga0501067_0043941_214_1167 | 297 |
| 158 | 3300049589 | Ga0501073_0031033 | Ga0501073_0031033_1146_2099 | 297 |
| 159 | 3300049590 | Ga0501074_0059882 | Ga0501074_0059882_944_1897 | 297 |
| 160 | 3300049742 | Ga0501080_0004871 | Ga0501080_0004871_5794_6747 | 297 |
| 161 | 3300049742 | Ga0501080_0064218 | Ga0501080_0064218_1630_2577 | 297 |
| 162 | 3300049744 | Ga0501083_0006560 | Ga0501083_0006560_5455_6408 | 297 |
| 163 | 3300050511 | nmdc:mga08y16_115285_c1 | nmdc:mga08y16_115285_c1_338_1279 | 297 |
| 164 | 3300060353 | Ga0501082_0042729 | Ga0501082_0042729_996_1949 | 297 |
| 165 | 3300005340 | Ga0070689_100174977 | Ga0070689_1001749772 | 298 |
| 166 | 3300005355 | Ga0070671_100116251 | Ga0070671_1001162512 | 298 |
| 167 | 3300005365 | Ga0070688_100037566 | Ga0070688_1000375662 | 298 |
| 168 | 3300007265 | Ga0099794_10022038 | Ga0099794_100220383 | 298 |
| 169 | 3300025917 | Ga0207660_10387918 | Ga0207660_103879181 | 298 |
| 170 | 3300005328 | Ga0070676_10113135 | Ga0070676_101131353 | 299 |
| 171 | 3300005331 | Ga0070670_100251733 | Ga0070670_1002517333 | 299 |
| 172 | 3300005347 | Ga0070668_100000951 | Ga0070668_10000095113 | 299 |
| 173 | 3300005354 | Ga0070675_100011460 | Ga0070675_1000114607 | 299 |
| 174 | 3300005356 | Ga0070674_100149299 | Ga0070674_1001492992 | 299 |
| 175 | 3300005467 | Ga0070706_100265778 | Ga0070706_1002657782 | 299 |
| 176 | 3300005468 | Ga0070707_100000032 | Ga0070707_10000003218 | 299 |
| 177 | 3300005543 | Ga0070672_100106674 | Ga0070672_1001066742 | 299 |
| 178 | 3300025910 | Ga0207684_10157635 | Ga0207684_101576352 | 299 |
| 179 | 3300025922 | Ga0207646_10000032 | Ga0207646_1000003260 | 299 |
| 180 | 3300025925 | Ga0207650_10268623 | Ga0207650_102686231 | 299 |
| 181 | 3300025926 | Ga0207659_10002371 | Ga0207659_100023715 | 299 |
| 182 | 3300025940 | Ga0207691_10121889 | Ga0207691_101218893 | 299 |
| 183 | 3300025972 | Ga0207668_10000663 | Ga0207668_1000066311 | 299 |
| 184 | 3300028380 | Ga0268265_10062858 | Ga0268265_100628584 | 299 |
| 185 | 3300028556 | Ga0265337_1001644 | Ga0265337_100164410 | 299 |
| 186 | 3300028558 | Ga0265326_10013130 | Ga0265326_100131302 | 299 |
| 187 | 3300028653 | Ga0265323_10005862 | Ga0265323_100058626 | 299 |
| 188 | 3300028800 | Ga0265338_10077849 | Ga0265338_100778492 | 299 |
| 189 | 3300031241 | Ga0265325_10005122 | Ga0265325_100051222 | 299 |
| 190 | 3300031247 | Ga0265340_10000108 | Ga0265340_100001089 | 299 |
| 191 | 3300031249 | Ga0265339_10034529 | Ga0265339_100345292 | 299 |
| 192 | 3300031344 | Ga0265316_10100115 | Ga0265316_101001154 | 299 |
| 193 | 3300031548 | Ga0307408_100040397 | Ga0307408_1000403973 | 299 |
| 194 | 3300031711 | Ga0265314_10000104 | Ga0265314_1000010427 | 299 |
| 195 | 3300031712 | Ga0265342_10001030 | Ga0265342_1000103016 | 299 |
| 196 | 3300031731 | Ga0307405_10050942 | Ga0307405_100509422 | 299 |
| 197 | 3300031852 | Ga0307410_10017356 | Ga0307410_100173563 | 299 |
| 198 | 3300032005 | Ga0307411_10235310 | Ga0307411_102353102 | 299 |
| 199 | 3300036401 | Ga0373937_0436749 | Ga0373937_0436749_227_1177 | 299 |
| 200 | 3300042876 | Ga0451577_0247500 | Ga0451577_0247500_17_964 | 299 |
| 201 | 3300044712 | Ga0453684_0349268 | Ga0453684_0349268_619_1566 | 299 |
| 202 | 3300046683 | Ga0495658_0138528 | Ga0495658_0138528_58_993 | 299 |
| 203 | 3300049823 | Ga0501044_0101639 | Ga0501044_0101639_1887_2837 | 299 |
| 204 | 3300050513 | nmdc:mga0rr50_145607_c2 | nmdc:mga0rr50_145607_c2_20_967 | 299 |
| 205 | 3300005577 | Ga0068857_100032403 | Ga0068857_1000324035 | 300 |
| 206 | 3300013105 | Ga0157369_10186487 | Ga0157369_101864871 | 300 |
| 207 | 3300014325 | Ga0163163_10001342 | Ga0163163_100013428 | 300 |
| 208 | 3300014325 | Ga0163163_10008479 | Ga0163163_100084799 | 300 |
| 209 | 3300025904 | Ga0207647_10010393 | Ga0207647_100103938 | 300 |
| 210 | 3300031241 | Ga0265325_10135437 | Ga0265325_101354371 | 300 |
| 211 | 3300031665 | Ga0316575_10002566 | Ga0316575_100025663 | 300 |
| 212 | 3300031665 | Ga0316575_10052820 | Ga0316575_100528201 | 300 |
| 213 | 3300031727 | Ga0316576_10003610 | Ga0316576_100036106 | 300 |
| 214 | 3300031728 | Ga0316578_10003237 | Ga0316578_100032373 | 300 |
| 215 | 3300031728 | Ga0316578_10172301 | Ga0316578_101723011 | 300 |
| 216 | 3300031733 | Ga0316577_10021897 | Ga0316577_100218973 | 300 |
| 217 | 3300032133 | Ga0316583_10003577 | Ga0316583_100035774 | 300 |
| 218 | 3300032133 | Ga0316583_10008550 | Ga0316583_100085502 | 300 |
| 219 | 3300032137 | Ga0316585_10008588 | Ga0316585_100085882 | 300 |
| 220 | 3300032139 | Ga0316580_10000900 | Ga0316580_100009007 | 300 |
| 221 | 3300035398 | Ga0316574_0012270 | Ga0316574_0012270_760_1710 | 300 |
| 222 | 3300035398 | Ga0316574_0014180 | Ga0316574_0014180_2002_2952 | 300 |
| 223 | 3300035398 | Ga0316574_0027730 | Ga0316574_0027730_1816_2766 | 300 |
| 224 | 3300036712 | Ga0316584_0004299 | Ga0316584_0004299_1852_2802 | 300 |
| 225 | 3300036712 | Ga0316584_0004621 | Ga0316584_0004621_4579_5529 | 300 |
| 226 | 3300046462 | Ga0495651_0000090 | Ga0495651_0000090_19012_19980 | 300 |
| 227 | 3300046543 | Ga0495645_0020717 | Ga0495645_0020717_1574_2542 | 300 |
| 228 | 3300046559 | Ga0495667_0005808 | Ga0495667_0005808_1583_2551 | 300 |
| 229 | 3300046809 | Ga0495600_0027708 | Ga0495600_0027708_1549_2517 | 300 |
| 230 | 3300047322 | Ga0495680_0001014 | Ga0495680_0001014_26758_27726 | 300 |
| 231 | 3300053094 | Ga0500566_0003670 | Ga0500566_0003670_7438_8391 | 300 |
| 232 | 3300053150 | Ga0500603_003764 | Ga0500603_003764_369_1322 | 300 |
| 233 | iso_pu_bacteria | 2643221601 | 2644016548 | 300 |
| 234 | iso_pu_bacteria | 2643221631 | 2644176468 | 300 |
| 235 | iso_pu_bacteria | 2738541278 | 2738725136 | 300 |
| 236 | 3300005471 | Ga0070698_100001998 | Ga0070698_1000019987 | 301 |
| 237 | 3300013297 | Ga0157378_10001754 | Ga0157378_100017547 | 301 |
| 238 | 3300026075 | Ga0207708_10096778 | Ga0207708_100967782 | 301 |
| 239 | 3300026089 | Ga0207648_10303428 | Ga0207648_103034281 | 301 |
| 240 | 3300031727 | Ga0316576_10127808 | Ga0316576_101278082 | 301 |
| 241 | 3300042876 | Ga0451577_0102493 | Ga0451577_0102493_1441_2403 | 301 |
| 242 | 3300048088 | Ga0495602_0199484 | Ga0495602_0199484_93_1127 | 301 |
| 243 | 3300005530 | Ga0070679_100525512 | Ga0070679_1005255121 | 302 |
| 244 | 3300005539 | Ga0068853_100412894 | Ga0068853_1004128941 | 302 |
| 245 | 3300005547 | Ga0070693_100012709 | Ga0070693_1000127093 | 302 |
| 246 | 3300009553 | Ga0105249_10013169 | Ga0105249_100131693 | 302 |
| 247 | 3300025960 | Ga0207651_10040387 | Ga0207651_100403873 | 302 |
| 248 | 3300026041 | Ga0207639_10086260 | Ga0207639_100862602 | 302 |
| 249 | 3300031711 | Ga0265314_10050435 | Ga0265314_100504352 | 302 |
| 250 | 3300031852 | Ga0307410_10299823 | Ga0307410_102998231 | 302 |
| 251 | 3300005293 | Ga0065715_10155878 | Ga0065715_101558782 | 303 |
| 252 | 3300005330 | Ga0070690_100003963 | Ga0070690_1000039632 | 303 |
| 253 | 3300005331 | Ga0070670_100018444 | Ga0070670_1000184443 | 303 |
| 254 | 3300005337 | Ga0070682_100095781 | Ga0070682_1000957812 | 303 |
| 255 | 3300005338 | Ga0068868_100008292 | Ga0068868_1000082922 | 303 |
| 256 | 3300005338 | Ga0068868_100015287 | Ga0068868_1000152874 | 303 |
| 257 | 3300005338 | Ga0068868_100158765 | Ga0068868_1001587651 | 303 |
| 258 | 3300005340 | Ga0070689_100031031 | Ga0070689_1000310311 | 303 |
| 259 | 3300005340 | Ga0070689_100073946 | Ga0070689_1000739462 | 303 |
| 260 | 3300005344 | Ga0070661_100013569 | Ga0070661_1000135693 | 303 |
| 261 | 3300005353 | Ga0070669_100242384 | Ga0070669_1002423841 | 303 |
| 262 | 3300005354 | Ga0070675_100099784 | Ga0070675_1000997842 | 303 |
| 263 | 3300005364 | Ga0070673_100002269 | Ga0070673_1000022693 | 303 |
| 264 | 3300005365 | Ga0070688_100032273 | Ga0070688_1000322733 | 303 |
| 265 | 3300005367 | Ga0070667_100005708 | Ga0070667_1000057083 | 303 |
| 266 | 3300005445 | Ga0070708_100282992 | Ga0070708_1002829922 | 303 |
| 267 | 3300005466 | Ga0070685_10033897 | Ga0070685_100338973 | 303 |
| 268 | 3300005518 | Ga0070699_100119960 | Ga0070699_1001199602 | 303 |
| 269 | 3300005530 | Ga0070679_100016964 | Ga0070679_1000169642 | 303 |
| 270 | 3300005543 | Ga0070672_100005846 | Ga0070672_1000058462 | 303 |
| 271 | 3300005543 | Ga0070672_100047244 | Ga0070672_1000472442 | 303 |
| 272 | 3300005544 | Ga0070686_100005546 | Ga0070686_1000055467 | 303 |
| 273 | 3300005617 | Ga0068859_100017217 | Ga0068859_1000172172 | 303 |
| 274 | 3300005718 | Ga0068866_10011514 | Ga0068866_100115142 | 303 |
| 275 | 3300005719 | Ga0068861_100339685 | Ga0068861_1003396852 | 303 |
| 276 | 3300005841 | Ga0068863_100022837 | Ga0068863_1000228372 | 303 |
| 277 | 3300005841 | Ga0068863_100186873 | Ga0068863_1001868732 | 303 |
| 278 | 3300005842 | Ga0068858_100026396 | Ga0068858_1000263964 | 303 |
| 279 | 3300005937 | Ga0081455_10285818 | Ga0081455_102858181 | 303 |
| 280 | 3300006237 | Ga0097621_100000554 | Ga0097621_10000055426 | 303 |
| 281 | 3300006358 | Ga0068871_100002575 | Ga0068871_1000025756 | 303 |
| 282 | 3300006358 | Ga0068871_100069994 | Ga0068871_1000699942 | 303 |
| 283 | 3300006931 | Ga0097620_100017217 | Ga0097620_1000172172 | 303 |
| 284 | 3300009093 | Ga0105240_10244183 | Ga0105240_102441832 | 303 |
| 285 | 3300009094 | Ga0111539_10000536 | Ga0111539_1000053624 | 303 |
| 286 | 3300009094 | Ga0111539_10489102 | Ga0111539_104891022 | 303 |
| 287 | 3300009098 | Ga0105245_10001786 | Ga0105245_100017868 | 303 |
| 288 | 3300009176 | Ga0105242_10022569 | Ga0105242_100225695 | 303 |
| 289 | 3300009176 | Ga0105242_10098613 | Ga0105242_100986131 | 303 |
| 290 | 3300009177 | Ga0105248_10057845 | Ga0105248_100578453 | 303 |
| 291 | 3300013104 | Ga0157370_10029120 | Ga0157370_100291204 | 303 |
| 292 | 3300013297 | Ga0157378_10000437 | Ga0157378_100004377 | 303 |
| 293 | 3300013297 | Ga0157378_10002581 | Ga0157378_100025819 | 303 |
| 294 | 3300013306 | Ga0163162_10124903 | Ga0163162_101249033 | 303 |
| 295 | 3300013306 | Ga0163162_10286741 | Ga0163162_102867411 | 303 |
| 296 | 3300013308 | Ga0157375_10122921 | Ga0157375_101229213 | 303 |
| 297 | 3300013308 | Ga0157375_10260729 | Ga0157375_102607291 | 303 |
| 298 | 3300014326 | Ga0157380_10050034 | Ga0157380_100500341 | 303 |
| 299 | 3300014326 | Ga0157380_10247718 | Ga0157380_102477181 | 303 |
| 300 | 3300014745 | Ga0157377_10016681 | Ga0157377_100166813 | 303 |
| 301 | 3300014969 | Ga0157376_10056318 | Ga0157376_100563183 | 303 |
| 302 | 3300025903 | Ga0207680_10011290 | Ga0207680_100112903 | 303 |
| 303 | 3300025908 | Ga0207643_10017411 | Ga0207643_100174113 | 303 |
| 304 | 3300025920 | Ga0207649_10002503 | Ga0207649_100025033 | 303 |
| 305 | 3300025921 | Ga0207652_10121649 | Ga0207652_101216492 | 303 |
| 306 | 3300025925 | Ga0207650_10000510 | Ga0207650_1000051024 | 303 |
| 307 | 3300025926 | Ga0207659_10020599 | Ga0207659_100205995 | 303 |
| 308 | 3300025931 | Ga0207644_10002882 | Ga0207644_100028827 | 303 |
| 309 | 3300025936 | Ga0207670_10029226 | Ga0207670_100292262 | 303 |
| 310 | 3300025936 | Ga0207670_10120701 | Ga0207670_101207011 | 303 |
| 311 | 3300025940 | Ga0207691_10019398 | Ga0207691_100193983 | 303 |
| 312 | 3300025940 | Ga0207691_10197390 | Ga0207691_101973901 | 303 |
| 313 | 3300025941 | Ga0207711_10267390 | Ga0207711_102673902 | 303 |
| 314 | 3300025942 | Ga0207689_10088810 | Ga0207689_100888102 | 303 |
| 315 | 3300025945 | Ga0207679_10021225 | Ga0207679_100212253 | 303 |
| 316 | 3300025986 | Ga0207658_10010785 | Ga0207658_100107855 | 303 |
| 317 | 3300026023 | Ga0207677_10028007 | Ga0207677_100280074 | 303 |
| 318 | 3300026088 | Ga0207641_10001235 | Ga0207641_1000123526 | 303 |
| 319 | 3300026088 | Ga0207641_10161340 | Ga0207641_101613402 | 303 |
| 320 | 3300026095 | Ga0207676_10026191 | Ga0207676_100261912 | 303 |
| 321 | 3300026116 | Ga0207674_10212617 | Ga0207674_102126172 | 303 |
| 322 | 3300026121 | Ga0207683_10287154 | Ga0207683_102871542 | 303 |
| 323 | 3300027907 | Ga0207428_10000031 | Ga0207428_10000031181 | 303 |
| 324 | 3300031995 | Ga0307409_100306417 | Ga0307409_1003064172 | 303 |
| 325 | 3300035725 | Ga0373947_0251800 | Ga0373947_0251800_199_1143 | 303 |
| 326 | 3300046462 | Ga0495651_0139011 | Ga0495651_0139011_562_1506 | 303 |
| 327 | 3300046683 | Ga0495658_0015758 | Ga0495658_0015758_2520_3539 | 303 |
| 328 | 3300046691 | Ga0495670_0159165 | Ga0495670_0159165_212_1162 | 303 |
| 329 | 3300047318 | Ga0495636_0000016 | Ga0495636_0000016_49057_50007 | 303 |
| 330 | 3300049583 | Ga0501067_0000249 | Ga0501067_0000249_7412_8356 | 303 |
| 331 | 3300050511 | nmdc:mga08y16_22_c1 | nmdc:mga08y16_22_c1_230433_231386 | 303 |
| 332 | 3300003323 | rootH1_10004495 | rootH1_1000449526 | 304 |
| 333 | 3300005288 | Ga0065714_10019946 | Ga0065714_100199461 | 304 |
| 334 | 3300005295 | Ga0065707_10091080 | Ga0065707_100910803 | 304 |
| 335 | 3300005295 | Ga0065707_10118341 | Ga0065707_101183412 | 304 |
| 336 | 3300005331 | Ga0070670_100012132 | Ga0070670_1000121324 | 304 |
| 337 | 3300005335 | Ga0070666_10029682 | Ga0070666_100296823 | 304 |
| 338 | 3300005347 | Ga0070668_100271460 | Ga0070668_1002714601 | 304 |
| 339 | 3300005355 | Ga0070671_100011830 | Ga0070671_1000118305 | 304 |
| 340 | 3300005356 | Ga0070674_100007915 | Ga0070674_1000079152 | 304 |
| 341 | 3300005364 | Ga0070673_100165222 | Ga0070673_1001652221 | 304 |
| 342 | 3300005367 | Ga0070667_100005498 | Ga0070667_1000054985 | 304 |
| 343 | 3300005367 | Ga0070667_100137970 | Ga0070667_1001379701 | 304 |
| 344 | 3300005367 | Ga0070667_100178526 | Ga0070667_1001785262 | 304 |
| 345 | 3300005455 | Ga0070663_100119781 | Ga0070663_1001197812 | 304 |
| 346 | 3300005471 | Ga0070698_100003211 | Ga0070698_1000032119 | 304 |
| 347 | 3300005543 | Ga0070672_100030941 | Ga0070672_1000309412 | 304 |
| 348 | 3300005544 | Ga0070686_100042469 | Ga0070686_1000424692 | 304 |
| 349 | 3300005548 | Ga0070665_100523045 | Ga0070665_1005230451 | 304 |
| 350 | 3300005617 | Ga0068859_100006459 | Ga0068859_10000645911 | 304 |
| 351 | 3300005834 | Ga0068851_10079402 | Ga0068851_100794021 | 304 |
| 352 | 3300005841 | Ga0068863_100000221 | Ga0068863_10000022143 | 304 |
| 353 | 3300005843 | Ga0068860_100006424 | Ga0068860_10000642410 | 304 |
| 354 | 3300005843 | Ga0068860_100018722 | Ga0068860_1000187224 | 304 |
| 355 | 3300005937 | Ga0081455_10093709 | Ga0081455_100937093 | 304 |
| 356 | 3300006237 | Ga0097621_100021757 | Ga0097621_1000217575 | 304 |
| 357 | 3300006358 | Ga0068871_100003879 | Ga0068871_10000387910 | 304 |
| 358 | 3300006358 | Ga0068871_100023121 | Ga0068871_1000231212 | 304 |
| 359 | 3300006881 | Ga0068865_100124073 | Ga0068865_1001240732 | 304 |
| 360 | 3300006931 | Ga0097620_100006459 | Ga0097620_10000645911 | 304 |
| 361 | 3300009101 | Ga0105247_10001541 | Ga0105247_1000154112 | 304 |
| 362 | 3300009147 | Ga0114129_10014027 | Ga0114129_100140277 | 304 |
| 363 | 3300009147 | Ga0114129_10558725 | Ga0114129_105587252 | 304 |
| 364 | 3300009176 | Ga0105242_10069023 | Ga0105242_100690232 | 304 |
| 365 | 3300009177 | Ga0105248_10000048 | Ga0105248_1000004838 | 304 |
| 366 | 3300013102 | Ga0157371_10185743 | Ga0157371_101857431 | 304 |
| 367 | 3300013296 | Ga0157374_10136846 | Ga0157374_101368462 | 304 |
| 368 | 3300013297 | Ga0157378_10087958 | Ga0157378_100879582 | 304 |
| 369 | 3300013308 | Ga0157375_10000262 | Ga0157375_1000026239 | 304 |
| 370 | 3300014325 | Ga0163163_10108304 | Ga0163163_101083042 | 304 |
| 371 | 3300014745 | Ga0157377_10083580 | Ga0157377_100835802 | 304 |
| 372 | 3300014968 | Ga0157379_10000264 | Ga0157379_1000026412 | 304 |
| 373 | 3300017792 | Ga0163161_10083804 | Ga0163161_100838042 | 304 |
| 374 | 3300021361 | Ga0213872_10047235 | Ga0213872_100472352 | 304 |
| 375 | 3300021441 | Ga0213871_10004166 | Ga0213871_100041663 | 304 |
| 376 | 3300025315 | Ga0207697_10086919 | Ga0207697_100869192 | 304 |
| 377 | 3300025903 | Ga0207680_10026291 | Ga0207680_100262913 | 304 |
| 378 | 3300025925 | Ga0207650_10067621 | Ga0207650_100676212 | 304 |
| 379 | 3300025925 | Ga0207650_10102126 | Ga0207650_101021261 | 304 |
| 380 | 3300025926 | Ga0207659_10000173 | Ga0207659_1000017311 | 304 |
| 381 | 3300025931 | Ga0207644_10015078 | Ga0207644_100150782 | 304 |
| 382 | 3300025938 | Ga0207704_10091665 | Ga0207704_100916652 | 304 |
| 383 | 3300025940 | Ga0207691_10028488 | Ga0207691_100284882 | 304 |
| 384 | 3300025941 | Ga0207711_10000648 | Ga0207711_1000064810 | 304 |
| 385 | 3300025960 | Ga0207651_10022287 | Ga0207651_100222872 | 304 |
| 386 | 3300025986 | Ga0207658_10153660 | Ga0207658_101536602 | 304 |
| 387 | 3300026088 | Ga0207641_10000561 | Ga0207641_100005618 | 304 |
| 388 | 3300028379 | Ga0268266_10191970 | Ga0268266_101919701 | 304 |
| 389 | 3300028381 | Ga0268264_10007005 | Ga0268264_100070053 | 304 |
| 390 | 3300028381 | Ga0268264_10030284 | Ga0268264_100302842 | 304 |
| 391 | 3300028381 | Ga0268264_10454451 | Ga0268264_104544512 | 304 |
| 392 | 3300028800 | Ga0265338_10169127 | Ga0265338_101691272 | 304 |
| 393 | 3300031456 | Ga0307513_10125887 | Ga0307513_101258873 | 304 |
| 394 | 3300031507 | Ga0307509_10107579 | Ga0307509_101075793 | 304 |
| 395 | 3300031691 | Ga0316579_10057577 | Ga0316579_100575772 | 304 |
| 396 | 3300031727 | Ga0316576_10008823 | Ga0316576_100088232 | 304 |
| 397 | 3300031728 | Ga0316578_10007341 | Ga0316578_100073413 | 304 |
| 398 | 3300032126 | Ga0307415_100240574 | Ga0307415_1002405742 | 304 |
| 399 | 3300032133 | Ga0316583_10048860 | Ga0316583_100488601 | 304 |
| 400 | 3300033524 | Ga0316592_1006636 | Ga0316592_10066363 | 304 |
| 401 | 3300033528 | Ga0316588_1040045 | Ga0316588_10400451 | 304 |
| 402 | 3300036401 | Ga0373937_0135290 | Ga0373937_0135290_1306_2253 | 304 |
| 403 | 3300037068 | Ga0373925_0497364 | Ga0373925_0497364_39_986 | 304 |
| 404 | 3300037418 | Ga0395900_0018883 | Ga0395900_0018883_1044_2039 | 304 |
| 405 | 3300037466 | Ga0395898_0001959 | Ga0395898_0001959_11642_12637 | 304 |
| 406 | 3300037471 | Ga0395905_0012005 | Ga0395905_0012005_5349_6305 | 304 |
| 407 | 3300037588 | Ga0316581_0027607 | Ga0316581_0027607_449_1396 | 304 |
| 408 | 3300038443 | Ga0395901_0009760 | Ga0395901_0009760_8357_9352 | 304 |
| 409 | 3300039437 | Ga0436365_0336651 | Ga0436365_0336651_21_968 | 304 |
| 410 | 3300039438 | Ga0436360_0105708 | Ga0436360_0105708_3385_4332 | 304 |
| 411 | 3300039447 | Ga0436361_0740991 | Ga0436361_0740991_1398_2345 | 304 |
| 412 | 3300039453 | Ga0436362_0346855 | Ga0436362_0346855_1188_2135 | 304 |
| 413 | 3300042876 | Ga0451577_0123283 | Ga0451577_0123283_147_1100 | 304 |
| 414 | 3300044658 | Ga0466972_0000009 | Ga0466972_0000009_151986_152933 | 304 |
| 415 | 3300044712 | Ga0453684_0518598 | Ga0453684_0518598_349_1302 | 304 |
| 416 | 3300044842 | Ga0466957_0033462 | Ga0466957_0033462_829_1776 | 304 |
| 417 | 3300046492 | Ga0495585_0000525 | Ga0495585_0000525_11943_12890 | 304 |
| 418 | 3300046522 | Ga0495643_0009334 | Ga0495643_0009334_3457_4404 | 304 |
| 419 | 3300046536 | Ga0495587_0054565 | Ga0495587_0054565_772_1719 | 304 |
| 420 | 3300046691 | Ga0495670_0125443 | Ga0495670_0125443_133_1080 | 304 |
| 421 | 3300047317 | Ga0495604_0006369 | Ga0495604_0006369_1679_2638 | 304 |
| 422 | 3300047444 | Ga0495675_0021392 | Ga0495675_0021392_1565_2524 | 304 |
| 423 | 3300048917 | Ga0496114_0135287 | Ga0496114_0135287_1069_2022 | 304 |
| 424 | 3300049579 | Ga0501043_0166570 | Ga0501043_0166570_651_1598 | 304 |
| 425 | 3300049592 | Ga0501076_0181864 | Ga0501076_0181864_73_1020 | 304 |
| 426 | 3300049705 | Ga0501225_0001987 | Ga0501225_0001987_4212_5159 | 304 |
| 427 | 3300049823 | Ga0501044_0044779 | Ga0501044_0044779_303_1250 | 304 |
| 428 | 3300049823 | Ga0501044_0250010 | Ga0501044_0250010_222_1169 | 304 |
| 429 | 3300053088 | Ga0500644_0006740 | Ga0500644_0006740_503_1450 | 304 |
| 430 | 3300053092 | Ga0500583_0000027 | Ga0500583_0000027_80118_81065 | 304 |
| 431 | 3300053092 | Ga0500583_0000598 | Ga0500583_0000598_5673_6620 | 304 |
| 432 | 3300053147 | Ga0500589_038939 | Ga0500589_038939_615_1562 | 304 |
| 433 | 3300053150 | Ga0500603_038290 | Ga0500603_038290_91_1038 | 304 |
| 434 | 3300002459 | JGI24751J29686_10000335 | JGI24751J29686_1000033514 | 305 |
| 435 | 3300003203 | JGI25406J46586_10023135 | JGI25406J46586_100231352 | 305 |
| 436 | 3300003323 | rootH1_10155694 | rootH1_101556941 | 305 |
| 437 | 3300005290 | Ga0065712_10000781 | Ga0065712_1000078115 | 305 |
| 438 | 3300005327 | Ga0070658_10001806 | Ga0070658_100018065 | 305 |
| 439 | 3300005328 | Ga0070676_10015570 | Ga0070676_100155702 | 305 |
| 440 | 3300005329 | Ga0070683_100020750 | Ga0070683_1000207504 | 305 |
| 441 | 3300005329 | Ga0070683_100236805 | Ga0070683_1002368051 | 305 |
| 442 | 3300005330 | Ga0070690_100040289 | Ga0070690_1000402893 | 305 |
| 443 | 3300005331 | Ga0070670_100025152 | Ga0070670_1000251524 | 305 |
| 444 | 3300005331 | Ga0070670_100052931 | Ga0070670_1000529315 | 305 |
| 445 | 3300005331 | Ga0070670_100064587 | Ga0070670_1000645872 | 305 |
| 446 | 3300005331 | Ga0070670_100083934 | Ga0070670_1000839344 | 305 |
| 447 | 3300005331 | Ga0070670_100206539 | Ga0070670_1002065391 | 305 |
| 448 | 3300005331 | Ga0070670_100248776 | Ga0070670_1002487762 | 305 |
| 449 | 3300005331 | Ga0070670_100302109 | Ga0070670_1003021091 | 305 |
| 450 | 3300005334 | Ga0068869_100024944 | Ga0068869_1000249443 | 305 |
| 451 | 3300005334 | Ga0068869_100066941 | Ga0068869_1000669412 | 305 |
| 452 | 3300005334 | Ga0068869_100087483 | Ga0068869_1000874831 | 305 |
| 453 | 3300005334 | Ga0068869_100386438 | Ga0068869_1003864381 | 305 |
| 454 | 3300005335 | Ga0070666_10021319 | Ga0070666_100213195 | 305 |
| 455 | 3300005335 | Ga0070666_10089305 | Ga0070666_100893052 | 305 |
| 456 | 3300005336 | Ga0070680_100006966 | Ga0070680_10000696610 | 305 |
| 457 | 3300005336 | Ga0070680_100043075 | Ga0070680_1000430752 | 305 |
| 458 | 3300005336 | Ga0070680_100425293 | Ga0070680_1004252931 | 305 |
| 459 | 3300005343 | Ga0070687_100001102 | Ga0070687_1000011025 | 305 |
| 460 | 3300005343 | Ga0070687_100059306 | Ga0070687_1000593062 | 305 |
| 461 | 3300005344 | Ga0070661_100085471 | Ga0070661_1000854712 | 305 |
| 462 | 3300005347 | Ga0070668_100023794 | Ga0070668_1000237941 | 305 |
| 463 | 3300005353 | Ga0070669_100037947 | Ga0070669_1000379473 | 305 |
| 464 | 3300005353 | Ga0070669_100053889 | Ga0070669_1000538891 | 305 |
| 465 | 3300005353 | Ga0070669_100210329 | Ga0070669_1002103292 | 305 |
| 466 | 3300005354 | Ga0070675_100008620 | Ga0070675_10000862010 | 305 |
| 467 | 3300005354 | Ga0070675_100033681 | Ga0070675_1000336814 | 305 |
| 468 | 3300005354 | Ga0070675_100116193 | Ga0070675_1001161932 | 305 |
| 469 | 3300005354 | Ga0070675_100340387 | Ga0070675_1003403871 | 305 |
| 470 | 3300005355 | Ga0070671_100380375 | Ga0070671_1003803751 | 305 |
| 471 | 3300005356 | Ga0070674_100069510 | Ga0070674_1000695102 | 305 |
| 472 | 3300005364 | Ga0070673_100113975 | Ga0070673_1001139752 | 305 |
| 473 | 3300005364 | Ga0070673_100315594 | Ga0070673_1003155941 | 305 |
| 474 | 3300005365 | Ga0070688_100381889 | Ga0070688_1003818891 | 305 |
| 475 | 3300005366 | Ga0070659_100025517 | Ga0070659_1000255176 | 305 |
| 476 | 3300005366 | Ga0070659_100118369 | Ga0070659_1001183692 | 305 |
| 477 | 3300005367 | Ga0070667_100205033 | Ga0070667_1002050332 | 305 |
| 478 | 3300005367 | Ga0070667_100218193 | Ga0070667_1002181931 | 305 |
| 479 | 3300005367 | Ga0070667_100228292 | Ga0070667_1002282922 | 305 |
| 480 | 3300005367 | Ga0070667_100264626 | Ga0070667_1002646262 | 305 |
| 481 | 3300005367 | Ga0070667_100320443 | Ga0070667_1003204432 | 305 |
| 482 | 3300005455 | Ga0070663_100259117 | Ga0070663_1002591171 | 305 |
| 483 | 3300005456 | Ga0070678_100095547 | Ga0070678_1000955472 | 305 |
| 484 | 3300005457 | Ga0070662_100226440 | Ga0070662_1002264401 | 305 |
| 485 | 3300005457 | Ga0070662_100228348 | Ga0070662_1002283482 | 305 |
| 486 | 3300005458 | Ga0070681_10073654 | Ga0070681_100736542 | 305 |
| 487 | 3300005458 | Ga0070681_10105715 | Ga0070681_101057152 | 305 |
| 488 | 3300005458 | Ga0070681_10127861 | Ga0070681_101278612 | 305 |
| 489 | 3300005458 | Ga0070681_10257086 | Ga0070681_102570862 | 305 |
| 490 | 3300005459 | Ga0068867_100116337 | Ga0068867_1001163372 | 305 |
| 491 | 3300005459 | Ga0068867_100450975 | Ga0068867_1004509751 | 305 |
| 492 | 3300005466 | Ga0070685_10007265 | Ga0070685_100072654 | 305 |
| 493 | 3300005466 | Ga0070685_10044525 | Ga0070685_100445253 | 305 |
| 494 | 3300005518 | Ga0070699_100259085 | Ga0070699_1002590852 | 305 |
| 495 | 3300005530 | Ga0070679_100002339 | Ga0070679_10000233912 | 305 |
| 496 | 3300005530 | Ga0070679_100004116 | Ga0070679_1000041163 | 305 |
| 497 | 3300005530 | Ga0070679_100013309 | Ga0070679_1000133096 | 305 |
| 498 | 3300005530 | Ga0070679_100024167 | Ga0070679_1000241676 | 305 |
| 499 | 3300005530 | Ga0070679_100076615 | Ga0070679_1000766152 | 305 |
| 500 | 3300005539 | Ga0068853_100216381 | Ga0068853_1002163811 | 305 |
| 501 | 3300005543 | Ga0070672_100090118 | Ga0070672_1000901182 | 305 |
| 502 | 3300005543 | Ga0070672_100256135 | Ga0070672_1002561351 | 305 |
| 503 | 3300005544 | Ga0070686_100004512 | Ga0070686_1000045124 | 305 |
| 504 | 3300005548 | Ga0070665_100051291 | Ga0070665_1000512913 | 305 |
| 505 | 3300005548 | Ga0070665_100186816 | Ga0070665_1001868161 | 305 |
| 506 | 3300005548 | Ga0070665_100258668 | Ga0070665_1002586682 | 305 |
| 507 | 3300005548 | Ga0070665_100304326 | Ga0070665_1003043262 | 305 |
| 508 | 3300005563 | Ga0068855_100000014 | Ga0068855_100000014133 | 305 |
| 509 | 3300005563 | Ga0068855_100173463 | Ga0068855_1001734631 | 305 |
| 510 | 3300005564 | Ga0070664_100195286 | Ga0070664_1001952861 | 305 |
| 511 | 3300005577 | Ga0068857_100034845 | Ga0068857_1000348452 | 305 |
| 512 | 3300005577 | Ga0068857_100266590 | Ga0068857_1002665902 | 305 |
| 513 | 3300005577 | Ga0068857_100286052 | Ga0068857_1002860522 | 305 |
| 514 | 3300005577 | Ga0068857_100539105 | Ga0068857_1005391051 | 305 |
| 515 | 3300005578 | Ga0068854_100085130 | Ga0068854_1000851302 | 305 |
| 516 | 3300005578 | Ga0068854_100127144 | Ga0068854_1001271441 | 305 |
| 517 | 3300005578 | Ga0068854_100360405 | Ga0068854_1003604052 | 305 |
| 518 | 3300005614 | Ga0068856_100089457 | Ga0068856_1000894572 | 305 |
| 519 | 3300005614 | Ga0068856_100395590 | Ga0068856_1003955901 | 305 |
| 520 | 3300005616 | Ga0068852_100023253 | Ga0068852_1000232533 | 305 |
| 521 | 3300005616 | Ga0068852_100046341 | Ga0068852_1000463412 | 305 |
| 522 | 3300005617 | Ga0068859_100114918 | Ga0068859_1001149182 | 305 |
| 523 | 3300005617 | Ga0068859_100341549 | Ga0068859_1003415492 | 305 |
| 524 | 3300005618 | Ga0068864_100008888 | Ga0068864_1000088883 | 305 |
| 525 | 3300005719 | Ga0068861_100029438 | Ga0068861_1000294383 | 305 |
| 526 | 3300005719 | Ga0068861_100093705 | Ga0068861_1000937052 | 305 |
| 527 | 3300005719 | Ga0068861_100373493 | Ga0068861_1003734931 | 305 |
| 528 | 3300005834 | Ga0068851_10016011 | Ga0068851_100160111 | 305 |
| 529 | 3300005841 | Ga0068863_100126403 | Ga0068863_1001264032 | 305 |
| 530 | 3300005842 | Ga0068858_100013096 | Ga0068858_1000130962 | 305 |
| 531 | 3300005842 | Ga0068858_100082124 | Ga0068858_1000821243 | 305 |
| 532 | 3300005843 | Ga0068860_100188187 | Ga0068860_1001881872 | 305 |
| 533 | 3300005843 | Ga0068860_100302272 | Ga0068860_1003022722 | 305 |
| 534 | 3300005844 | Ga0068862_100011917 | Ga0068862_1000119175 | 305 |
| 535 | 3300005844 | Ga0068862_100221636 | Ga0068862_1002216361 | 305 |
| 536 | 3300005985 | Ga0081539_10004448 | Ga0081539_100044489 | 305 |
| 537 | 3300006163 | Ga0070715_10132209 | Ga0070715_101322091 | 305 |
| 538 | 3300006173 | Ga0070716_100059682 | Ga0070716_1000596821 | 305 |
| 539 | 3300006237 | Ga0097621_100019149 | Ga0097621_1000191495 | 305 |
| 540 | 3300006237 | Ga0097621_100021327 | Ga0097621_1000213273 | 305 |
| 541 | 3300006237 | Ga0097621_100021395 | Ga0097621_1000213954 | 305 |
| 542 | 3300006237 | Ga0097621_100039645 | Ga0097621_1000396452 | 305 |
| 543 | 3300006237 | Ga0097621_100062570 | Ga0097621_1000625702 | 305 |
| 544 | 3300006358 | Ga0068871_100001750 | Ga0068871_10000175015 | 305 |
| 545 | 3300006358 | Ga0068871_100037217 | Ga0068871_1000372174 | 305 |
| 546 | 3300006358 | Ga0068871_100107602 | Ga0068871_1001076023 | 305 |
| 547 | 3300006844 | Ga0075428_100064824 | Ga0075428_1000648244 | 305 |
| 548 | 3300006844 | Ga0075428_100148569 | Ga0075428_1001485693 | 305 |
| 549 | 3300006846 | Ga0075430_100005824 | Ga0075430_1000058249 | 305 |
| 550 | 3300006847 | Ga0075431_100002400 | Ga0075431_1000024009 | 305 |
| 551 | 3300006847 | Ga0075431_100134669 | Ga0075431_1001346692 | 305 |
| 552 | 3300006847 | Ga0075431_100243672 | Ga0075431_1002436722 | 305 |
| 553 | 3300006847 | Ga0075431_100363120 | Ga0075431_1003631201 | 305 |
| 554 | 3300006847 | Ga0075431_100431028 | Ga0075431_1004310281 | 305 |
| 555 | 3300006852 | Ga0075433_10224420 | Ga0075433_102244202 | 305 |
| 556 | 3300006852 | Ga0075433_10252385 | Ga0075433_102523852 | 305 |
| 557 | 3300006871 | Ga0075434_100063233 | Ga0075434_1000632333 | 305 |
| 558 | 3300006880 | Ga0075429_100050163 | Ga0075429_1000501633 | 305 |
| 559 | 3300006880 | Ga0075429_100091904 | Ga0075429_1000919042 | 305 |
| 560 | 3300006880 | Ga0075429_100094474 | Ga0075429_1000944744 | 305 |
| 561 | 3300006881 | Ga0068865_100056511 | Ga0068865_1000565112 | 305 |
| 562 | 3300006881 | Ga0068865_100260300 | Ga0068865_1002603002 | 305 |
| 563 | 3300006931 | Ga0097620_100114917 | Ga0097620_1001149172 | 305 |
| 564 | 3300006931 | Ga0097620_100309232 | Ga0097620_1003092322 | 305 |
| 565 | 3300006931 | Ga0097620_100341549 | Ga0097620_1003415491 | 305 |
| 566 | 3300009093 | Ga0105240_10043874 | Ga0105240_100438742 | 305 |
| 567 | 3300009093 | Ga0105240_10064765 | Ga0105240_100647652 | 305 |
| 568 | 3300009094 | Ga0111539_10031210 | Ga0111539_100312105 | 305 |
| 569 | 3300009094 | Ga0111539_10277409 | Ga0111539_102774091 | 305 |
| 570 | 3300009094 | Ga0111539_10675418 | Ga0111539_106754181 | 305 |
| 571 | 3300009147 | Ga0114129_10093237 | Ga0114129_100932375 | 305 |
| 572 | 3300009147 | Ga0114129_10176339 | Ga0114129_101763393 | 305 |
| 573 | 3300009147 | Ga0114129_10381086 | Ga0114129_103810862 | 305 |
| 574 | 3300009148 | Ga0105243_10232472 | Ga0105243_102324722 | 305 |
| 575 | 3300009174 | Ga0105241_10004396 | Ga0105241_100043965 | 305 |
| 576 | 3300009174 | Ga0105241_10166884 | Ga0105241_101668842 | 305 |
| 577 | 3300009176 | Ga0105242_10003021 | Ga0105242_100030215 | 305 |
| 578 | 3300009176 | Ga0105242_10006100 | Ga0105242_100061007 | 305 |
| 579 | 3300009177 | Ga0105248_10185968 | Ga0105248_101859684 | 305 |
| 580 | 3300009177 | Ga0105248_10448313 | Ga0105248_104483132 | 305 |
| 581 | 3300009545 | Ga0105237_10009302 | Ga0105237_100093026 | 305 |
| 582 | 3300009551 | Ga0105238_10459933 | Ga0105238_104599331 | 305 |
| 583 | 3300009553 | Ga0105249_10021095 | Ga0105249_100210954 | 305 |
| 584 | 3300009553 | Ga0105249_10058553 | Ga0105249_100585534 | 305 |
| 585 | 3300009553 | Ga0105249_10060141 | Ga0105249_100601413 | 305 |
| 586 | 3300010375 | Ga0105239_10012617 | Ga0105239_100126175 | 305 |
| 587 | 3300011119 | Ga0105246_10042738 | Ga0105246_100427382 | 305 |
| 588 | 3300013100 | Ga0157373_10007196 | Ga0157373_100071964 | 305 |
| 589 | 3300013100 | Ga0157373_10217816 | Ga0157373_102178161 | 305 |
| 590 | 3300013100 | Ga0157373_10341215 | Ga0157373_103412151 | 305 |
| 591 | 3300013102 | Ga0157371_10015347 | Ga0157371_100153471 | 305 |
| 592 | 3300013102 | Ga0157371_10030981 | Ga0157371_100309813 | 305 |
| 593 | 3300013102 | Ga0157371_10079361 | Ga0157371_100793613 | 305 |
| 594 | 3300013104 | Ga0157370_10005480 | Ga0157370_100054807 | 305 |
| 595 | 3300013104 | Ga0157370_10011127 | Ga0157370_100111277 | 305 |
| 596 | 3300013104 | Ga0157370_10102080 | Ga0157370_101020803 | 305 |
| 597 | 3300013104 | Ga0157370_10248094 | Ga0157370_102480942 | 305 |
| 598 | 3300013104 | Ga0157370_10509787 | Ga0157370_105097871 | 305 |
| 599 | 3300013296 | Ga0157374_10022899 | Ga0157374_100228993 | 305 |
| 600 | 3300013296 | Ga0157374_10053519 | Ga0157374_100535195 | 305 |
| 601 | 3300013296 | Ga0157374_10162036 | Ga0157374_101620363 | 305 |
| 602 | 3300013296 | Ga0157374_10196769 | Ga0157374_101967693 | 305 |
| 603 | 3300013297 | Ga0157378_10091891 | Ga0157378_100918913 | 305 |
| 604 | 3300013297 | Ga0157378_10284743 | Ga0157378_102847432 | 305 |
| 605 | 3300013306 | Ga0163162_10635131 | Ga0163162_106351311 | 305 |
| 606 | 3300013307 | Ga0157372_10015460 | Ga0157372_100154602 | 305 |
| 607 | 3300013307 | Ga0157372_10055142 | Ga0157372_100551422 | 305 |
| 608 | 3300013307 | Ga0157372_10067718 | Ga0157372_100677185 | 305 |
| 609 | 3300013307 | Ga0157372_10192125 | Ga0157372_101921252 | 305 |
| 610 | 3300013307 | Ga0157372_10334192 | Ga0157372_103341921 | 305 |
| 611 | 3300013307 | Ga0157372_10651318 | Ga0157372_106513181 | 305 |
| 612 | 3300013308 | Ga0157375_10035272 | Ga0157375_100352722 | 305 |
| 613 | 3300013308 | Ga0157375_10392539 | Ga0157375_103925392 | 305 |
| 614 | 3300013308 | Ga0157375_10438695 | Ga0157375_104386952 | 305 |
| 615 | 3300013308 | Ga0157375_10640445 | Ga0157375_106404451 | 305 |
| 616 | 3300014325 | Ga0163163_10008192 | Ga0163163_1000819212 | 305 |
| 617 | 3300014325 | Ga0163163_10116640 | Ga0163163_101166403 | 305 |
| 618 | 3300014325 | Ga0163163_10378901 | Ga0163163_103789011 | 305 |
| 619 | 3300014326 | Ga0157380_10035103 | Ga0157380_100351032 | 305 |
| 620 | 3300014326 | Ga0157380_10127011 | Ga0157380_101270112 | 305 |
| 621 | 3300014326 | Ga0157380_10205732 | Ga0157380_102057322 | 305 |
| 622 | 3300014326 | Ga0157380_10426794 | Ga0157380_104267942 | 305 |
| 623 | 3300014745 | Ga0157377_10030983 | Ga0157377_100309831 | 305 |
| 624 | 3300014968 | Ga0157379_10167729 | Ga0157379_101677292 | 305 |
| 625 | 3300014968 | Ga0157379_10263715 | Ga0157379_102637152 | 305 |
| 626 | 3300014968 | Ga0157379_10268109 | Ga0157379_102681092 | 305 |
| 627 | 3300014969 | Ga0157376_10081417 | Ga0157376_100814172 | 305 |
| 628 | 3300014969 | Ga0157376_10101092 | Ga0157376_101010921 | 305 |
| 629 | 3300014969 | Ga0157376_10207736 | Ga0157376_102077362 | 305 |
| 630 | 3300017792 | Ga0163161_10018613 | Ga0163161_100186132 | 305 |
| 631 | 3300017792 | Ga0163161_10030173 | Ga0163161_100301732 | 305 |
| 632 | 3300025321 | Ga0207656_10000483 | Ga0207656_1000048312 | 305 |
| 633 | 3300025903 | Ga0207680_10130427 | Ga0207680_101304273 | 305 |
| 634 | 3300025907 | Ga0207645_10018735 | Ga0207645_100187352 | 305 |
| 635 | 3300025909 | Ga0207705_10000623 | Ga0207705_1000062321 | 305 |
| 636 | 3300025909 | Ga0207705_10072838 | Ga0207705_100728381 | 305 |
| 637 | 3300025911 | Ga0207654_10028106 | Ga0207654_100281061 | 305 |
| 638 | 3300025911 | Ga0207654_10172482 | Ga0207654_101724821 | 305 |
| 639 | 3300025912 | Ga0207707_10019903 | Ga0207707_100199034 | 305 |
| 640 | 3300025913 | Ga0207695_10005932 | Ga0207695_100059328 | 305 |
| 641 | 3300025913 | Ga0207695_10029463 | Ga0207695_100294634 | 305 |
| 642 | 3300025913 | Ga0207695_10034212 | Ga0207695_100342124 | 305 |
| 643 | 3300025917 | Ga0207660_10033757 | Ga0207660_100337571 | 305 |
| 644 | 3300025917 | Ga0207660_10067556 | Ga0207660_100675561 | 305 |
| 645 | 3300025917 | Ga0207660_10071945 | Ga0207660_100719454 | 305 |
| 646 | 3300025918 | Ga0207662_10002985 | Ga0207662_100029857 | 305 |
| 647 | 3300025918 | Ga0207662_10058259 | Ga0207662_100582592 | 305 |
| 648 | 3300025919 | Ga0207657_10025421 | Ga0207657_100254216 | 305 |
| 649 | 3300025920 | Ga0207649_10233776 | Ga0207649_102337762 | 305 |
| 650 | 3300025921 | Ga0207652_10002089 | Ga0207652_100020893 | 305 |
| 651 | 3300025921 | Ga0207652_10005426 | Ga0207652_100054262 | 305 |
| 652 | 3300025921 | Ga0207652_10170678 | Ga0207652_101706782 | 305 |
| 653 | 3300025923 | Ga0207681_10108322 | Ga0207681_101083222 | 305 |
| 654 | 3300025923 | Ga0207681_10322777 | Ga0207681_103227771 | 305 |
| 655 | 3300025925 | Ga0207650_10031978 | Ga0207650_100319782 | 305 |
| 656 | 3300025925 | Ga0207650_10085894 | Ga0207650_100858942 | 305 |
| 657 | 3300025925 | Ga0207650_10090549 | Ga0207650_100905491 | 305 |
| 658 | 3300025925 | Ga0207650_10115851 | Ga0207650_101158513 | 305 |
| 659 | 3300025925 | Ga0207650_10148330 | Ga0207650_101483302 | 305 |
| 660 | 3300025925 | Ga0207650_10177790 | Ga0207650_101777902 | 305 |
| 661 | 3300025926 | Ga0207659_10029299 | Ga0207659_100292994 | 305 |
| 662 | 3300025926 | Ga0207659_10286541 | Ga0207659_102865412 | 305 |
| 663 | 3300025932 | Ga0207690_10073407 | Ga0207690_100734071 | 305 |
| 664 | 3300025932 | Ga0207690_10147506 | Ga0207690_101475062 | 305 |
| 665 | 3300025932 | Ga0207690_10263057 | Ga0207690_102630571 | 305 |
| 666 | 3300025932 | Ga0207690_10425887 | Ga0207690_104258871 | 305 |
| 667 | 3300025933 | Ga0207706_10052994 | Ga0207706_100529943 | 305 |
| 668 | 3300025933 | Ga0207706_10077398 | Ga0207706_100773982 | 305 |
| 669 | 3300025933 | Ga0207706_10112705 | Ga0207706_101127054 | 305 |
| 670 | 3300025934 | Ga0207686_10000884 | Ga0207686_100008847 | 305 |
| 671 | 3300025934 | Ga0207686_10171732 | Ga0207686_101717321 | 305 |
| 672 | 3300025936 | Ga0207670_10004333 | Ga0207670_100043338 | 305 |
| 673 | 3300025936 | Ga0207670_10351037 | Ga0207670_103510371 | 305 |
| 674 | 3300025940 | Ga0207691_10019513 | Ga0207691_100195136 | 305 |
| 675 | 3300025942 | Ga0207689_10002805 | Ga0207689_100028054 | 305 |
| 676 | 3300025942 | Ga0207689_10040689 | Ga0207689_100406893 | 305 |
| 677 | 3300025942 | Ga0207689_10244290 | Ga0207689_102442901 | 305 |
| 678 | 3300025944 | Ga0207661_10001069 | Ga0207661_100010692 | 305 |
| 679 | 3300025944 | Ga0207661_10120313 | Ga0207661_101203134 | 305 |
| 680 | 3300025945 | Ga0207679_10013567 | Ga0207679_100135674 | 305 |
| 681 | 3300025945 | Ga0207679_10036606 | Ga0207679_100366062 | 305 |
| 682 | 3300025949 | Ga0207667_10000049 | Ga0207667_10000049131 | 305 |
| 683 | 3300025949 | Ga0207667_10019413 | Ga0207667_100194133 | 305 |
| 684 | 3300025949 | Ga0207667_10081514 | Ga0207667_100815144 | 305 |
| 685 | 3300025949 | Ga0207667_10198753 | Ga0207667_101987532 | 305 |
| 686 | 3300025949 | Ga0207667_10253002 | Ga0207667_102530022 | 305 |
| 687 | 3300025960 | Ga0207651_10148977 | Ga0207651_101489772 | 305 |
| 688 | 3300025960 | Ga0207651_10294905 | Ga0207651_102949051 | 305 |
| 689 | 3300025961 | Ga0207712_10002170 | Ga0207712_100021703 | 305 |
| 690 | 3300025961 | Ga0207712_10013251 | Ga0207712_100132514 | 305 |
| 691 | 3300025972 | Ga0207668_10032610 | Ga0207668_100326102 | 305 |
| 692 | 3300025972 | Ga0207668_10083168 | Ga0207668_100831682 | 305 |
| 693 | 3300025981 | Ga0207640_10012544 | Ga0207640_100125445 | 305 |
| 694 | 3300025981 | Ga0207640_10069819 | Ga0207640_100698192 | 305 |
| 695 | 3300025981 | Ga0207640_10187764 | Ga0207640_101877642 | 305 |
| 696 | 3300025986 | Ga0207658_10056336 | Ga0207658_100563363 | 305 |
| 697 | 3300025986 | Ga0207658_10132733 | Ga0207658_101327332 | 305 |
| 698 | 3300025986 | Ga0207658_10195617 | Ga0207658_101956172 | 305 |
| 699 | 3300025986 | Ga0207658_10257330 | Ga0207658_102573302 | 305 |
| 700 | 3300026023 | Ga0207677_10038103 | Ga0207677_100381033 | 305 |
| 701 | 3300026035 | Ga0207703_10019904 | Ga0207703_100199042 | 305 |
| 702 | 3300026041 | Ga0207639_10093975 | Ga0207639_100939752 | 305 |
| 703 | 3300026041 | Ga0207639_10257563 | Ga0207639_102575632 | 305 |
| 704 | 3300026088 | Ga0207641_10035180 | Ga0207641_100351802 | 305 |
| 705 | 3300026089 | Ga0207648_10002623 | Ga0207648_1000262312 | 305 |
| 706 | 3300026095 | Ga0207676_10082344 | Ga0207676_100823443 | 305 |
| 707 | 3300026095 | Ga0207676_10379983 | Ga0207676_103799831 | 305 |
| 708 | 3300026116 | Ga0207674_10033423 | Ga0207674_100334235 | 305 |
| 709 | 3300026116 | Ga0207674_10529904 | Ga0207674_105299041 | 305 |
| 710 | 3300026118 | Ga0207675_100049100 | Ga0207675_1000491006 | 305 |
| 711 | 3300026118 | Ga0207675_100077458 | Ga0207675_1000774582 | 305 |
| 712 | 3300026118 | Ga0207675_100429753 | Ga0207675_1004297531 | 305 |
| 713 | 3300026121 | Ga0207683_10020712 | Ga0207683_100207127 | 305 |
| 714 | 3300026121 | Ga0207683_10124392 | Ga0207683_101243922 | 305 |
| 715 | 3300026142 | Ga0207698_10018072 | Ga0207698_100180723 | 305 |
| 716 | 3300026142 | Ga0207698_10052775 | Ga0207698_100527752 | 305 |
| 717 | 3300026142 | Ga0207698_10327836 | Ga0207698_103278361 | 305 |
| 718 | 3300027876 | Ga0209974_10005581 | Ga0209974_100055813 | 305 |
| 719 | 3300028379 | Ga0268266_10209886 | Ga0268266_102098862 | 305 |
| 720 | 3300028379 | Ga0268266_10269806 | Ga0268266_102698062 | 305 |
| 721 | 3300028379 | Ga0268266_10280572 | Ga0268266_102805721 | 305 |
| 722 | 3300028379 | Ga0268266_10476697 | Ga0268266_104766972 | 305 |
| 723 | 3300028380 | Ga0268265_10219681 | Ga0268265_102196812 | 305 |
| 724 | 3300028381 | Ga0268264_10059906 | Ga0268264_100599064 | 305 |
| 725 | 3300028381 | Ga0268264_10316568 | Ga0268264_103165681 | 305 |
| 726 | 3300028577 | Ga0265318_10000195 | Ga0265318_1000019544 | 305 |
| 727 | 3300028654 | Ga0265322_10001230 | Ga0265322_100012306 | 305 |
| 728 | 3300028794 | Ga0307515_10000092 | Ga0307515_1000009224 | 305 |
| 729 | 3300031235 | Ga0265330_10009657 | Ga0265330_100096572 | 305 |
| 730 | 3300031238 | Ga0265332_10036575 | Ga0265332_100365752 | 305 |
| 731 | 3300031240 | Ga0265320_10000070 | Ga0265320_1000007031 | 305 |
| 732 | 3300031241 | Ga0265325_10033045 | Ga0265325_100330452 | 305 |
| 733 | 3300031242 | Ga0265329_10000929 | Ga0265329_100009295 | 305 |
| 734 | 3300031247 | Ga0265340_10003007 | Ga0265340_100030076 | 305 |
| 735 | 3300031249 | Ga0265339_10087891 | Ga0265339_100878911 | 305 |
| 736 | 3300031250 | Ga0265331_10003091 | Ga0265331_100030913 | 305 |
| 737 | 3300031344 | Ga0265316_10006923 | Ga0265316_100069236 | 305 |
| 738 | 3300031548 | Ga0307408_100040579 | Ga0307408_1000405793 | 305 |
| 739 | 3300031595 | Ga0265313_10001878 | Ga0265313_100018789 | 305 |
| 740 | 3300031665 | Ga0316575_10001544 | Ga0316575_100015442 | 305 |
| 741 | 3300031665 | Ga0316575_10012027 | Ga0316575_100120272 | 305 |
| 742 | 3300031711 | Ga0265314_10054940 | Ga0265314_100549401 | 305 |
| 743 | 3300031712 | Ga0265342_10000433 | Ga0265342_100004339 | 305 |
| 744 | 3300031727 | Ga0316576_10048941 | Ga0316576_100489412 | 305 |
| 745 | 3300031727 | Ga0316576_10052550 | Ga0316576_100525503 | 305 |
| 746 | 3300031727 | Ga0316576_10198194 | Ga0316576_101981941 | 305 |
| 747 | 3300031852 | Ga0307410_10013477 | Ga0307410_100134771 | 305 |
| 748 | 3300031852 | Ga0307410_10040082 | Ga0307410_100400822 | 305 |
| 749 | 3300031852 | Ga0307410_10123549 | Ga0307410_101235492 | 305 |
| 750 | 3300031903 | Ga0307407_10045299 | Ga0307407_100452992 | 305 |
| 751 | 3300031911 | Ga0307412_10232205 | Ga0307412_102322051 | 305 |
| 752 | 3300031995 | Ga0307409_100085900 | Ga0307409_1000859002 | 305 |
| 753 | 3300032002 | Ga0307416_100027174 | Ga0307416_1000271741 | 305 |
| 754 | 3300032002 | Ga0307416_100056409 | Ga0307416_1000564092 | 305 |
| 755 | 3300032004 | Ga0307414_10367887 | Ga0307414_103678871 | 305 |
| 756 | 3300032005 | Ga0307411_10038303 | Ga0307411_100383032 | 305 |
| 757 | 3300032005 | Ga0307411_10042060 | Ga0307411_100420602 | 305 |
| 758 | 3300032005 | Ga0307411_10189530 | Ga0307411_101895301 | 305 |
| 759 | 3300032126 | Ga0307415_100030729 | Ga0307415_1000307292 | 305 |
| 760 | 3300032133 | Ga0316583_10004947 | Ga0316583_100049474 | 305 |
| 761 | 3300032133 | Ga0316583_10021390 | Ga0316583_100213902 | 305 |
| 762 | 3300032133 | Ga0316583_10026515 | Ga0316583_100265152 | 305 |
| 763 | 3300032133 | Ga0316583_10035788 | Ga0316583_100357882 | 305 |
| 764 | 3300032133 | Ga0316583_10040292 | Ga0316583_100402921 | 305 |
| 765 | 3300032137 | Ga0316585_10052164 | Ga0316585_100521641 | 305 |
| 766 | 3300032139 | Ga0316580_10001815 | Ga0316580_100018153 | 305 |
| 767 | 3300035172 | Ga0373955_0073320 | Ga0373955_0073320_319_1269 | 305 |
| 768 | 3300036401 | Ga0373937_0012246 | Ga0373937_0012246_1709_2659 | 305 |
| 769 | 3300036647 | Ga0316582_0055855 | Ga0316582_0055855_584_1534 | 305 |
| 770 | 3300037312 | Ga0395899_0017367 | Ga0395899_0017367_426_1376 | 305 |
| 771 | 3300037418 | Ga0395900_0027156 | Ga0395900_0027156_2610_3560 | 305 |
| 772 | 3300037418 | Ga0395900_0124498 | Ga0395900_0124498_665_1615 | 305 |
| 773 | 3300037466 | Ga0395898_0085750 | Ga0395898_0085750_751_1725 | 305 |
| 774 | 3300037466 | Ga0395898_0154787 | Ga0395898_0154787_477_1448 | 305 |
| 775 | 3300038443 | Ga0395901_0001045 | Ga0395901_0001045_26730_27680 | 305 |
| 776 | 3300038443 | Ga0395901_0015422 | Ga0395901_0015422_1349_2323 | 305 |
| 777 | 3300042007 | Ga0439449_0040168 | Ga0439449_0040168_681_1631 | 305 |
| 778 | 3300042436 | Ga0439435_0049817 | Ga0439435_0049817_43_1047 | 305 |
| 779 | 3300042876 | Ga0451577_0003018 | Ga0451577_0003018_11635_12651 | 305 |
| 780 | 3300042876 | Ga0451577_0147235 | Ga0451577_0147235_132_1100 | 305 |
| 781 | 3300044673 | Ga0453683_0049204 | Ga0453683_0049204_919_1887 | 305 |
| 782 | 3300044673 | Ga0453683_0204881 | Ga0453683_0204881_144_1094 | 305 |
| 783 | 3300044712 | Ga0453684_0000220 | Ga0453684_0000220_48571_49521 | 305 |
| 784 | 3300044712 | Ga0453684_0029795 | Ga0453684_0029795_4114_5064 | 305 |
| 785 | 3300044712 | Ga0453684_0120717 | Ga0453684_0120717_1220_2170 | 305 |
| 786 | 3300044712 | Ga0453684_0187841 | Ga0453684_0187841_1350_2300 | 305 |
| 787 | 3300044712 | Ga0453684_0464060 | Ga0453684_0464060_444_1394 | 305 |
| 788 | 3300044712 | Ga0453684_0481969 | Ga0453684_0481969_328_1296 | 305 |
| 789 | 3300045051 | Ga0451576_0030100 | Ga0451576_0030100_3105_4055 | 305 |
| 790 | 3300045051 | Ga0451576_0031338 | Ga0451576_0031338_1418_2368 | 305 |
| 791 | 3300045051 | Ga0451576_0255094 | Ga0451576_0255094_80_1030 | 305 |
| 792 | 3300046459 | Ga0495629_0105738 | Ga0495629_0105738_303_1253 | 305 |
| 793 | 3300046514 | Ga0495618_0038745 | Ga0495618_0038745_1048_1998 | 305 |
| 794 | 3300046517 | Ga0495630_0361005 | Ga0495630_0361005_46_996 | 305 |
| 795 | 3300046533 | Ga0495640_0081835 | Ga0495640_0081835_961_1911 | 305 |
| 796 | 3300046536 | Ga0495587_0034140 | Ga0495587_0034140_1075_2025 | 305 |
| 797 | 3300046536 | Ga0495587_0094614 | Ga0495587_0094614_648_1613 | 305 |
| 798 | 3300046537 | Ga0495598_0007722 | Ga0495598_0007722_814_1764 | 305 |
| 799 | 3300046615 | Ga0495656_0001607 | Ga0495656_0001607_1950_2903 | 305 |
| 800 | 3300046615 | Ga0495656_0118129 | Ga0495656_0118129_252_1202 | 305 |
| 801 | 3300046642 | Ga0495634_0038710 | Ga0495634_0038710_2255_3205 | 305 |
| 802 | 3300046663 | Ga0495635_0014765 | Ga0495635_0014765_951_1901 | 305 |
| 803 | 3300046675 | Ga0495657_0220443 | Ga0495657_0220443_134_1084 | 305 |
| 804 | 3300046678 | Ga0495599_0119314 | Ga0495599_0119314_65_1015 | 305 |
| 805 | 3300046678 | Ga0495599_0189701 | Ga0495599_0189701_65_1018 | 305 |
| 806 | 3300046684 | Ga0495669_0006927 | Ga0495669_0006927_2971_3939 | 305 |
| 807 | 3300046691 | Ga0495670_0124712 | Ga0495670_0124712_257_1207 | 305 |
| 808 | 3300046809 | Ga0495600_0122883 | Ga0495600_0122883_324_1274 | 305 |
| 809 | 3300047315 | Ga0495581_0079809 | Ga0495581_0079809_890_1855 | 305 |
| 810 | 3300047317 | Ga0495604_0111219 | Ga0495604_0111219_447_1397 | 305 |
| 811 | 3300047317 | Ga0495604_0220447 | Ga0495604_0220447_293_1243 | 305 |
| 812 | 3300047444 | Ga0495675_0051785 | Ga0495675_0051785_246_1211 | 305 |
| 813 | 3300047471 | Ga0495684_0057463 | Ga0495684_0057463_1869_2819 | 305 |
| 814 | 3300048088 | Ga0495602_0092839 | Ga0495602_0092839_1112_2062 | 305 |
| 815 | 3300048907 | Ga0496104_0088030 | Ga0496104_0088030_663_1613 | 305 |
| 816 | 3300048908 | Ga0496105_0087649 | Ga0496105_0087649_351_1301 | 305 |
| 817 | 3300048911 | Ga0496108_0057265 | Ga0496108_0057265_197_1165 | 305 |
| 818 | 3300048911 | Ga0496108_0161989 | Ga0496108_0161989_828_1781 | 305 |
| 819 | 3300048912 | Ga0496109_0130602 | Ga0496109_0130602_1315_2283 | 305 |
| 820 | 3300048915 | Ga0496112_0117533 | Ga0496112_0117533_32_982 | 305 |
| 821 | 3300048917 | Ga0496114_0058821 | Ga0496114_0058821_1807_2757 | 305 |
| 822 | 3300049569 | Ga0501032_0128267 | Ga0501032_0128267_120_1070 | 305 |
| 823 | 3300049570 | Ga0501033_0045063 | Ga0501033_0045063_296_1246 | 305 |
| 824 | 3300049570 | Ga0501033_0226804 | Ga0501033_0226804_80_1030 | 305 |
| 825 | 3300049571 | Ga0501034_0010869 | Ga0501034_0010869_6113_7063 | 305 |
| 826 | 3300049572 | Ga0501036_0006252 | Ga0501036_0006252_4883_5860 | 305 |
| 827 | 3300049572 | Ga0501036_0115614 | Ga0501036_0115614_118_1068 | 305 |
| 828 | 3300049573 | Ga0501037_0014266 | Ga0501037_0014266_1056_2006 | 305 |
| 829 | 3300049573 | Ga0501037_0038256 | Ga0501037_0038256_21_971 | 305 |
| 830 | 3300049574 | Ga0501038_0069442 | Ga0501038_0069442_1810_2760 | 305 |
| 831 | 3300049574 | Ga0501038_0090020 | Ga0501038_0090020_695_1672 | 305 |
| 832 | 3300049574 | Ga0501038_0112482 | Ga0501038_0112482_761_1711 | 305 |
| 833 | 3300049574 | Ga0501038_0247264 | Ga0501038_0247264_232_1182 | 305 |
| 834 | 3300049575 | Ga0501039_0016664 | Ga0501039_0016664_3054_4004 | 305 |
| 835 | 3300049575 | Ga0501039_0022435 | Ga0501039_0022435_1729_2679 | 305 |
| 836 | 3300049575 | Ga0501039_0084494 | Ga0501039_0084494_954_1931 | 305 |
| 837 | 3300049576 | Ga0501040_0001939 | Ga0501040_0001939_5133_6110 | 305 |
| 838 | 3300049576 | Ga0501040_0028138 | Ga0501040_0028138_2714_3664 | 305 |
| 839 | 3300049578 | Ga0501042_0014495 | Ga0501042_0014495_3088_4038 | 305 |
| 840 | 3300049578 | Ga0501042_0095252 | Ga0501042_0095252_295_1272 | 305 |
| 841 | 3300049579 | Ga0501043_0150986 | Ga0501043_0150986_80_1030 | 305 |
| 842 | 3300049580 | Ga0501046_0018198 | Ga0501046_0018198_1057_2007 | 305 |
| 843 | 3300049580 | Ga0501046_0062127 | Ga0501046_0062127_1440_2417 | 305 |
| 844 | 3300049581 | Ga0501047_0034670 | Ga0501047_0034670_2238_3188 | 305 |
| 845 | 3300049582 | Ga0501048_0009500 | Ga0501048_0009500_1117_2094 | 305 |
| 846 | 3300049582 | Ga0501048_0046381 | Ga0501048_0046381_293_1243 | 305 |
| 847 | 3300049582 | Ga0501048_0210136 | Ga0501048_0210136_417_1367 | 305 |
| 848 | 3300049584 | Ga0501068_0270012 | Ga0501068_0270012_34_984 | 305 |
| 849 | 3300049588 | Ga0501072_0022119 | Ga0501072_0022119_631_1608 | 305 |
| 850 | 3300049590 | Ga0501074_0095165 | Ga0501074_0095165_320_1270 | 305 |
| 851 | 3300049591 | Ga0501075_0008564 | Ga0501075_0008564_2775_3740 | 305 |
| 852 | 3300049591 | Ga0501075_0093423 | Ga0501075_0093423_1131_2108 | 305 |
| 853 | 3300049592 | Ga0501076_0008547 | Ga0501076_0008547_2788_3765 | 305 |
| 854 | 3300049592 | Ga0501076_0033519 | Ga0501076_0033519_3027_3986 | 305 |
| 855 | 3300049592 | Ga0501076_0301692 | Ga0501076_0301692_225_1175 | 305 |
| 856 | 3300049592 | Ga0501076_0305508 | Ga0501076_0305508_183_1133 | 305 |
| 857 | 3300049593 | Ga0501077_0009906 | Ga0501077_0009906_4576_5541 | 305 |
| 858 | 3300049649 | Ga0501198_012893 | Ga0501198_012893_263_1213 | 305 |
| 859 | 3300049652 | Ga0501202_029143 | Ga0501202_029143_147_1097 | 305 |
| 860 | 3300049661 | Ga0501217_000055 | Ga0501217_000055_4314_5264 | 305 |
| 861 | 3300049662 | Ga0501222_004506 | Ga0501222_004506_790_1740 | 305 |
| 862 | 3300049663 | Ga0501223_001899 | Ga0501223_001899_2534_3484 | 305 |
| 863 | 3300049668 | Ga0501233_004326 | Ga0501233_004326_29_979 | 305 |
| 864 | 3300049675 | Ga0501243_000975 | Ga0501243_000975_942_1892 | 305 |
| 865 | 3300049688 | Ga0501259_001374 | Ga0501259_001374_1172_2122 | 305 |
| 866 | 3300049704 | Ga0501221_000337 | Ga0501221_000337_3654_4604 | 305 |
| 867 | 3300049705 | Ga0501225_0001107 | Ga0501225_0001107_5546_6496 | 305 |
| 868 | 3300049708 | Ga0501245_000875 | Ga0501245_000875_2232_3182 | 305 |
| 869 | 3300049741 | Ga0501079_0010716 | Ga0501079_0010716_222_1199 | 305 |
| 870 | 3300049741 | Ga0501079_0060330 | Ga0501079_0060330_1052_2002 | 305 |
| 871 | 3300049741 | Ga0501079_0146628 | Ga0501079_0146628_170_1135 | 305 |
| 872 | 3300049741 | Ga0501079_0158162 | Ga0501079_0158162_311_1261 | 305 |
| 873 | 3300049741 | Ga0501079_0188864 | Ga0501079_0188864_115_1065 | 305 |
| 874 | 3300049742 | Ga0501080_0014784 | Ga0501080_0014784_3767_4744 | 305 |
| 875 | 3300049743 | Ga0501081_0007334 | Ga0501081_0007334_5346_6323 | 305 |
| 876 | 3300049743 | Ga0501081_0012374 | Ga0501081_0012374_3151_4116 | 305 |
| 877 | 3300049743 | Ga0501081_0135937 | Ga0501081_0135937_463_1413 | 305 |
| 878 | 3300049760 | Ga0501263_007208 | Ga0501263_007208_30_995 | 305 |
| 879 | 3300049765 | Ga0501268_023281 | Ga0501268_023281_68_1033 | 305 |
| 880 | 3300049822 | Ga0501035_0035768 | Ga0501035_0035768_2126_3076 | 305 |
| 881 | 3300049822 | Ga0501035_0133458 | Ga0501035_0133458_1198_2148 | 305 |
| 882 | 3300049823 | Ga0501044_0002454 | Ga0501044_0002454_2104_3054 | 305 |
| 883 | 3300049824 | Ga0501045_0002074 | Ga0501045_0002074_7732_8709 | 305 |
| 884 | 3300049824 | Ga0501045_0039920 | Ga0501045_0039920_2122_3072 | 305 |
| 885 | 3300049824 | Ga0501045_0043711 | Ga0501045_0043711_2023_2973 | 305 |
| 886 | 3300049824 | Ga0501045_0051695 | Ga0501045_0051695_1987_2952 | 305 |
| 887 | 3300050507 | nmdc:mga05p37_142569_c1 | nmdc:mga05p37_142569_c1_472_1425 | 305 |
| 888 | 3300050507 | nmdc:mga05p37_148017_c1 | nmdc:mga05p37_148017_c1_817_1767 | 305 |
| 889 | 3300050507 | nmdc:mga05p37_50876_c1 | nmdc:mga05p37_50876_c1_2911_3897 | 305 |
| 890 | 3300050508 | nmdc:mga09592_275417_c1 | nmdc:mga09592_275417_c1_319_1305 | 305 |
| 891 | 3300050508 | nmdc:mga09592_40794_c1 | nmdc:mga09592_40794_c1_1282_2232 | 305 |
| 892 | 3300050508 | nmdc:mga09592_87369_c1 | nmdc:mga09592_87369_c1_1164_2114 | 305 |
| 893 | 3300050508 | nmdc:mga09592_99597_c1 | nmdc:mga09592_99597_c1_1150_2100 | 305 |
| 894 | 3300050509 | nmdc:mga0qj67_12488_c1 | nmdc:mga0qj67_12488_c1_1678_2628 | 305 |
| 895 | 3300050509 | nmdc:mga0qj67_2698_c1 | nmdc:mga0qj67_2698_c1_9999_10949 | 305 |
| 896 | 3300050509 | nmdc:mga0qj67_53056_c1 | nmdc:mga0qj67_53056_c1_951_1916 | 305 |
| 897 | 3300050510 | nmdc:mga06r32_354305_c1 | nmdc:mga06r32_354305_c1_73_1023 | 305 |
| 898 | 3300050510 | nmdc:mga06r32_418705_c1 | nmdc:mga06r32_418705_c1_293_1243 | 305 |
| 899 | 3300050510 | nmdc:mga06r32_47840_c1 | nmdc:mga06r32_47840_c1_421_1371 | 305 |
| 900 | 3300050510 | nmdc:mga06r32_55517_c1 | nmdc:mga06r32_55517_c1_1506_2492 | 305 |
| 901 | 3300050510 | nmdc:mga06r32_8661_c1 | nmdc:mga06r32_8661_c1_5991_6956 | 305 |
| 902 | 3300050514 | nmdc:mga08x19_185705_c1 | nmdc:mga08x19_185705_c1_150_1136 | 305 |
| 903 | 3300050515 | nmdc:mga0a205_119095_c1 | nmdc:mga0a205_119095_c1_869_1855 | 305 |
| 904 | 3300050515 | nmdc:mga0a205_90561_c1 | nmdc:mga0a205_90561_c1_290_1243 | 305 |
| 905 | 3300053077 | Ga0495601_0045849 | Ga0495601_0045849_483_1433 | 305 |
| 906 | 3300053077 | Ga0495601_0084683 | Ga0495601_0084683_733_1683 | 305 |
| 907 | 3300053084 | Ga0495595_0010711 | Ga0495595_0010711_458_1408 | 305 |
| 908 | 3300053085 | Ga0495619_0005570 | Ga0495619_0005570_4945_5895 | 305 |
| 909 | 3300053085 | Ga0495619_0023411 | Ga0495619_0023411_2054_3004 | 305 |
| 910 | 3300054114 | Ga0501084_0159099 | Ga0501084_0159099_58_1008 | 305 |
| 911 | 3300054114 | Ga0501084_0214105 | Ga0501084_0214105_241_1218 | 305 |
| 912 | 3300060353 | Ga0501082_0004906 | Ga0501082_0004906_5036_6013 | 305 |
| 913 | 3300060353 | Ga0501082_0015866 | Ga0501082_0015866_2445_3410 | 305 |
| 914 | 3300061734 | Ga0530510_0002730 | Ga0530510_0002730_6095_7072 | 305 |
| 915 | 3300061734 | Ga0530510_0086070 | Ga0530510_0086070_284_1234 | 305 |
| 916 | 3300061734 | Ga0530510_0104328 | Ga0530510_0104328_680_1645 | 305 |
| 917 | 3300061734 | Ga0530510_0138981 | Ga0530510_0138981_128_1078 | 305 |
| 918 | 3300061734 | Ga0530510_0140894 | Ga0530510_0140894_171_1121 | 305 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3dxf-assembly2.cif.gz_B | crystal structure of the hscarg r37a mutant | 0.897 | 4 | 301 |
| 3dxf-assembly2.cif.gz_B | crystal structure of the hscarg r37a mutant | 0.8909 | 4 | 301 |
| 2wmd-assembly1.cif.gz_A-2 | crystal structure of nmra-like family domain containing protein 1 in complex with nadp and 2-(4-chloro-phenylamino)-nicotinic acid | 0.8858 | 4 | 304 |
| 3dxf-assembly1.cif.gz_A | crystal structure of the hscarg r37a mutant | 0.8842 | 4 | 301 |
| 2wmd-assembly1.cif.gz_A-2 | crystal structure of nmra-like family domain containing protein 1 in complex with nadp and 2-(4-chloro-phenylamino)-nicotinic acid | 0.883 | 4 | 304 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3dxfA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8415 | 4 | 287 | 3.40.50.720 |
| 3dxfA02 | Alpha Beta;Alpha-Beta Complex;UDP-galactose 4-epimerase; domain 1;UDP-galactose 4-epimerase, domain 1 | 0.8404 | 156 | 301 | 3.90.25.10 |
| 5f5lA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8348 | 3 | 305 | 3.40.50.720 |
| 3dxfA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8331 | 4 | 287 | 3.40.50.720 |
| 5f5lA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8321 | 3 | 305 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A533XDF9-F1-model_v4 | NmrA/HSCARG family protein | 0.9939 | 137 | 305 |
|
| AF-A0A524LHP2-F1-model_v4 | NmrA/HSCARG family protein | 0.9934 | 60 | 305 |
|
| AF-A0A7Y2CQ11-F1-model_v4 | NmrA family NAD(P)-binding protein | 0.9864 | 178 | 305 |
|
| AF-A0A838NQV1-F1-model_v4 | NmrA family NAD(P)-binding protein | 0.9861 | 165 | 305 |
|
| AF-A0A524LHP2-F1-model_v4 | NmrA/HSCARG family protein | 0.9854 | 60 | 305 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar