F485666

General Info

Members Datasets Scaffolds Average Seq Length
918 339 915 312

Family's Representative Sequence

Representative Sequence 3300005834|Ga0068851_10016011|Ga0068851_100160111
Length 344
Sequence MKILKTFSLLFHLTIFVSFKTFNHRSTFMTQKKIIAVFGATGAQGGGLARAILSDPHSEFSVRVVTRAVHSDKAKALEAMGAELVNADVDNPKEIRKALQGAYGAFFVTFFWAHYSPELENKHAEDFAKAAKEAGLKHVIWSTLEDTRKWYPLDDDRMPTLHDNYKVPHFDGKGASDHYFTDNGVPTTFLMASFYWENMIYFGMGPKRGDDGKLTFTLPMADKKMGGIGAEDIGRCAYGIFKKGTELVGKYVGIAGEQLTGEQMAHHLSKSLGEEVKYNAITPATFRSFGFPGADDLGNMFQFYAEQEKYLDDARDPKISKQLNPQLKNFDAWLKDNAKLIPLE

Samples

Sample ID Description Type Environment
1 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
2 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
3 2738541278 Niastella sp. CF465 Isolate Unclassified
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
68 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
69 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
75 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
76 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
97 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
98 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
111 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
112 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
113 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
166 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
170 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
171 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
172 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
173 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
174 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
175 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
176 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
177 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
178 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
179 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
180 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
181 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
182 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
183 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
184 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
185 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
186 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
187 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
188 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
189 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
190 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
191 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
192 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
193 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
194 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
195 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
196 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
197 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
198 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
199 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
200 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
201 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
202 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
203 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
204 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
205 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
206 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
207 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
208 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
210 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
211 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
212 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
213 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
214 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
215 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
216 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
217 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
218 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
219 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
220 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
221 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
222 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
223 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
224 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
225 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
226 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
227 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
228 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
229 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
230 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
231 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
232 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
233 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
234 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
235 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
236 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
237 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
238 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
239 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
240 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
241 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
242 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
243 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
244 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
245 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
246 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
247 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
248 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
249 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
250 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
251 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
252 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
253 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
254 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
255 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
256 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
257 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
258 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
259 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
260 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
261 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
262 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
263 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
264 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
265 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
266 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
267 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
268 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
269 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
270 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
271 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
272 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
273 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
274 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
275 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
276 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
277 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
278 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
279 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
280 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
281 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
282 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
283 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
285 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
286 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
288 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
289 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
291 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
292 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
293 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
294 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
295 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
296 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
297 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
298 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
299 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
300 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
301 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
302 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
303 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
304 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
305 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
306 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
307 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
308 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
309 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
310 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
311 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
312 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
313 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
314 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
315 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
316 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
317 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
318 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
319 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
320 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
321 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
322 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
323 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
324 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
325 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
326 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
327 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
328 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
329 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
330 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
331 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
332 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
333 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
334 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
335 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
336 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
337 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
338 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
339 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.46
Metatranscriptomes 0.22
Isolates 0.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.76
Nodule 0
Rhizoplane 1.63
Rhizosphere 96.62
Stem 0
Stem Tuber 0
Unclassified 0.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10000335 3300002459 Bacteria 17022
2 JGI25406J46586_10023135 3300003203 Bacteria 2460
3 rootH1_10004495 3300003323 Bacteria 36666
4 rootH1_10155694 3300003323 Bacteria 1652
5 Ga0065714_10019946 3300005288 Bacteria 1173
6 Ga0065712_10000781 3300005290 Bacteria 14555
7 Ga0065715_10155878 3300005293 Bacteria 1670
8 Ga0065707_10091080 3300005295 Bacteria 4010
9 Ga0065707_10118341 3300005295 Bacteria 2188
10 Ga0070658_10001806 3300005327 Bacteria 17989
11 Ga0070676_10015570 3300005328 Bacteria 4196
12 Ga0070676_10113135 3300005328 Bacteria 1693
13 Ga0070683_100005550 3300005329 Bacteria 10535
14 Ga0070683_100020750 3300005329 Bacteria 5852
15 Ga0070683_100132805 3300005329 Bacteria 2356
16 Ga0070683_100236805 3300005329 Bacteria 1736
17 Ga0070690_100003963 3300005330 Bacteria 8179
18 Ga0070690_100040289 3300005330 Unclassified 2954
19 Ga0070670_100012132 3300005331 Bacteria 7371
20 Ga0070670_100018444 3300005331 Bacteria 5987
21 Ga0070670_100025152 3300005331 Bacteria 5122
22 Ga0070670_100052931 3300005331 Bacteria 3487
23 Ga0070670_100064587 3300005331 Bacteria 3140
24 Ga0070670_100083934 3300005331 Bacteria 2737
25 Ga0070670_100206539 3300005331 Unclassified 1707
26 Ga0070670_100248776 3300005331 Bacteria 1548
27 Ga0070670_100251733 3300005331 Bacteria 1539
28 Ga0070670_100302109 3300005331 Bacteria 1400
29 Ga0068869_100024944 3300005334 Bacteria 4147
30 Ga0068869_100066941 3300005334 Bacteria 2648
31 Ga0068869_100087483 3300005334 Unclassified 2337
32 Ga0068869_100386438 3300005334 Bacteria 1148
33 Ga0070666_10001316 3300005335 Bacteria 15045
34 Ga0070666_10005429 3300005335 Bacteria 7817
35 Ga0070666_10021319 3300005335 Bacteria 4200
36 Ga0070666_10029682 3300005335 Bacteria 3597
37 Ga0070666_10089305 3300005335 Unclassified 2115
38 Ga0070680_100006966 3300005336 Bacteria 8616
39 Ga0070680_100043075 3300005336 Bacteria 3665
40 Ga0070680_100425293 3300005336 Bacteria 1133
41 Ga0070682_100006403 3300005337 Bacteria 6613
42 Ga0070682_100095781 3300005337 Unclassified 1950
43 Ga0068868_100008292 3300005338 Bacteria 7442
44 Ga0068868_100015287 3300005338 Bacteria 5675
45 Ga0068868_100158765 3300005338 Bacteria 1866
46 Ga0070660_100031268 3300005339 Bacteria 3997
47 Ga0070660_100192229 3300005339 Bacteria 1653
48 Ga0070689_100031031 3300005340 Bacteria 4060
49 Ga0070689_100073946 3300005340 Bacteria 2666
50 Ga0070689_100174977 3300005340 Bacteria 1740
51 Ga0070687_100001102 3300005343 Bacteria 9291
52 Ga0070687_100059306 3300005343 Unclassified 2014
53 Ga0070661_100009793 3300005344 Bacteria 6645
54 Ga0070661_100013569 3300005344 Bacteria 5721
55 Ga0070661_100085471 3300005344 Bacteria 2331
56 Ga0070661_100142381 3300005344 Bacteria 1808
57 Ga0070668_100000951 3300005347 Bacteria 20217
58 Ga0070668_100023794 3300005347 Bacteria 4636
59 Ga0070668_100113597 3300005347 Bacteria 2158
60 Ga0070668_100271460 3300005347 Bacteria 1414
61 Ga0070669_100037947 3300005353 Bacteria 3496
62 Ga0070669_100053889 3300005353 Bacteria 2945
63 Ga0070669_100092951 3300005353 Bacteria 2265
64 Ga0070669_100210329 3300005353 Bacteria 1534
65 Ga0070669_100242384 3300005353 Bacteria 1433
66 Ga0070675_100008620 3300005354 Bacteria 7918
67 Ga0070675_100011460 3300005354 Bacteria 6942
68 Ga0070675_100033681 3300005354 Unclassified 4154
69 Ga0070675_100099784 3300005354 Bacteria 2445
70 Ga0070675_100116193 3300005354 Bacteria 2269
71 Ga0070675_100340387 3300005354 Bacteria 1328
72 Ga0070671_100011830 3300005355 Bacteria 7020
73 Ga0070671_100116251 3300005355 Bacteria 2249
74 Ga0070671_100380375 3300005355 Bacteria 1206
75 Ga0070674_100007915 3300005356 Bacteria 6291
76 Ga0070674_100069510 3300005356 Unclassified 2484
77 Ga0070674_100149299 3300005356 Bacteria 1762
78 Ga0070673_100002269 3300005364 Bacteria 11656
79 Ga0070673_100091941 3300005364 Bacteria 2481
80 Ga0070673_100113975 3300005364 Unclassified 2246
81 Ga0070673_100165222 3300005364 Bacteria 1885
82 Ga0070673_100315594 3300005364 Bacteria 1379
83 Ga0070688_100032273 3300005365 Unclassified 3156
84 Ga0070688_100037566 3300005365 Bacteria 2951
85 Ga0070688_100381889 3300005365 Bacteria 1038
86 Ga0070659_100025517 3300005366 Bacteria 4540
87 Ga0070659_100025984 3300005366 Bacteria 4504
88 Ga0070659_100118369 3300005366 Bacteria 2143
89 Ga0070659_100181859 3300005366 Bacteria 1726
90 Ga0070667_100005498 3300005367 Bacteria 10581
91 Ga0070667_100005708 3300005367 Bacteria 10398
92 Ga0070667_100137970 3300005367 Bacteria 2133
93 Ga0070667_100178526 3300005367 Bacteria 1877
94 Ga0070667_100205033 3300005367 Bacteria 1750
95 Ga0070667_100218193 3300005367 Unclassified 1697
96 Ga0070667_100228292 3300005367 Bacteria 1659
97 Ga0070667_100264626 3300005367 Bacteria 1540
98 Ga0070667_100320443 3300005367 Bacteria 1399
99 Ga0070708_100282992 3300005445 Bacteria 1561
100 Ga0070663_100119781 3300005455 Bacteria 1987
101 Ga0070663_100259117 3300005455 Bacteria 1379
102 Ga0070678_100095547 3300005456 Unclassified 2290
103 Ga0070662_100226440 3300005457 Bacteria 1494
104 Ga0070662_100228348 3300005457 Bacteria 1488
105 Ga0070662_100262169 3300005457 Bacteria 1392
106 Ga0070681_10073654 3300005458 Bacteria 3377
107 Ga0070681_10105715 3300005458 Bacteria 2757
108 Ga0070681_10123298 3300005458 Bacteria 2524
109 Ga0070681_10127861 3300005458 Bacteria 2474
110 Ga0070681_10257086 3300005458 Bacteria 1658
111 Ga0068867_100116337 3300005459 Unclassified 2060
112 Ga0068867_100450975 3300005459 Bacteria 1096
113 Ga0070685_10007265 3300005466 Bacteria 5664
114 Ga0070685_10033897 3300005466 Unclassified 2872
115 Ga0070685_10044525 3300005466 Bacteria 2541
116 Ga0070706_100265778 3300005467 Unclassified 1601
117 Ga0070707_100000032 3300005468 Bacteria 118776
118 Ga0070698_100001998 3300005471 Bacteria 22644
119 Ga0070698_100003211 3300005471 Bacteria 18007
120 Ga0070699_100119960 3300005518 Unclassified 2312
121 Ga0070699_100259085 3300005518 Unclassified 1555
122 Ga0070679_100002339 3300005530 Bacteria 17152
123 Ga0070679_100004116 3300005530 Bacteria 13409
124 Ga0070679_100013309 3300005530 Bacteria 7876
125 Ga0070679_100016964 3300005530 Bacteria 7039
126 Ga0070679_100024167 3300005530 Bacteria 5954
127 Ga0070679_100076615 3300005530 Bacteria 3333
128 Ga0070679_100525512 3300005530 Bacteria 1127
129 Ga0070684_100012839 3300005535 Bacteria 6729
130 Ga0070684_100411356 3300005535 Bacteria 1248
131 Ga0068853_100011024 3300005539 Bacteria 7331
132 Ga0068853_100045604 3300005539 Bacteria 3755
133 Ga0068853_100131745 3300005539 Bacteria 2239
134 Ga0068853_100216381 3300005539 Bacteria 1748
135 Ga0068853_100412894 3300005539 Bacteria 1265
136 Ga0070672_100005846 3300005543 Bacteria 8207
137 Ga0070672_100030941 3300005543 Bacteria 4026
138 Ga0070672_100047244 3300005543 Unclassified 3339
139 Ga0070672_100090118 3300005543 Bacteria 2472
140 Ga0070672_100106674 3300005543 Bacteria 2279
141 Ga0070672_100256135 3300005543 Unclassified 1475
142 Ga0070686_100004512 3300005544 Bacteria 7676
143 Ga0070686_100005546 3300005544 Bacteria 6981
144 Ga0070686_100042469 3300005544 Bacteria 2848
145 Ga0070693_100012709 3300005547 Bacteria 4268
146 Ga0070665_100051291 3300005548 Bacteria 4138
147 Ga0070665_100186816 3300005548 Unclassified 2073
148 Ga0070665_100258668 3300005548 Bacteria 1742
149 Ga0070665_100304326 3300005548 Bacteria 1597
150 Ga0070665_100523045 3300005548 Bacteria 1198
151 Ga0068855_100000014 3300005563 Bacteria 232720
152 Ga0068855_100043250 3300005563 Bacteria 5336
153 Ga0068855_100173463 3300005563 Bacteria 2441
154 Ga0068855_100213568 3300005563 Bacteria 2167
155 Ga0070664_100000492 3300005564 Bacteria 29880
156 Ga0070664_100022854 3300005564 Bacteria 5158
157 Ga0070664_100139951 3300005564 Bacteria 2130
158 Ga0070664_100195286 3300005564 Bacteria 1804
159 Ga0068857_100032403 3300005577 Bacteria 4620
160 Ga0068857_100034845 3300005577 Bacteria 4454
161 Ga0068857_100266590 3300005577 Bacteria 1573
162 Ga0068857_100286052 3300005577 Unclassified 1517
163 Ga0068857_100539105 3300005577 Unclassified 1098
164 Ga0068854_100064759 3300005578 Bacteria 2656
165 Ga0068854_100085130 3300005578 Bacteria 2341
166 Ga0068854_100127144 3300005578 Bacteria 1942
167 Ga0068854_100235901 3300005578 Bacteria 1454
168 Ga0068854_100360405 3300005578 Bacteria 1193
169 Ga0068856_100089457 3300005614 Bacteria 3062
170 Ga0068856_100395590 3300005614 Bacteria 1401
171 Ga0068852_100023253 3300005616 Bacteria 4985
172 Ga0068852_100046341 3300005616 Bacteria 3704
173 Ga0068859_100006459 3300005617 Bacteria 11893
174 Ga0068859_100017217 3300005617 Bacteria 7257
175 Ga0068859_100114918 3300005617 Bacteria 2756
176 Ga0068859_100180101 3300005617 Bacteria 2196
177 Ga0068859_100341549 3300005617 Bacteria 1591
178 Ga0068864_100000781 3300005618 Bacteria 26753
179 Ga0068864_100008888 3300005618 Bacteria 8282
180 Ga0068864_100051164 3300005618 Bacteria 3557
181 Ga0068866_10011514 3300005718 Bacteria 3829
182 Ga0068861_100029438 3300005719 Bacteria 4018
183 Ga0068861_100093705 3300005719 Unclassified 2375
184 Ga0068861_100339685 3300005719 Unclassified 1314
185 Ga0068861_100373493 3300005719 Bacteria 1257
186 Ga0068851_10016011 3300005834 Unclassified 3581
187 Ga0068851_10079402 3300005834 Unclassified 1711
188 Ga0068863_100000221 3300005841 Bacteria 60285
189 Ga0068863_100022837 3300005841 Bacteria 5977
190 Ga0068863_100126403 3300005841 Bacteria 2439
191 Ga0068863_100186873 3300005841 Unclassified 1990
192 Ga0068858_100013096 3300005842 Bacteria 7821
193 Ga0068858_100026396 3300005842 Bacteria 5398
194 Ga0068858_100082124 3300005842 Unclassified 2995
195 Ga0068860_100006424 3300005843 Bacteria 11803
196 Ga0068860_100018722 3300005843 Bacteria 6730
197 Ga0068860_100188187 3300005843 Unclassified 1997
198 Ga0068860_100302272 3300005843 Bacteria 1568
199 Ga0068860_100378000 3300005843 Bacteria 1398
200 Ga0068862_100011917 3300005844 Bacteria 7182
201 Ga0068862_100221636 3300005844 Bacteria 1712
202 Ga0068862_100288606 3300005844 Bacteria 1506
203 Ga0081455_10007011 3300005937 Bacteria 11975
204 Ga0081455_10093709 3300005937 Unclassified 2427
205 Ga0081455_10285818 3300005937 Bacteria 1189
206 Ga0081539_10004015 3300005985 Bacteria 16914
207 Ga0081539_10004448 3300005985 Bacteria 15475
208 Ga0070715_10132209 3300006163 Unclassified 1202
209 Ga0070716_100059682 3300006173 Bacteria 2200
210 Ga0097621_100000554 3300006237 Bacteria 26269
211 Ga0097621_100019149 3300006237 Bacteria 5247
212 Ga0097621_100021327 3300006237 Bacteria 5009
213 Ga0097621_100021395 3300006237 Bacteria 5002
214 Ga0097621_100021757 3300006237 Bacteria 4968
215 Ga0097621_100039645 3300006237 Bacteria 3784
216 Ga0097621_100062570 3300006237 Unclassified 3056
217 Ga0068871_100001750 3300006358 Bacteria 14634
218 Ga0068871_100002575 3300006358 Bacteria 12387
219 Ga0068871_100003879 3300006358 Bacteria 10310
220 Ga0068871_100023121 3300006358 Bacteria 4801
221 Ga0068871_100037217 3300006358 Bacteria 3880
222 Ga0068871_100069994 3300006358 Bacteria 2883
223 Ga0068871_100107602 3300006358 Bacteria 2342
224 Ga0075428_100064824 3300006844 Unclassified 4001
225 Ga0075428_100148569 3300006844 Bacteria 2547
226 Ga0075428_100151035 3300006844 Unclassified 2523
227 Ga0075430_100005824 3300006846 Bacteria 10398
228 Ga0075430_100007274 3300006846 Bacteria 9345
229 Ga0075431_100002400 3300006847 Bacteria 18025
230 Ga0075431_100095188 3300006847 Bacteria 3074
231 Ga0075431_100134669 3300006847 Bacteria 2547
232 Ga0075431_100243672 3300006847 Bacteria 1828
233 Ga0075431_100363120 3300006847 Bacteria 1454
234 Ga0075431_100431028 3300006847 Bacteria 1316
235 Ga0075433_10224420 3300006852 Bacteria 1668
236 Ga0075433_10252385 3300006852 Bacteria 1565
237 Ga0075434_100063233 3300006871 Bacteria 3684
238 Ga0075429_100050163 3300006880 Bacteria 3631
239 Ga0075429_100091904 3300006880 Bacteria 2647
240 Ga0075429_100094474 3300006880 Bacteria 2608
241 Ga0075429_100108399 3300006880 Unclassified 2427
242 Ga0068865_100056511 3300006881 Bacteria 2735
243 Ga0068865_100124073 3300006881 Bacteria 1925
244 Ga0068865_100260300 3300006881 Bacteria 1373
245 Ga0097620_100006459 3300006931 Bacteria 11893
246 Ga0097620_100017217 3300006931 Bacteria 7257
247 Ga0097620_100114917 3300006931 Bacteria 2756
248 Ga0097620_100180104 3300006931 Bacteria 2196
249 Ga0097620_100309232 3300006931 Bacteria 1674
250 Ga0097620_100341549 3300006931 Bacteria 1591
251 Ga0099794_10022038 3300007265 Bacteria 2901
252 Ga0105240_10028359 3300009093 Bacteria 7314
253 Ga0105240_10043874 3300009093 Bacteria 5686
254 Ga0105240_10064765 3300009093 Bacteria 4540
255 Ga0105240_10169230 3300009093 Unclassified 2589
256 Ga0105240_10244183 3300009093 Bacteria 2080
257 Ga0111539_10000536 3300009094 Bacteria 48260
258 Ga0111539_10031210 3300009094 Bacteria 6475
259 Ga0111539_10076633 3300009094 Bacteria 3937
260 Ga0111539_10277409 3300009094 Bacteria 1951
261 Ga0111539_10489102 3300009094 Unclassified 1433
262 Ga0111539_10675418 3300009094 Unclassified 1203
263 Ga0105245_10001786 3300009098 Bacteria 19580
264 Ga0105245_10043077 3300009098 Bacteria 4027
265 Ga0105247_10001541 3300009101 Bacteria 16441
266 Ga0114129_10014027 3300009147 Bacteria 11414
267 Ga0114129_10093237 3300009147 Bacteria 4171
268 Ga0114129_10176339 3300009147 Bacteria 2911
269 Ga0114129_10194413 3300009147 Unclassified 2752
270 Ga0114129_10381086 3300009147 Bacteria 1863
271 Ga0114129_10558725 3300009147 Bacteria 1487
272 Ga0105243_10232472 3300009148 Bacteria 1636
273 Ga0105241_10004396 3300009174 Bacteria 10420
274 Ga0105241_10166884 3300009174 Bacteria 1815
275 Ga0105242_10003021 3300009176 Bacteria 13152
276 Ga0105242_10006100 3300009176 Bacteria 9291
277 Ga0105242_10022569 3300009176 Bacteria 4952
278 Ga0105242_10069023 3300009176 Unclassified 2927
279 Ga0105242_10098613 3300009176 Bacteria 2471
280 Ga0105248_10000048 3300009177 Bacteria 154635
281 Ga0105248_10015185 3300009177 Bacteria 8486
282 Ga0105248_10057845 3300009177 Bacteria 4353
283 Ga0105248_10185968 3300009177 Bacteria 2341
284 Ga0105248_10442529 3300009177 Bacteria 1464
285 Ga0105248_10448313 3300009177 Bacteria 1454
286 Ga0105237_10009302 3300009545 Bacteria 10530
287 Ga0105237_10093453 3300009545 Unclassified 2997
288 Ga0105238_10459933 3300009551 Bacteria 1270
289 Ga0105249_10013169 3300009553 Bacteria 7297
290 Ga0105249_10021095 3300009553 Bacteria 5830
291 Ga0105249_10058553 3300009553 Bacteria 3531
292 Ga0105249_10060141 3300009553 Unclassified 3485
293 Ga0105239_10012617 3300010375 Bacteria 9403
294 Ga0105239_10205151 3300010375 Bacteria 2209
295 Ga0105246_10042738 3300011119 Bacteria 3070
296 Ga0157373_10007196 3300013100 Bacteria 8299
297 Ga0157373_10025876 3300013100 Bacteria 4240
298 Ga0157373_10217816 3300013100 Bacteria 1347
299 Ga0157373_10341215 3300013100 Bacteria 1068
300 Ga0157371_10015347 3300013102 Bacteria 5749
301 Ga0157371_10030981 3300013102 Bacteria 3855
302 Ga0157371_10079361 3300013102 Bacteria 2325
303 Ga0157371_10185743 3300013102 Bacteria 1487
304 Ga0157370_10005480 3300013104 Bacteria 14234
305 Ga0157370_10011127 3300013104 Bacteria 9432
306 Ga0157370_10013214 3300013104 Bacteria 8513
307 Ga0157370_10029120 3300013104 Bacteria 5425
308 Ga0157370_10102080 3300013104 Bacteria 2686
309 Ga0157370_10121961 3300013104 Bacteria 2434
310 Ga0157370_10248094 3300013104 Bacteria 1647
311 Ga0157370_10509787 3300013104 Bacteria 1104
312 Ga0157369_10186487 3300013105 Bacteria 2181
313 Ga0157369_10305621 3300013105 Bacteria 1654
314 Ga0157374_10005430 3300013296 Bacteria 10708
315 Ga0157374_10022899 3300013296 Bacteria 5579
316 Ga0157374_10024433 3300013296 Bacteria 5419
317 Ga0157374_10053519 3300013296 Bacteria 3763
318 Ga0157374_10136846 3300013296 Bacteria 2375
319 Ga0157374_10161837 3300013296 Bacteria 2180
320 Ga0157374_10162036 3300013296 Unclassified 2178
321 Ga0157374_10196769 3300013296 Bacteria 1973
322 Ga0157374_10208221 3300013296 Bacteria 1917
323 Ga0157378_10000437 3300013297 Bacteria 40470
324 Ga0157378_10001754 3300013297 Bacteria 19460
325 Ga0157378_10002581 3300013297 Bacteria 16118
326 Ga0157378_10003439 3300013297 Bacteria 14041
327 Ga0157378_10087958 3300013297 Bacteria 2819
328 Ga0157378_10091891 3300013297 Bacteria 2760
329 Ga0157378_10284743 3300013297 Unclassified 1594
330 Ga0163162_10000523 3300013306 Bacteria 35637
331 Ga0163162_10005980 3300013306 Bacteria 11778
332 Ga0163162_10124903 3300013306 Unclassified 2679
333 Ga0163162_10286741 3300013306 Bacteria 1778
334 Ga0163162_10635131 3300013306 Bacteria 1192
335 Ga0157372_10015460 3300013307 Bacteria 8181
336 Ga0157372_10055142 3300013307 Bacteria 4437
337 Ga0157372_10067718 3300013307 Bacteria 4013
338 Ga0157372_10192125 3300013307 Bacteria 2364
339 Ga0157372_10334192 3300013307 Bacteria 1765
340 Ga0157372_10479819 3300013307 Bacteria 1450
341 Ga0157372_10651318 3300013307 Unclassified 1227
342 Ga0157375_10000262 3300013308 Bacteria 47771
343 Ga0157375_10001301 3300013308 Bacteria 21494
344 Ga0157375_10035272 3300013308 Bacteria 4773
345 Ga0157375_10122921 3300013308 Bacteria 2707
346 Ga0157375_10260729 3300013308 Bacteria 1895
347 Ga0157375_10310801 3300013308 Bacteria 1740
348 Ga0157375_10392539 3300013308 Bacteria 1554
349 Ga0157375_10438695 3300013308 Unclassified 1472
350 Ga0157375_10640445 3300013308 Bacteria 1220
351 Ga0163163_10001342 3300014325 Bacteria 20762
352 Ga0163163_10008192 3300014325 Bacteria 9270
353 Ga0163163_10008479 3300014325 Bacteria 9135
354 Ga0163163_10108304 3300014325 Bacteria 2806
355 Ga0163163_10116640 3300014325 Bacteria 2701
356 Ga0163163_10232956 3300014325 Bacteria 1891
357 Ga0163163_10378901 3300014325 Unclassified 1472
358 Ga0163163_10435545 3300014325 Bacteria 1370
359 Ga0157380_10010459 3300014326 Bacteria 6675
360 Ga0157380_10035103 3300014326 Bacteria 3872
361 Ga0157380_10050034 3300014326 Unclassified 3299
362 Ga0157380_10127011 3300014326 Bacteria 2169
363 Ga0157380_10205732 3300014326 Bacteria 1750
364 Ga0157380_10247718 3300014326 Unclassified 1611
365 Ga0157380_10426794 3300014326 Bacteria 1266
366 Ga0157377_10016681 3300014745 Unclassified 3782
367 Ga0157377_10030983 3300014745 Bacteria 2903
368 Ga0157377_10083580 3300014745 Bacteria 1871
369 Ga0157379_10000264 3300014968 Bacteria 41186
370 Ga0157379_10135713 3300014968 Unclassified 2217
371 Ga0157379_10167729 3300014968 Unclassified 1982
372 Ga0157379_10263715 3300014968 Unclassified 1566
373 Ga0157379_10268109 3300014968 Bacteria 1552
374 Ga0157376_10041099 3300014969 Unclassified 3784
375 Ga0157376_10056318 3300014969 Bacteria 3284
376 Ga0157376_10081417 3300014969 Unclassified 2780
377 Ga0157376_10101092 3300014969 Bacteria 2519
378 Ga0157376_10207736 3300014969 Bacteria 1806
379 Ga0163161_10018613 3300017792 Bacteria 4868
380 Ga0163161_10030173 3300017792 Unclassified 3856
381 Ga0163161_10083804 3300017792 Bacteria 2350
382 Ga0213872_10047235 3300021361 Unclassified 1958
383 Ga0213871_10004166 3300021441 Unclassified 2869
384 Ga0207697_10086919 3300025315 Bacteria 1322
385 Ga0207656_10000483 3300025321 Bacteria 13166
386 Ga0207688_10252598 3300025901 Unclassified 1068
387 Ga0207680_10001546 3300025903 Bacteria 10833
388 Ga0207680_10011290 3300025903 Bacteria 4509
389 Ga0207680_10026291 3300025903 Bacteria 3225
390 Ga0207680_10130427 3300025903 Bacteria 1656
391 Ga0207647_10010393 3300025904 Bacteria 6574
392 Ga0207647_10135566 3300025904 Unclassified 1445
393 Ga0207645_10018735 3300025907 Bacteria 4547
394 Ga0207645_10029340 3300025907 Bacteria 3547
395 Ga0207643_10017411 3300025908 Bacteria 3929
396 Ga0207705_10000623 3300025909 Bacteria 29594
397 Ga0207705_10072838 3300025909 Bacteria 2492
398 Ga0207684_10157635 3300025910 Bacteria 1954
399 Ga0207654_10028106 3300025911 Bacteria 3064
400 Ga0207654_10172482 3300025911 Bacteria 1405
401 Ga0207707_10019903 3300025912 Bacteria 5858
402 Ga0207707_10096788 3300025912 Bacteria 2579
403 Ga0207695_10005932 3300025913 Bacteria 16010
404 Ga0207695_10029463 3300025913 Bacteria 6064
405 Ga0207695_10034212 3300025913 Bacteria 5531
406 Ga0207695_10134545 3300025913 Unclassified 2426
407 Ga0207660_10033757 3300025917 Bacteria 3542
408 Ga0207660_10067556 3300025917 Bacteria 2590
409 Ga0207660_10071945 3300025917 Bacteria 2517
410 Ga0207660_10387918 3300025917 Bacteria 1123
411 Ga0207662_10002985 3300025918 Bacteria 8615
412 Ga0207662_10058259 3300025918 Unclassified 2312
413 Ga0207657_10010235 3300025919 Bacteria 9367
414 Ga0207657_10025421 3300025919 Bacteria 5462
415 Ga0207657_10119828 3300025919 Bacteria 2165
416 Ga0207649_10002503 3300025920 Bacteria 10263
417 Ga0207649_10025152 3300025920 Bacteria 3468
418 Ga0207649_10233776 3300025920 Bacteria 1316
419 Ga0207652_10002089 3300025921 Bacteria 17168
420 Ga0207652_10005426 3300025921 Bacteria 10345
421 Ga0207652_10021177 3300025921 Bacteria 5365
422 Ga0207652_10121649 3300025921 Bacteria 2323
423 Ga0207652_10170678 3300025921 Bacteria 1952
424 Ga0207652_10349652 3300025921 Bacteria 1334
425 Ga0207646_10000032 3300025922 Bacteria 216397
426 Ga0207646_10524475 3300025922 Bacteria 1066
427 Ga0207681_10108322 3300025923 Unclassified 2016
428 Ga0207681_10322777 3300025923 Bacteria 1228
429 Ga0207650_10000510 3300025925 Bacteria 32441
430 Ga0207650_10031978 3300025925 Bacteria 3805
431 Ga0207650_10067621 3300025925 Bacteria 2681
432 Ga0207650_10085894 3300025925 Bacteria 2394
433 Ga0207650_10090549 3300025925 Bacteria 2336
434 Ga0207650_10102126 3300025925 Unclassified 2209
435 Ga0207650_10115851 3300025925 Bacteria 2080
436 Ga0207650_10148330 3300025925 Bacteria 1849
437 Ga0207650_10177790 3300025925 Bacteria 1695
438 Ga0207650_10268623 3300025925 Bacteria 1386
439 Ga0207659_10000173 3300025926 Bacteria 38585
440 Ga0207659_10002371 3300025926 Bacteria 11213
441 Ga0207659_10020599 3300025926 Bacteria 4362
442 Ga0207659_10029299 3300025926 Unclassified 3751
443 Ga0207659_10286541 3300025926 Unclassified 1348
444 Ga0207644_10002882 3300025931 Bacteria 11083
445 Ga0207644_10015078 3300025931 Bacteria 5185
446 Ga0207690_10073407 3300025932 Bacteria 2366
447 Ga0207690_10147506 3300025932 Bacteria 1741
448 Ga0207690_10209824 3300025932 Bacteria 1484
449 Ga0207690_10263057 3300025932 Unclassified 1337
450 Ga0207690_10425887 3300025932 Bacteria 1063
451 Ga0207706_10052994 3300025933 Bacteria 3581
452 Ga0207706_10077398 3300025933 Bacteria 2925
453 Ga0207706_10112705 3300025933 Bacteria 2393
454 Ga0207686_10000884 3300025934 Bacteria 18109
455 Ga0207686_10171732 3300025934 Unclassified 1529
456 Ga0207670_10004333 3300025936 Bacteria 7624
457 Ga0207670_10029226 3300025936 Bacteria 3509
458 Ga0207670_10120701 3300025936 Bacteria 1905
459 Ga0207670_10351037 3300025936 Bacteria 1168
460 Ga0207704_10015131 3300025938 Bacteria 3922
461 Ga0207704_10091665 3300025938 Bacteria 1998
462 Ga0207691_10019398 3300025940 Bacteria 6435
463 Ga0207691_10019513 3300025940 Bacteria 6415
464 Ga0207691_10028488 3300025940 Bacteria 5231
465 Ga0207691_10121889 3300025940 Bacteria 2310
466 Ga0207691_10197390 3300025940 Bacteria 1752
467 Ga0207711_10000648 3300025941 Bacteria 34717
468 Ga0207711_10267390 3300025941 Bacteria 1573
469 Ga0207711_10305515 3300025941 Bacteria 1468
470 Ga0207689_10002805 3300025942 Bacteria 16095
471 Ga0207689_10040689 3300025942 Bacteria 3846
472 Ga0207689_10088810 3300025942 Unclassified 2539
473 Ga0207689_10244290 3300025942 Bacteria 1484
474 Ga0207661_10001069 3300025944 Bacteria 18229
475 Ga0207661_10036520 3300025944 Bacteria 3836
476 Ga0207661_10120313 3300025944 Bacteria 2234
477 Ga0207661_10244550 3300025944 Bacteria 1593
478 Ga0207679_10013567 3300025945 Bacteria 5340
479 Ga0207679_10021225 3300025945 Bacteria 4398
480 Ga0207679_10036606 3300025945 Bacteria 3481
481 Ga0207679_10320840 3300025945 Unclassified 1341
482 Ga0207667_10000049 3300025949 Bacteria 235027
483 Ga0207667_10019413 3300025949 Bacteria 7590
484 Ga0207667_10081514 3300025949 Bacteria 3352
485 Ga0207667_10198753 3300025949 Bacteria 2057
486 Ga0207667_10213407 3300025949 Bacteria 1978
487 Ga0207667_10253002 3300025949 Unclassified 1802
488 Ga0207651_10022287 3300025960 Bacteria 3869
489 Ga0207651_10040387 3300025960 Bacteria 3086
490 Ga0207651_10148977 3300025960 Unclassified 1819
491 Ga0207651_10294905 3300025960 Unclassified 1346
492 Ga0207712_10002170 3300025961 Bacteria 12828
493 Ga0207712_10013251 3300025961 Bacteria 5285
494 Ga0207668_10000663 3300025972 Bacteria 21145
495 Ga0207668_10032610 3300025972 Bacteria 3444
496 Ga0207668_10083168 3300025972 Unclassified 2328
497 Ga0207640_10012544 3300025981 Bacteria 4831
498 Ga0207640_10058766 3300025981 Bacteria 2535
499 Ga0207640_10069819 3300025981 Bacteria 2360
500 Ga0207640_10187764 3300025981 Bacteria 1555
501 Ga0207658_10010785 3300025986 Bacteria 6217
502 Ga0207658_10056336 3300025986 Bacteria 2917
503 Ga0207658_10132733 3300025986 Bacteria 2003
504 Ga0207658_10153660 3300025986 Bacteria 1878
505 Ga0207658_10195617 3300025986 Bacteria 1684
506 Ga0207658_10257330 3300025986 Unclassified 1486
507 Ga0207677_10028007 3300026023 Bacteria 3558
508 Ga0207677_10038103 3300026023 Bacteria 3148
509 Ga0207703_10013004 3300026035 Bacteria 6485
510 Ga0207703_10019904 3300026035 Bacteria 5246
511 Ga0207639_10005388 3300026041 Bacteria 8651
512 Ga0207639_10007679 3300026041 Bacteria 7362
513 Ga0207639_10086260 3300026041 Bacteria 2499
514 Ga0207639_10091546 3300026041 Bacteria 2435
515 Ga0207639_10093975 3300026041 Bacteria 2406
516 Ga0207639_10257563 3300026041 Bacteria 1524
517 Ga0207678_10170339 3300026067 Unclassified 1859
518 Ga0207708_10096778 3300026075 Bacteria 2281
519 Ga0207702_10051789 3300026078 Bacteria 3471
520 Ga0207641_10000561 3300026088 Bacteria 41567
521 Ga0207641_10001235 3300026088 Bacteria 25590
522 Ga0207641_10015720 3300026088 Bacteria 6201
523 Ga0207641_10035180 3300026088 Bacteria 4171
524 Ga0207641_10161340 3300026088 Bacteria 2038
525 Ga0207648_10002623 3300026089 Bacteria 19251
526 Ga0207648_10303428 3300026089 Bacteria 1432
527 Ga0207676_10026191 3300026095 Bacteria 4335
528 Ga0207676_10049325 3300026095 Bacteria 3274
529 Ga0207676_10082344 3300026095 Bacteria 2617
530 Ga0207676_10379983 3300026095 Unclassified 1315
531 Ga0207674_10033423 3300026116 Bacteria 5385
532 Ga0207674_10061864 3300026116 Bacteria 3782
533 Ga0207674_10212617 3300026116 Bacteria 1883
534 Ga0207674_10529904 3300026116 Unclassified 1138
535 Ga0207675_100049100 3300026118 Bacteria 3939
536 Ga0207675_100077458 3300026118 Bacteria 3115
537 Ga0207675_100429753 3300026118 Bacteria 1305
538 Ga0207683_10020712 3300026121 Bacteria 5627
539 Ga0207683_10124392 3300026121 Bacteria 2317
540 Ga0207683_10287154 3300026121 Unclassified 1504
541 Ga0207698_10018072 3300026142 Bacteria 4797
542 Ga0207698_10052775 3300026142 Bacteria 3117
543 Ga0207698_10327836 3300026142 Bacteria 1437
544 Ga0209974_10005581 3300027876 Bacteria 4420
545 Ga0207428_10000031 3300027907 Bacteria 235245
546 Ga0268266_10191970 3300028379 Bacteria 1865
547 Ga0268266_10209886 3300028379 Unclassified 1785
548 Ga0268266_10269806 3300028379 Bacteria 1579
549 Ga0268266_10280572 3300028379 Bacteria 1549
550 Ga0268266_10476697 3300028379 Bacteria 1189
551 Ga0268265_10062858 3300028380 Bacteria 2854
552 Ga0268265_10097521 3300028380 Bacteria 2365
553 Ga0268265_10219681 3300028380 Unclassified 1662
554 Ga0268264_10007005 3300028381 Bacteria 9459
555 Ga0268264_10030284 3300028381 Bacteria 4436
556 Ga0268264_10059906 3300028381 Bacteria 3191
557 Ga0268264_10316568 3300028381 Bacteria 1474
558 Ga0268264_10454451 3300028381 Bacteria 1242
559 Ga0265337_1001644 3300028556 Bacteria 10866
560 Ga0265326_10013130 3300028558 Bacteria 2426
561 Ga0265318_10000195 3300028577 Bacteria 53122
562 Ga0265323_10005862 3300028653 Bacteria 5194
563 Ga0265322_10001230 3300028654 Bacteria 8712
564 Ga0307515_10000092 3300028794 Bacteria 212425
565 Ga0265338_10077849 3300028800 Bacteria 2800
566 Ga0265338_10169127 3300028800 Bacteria 1679
567 Ga0265330_10009657 3300031235 Unclassified 4575
568 Ga0265332_10036575 3300031238 Bacteria 2131
569 Ga0265320_10000070 3300031240 Bacteria 90235
570 Ga0265325_10005122 3300031241 Bacteria 8153
571 Ga0265325_10033045 3300031241 Bacteria 2759
572 Ga0265325_10135437 3300031241 Bacteria 1176
573 Ga0265329_10000929 3300031242 Bacteria 14720
574 Ga0265340_10000108 3300031247 Bacteria 40680
575 Ga0265340_10003007 3300031247 Bacteria 9597
576 Ga0265339_10034529 3300031249 Bacteria 2841
577 Ga0265339_10087891 3300031249 Bacteria 1633
578 Ga0265331_10003091 3300031250 Bacteria 10913
579 Ga0265316_10006923 3300031344 Bacteria 10753
580 Ga0265316_10080444 3300031344 Unclassified 2499
581 Ga0265316_10100115 3300031344 Bacteria 2203
582 Ga0307513_10125887 3300031456 Bacteria 2518
583 Ga0307509_10107579 3300031507 Bacteria 2804
584 Ga0307408_100040397 3300031548 Bacteria 3303
585 Ga0307408_100040579 3300031548 Bacteria 3296
586 Ga0265313_10001878 3300031595 Bacteria 19092
587 Ga0265313_10039862 3300031595 Bacteria 2327
588 Ga0316575_10001544 3300031665 Bacteria 7459
589 Ga0316575_10002566 3300031665 Bacteria 6107
590 Ga0316575_10012027 3300031665 Bacteria 3212
591 Ga0316575_10052820 3300031665 Bacteria 1618
592 Ga0316579_10057577 3300031691 Bacteria 1826
593 Ga0316579_10073899 3300031691 Bacteria 1618
594 Ga0265314_10000104 3300031711 Bacteria 127566
595 Ga0265314_10050435 3300031711 Bacteria 2907
596 Ga0265314_10054940 3300031711 Bacteria 2752
597 Ga0265342_10000433 3300031712 Bacteria 45864
598 Ga0265342_10001030 3300031712 Bacteria 27382
599 Ga0316576_10003610 3300031727 Bacteria 9123
600 Ga0316576_10006995 3300031727 Bacteria 7059
601 Ga0316576_10008823 3300031727 Bacteria 6465
602 Ga0316576_10048941 3300031727 Bacteria 3068
603 Ga0316576_10052550 3300031727 Bacteria 2967
604 Ga0316576_10127808 3300031727 Bacteria 1911
605 Ga0316576_10198194 3300031727 Bacteria 1513
606 Ga0316578_10002870 3300031728 Bacteria 7704
607 Ga0316578_10003237 3300031728 Bacteria 7393
608 Ga0316578_10007341 3300031728 Bacteria 5519
609 Ga0316578_10161863 3300031728 Bacteria 1349
610 Ga0316578_10172301 3300031728 Bacteria 1304
611 Ga0307405_10050942 3300031731 Bacteria 2567
612 Ga0316577_10021897 3300031733 Unclassified 3547
613 Ga0316577_10074270 3300031733 Bacteria 1898
614 Ga0307410_10013477 3300031852 Bacteria 4771
615 Ga0307410_10017356 3300031852 Bacteria 4321
616 Ga0307410_10040082 3300031852 Bacteria 3080
617 Ga0307410_10123549 3300031852 Bacteria 1891
618 Ga0307410_10299823 3300031852 Bacteria 1268
619 Ga0307407_10045299 3300031903 Bacteria 2485
620 Ga0307412_10232205 3300031911 Bacteria 1421
621 Ga0307409_100085900 3300031995 Bacteria 2559
622 Ga0307409_100306417 3300031995 Bacteria 1480
623 Ga0307416_100027174 3300032002 Bacteria 4233
624 Ga0307416_100056409 3300032002 Bacteria 3170
625 Ga0307416_100135889 3300032002 Bacteria 2224
626 Ga0307414_10367887 3300032004 Bacteria 1239
627 Ga0307411_10038303 3300032005 Unclassified 3023
628 Ga0307411_10042060 3300032005 Bacteria 2912
629 Ga0307411_10189530 3300032005 Unclassified 1569
630 Ga0307411_10235310 3300032005 Bacteria 1430
631 Ga0307411_10308563 3300032005 Bacteria 1272
632 Ga0307415_100030729 3300032126 Bacteria 3452
633 Ga0307415_100240574 3300032126 Bacteria 1464
634 Ga0316583_10003577 3300032133 Bacteria 5488
635 Ga0316583_10004947 3300032133 Bacteria 4760
636 Ga0316583_10008550 3300032133 Bacteria 3692
637 Ga0316583_10021390 3300032133 Bacteria 2318
638 Ga0316583_10026515 3300032133 Bacteria 2068
639 Ga0316583_10035788 3300032133 Bacteria 1762
640 Ga0316583_10040292 3300032133 Bacteria 1654
641 Ga0316583_10048860 3300032133 Bacteria 1489
642 Ga0316585_10008588 3300032137 Unclassified 2967
643 Ga0316585_10052164 3300032137 Bacteria 1314
644 Ga0316580_10000900 3300032139 Bacteria 7356
645 Ga0316580_10001815 3300032139 Bacteria 5722
646 Ga0316580_10056442 3300032139 Bacteria 1207
647 Ga0316592_1006636 3300033524 Bacteria 2236
648 Ga0316588_1040045 3300033528 Bacteria 1118
649 Ga0373953_0095547 3300035117 Bacteria 1247
650 Ga0373953_0148845 3300035117 Archaea 1003
651 Ga0373955_0073320 3300035172 Unclassified 1919
652 Ga0316574_0012270 3300035398 Bacteria 4900
653 Ga0316574_0014180 3300035398 Bacteria 4597
654 Ga0316574_0027730 3300035398 Bacteria 3412
655 Ga0373947_0251800 3300035725 Bacteria 1168
656 Ga0373937_0012246 3300036401 Bacteria 7536
657 Ga0373937_0043557 3300036401 Unclassified 4098
658 Ga0373937_0135290 3300036401 Bacteria 2304
659 Ga0373937_0436749 3300036401 Bacteria 1243
660 Ga0316582_0016664 3300036647 Bacteria 4231
661 Ga0316582_0055855 3300036647 Bacteria 2518
662 Ga0316584_0004299 3300036712 Bacteria 9415
663 Ga0316584_0004621 3300036712 Bacteria 9123
664 Ga0316584_0004631 3300036712 Bacteria 9112
665 Ga0373925_0497364 3300037068 Bacteria 1001
666 Ga0395899_0017367 3300037312 Bacteria 5481
667 Ga0395900_0018883 3300037418 Bacteria 7032
668 Ga0395900_0027156 3300037418 Bacteria 5861
669 Ga0395900_0124498 3300037418 Bacteria 2644
670 Ga0395898_0001959 3300037466 Bacteria 26028
671 Ga0395898_0085750 3300037466 Bacteria 3036
672 Ga0395898_0154787 3300037466 Bacteria 2193
673 Ga0395905_0012005 3300037471 Bacteria 8354
674 Ga0316581_0027607 3300037588 Bacteria 1697
675 Ga0316581_0034851 3300037588 Bacteria 1524
676 Ga0395901_0001045 3300038443 Bacteria 29867
677 Ga0395901_0009760 3300038443 Bacteria 9734
678 Ga0395901_0015422 3300038443 Bacteria 7781
679 Ga0436365_0336651 3300039437 Bacteria 1798
680 Ga0436360_0105708 3300039438 Bacteria 7936
681 Ga0436361_0740991 3300039447 Bacteria 8130
682 Ga0436362_0346855 3300039453 Bacteria 4746
683 Ga0439449_0040168 3300042007 Bacteria 1739
684 Ga0439435_0049817 3300042436 Unclassified 1196
685 Ga0451577_0003018 3300042876 Bacteria 19168
686 Ga0451577_0016447 3300042876 Bacteria 6852
687 Ga0451577_0102493 3300042876 Unclassified 2558
688 Ga0451577_0123283 3300042876 Bacteria 2321
689 Ga0451577_0147235 3300042876 Bacteria 2118
690 Ga0451577_0247500 3300042876 Bacteria 1613
691 Ga0466972_0000009 3300044658 Bacteria 256374
692 Ga0453683_0049204 3300044673 Bacteria 2643
693 Ga0453683_0204881 3300044673 Bacteria 1252
694 Ga0453684_0000220 3300044712 Bacteria 249922
695 Ga0453684_0029795 3300044712 Bacteria 7733
696 Ga0453684_0120717 3300044712 Bacteria 3165
697 Ga0453684_0153749 3300044712 Bacteria 2730
698 Ga0453684_0187841 3300044712 Bacteria 2420
699 Ga0453684_0349268 3300044712 Bacteria 1668
700 Ga0453684_0464060 3300044712 Bacteria 1407
701 Ga0453684_0481969 3300044712 Bacteria 1376
702 Ga0453684_0518598 3300044712 Bacteria 1317
703 Ga0466957_0033462 3300044842 Bacteria 3084
704 Ga0451576_0030100 3300045051 Bacteria 5805
705 Ga0451576_0031338 3300045051 Bacteria 5670
706 Ga0451576_0255094 3300045051 Bacteria 1833
707 Ga0495592_0054446 3300046454 Bacteria 2964
708 Ga0495629_0105738 3300046459 Bacteria 1963
709 Ga0495629_0145201 3300046459 Unclassified 1650
710 Ga0495629_0193814 3300046459 Unclassified 1406
711 Ga0495651_0000090 3300046462 Bacteria 66511
712 Ga0495651_0139011 3300046462 Bacteria 1764
713 Ga0495580_0163858 3300046472 Bacteria 1538
714 Ga0495662_0009490 3300046476 Unclassified 4773
715 Ga0495664_0187534 3300046477 Bacteria 1254
716 Ga0495585_0000525 3300046492 Bacteria 36200
717 Ga0495618_0038745 3300046514 Bacteria 2997
718 Ga0495618_0170044 3300046514 Unclassified 1387
719 Ga0495630_0012249 3300046517 Bacteria 6221
720 Ga0495630_0361005 3300046517 Bacteria 1112
721 Ga0495643_0009334 3300046522 Bacteria 6104
722 Ga0495640_0081835 3300046533 Unclassified 2146
723 Ga0495640_0163101 3300046533 Bacteria 1427
724 Ga0495587_0034140 3300046536 Bacteria 3069
725 Ga0495587_0054565 3300046536 Bacteria 2355
726 Ga0495587_0094614 3300046536 Bacteria 1725
727 Ga0495598_0007722 3300046537 Bacteria 2479
728 Ga0495645_0020717 3300046543 Bacteria 4748
729 Ga0495667_0005808 3300046559 Bacteria 8363
730 Ga0495667_0030382 3300046559 Unclassified 3630
731 Ga0495656_0001607 3300046615 Bacteria 7396
732 Ga0495656_0118129 3300046615 Bacteria 1248
733 Ga0495634_0038710 3300046642 Bacteria 3250
734 Ga0495635_0014765 3300046663 Bacteria 5464
735 Ga0495657_0002664 3300046675 Bacteria 14920
736 Ga0495657_0220443 3300046675 Bacteria 1150
737 Ga0495599_0119314 3300046678 Bacteria 1640
738 Ga0495599_0189701 3300046678 Bacteria 1265
739 Ga0495658_0015758 3300046683 Bacteria 3882
740 Ga0495658_0094565 3300046683 Unclassified 1775
741 Ga0495658_0138528 3300046683 Bacteria 1487
742 Ga0495669_0006927 3300046684 Bacteria 4748
743 Ga0495613_0043195 3300046689 Unclassified 3334
744 Ga0495670_0124712 3300046691 Bacteria 1340
745 Ga0495670_0125443 3300046691 Bacteria 1336
746 Ga0495670_0159165 3300046691 Bacteria 1186
747 Ga0495600_0027708 3300046809 Bacteria 3662
748 Ga0495600_0122883 3300046809 Bacteria 1688
749 Ga0495581_0079809 3300047315 Unclassified 1894
750 Ga0495604_0006369 3300047317 Bacteria 9362
751 Ga0495604_0111219 3300047317 Bacteria 1997
752 Ga0495604_0220447 3300047317 Unclassified 1306
753 Ga0495636_0000016 3300047318 Bacteria 78995
754 Ga0495674_0061772 3300047319 Bacteria 3264
755 Ga0495674_0168095 3300047319 Unclassified 1831
756 Ga0495680_0001014 3300047322 Bacteria 31192
757 Ga0495680_0047511 3300047322 Bacteria 3376
758 Ga0495675_0021392 3300047444 Bacteria 4118
759 Ga0495675_0051785 3300047444 Unclassified 2607
760 Ga0495684_0057463 3300047471 Bacteria 2965
761 Ga0495684_0158850 3300047471 Unclassified 1687
762 Ga0495602_0092839 3300048088 Bacteria 2499
763 Ga0495602_0199484 3300048088 Bacteria 1528
764 Ga0496101_0201633 3300048904 Bacteria 1538
765 Ga0496102_0065747 3300048905 Bacteria 3324
766 Ga0496104_0088030 3300048907 Bacteria 2966
767 Ga0496105_0087649 3300048908 Bacteria 2572
768 Ga0496106_0061170 3300048909 Bacteria 2856
769 Ga0496107_0029175 3300048910 Bacteria 3924
770 Ga0496108_0057265 3300048911 Bacteria 3275
771 Ga0496108_0143849 3300048911 Bacteria 2055
772 Ga0496108_0161989 3300048911 Bacteria 1934
773 Ga0496109_0130602 3300048912 Bacteria 2344
774 Ga0496109_0476539 3300048912 Bacteria 1178
775 Ga0496112_0117533 3300048915 Bacteria 2629
776 Ga0496112_0702373 3300048915 Bacteria 939
777 Ga0496114_0058821 3300048917 Bacteria 3209
778 Ga0496114_0135287 3300048917 Bacteria 2131
779 Ga0501032_0128267 3300049569 Unclassified 1674
780 Ga0501033_0045063 3300049570 Unclassified 3283
781 Ga0501033_0226804 3300049570 Bacteria 1328
782 Ga0501034_0010869 3300049571 Bacteria 9455
783 Ga0501034_0011076 3300049571 Bacteria 9366
784 Ga0501036_0006252 3300049572 Bacteria 9659
785 Ga0501036_0115614 3300049572 Unclassified 2266
786 Ga0501037_0014266 3300049573 Bacteria 5855
787 Ga0501037_0038256 3300049573 Bacteria 3535
788 Ga0501038_0069442 3300049574 Bacteria 2993
789 Ga0501038_0090020 3300049574 Bacteria 2573
790 Ga0501038_0112482 3300049574 Unclassified 2254
791 Ga0501038_0116511 3300049574 Bacteria 2208
792 Ga0501038_0247264 3300049574 Bacteria 1414
793 Ga0501039_0016664 3300049575 Bacteria 5629
794 Ga0501039_0022435 3300049575 Unclassified 4846
795 Ga0501039_0084494 3300049575 Bacteria 2472
796 Ga0501040_0001939 3300049576 Bacteria 13306
797 Ga0501040_0028138 3300049576 Bacteria 3788
798 Ga0501042_0014495 3300049578 Bacteria 5383
799 Ga0501042_0095252 3300049578 Bacteria 2138
800 Ga0501043_0150986 3300049579 Bacteria 1818
801 Ga0501043_0166570 3300049579 Unclassified 1721
802 Ga0501046_0018198 3300049580 Bacteria 5851
803 Ga0501046_0062127 3300049580 Bacteria 2919
804 Ga0501046_0158663 3300049580 Unclassified 1702
805 Ga0501047_0034670 3300049581 Unclassified 4873
806 Ga0501047_0137193 3300049581 Bacteria 2326
807 Ga0501048_0009500 3300049582 Bacteria 7300
808 Ga0501048_0046381 3300049582 Bacteria 3102
809 Ga0501048_0210136 3300049582 Bacteria 1380
810 Ga0501067_0000249 3300049583 Bacteria 29614
811 Ga0501067_0043941 3300049583 Bacteria 2482
812 Ga0501068_0270012 3300049584 Unclassified 1086
813 Ga0501070_0209990 3300049586 Bacteria 1598
814 Ga0501072_0022119 3300049588 Bacteria 4932
815 Ga0501073_0031033 3300049589 Bacteria 3814
816 Ga0501074_0059882 3300049590 Bacteria 2743
817 Ga0501074_0095165 3300049590 Bacteria 2133
818 Ga0501075_0008564 3300049591 Bacteria 7131
819 Ga0501075_0093423 3300049591 Bacteria 2283
820 Ga0501075_0430622 3300049591 Bacteria 1006
821 Ga0501076_0008547 3300049592 Bacteria 7507
822 Ga0501076_0033519 3300049592 Bacteria 4010
823 Ga0501076_0181864 3300049592 Bacteria 1714
824 Ga0501076_0301692 3300049592 Bacteria 1313
825 Ga0501076_0305508 3300049592 Bacteria 1304
826 Ga0501076_0441263 3300049592 Unclassified 1071
827 Ga0501077_0009906 3300049593 Bacteria 5931
828 Ga0501198_012893 3300049649 Unclassified 1260
829 Ga0501202_029143 3300049652 Unclassified 1143
830 Ga0501217_000055 3300049661 Bacteria 13339
831 Ga0501222_004506 3300049662 Unclassified 1892
832 Ga0501223_001899 3300049663 Unclassified 4708
833 Ga0501233_004326 3300049668 Unclassified 2597
834 Ga0501243_000975 3300049675 Unclassified 4027
835 Ga0501259_001374 3300049688 Unclassified 4071
836 Ga0501221_000337 3300049704 Bacteria 7125
837 Ga0501225_0001107 3300049705 Bacteria 8457
838 Ga0501225_0001987 3300049705 Bacteria 6389
839 Ga0501245_000875 3300049708 Unclassified 3811
840 Ga0501079_0010716 3300049741 Bacteria 6981
841 Ga0501079_0060330 3300049741 Bacteria 2926
842 Ga0501079_0146628 3300049741 Bacteria 1839
843 Ga0501079_0158162 3300049741 Bacteria 1766
844 Ga0501079_0188864 3300049741 Bacteria 1608
845 Ga0501080_0004871 3300049742 Bacteria 11965
846 Ga0501080_0014784 3300049742 Bacteria 7189
847 Ga0501080_0064218 3300049742 Bacteria 3415
848 Ga0501080_0395661 3300049742 Bacteria 1243
849 Ga0501081_0007334 3300049743 Bacteria 7157
850 Ga0501081_0012374 3300049743 Bacteria 5605
851 Ga0501081_0135937 3300049743 Bacteria 1759
852 Ga0501083_0006560 3300049744 Bacteria 8257
853 Ga0501083_0062118 3300049744 Bacteria 2493
854 Ga0501083_0267033 3300049744 Bacteria 1113
855 Ga0501263_007208 3300049760 Bacteria 1304
856 Ga0501268_023281 3300049765 Bacteria 1074
857 Ga0501035_0035768 3300049822 Unclassified 4506
858 Ga0501035_0133458 3300049822 Bacteria 2163
859 Ga0501044_0002454 3300049823 Bacteria 21139
860 Ga0501044_0044779 3300049823 Bacteria 4589
861 Ga0501044_0101639 3300049823 Unclassified 2892
862 Ga0501044_0250010 3300049823 Bacteria 1714
863 Ga0501045_0002074 3300049824 Bacteria 13539
864 Ga0501045_0039920 3300049824 Bacteria 3415
865 Ga0501045_0043711 3300049824 Bacteria 3263
866 Ga0501045_0051695 3300049824 Bacteria 2999
867 nmdc:mga05p37_142569_c1 3300050507 Bacteria 2935
868 nmdc:mga05p37_148017_c1 3300050507 Bacteria 2874
869 nmdc:mga05p37_462788_c1 3300050507 Unclassified 1465
870 nmdc:mga05p37_50876_c1 3300050507 Bacteria 5095
871 nmdc:mga05p37_561131_c1 3300050507 Bacteria 1297
872 nmdc:mga09592_275417_c1 3300050508 Bacteria 1460
873 nmdc:mga09592_40794_c1 3300050508 Bacteria 3900
874 nmdc:mga09592_72684_c1 3300050508 Bacteria 2921
875 nmdc:mga09592_87369_c1 3300050508 Bacteria 2662
876 nmdc:mga09592_99597_c1 3300050508 Bacteria 2488
877 nmdc:mga0qj67_12488_c1 3300050509 Bacteria 6398
878 nmdc:mga0qj67_2698_c1 3300050509 Bacteria 12729
879 nmdc:mga0qj67_32779_c1 3300050509 Bacteria 4053
880 nmdc:mga0qj67_53056_c1 3300050509 Bacteria 3209
881 nmdc:mga06r32_354305_c1 3300050510 Bacteria 1452
882 nmdc:mga06r32_418705_c1 3300050510 Bacteria 1321
883 nmdc:mga06r32_47840_c1 3300050510 Bacteria 4087
884 nmdc:mga06r32_54656_c1 3300050510 Bacteria 3829
885 nmdc:mga06r32_55517_c1 3300050510 Bacteria 3799
886 nmdc:mga06r32_8661_c1 3300050510 Bacteria 9168
887 nmdc:mga08y16_115285_c1 3300050511 Bacteria 2797
888 nmdc:mga08y16_22_c1 3300050511 Bacteria 250162
889 nmdc:mga0rr50_145607_c2 3300050513 Bacteria 1563
890 nmdc:mga08x19_185705_c1 3300050514 Bacteria 1421
891 nmdc:mga0a205_119095_c1 3300050515 Bacteria 2539
892 nmdc:mga0a205_90561_c1 3300050515 Bacteria 2956
893 Ga0495601_0045849 3300053077 Bacteria 2751
894 Ga0495601_0084683 3300053077 Bacteria 2037
895 Ga0495595_0010711 3300053084 Bacteria 3819
896 Ga0495619_0005570 3300053085 Bacteria 7989
897 Ga0495619_0023411 3300053085 Bacteria 3959
898 Ga0500644_0006740 3300053088 Bacteria 2959
899 Ga0500583_0000027 3300053092 Bacteria 109138
900 Ga0500583_0000598 3300053092 Bacteria 10793
901 Ga0500566_0003670 3300053094 Bacteria 9165
902 Ga0500589_038939 3300053147 Unclassified 2219
903 Ga0500603_003764 3300053150 Bacteria 3247
904 Ga0500603_038290 3300053150 Bacteria 1269
905 Ga0501084_0159099 3300054114 Unclassified 1905
906 Ga0501084_0214105 3300054114 Bacteria 1625
907 Ga0501082_0004906 3300060353 Bacteria 11666
908 Ga0501082_0015866 3300060353 Bacteria 6477
909 Ga0501082_0042729 3300060353 Bacteria 3907
910 Ga0530510_0002730 3300061734 Bacteria 12149
911 Ga0530510_0033484 3300061734 Bacteria 3699
912 Ga0530510_0086070 3300061734 Bacteria 2290
913 Ga0530510_0104328 3300061734 Bacteria 2074
914 Ga0530510_0138981 3300061734 Bacteria 1789
915 Ga0530510_0140894 3300061734 Bacteria 1776

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049744 Ga0501083_0062118 Ga0501083_0062118_1574_2464 264
2 3300005618 Ga0068864_100051164 Ga0068864_1000511642 268
3 3300009177 Ga0105248_10442529 Ga0105248_104425291 271
4 3300025941 Ga0207711_10305515 Ga0207711_103055152 271
5 3300048911 Ga0496108_0143849 Ga0496108_0143849_1188_2039 272
6 3300005539 Ga0068853_100011024 Ga0068853_1000110244 274
7 3300026041 Ga0207639_10007679 Ga0207639_100076795 274
8 3300025922 Ga0207646_10524475 Ga0207646_105244751 275
9 3300026095 Ga0207676_10049325 Ga0207676_100493252 275
10 3300031595 Ga0265313_10039862 Ga0265313_100398621 275
11 3300005335 Ga0070666_10005429 Ga0070666_100054294 277
12 3300025903 Ga0207680_10001546 Ga0207680_100015464 277
13 3300025938 Ga0207704_10015131 Ga0207704_100151314 277
14 3300005458 Ga0070681_10123298 Ga0070681_101232982 278
15 3300025901 Ga0207688_10252598 Ga0207688_102525981 278
16 3300025912 Ga0207707_10096788 Ga0207707_100967882 278
17 3300025921 Ga0207652_10021177 Ga0207652_100211776 278
18 3300031691 Ga0316579_10073899 Ga0316579_100738992 278
19 3300031727 Ga0316576_10006995 Ga0316576_100069957 278
20 3300031728 Ga0316578_10002870 Ga0316578_100028702 278
21 3300031733 Ga0316577_10074270 Ga0316577_100742702 278
22 3300032139 Ga0316580_10056442 Ga0316580_100564422 278
23 3300036647 Ga0316582_0016664 Ga0316582_0016664_738_1691 278
24 3300036712 Ga0316584_0004631 Ga0316584_0004631_5623_6576 278
25 3300037588 Ga0316581_0034851 Ga0316581_0034851_91_1044 278
26 3300005937 Ga0081455_10007011 Ga0081455_100070119 280
27 3300048915 Ga0496112_0702373 Ga0496112_0702373_12_887 280
28 3300005617 Ga0068859_100180101 Ga0068859_1001801013 281
29 3300005844 Ga0068862_100288606 Ga0068862_1002886062 281
30 3300006931 Ga0097620_100180104 Ga0097620_1001801043 281
31 3300028380 Ga0268265_10097521 Ga0268265_100975214 281
32 3300031728 Ga0316578_10161863 Ga0316578_101618631 281
33 3300013306 Ga0163162_10005980 Ga0163162_1000598012 282
34 3300005329 Ga0070683_100132805 Ga0070683_1001328051 283
35 3300005337 Ga0070682_100006403 Ga0070682_1000064032 283
36 3300005339 Ga0070660_100192229 Ga0070660_1001922292 283
37 3300005344 Ga0070661_100142381 Ga0070661_1001423812 283
38 3300005364 Ga0070673_100091941 Ga0070673_1000919412 283
39 3300005366 Ga0070659_100181859 Ga0070659_1001818591 283
40 3300005457 Ga0070662_100262169 Ga0070662_1002621691 283
41 3300005535 Ga0070684_100411356 Ga0070684_1004113561 283
42 3300005539 Ga0068853_100131745 Ga0068853_1001317452 283
43 3300005563 Ga0068855_100213568 Ga0068855_1002135682 283
44 3300005564 Ga0070664_100139951 Ga0070664_1001399511 283
45 3300013100 Ga0157373_10025876 Ga0157373_100258765 283
46 3300013105 Ga0157369_10305621 Ga0157369_103056212 283
47 3300013296 Ga0157374_10024433 Ga0157374_100244332 283
48 3300013307 Ga0157372_10479819 Ga0157372_104798192 283
49 3300025919 Ga0207657_10010235 Ga0207657_100102351 283
50 3300025921 Ga0207652_10349652 Ga0207652_103496522 283
51 3300025944 Ga0207661_10244550 Ga0207661_102445502 283
52 3300025981 Ga0207640_10058766 Ga0207640_100587663 283
53 3300026041 Ga0207639_10091546 Ga0207639_100915462 283
54 3300026078 Ga0207702_10051789 Ga0207702_100517891 283
55 3300005578 Ga0068854_100064759 Ga0068854_1000647592 284
56 3300049574 Ga0501038_0116511 Ga0501038_0116511_864_1838 284
57 3300061734 Ga0530510_0033484 Ga0530510_0033484_214_1188 284
58 3300005347 Ga0070668_100113597 Ga0070668_1001135971 285
59 3300005353 Ga0070669_100092951 Ga0070669_1000929512 285
60 3300013296 Ga0157374_10161837 Ga0157374_101618372 286
61 3300013308 Ga0157375_10310801 Ga0157375_103108011 286
62 3300014968 Ga0157379_10135713 Ga0157379_101357132 286
63 3300025904 Ga0207647_10135566 Ga0207647_101355662 286
64 3300025945 Ga0207679_10320840 Ga0207679_103208402 286
65 3300026067 Ga0207678_10170339 Ga0207678_101703392 286
66 3300026116 Ga0207674_10061864 Ga0207674_100618641 286
67 3300031344 Ga0265316_10080444 Ga0265316_100804442 286
68 3300049591 Ga0501075_0430622 Ga0501075_0430622_12_905 286
69 3300050507 nmdc:mga05p37_561131_c1 nmdc:mga05p37_561131_c1_372_1274 286
70 3300013104 Ga0157370_10121961 Ga0157370_101219611 287
71 3300025949 Ga0207667_10213407 Ga0207667_102134072 287
72 3300005563 Ga0068855_100043250 Ga0068855_1000432505 288
73 3300049742 Ga0501080_0395661 Ga0501080_0395661_213_1163 288
74 3300005339 Ga0070660_100031268 Ga0070660_1000312684 289
75 3300014325 Ga0163163_10435545 Ga0163163_104355451 289
76 3300025919 Ga0207657_10119828 Ga0207657_101198281 289
77 3300032005 Ga0307411_10308563 Ga0307411_103085631 289
78 3300046675 Ga0495657_0002664 Ga0495657_0002664_104_1006 289
79 3300005329 Ga0070683_100005550 Ga0070683_10000555011 290
80 3300005344 Ga0070661_100009793 Ga0070661_1000097939 290
81 3300005366 Ga0070659_100025984 Ga0070659_1000259842 290
82 3300005535 Ga0070684_100012839 Ga0070684_1000128396 290
83 3300005539 Ga0068853_100045604 Ga0068853_1000456045 290
84 3300005564 Ga0070664_100022854 Ga0070664_1000228545 290
85 3300005578 Ga0068854_100235901 Ga0068854_1002359012 290
86 3300005843 Ga0068860_100378000 Ga0068860_1003780002 290
87 3300006844 Ga0075428_100151035 Ga0075428_1001510353 290
88 3300006846 Ga0075430_100007274 Ga0075430_1000072746 290
89 3300006847 Ga0075431_100095188 Ga0075431_1000951884 290
90 3300006880 Ga0075429_100108399 Ga0075429_1001083992 290
91 3300009147 Ga0114129_10194413 Ga0114129_101944132 290
92 3300013104 Ga0157370_10013214 Ga0157370_100132144 290
93 3300025920 Ga0207649_10025152 Ga0207649_100251524 290
94 3300025932 Ga0207690_10209824 Ga0207690_102098242 290
95 3300025944 Ga0207661_10036520 Ga0207661_100365204 290
96 3300026041 Ga0207639_10005388 Ga0207639_100053884 290
97 3300050507 nmdc:mga05p37_462788_c1 nmdc:mga05p37_462788_c1_390_1337 290
98 3300050508 nmdc:mga09592_72684_c1 nmdc:mga09592_72684_c1_1584_2531 290
99 3300050509 nmdc:mga0qj67_32779_c1 nmdc:mga0qj67_32779_c1_2263_3210 290
100 3300050510 nmdc:mga06r32_54656_c1 nmdc:mga06r32_54656_c1_547_1494 290
101 3300046477 Ga0495664_0187534 Ga0495664_0187534_76_1092 291
102 3300046517 Ga0495630_0012249 Ga0495630_0012249_3810_4826 291
103 3300046533 Ga0495640_0163101 Ga0495640_0163101_66_1082 291
104 3300047319 Ga0495674_0061772 Ga0495674_0061772_1548_2564 291
105 3300049586 Ga0501070_0209990 Ga0501070_0209990_184_1134 291
106 3300048904 Ga0496101_0201633 Ga0496101_0201633_512_1456 294
107 3300048905 Ga0496102_0065747 Ga0496102_0065747_1838_2782 294
108 3300048909 Ga0496106_0061170 Ga0496106_0061170_1363_2307 294
109 3300048910 Ga0496107_0029175 Ga0496107_0029175_1575_2519 294
110 3300048912 Ga0496109_0476539 Ga0496109_0476539_151_1095 294
111 3300049744 Ga0501083_0267033 Ga0501083_0267033_65_1012 294
112 3300005335 Ga0070666_10001316 Ga0070666_100013162 295
113 3300005564 Ga0070664_100000492 Ga0070664_10000049211 295
114 3300005618 Ga0068864_100000781 Ga0068864_1000007819 295
115 3300005985 Ga0081539_10004015 Ga0081539_1000401515 295
116 3300009093 Ga0105240_10028359 Ga0105240_100283594 295
117 3300009177 Ga0105248_10015185 Ga0105248_100151852 295
118 3300010375 Ga0105239_10205151 Ga0105239_102051512 295
119 3300013296 Ga0157374_10208221 Ga0157374_102082212 295
120 3300013306 Ga0163162_10000523 Ga0163162_1000052325 295
121 3300013308 Ga0157375_10001301 Ga0157375_100013016 295
122 3300014325 Ga0163163_10232956 Ga0163163_102329562 295
123 3300014969 Ga0157376_10041099 Ga0157376_100410992 295
124 3300026035 Ga0207703_10013004 Ga0207703_100130044 295
125 3300026088 Ga0207641_10015720 Ga0207641_100157203 295
126 3300032002 Ga0307416_100135889 Ga0307416_1001358892 295
127 3300035117 Ga0373953_0095547 Ga0373953_0095547_168_1088 295
128 3300042876 Ga0451577_0016447 Ga0451577_0016447_1241_2173 295
129 3300044712 Ga0453684_0153749 Ga0453684_0153749_742_1674 295
130 3300046459 Ga0495629_0145201 Ga0495629_0145201_691_1611 295
131 3300046459 Ga0495629_0193814 Ga0495629_0193814_58_978 295
132 3300046476 Ga0495662_0009490 Ga0495662_0009490_541_1461 295
133 3300046514 Ga0495618_0170044 Ga0495618_0170044_112_1032 295
134 3300046683 Ga0495658_0094565 Ga0495658_0094565_808_1728 295
135 3300046689 Ga0495613_0043195 Ga0495613_0043195_341_1261 295
136 3300047319 Ga0495674_0168095 Ga0495674_0168095_424_1344 295
137 3300047471 Ga0495684_0158850 Ga0495684_0158850_101_1021 295
138 3300009545 Ga0105237_10093453 Ga0105237_100934533 296
139 3300035117 Ga0373953_0148845 Ga0373953_0148845_65_988 296
140 3300036401 Ga0373937_0043557 Ga0373937_0043557_3113_4069 296
141 3300046454 Ga0495592_0054446 Ga0495592_0054446_57_998 296
142 3300046559 Ga0495667_0030382 Ga0495667_0030382_120_1076 296
143 3300047322 Ga0495680_0047511 Ga0495680_0047511_2292_3260 296
144 3300049580 Ga0501046_0158663 Ga0501046_0158663_311_1354 296
145 3300049592 Ga0501076_0441263 Ga0501076_0441263_133_1056 296
146 3300009093 Ga0105240_10169230 Ga0105240_101692302 297
147 3300009094 Ga0111539_10076633 Ga0111539_100766334 297
148 3300009098 Ga0105245_10043077 Ga0105245_100430773 297
149 3300013296 Ga0157374_10005430 Ga0157374_100054306 297
150 3300013297 Ga0157378_10003439 Ga0157378_100034398 297
151 3300014326 Ga0157380_10010459 Ga0157380_100104595 297
152 3300025907 Ga0207645_10029340 Ga0207645_100293402 297
153 3300025913 Ga0207695_10134545 Ga0207695_101345452 297
154 3300046472 Ga0495580_0163858 Ga0495580_0163858_366_1334 297
155 3300049571 Ga0501034_0011076 Ga0501034_0011076_3775_4728 297
156 3300049581 Ga0501047_0137193 Ga0501047_0137193_430_1383 297
157 3300049583 Ga0501067_0043941 Ga0501067_0043941_214_1167 297
158 3300049589 Ga0501073_0031033 Ga0501073_0031033_1146_2099 297
159 3300049590 Ga0501074_0059882 Ga0501074_0059882_944_1897 297
160 3300049742 Ga0501080_0004871 Ga0501080_0004871_5794_6747 297
161 3300049742 Ga0501080_0064218 Ga0501080_0064218_1630_2577 297
162 3300049744 Ga0501083_0006560 Ga0501083_0006560_5455_6408 297
163 3300050511 nmdc:mga08y16_115285_c1 nmdc:mga08y16_115285_c1_338_1279 297
164 3300060353 Ga0501082_0042729 Ga0501082_0042729_996_1949 297
165 3300005340 Ga0070689_100174977 Ga0070689_1001749772 298
166 3300005355 Ga0070671_100116251 Ga0070671_1001162512 298
167 3300005365 Ga0070688_100037566 Ga0070688_1000375662 298
168 3300007265 Ga0099794_10022038 Ga0099794_100220383 298
169 3300025917 Ga0207660_10387918 Ga0207660_103879181 298
170 3300005328 Ga0070676_10113135 Ga0070676_101131353 299
171 3300005331 Ga0070670_100251733 Ga0070670_1002517333 299
172 3300005347 Ga0070668_100000951 Ga0070668_10000095113 299
173 3300005354 Ga0070675_100011460 Ga0070675_1000114607 299
174 3300005356 Ga0070674_100149299 Ga0070674_1001492992 299
175 3300005467 Ga0070706_100265778 Ga0070706_1002657782 299
176 3300005468 Ga0070707_100000032 Ga0070707_10000003218 299
177 3300005543 Ga0070672_100106674 Ga0070672_1001066742 299
178 3300025910 Ga0207684_10157635 Ga0207684_101576352 299
179 3300025922 Ga0207646_10000032 Ga0207646_1000003260 299
180 3300025925 Ga0207650_10268623 Ga0207650_102686231 299
181 3300025926 Ga0207659_10002371 Ga0207659_100023715 299
182 3300025940 Ga0207691_10121889 Ga0207691_101218893 299
183 3300025972 Ga0207668_10000663 Ga0207668_1000066311 299
184 3300028380 Ga0268265_10062858 Ga0268265_100628584 299
185 3300028556 Ga0265337_1001644 Ga0265337_100164410 299
186 3300028558 Ga0265326_10013130 Ga0265326_100131302 299
187 3300028653 Ga0265323_10005862 Ga0265323_100058626 299
188 3300028800 Ga0265338_10077849 Ga0265338_100778492 299
189 3300031241 Ga0265325_10005122 Ga0265325_100051222 299
190 3300031247 Ga0265340_10000108 Ga0265340_100001089 299
191 3300031249 Ga0265339_10034529 Ga0265339_100345292 299
192 3300031344 Ga0265316_10100115 Ga0265316_101001154 299
193 3300031548 Ga0307408_100040397 Ga0307408_1000403973 299
194 3300031711 Ga0265314_10000104 Ga0265314_1000010427 299
195 3300031712 Ga0265342_10001030 Ga0265342_1000103016 299
196 3300031731 Ga0307405_10050942 Ga0307405_100509422 299
197 3300031852 Ga0307410_10017356 Ga0307410_100173563 299
198 3300032005 Ga0307411_10235310 Ga0307411_102353102 299
199 3300036401 Ga0373937_0436749 Ga0373937_0436749_227_1177 299
200 3300042876 Ga0451577_0247500 Ga0451577_0247500_17_964 299
201 3300044712 Ga0453684_0349268 Ga0453684_0349268_619_1566 299
202 3300046683 Ga0495658_0138528 Ga0495658_0138528_58_993 299
203 3300049823 Ga0501044_0101639 Ga0501044_0101639_1887_2837 299
204 3300050513 nmdc:mga0rr50_145607_c2 nmdc:mga0rr50_145607_c2_20_967 299
205 3300005577 Ga0068857_100032403 Ga0068857_1000324035 300
206 3300013105 Ga0157369_10186487 Ga0157369_101864871 300
207 3300014325 Ga0163163_10001342 Ga0163163_100013428 300
208 3300014325 Ga0163163_10008479 Ga0163163_100084799 300
209 3300025904 Ga0207647_10010393 Ga0207647_100103938 300
210 3300031241 Ga0265325_10135437 Ga0265325_101354371 300
211 3300031665 Ga0316575_10002566 Ga0316575_100025663 300
212 3300031665 Ga0316575_10052820 Ga0316575_100528201 300
213 3300031727 Ga0316576_10003610 Ga0316576_100036106 300
214 3300031728 Ga0316578_10003237 Ga0316578_100032373 300
215 3300031728 Ga0316578_10172301 Ga0316578_101723011 300
216 3300031733 Ga0316577_10021897 Ga0316577_100218973 300
217 3300032133 Ga0316583_10003577 Ga0316583_100035774 300
218 3300032133 Ga0316583_10008550 Ga0316583_100085502 300
219 3300032137 Ga0316585_10008588 Ga0316585_100085882 300
220 3300032139 Ga0316580_10000900 Ga0316580_100009007 300
221 3300035398 Ga0316574_0012270 Ga0316574_0012270_760_1710 300
222 3300035398 Ga0316574_0014180 Ga0316574_0014180_2002_2952 300
223 3300035398 Ga0316574_0027730 Ga0316574_0027730_1816_2766 300
224 3300036712 Ga0316584_0004299 Ga0316584_0004299_1852_2802 300
225 3300036712 Ga0316584_0004621 Ga0316584_0004621_4579_5529 300
226 3300046462 Ga0495651_0000090 Ga0495651_0000090_19012_19980 300
227 3300046543 Ga0495645_0020717 Ga0495645_0020717_1574_2542 300
228 3300046559 Ga0495667_0005808 Ga0495667_0005808_1583_2551 300
229 3300046809 Ga0495600_0027708 Ga0495600_0027708_1549_2517 300
230 3300047322 Ga0495680_0001014 Ga0495680_0001014_26758_27726 300
231 3300053094 Ga0500566_0003670 Ga0500566_0003670_7438_8391 300
232 3300053150 Ga0500603_003764 Ga0500603_003764_369_1322 300
233 iso_pu_bacteria 2643221601 2644016548 300
234 iso_pu_bacteria 2643221631 2644176468 300
235 iso_pu_bacteria 2738541278 2738725136 300
236 3300005471 Ga0070698_100001998 Ga0070698_1000019987 301
237 3300013297 Ga0157378_10001754 Ga0157378_100017547 301
238 3300026075 Ga0207708_10096778 Ga0207708_100967782 301
239 3300026089 Ga0207648_10303428 Ga0207648_103034281 301
240 3300031727 Ga0316576_10127808 Ga0316576_101278082 301
241 3300042876 Ga0451577_0102493 Ga0451577_0102493_1441_2403 301
242 3300048088 Ga0495602_0199484 Ga0495602_0199484_93_1127 301
243 3300005530 Ga0070679_100525512 Ga0070679_1005255121 302
244 3300005539 Ga0068853_100412894 Ga0068853_1004128941 302
245 3300005547 Ga0070693_100012709 Ga0070693_1000127093 302
246 3300009553 Ga0105249_10013169 Ga0105249_100131693 302
247 3300025960 Ga0207651_10040387 Ga0207651_100403873 302
248 3300026041 Ga0207639_10086260 Ga0207639_100862602 302
249 3300031711 Ga0265314_10050435 Ga0265314_100504352 302
250 3300031852 Ga0307410_10299823 Ga0307410_102998231 302
251 3300005293 Ga0065715_10155878 Ga0065715_101558782 303
252 3300005330 Ga0070690_100003963 Ga0070690_1000039632 303
253 3300005331 Ga0070670_100018444 Ga0070670_1000184443 303
254 3300005337 Ga0070682_100095781 Ga0070682_1000957812 303
255 3300005338 Ga0068868_100008292 Ga0068868_1000082922 303
256 3300005338 Ga0068868_100015287 Ga0068868_1000152874 303
257 3300005338 Ga0068868_100158765 Ga0068868_1001587651 303
258 3300005340 Ga0070689_100031031 Ga0070689_1000310311 303
259 3300005340 Ga0070689_100073946 Ga0070689_1000739462 303
260 3300005344 Ga0070661_100013569 Ga0070661_1000135693 303
261 3300005353 Ga0070669_100242384 Ga0070669_1002423841 303
262 3300005354 Ga0070675_100099784 Ga0070675_1000997842 303
263 3300005364 Ga0070673_100002269 Ga0070673_1000022693 303
264 3300005365 Ga0070688_100032273 Ga0070688_1000322733 303
265 3300005367 Ga0070667_100005708 Ga0070667_1000057083 303
266 3300005445 Ga0070708_100282992 Ga0070708_1002829922 303
267 3300005466 Ga0070685_10033897 Ga0070685_100338973 303
268 3300005518 Ga0070699_100119960 Ga0070699_1001199602 303
269 3300005530 Ga0070679_100016964 Ga0070679_1000169642 303
270 3300005543 Ga0070672_100005846 Ga0070672_1000058462 303
271 3300005543 Ga0070672_100047244 Ga0070672_1000472442 303
272 3300005544 Ga0070686_100005546 Ga0070686_1000055467 303
273 3300005617 Ga0068859_100017217 Ga0068859_1000172172 303
274 3300005718 Ga0068866_10011514 Ga0068866_100115142 303
275 3300005719 Ga0068861_100339685 Ga0068861_1003396852 303
276 3300005841 Ga0068863_100022837 Ga0068863_1000228372 303
277 3300005841 Ga0068863_100186873 Ga0068863_1001868732 303
278 3300005842 Ga0068858_100026396 Ga0068858_1000263964 303
279 3300005937 Ga0081455_10285818 Ga0081455_102858181 303
280 3300006237 Ga0097621_100000554 Ga0097621_10000055426 303
281 3300006358 Ga0068871_100002575 Ga0068871_1000025756 303
282 3300006358 Ga0068871_100069994 Ga0068871_1000699942 303
283 3300006931 Ga0097620_100017217 Ga0097620_1000172172 303
284 3300009093 Ga0105240_10244183 Ga0105240_102441832 303
285 3300009094 Ga0111539_10000536 Ga0111539_1000053624 303
286 3300009094 Ga0111539_10489102 Ga0111539_104891022 303
287 3300009098 Ga0105245_10001786 Ga0105245_100017868 303
288 3300009176 Ga0105242_10022569 Ga0105242_100225695 303
289 3300009176 Ga0105242_10098613 Ga0105242_100986131 303
290 3300009177 Ga0105248_10057845 Ga0105248_100578453 303
291 3300013104 Ga0157370_10029120 Ga0157370_100291204 303
292 3300013297 Ga0157378_10000437 Ga0157378_100004377 303
293 3300013297 Ga0157378_10002581 Ga0157378_100025819 303
294 3300013306 Ga0163162_10124903 Ga0163162_101249033 303
295 3300013306 Ga0163162_10286741 Ga0163162_102867411 303
296 3300013308 Ga0157375_10122921 Ga0157375_101229213 303
297 3300013308 Ga0157375_10260729 Ga0157375_102607291 303
298 3300014326 Ga0157380_10050034 Ga0157380_100500341 303
299 3300014326 Ga0157380_10247718 Ga0157380_102477181 303
300 3300014745 Ga0157377_10016681 Ga0157377_100166813 303
301 3300014969 Ga0157376_10056318 Ga0157376_100563183 303
302 3300025903 Ga0207680_10011290 Ga0207680_100112903 303
303 3300025908 Ga0207643_10017411 Ga0207643_100174113 303
304 3300025920 Ga0207649_10002503 Ga0207649_100025033 303
305 3300025921 Ga0207652_10121649 Ga0207652_101216492 303
306 3300025925 Ga0207650_10000510 Ga0207650_1000051024 303
307 3300025926 Ga0207659_10020599 Ga0207659_100205995 303
308 3300025931 Ga0207644_10002882 Ga0207644_100028827 303
309 3300025936 Ga0207670_10029226 Ga0207670_100292262 303
310 3300025936 Ga0207670_10120701 Ga0207670_101207011 303
311 3300025940 Ga0207691_10019398 Ga0207691_100193983 303
312 3300025940 Ga0207691_10197390 Ga0207691_101973901 303
313 3300025941 Ga0207711_10267390 Ga0207711_102673902 303
314 3300025942 Ga0207689_10088810 Ga0207689_100888102 303
315 3300025945 Ga0207679_10021225 Ga0207679_100212253 303
316 3300025986 Ga0207658_10010785 Ga0207658_100107855 303
317 3300026023 Ga0207677_10028007 Ga0207677_100280074 303
318 3300026088 Ga0207641_10001235 Ga0207641_1000123526 303
319 3300026088 Ga0207641_10161340 Ga0207641_101613402 303
320 3300026095 Ga0207676_10026191 Ga0207676_100261912 303
321 3300026116 Ga0207674_10212617 Ga0207674_102126172 303
322 3300026121 Ga0207683_10287154 Ga0207683_102871542 303
323 3300027907 Ga0207428_10000031 Ga0207428_10000031181 303
324 3300031995 Ga0307409_100306417 Ga0307409_1003064172 303
325 3300035725 Ga0373947_0251800 Ga0373947_0251800_199_1143 303
326 3300046462 Ga0495651_0139011 Ga0495651_0139011_562_1506 303
327 3300046683 Ga0495658_0015758 Ga0495658_0015758_2520_3539 303
328 3300046691 Ga0495670_0159165 Ga0495670_0159165_212_1162 303
329 3300047318 Ga0495636_0000016 Ga0495636_0000016_49057_50007 303
330 3300049583 Ga0501067_0000249 Ga0501067_0000249_7412_8356 303
331 3300050511 nmdc:mga08y16_22_c1 nmdc:mga08y16_22_c1_230433_231386 303
332 3300003323 rootH1_10004495 rootH1_1000449526 304
333 3300005288 Ga0065714_10019946 Ga0065714_100199461 304
334 3300005295 Ga0065707_10091080 Ga0065707_100910803 304
335 3300005295 Ga0065707_10118341 Ga0065707_101183412 304
336 3300005331 Ga0070670_100012132 Ga0070670_1000121324 304
337 3300005335 Ga0070666_10029682 Ga0070666_100296823 304
338 3300005347 Ga0070668_100271460 Ga0070668_1002714601 304
339 3300005355 Ga0070671_100011830 Ga0070671_1000118305 304
340 3300005356 Ga0070674_100007915 Ga0070674_1000079152 304
341 3300005364 Ga0070673_100165222 Ga0070673_1001652221 304
342 3300005367 Ga0070667_100005498 Ga0070667_1000054985 304
343 3300005367 Ga0070667_100137970 Ga0070667_1001379701 304
344 3300005367 Ga0070667_100178526 Ga0070667_1001785262 304
345 3300005455 Ga0070663_100119781 Ga0070663_1001197812 304
346 3300005471 Ga0070698_100003211 Ga0070698_1000032119 304
347 3300005543 Ga0070672_100030941 Ga0070672_1000309412 304
348 3300005544 Ga0070686_100042469 Ga0070686_1000424692 304
349 3300005548 Ga0070665_100523045 Ga0070665_1005230451 304
350 3300005617 Ga0068859_100006459 Ga0068859_10000645911 304
351 3300005834 Ga0068851_10079402 Ga0068851_100794021 304
352 3300005841 Ga0068863_100000221 Ga0068863_10000022143 304
353 3300005843 Ga0068860_100006424 Ga0068860_10000642410 304
354 3300005843 Ga0068860_100018722 Ga0068860_1000187224 304
355 3300005937 Ga0081455_10093709 Ga0081455_100937093 304
356 3300006237 Ga0097621_100021757 Ga0097621_1000217575 304
357 3300006358 Ga0068871_100003879 Ga0068871_10000387910 304
358 3300006358 Ga0068871_100023121 Ga0068871_1000231212 304
359 3300006881 Ga0068865_100124073 Ga0068865_1001240732 304
360 3300006931 Ga0097620_100006459 Ga0097620_10000645911 304
361 3300009101 Ga0105247_10001541 Ga0105247_1000154112 304
362 3300009147 Ga0114129_10014027 Ga0114129_100140277 304
363 3300009147 Ga0114129_10558725 Ga0114129_105587252 304
364 3300009176 Ga0105242_10069023 Ga0105242_100690232 304
365 3300009177 Ga0105248_10000048 Ga0105248_1000004838 304
366 3300013102 Ga0157371_10185743 Ga0157371_101857431 304
367 3300013296 Ga0157374_10136846 Ga0157374_101368462 304
368 3300013297 Ga0157378_10087958 Ga0157378_100879582 304
369 3300013308 Ga0157375_10000262 Ga0157375_1000026239 304
370 3300014325 Ga0163163_10108304 Ga0163163_101083042 304
371 3300014745 Ga0157377_10083580 Ga0157377_100835802 304
372 3300014968 Ga0157379_10000264 Ga0157379_1000026412 304
373 3300017792 Ga0163161_10083804 Ga0163161_100838042 304
374 3300021361 Ga0213872_10047235 Ga0213872_100472352 304
375 3300021441 Ga0213871_10004166 Ga0213871_100041663 304
376 3300025315 Ga0207697_10086919 Ga0207697_100869192 304
377 3300025903 Ga0207680_10026291 Ga0207680_100262913 304
378 3300025925 Ga0207650_10067621 Ga0207650_100676212 304
379 3300025925 Ga0207650_10102126 Ga0207650_101021261 304
380 3300025926 Ga0207659_10000173 Ga0207659_1000017311 304
381 3300025931 Ga0207644_10015078 Ga0207644_100150782 304
382 3300025938 Ga0207704_10091665 Ga0207704_100916652 304
383 3300025940 Ga0207691_10028488 Ga0207691_100284882 304
384 3300025941 Ga0207711_10000648 Ga0207711_1000064810 304
385 3300025960 Ga0207651_10022287 Ga0207651_100222872 304
386 3300025986 Ga0207658_10153660 Ga0207658_101536602 304
387 3300026088 Ga0207641_10000561 Ga0207641_100005618 304
388 3300028379 Ga0268266_10191970 Ga0268266_101919701 304
389 3300028381 Ga0268264_10007005 Ga0268264_100070053 304
390 3300028381 Ga0268264_10030284 Ga0268264_100302842 304
391 3300028381 Ga0268264_10454451 Ga0268264_104544512 304
392 3300028800 Ga0265338_10169127 Ga0265338_101691272 304
393 3300031456 Ga0307513_10125887 Ga0307513_101258873 304
394 3300031507 Ga0307509_10107579 Ga0307509_101075793 304
395 3300031691 Ga0316579_10057577 Ga0316579_100575772 304
396 3300031727 Ga0316576_10008823 Ga0316576_100088232 304
397 3300031728 Ga0316578_10007341 Ga0316578_100073413 304
398 3300032126 Ga0307415_100240574 Ga0307415_1002405742 304
399 3300032133 Ga0316583_10048860 Ga0316583_100488601 304
400 3300033524 Ga0316592_1006636 Ga0316592_10066363 304
401 3300033528 Ga0316588_1040045 Ga0316588_10400451 304
402 3300036401 Ga0373937_0135290 Ga0373937_0135290_1306_2253 304
403 3300037068 Ga0373925_0497364 Ga0373925_0497364_39_986 304
404 3300037418 Ga0395900_0018883 Ga0395900_0018883_1044_2039 304
405 3300037466 Ga0395898_0001959 Ga0395898_0001959_11642_12637 304
406 3300037471 Ga0395905_0012005 Ga0395905_0012005_5349_6305 304
407 3300037588 Ga0316581_0027607 Ga0316581_0027607_449_1396 304
408 3300038443 Ga0395901_0009760 Ga0395901_0009760_8357_9352 304
409 3300039437 Ga0436365_0336651 Ga0436365_0336651_21_968 304
410 3300039438 Ga0436360_0105708 Ga0436360_0105708_3385_4332 304
411 3300039447 Ga0436361_0740991 Ga0436361_0740991_1398_2345 304
412 3300039453 Ga0436362_0346855 Ga0436362_0346855_1188_2135 304
413 3300042876 Ga0451577_0123283 Ga0451577_0123283_147_1100 304
414 3300044658 Ga0466972_0000009 Ga0466972_0000009_151986_152933 304
415 3300044712 Ga0453684_0518598 Ga0453684_0518598_349_1302 304
416 3300044842 Ga0466957_0033462 Ga0466957_0033462_829_1776 304
417 3300046492 Ga0495585_0000525 Ga0495585_0000525_11943_12890 304
418 3300046522 Ga0495643_0009334 Ga0495643_0009334_3457_4404 304
419 3300046536 Ga0495587_0054565 Ga0495587_0054565_772_1719 304
420 3300046691 Ga0495670_0125443 Ga0495670_0125443_133_1080 304
421 3300047317 Ga0495604_0006369 Ga0495604_0006369_1679_2638 304
422 3300047444 Ga0495675_0021392 Ga0495675_0021392_1565_2524 304
423 3300048917 Ga0496114_0135287 Ga0496114_0135287_1069_2022 304
424 3300049579 Ga0501043_0166570 Ga0501043_0166570_651_1598 304
425 3300049592 Ga0501076_0181864 Ga0501076_0181864_73_1020 304
426 3300049705 Ga0501225_0001987 Ga0501225_0001987_4212_5159 304
427 3300049823 Ga0501044_0044779 Ga0501044_0044779_303_1250 304
428 3300049823 Ga0501044_0250010 Ga0501044_0250010_222_1169 304
429 3300053088 Ga0500644_0006740 Ga0500644_0006740_503_1450 304
430 3300053092 Ga0500583_0000027 Ga0500583_0000027_80118_81065 304
431 3300053092 Ga0500583_0000598 Ga0500583_0000598_5673_6620 304
432 3300053147 Ga0500589_038939 Ga0500589_038939_615_1562 304
433 3300053150 Ga0500603_038290 Ga0500603_038290_91_1038 304
434 3300002459 JGI24751J29686_10000335 JGI24751J29686_1000033514 305
435 3300003203 JGI25406J46586_10023135 JGI25406J46586_100231352 305
436 3300003323 rootH1_10155694 rootH1_101556941 305
437 3300005290 Ga0065712_10000781 Ga0065712_1000078115 305
438 3300005327 Ga0070658_10001806 Ga0070658_100018065 305
439 3300005328 Ga0070676_10015570 Ga0070676_100155702 305
440 3300005329 Ga0070683_100020750 Ga0070683_1000207504 305
441 3300005329 Ga0070683_100236805 Ga0070683_1002368051 305
442 3300005330 Ga0070690_100040289 Ga0070690_1000402893 305
443 3300005331 Ga0070670_100025152 Ga0070670_1000251524 305
444 3300005331 Ga0070670_100052931 Ga0070670_1000529315 305
445 3300005331 Ga0070670_100064587 Ga0070670_1000645872 305
446 3300005331 Ga0070670_100083934 Ga0070670_1000839344 305
447 3300005331 Ga0070670_100206539 Ga0070670_1002065391 305
448 3300005331 Ga0070670_100248776 Ga0070670_1002487762 305
449 3300005331 Ga0070670_100302109 Ga0070670_1003021091 305
450 3300005334 Ga0068869_100024944 Ga0068869_1000249443 305
451 3300005334 Ga0068869_100066941 Ga0068869_1000669412 305
452 3300005334 Ga0068869_100087483 Ga0068869_1000874831 305
453 3300005334 Ga0068869_100386438 Ga0068869_1003864381 305
454 3300005335 Ga0070666_10021319 Ga0070666_100213195 305
455 3300005335 Ga0070666_10089305 Ga0070666_100893052 305
456 3300005336 Ga0070680_100006966 Ga0070680_10000696610 305
457 3300005336 Ga0070680_100043075 Ga0070680_1000430752 305
458 3300005336 Ga0070680_100425293 Ga0070680_1004252931 305
459 3300005343 Ga0070687_100001102 Ga0070687_1000011025 305
460 3300005343 Ga0070687_100059306 Ga0070687_1000593062 305
461 3300005344 Ga0070661_100085471 Ga0070661_1000854712 305
462 3300005347 Ga0070668_100023794 Ga0070668_1000237941 305
463 3300005353 Ga0070669_100037947 Ga0070669_1000379473 305
464 3300005353 Ga0070669_100053889 Ga0070669_1000538891 305
465 3300005353 Ga0070669_100210329 Ga0070669_1002103292 305
466 3300005354 Ga0070675_100008620 Ga0070675_10000862010 305
467 3300005354 Ga0070675_100033681 Ga0070675_1000336814 305
468 3300005354 Ga0070675_100116193 Ga0070675_1001161932 305
469 3300005354 Ga0070675_100340387 Ga0070675_1003403871 305
470 3300005355 Ga0070671_100380375 Ga0070671_1003803751 305
471 3300005356 Ga0070674_100069510 Ga0070674_1000695102 305
472 3300005364 Ga0070673_100113975 Ga0070673_1001139752 305
473 3300005364 Ga0070673_100315594 Ga0070673_1003155941 305
474 3300005365 Ga0070688_100381889 Ga0070688_1003818891 305
475 3300005366 Ga0070659_100025517 Ga0070659_1000255176 305
476 3300005366 Ga0070659_100118369 Ga0070659_1001183692 305
477 3300005367 Ga0070667_100205033 Ga0070667_1002050332 305
478 3300005367 Ga0070667_100218193 Ga0070667_1002181931 305
479 3300005367 Ga0070667_100228292 Ga0070667_1002282922 305
480 3300005367 Ga0070667_100264626 Ga0070667_1002646262 305
481 3300005367 Ga0070667_100320443 Ga0070667_1003204432 305
482 3300005455 Ga0070663_100259117 Ga0070663_1002591171 305
483 3300005456 Ga0070678_100095547 Ga0070678_1000955472 305
484 3300005457 Ga0070662_100226440 Ga0070662_1002264401 305
485 3300005457 Ga0070662_100228348 Ga0070662_1002283482 305
486 3300005458 Ga0070681_10073654 Ga0070681_100736542 305
487 3300005458 Ga0070681_10105715 Ga0070681_101057152 305
488 3300005458 Ga0070681_10127861 Ga0070681_101278612 305
489 3300005458 Ga0070681_10257086 Ga0070681_102570862 305
490 3300005459 Ga0068867_100116337 Ga0068867_1001163372 305
491 3300005459 Ga0068867_100450975 Ga0068867_1004509751 305
492 3300005466 Ga0070685_10007265 Ga0070685_100072654 305
493 3300005466 Ga0070685_10044525 Ga0070685_100445253 305
494 3300005518 Ga0070699_100259085 Ga0070699_1002590852 305
495 3300005530 Ga0070679_100002339 Ga0070679_10000233912 305
496 3300005530 Ga0070679_100004116 Ga0070679_1000041163 305
497 3300005530 Ga0070679_100013309 Ga0070679_1000133096 305
498 3300005530 Ga0070679_100024167 Ga0070679_1000241676 305
499 3300005530 Ga0070679_100076615 Ga0070679_1000766152 305
500 3300005539 Ga0068853_100216381 Ga0068853_1002163811 305
501 3300005543 Ga0070672_100090118 Ga0070672_1000901182 305
502 3300005543 Ga0070672_100256135 Ga0070672_1002561351 305
503 3300005544 Ga0070686_100004512 Ga0070686_1000045124 305
504 3300005548 Ga0070665_100051291 Ga0070665_1000512913 305
505 3300005548 Ga0070665_100186816 Ga0070665_1001868161 305
506 3300005548 Ga0070665_100258668 Ga0070665_1002586682 305
507 3300005548 Ga0070665_100304326 Ga0070665_1003043262 305
508 3300005563 Ga0068855_100000014 Ga0068855_100000014133 305
509 3300005563 Ga0068855_100173463 Ga0068855_1001734631 305
510 3300005564 Ga0070664_100195286 Ga0070664_1001952861 305
511 3300005577 Ga0068857_100034845 Ga0068857_1000348452 305
512 3300005577 Ga0068857_100266590 Ga0068857_1002665902 305
513 3300005577 Ga0068857_100286052 Ga0068857_1002860522 305
514 3300005577 Ga0068857_100539105 Ga0068857_1005391051 305
515 3300005578 Ga0068854_100085130 Ga0068854_1000851302 305
516 3300005578 Ga0068854_100127144 Ga0068854_1001271441 305
517 3300005578 Ga0068854_100360405 Ga0068854_1003604052 305
518 3300005614 Ga0068856_100089457 Ga0068856_1000894572 305
519 3300005614 Ga0068856_100395590 Ga0068856_1003955901 305
520 3300005616 Ga0068852_100023253 Ga0068852_1000232533 305
521 3300005616 Ga0068852_100046341 Ga0068852_1000463412 305
522 3300005617 Ga0068859_100114918 Ga0068859_1001149182 305
523 3300005617 Ga0068859_100341549 Ga0068859_1003415492 305
524 3300005618 Ga0068864_100008888 Ga0068864_1000088883 305
525 3300005719 Ga0068861_100029438 Ga0068861_1000294383 305
526 3300005719 Ga0068861_100093705 Ga0068861_1000937052 305
527 3300005719 Ga0068861_100373493 Ga0068861_1003734931 305
528 3300005834 Ga0068851_10016011 Ga0068851_100160111 305
529 3300005841 Ga0068863_100126403 Ga0068863_1001264032 305
530 3300005842 Ga0068858_100013096 Ga0068858_1000130962 305
531 3300005842 Ga0068858_100082124 Ga0068858_1000821243 305
532 3300005843 Ga0068860_100188187 Ga0068860_1001881872 305
533 3300005843 Ga0068860_100302272 Ga0068860_1003022722 305
534 3300005844 Ga0068862_100011917 Ga0068862_1000119175 305
535 3300005844 Ga0068862_100221636 Ga0068862_1002216361 305
536 3300005985 Ga0081539_10004448 Ga0081539_100044489 305
537 3300006163 Ga0070715_10132209 Ga0070715_101322091 305
538 3300006173 Ga0070716_100059682 Ga0070716_1000596821 305
539 3300006237 Ga0097621_100019149 Ga0097621_1000191495 305
540 3300006237 Ga0097621_100021327 Ga0097621_1000213273 305
541 3300006237 Ga0097621_100021395 Ga0097621_1000213954 305
542 3300006237 Ga0097621_100039645 Ga0097621_1000396452 305
543 3300006237 Ga0097621_100062570 Ga0097621_1000625702 305
544 3300006358 Ga0068871_100001750 Ga0068871_10000175015 305
545 3300006358 Ga0068871_100037217 Ga0068871_1000372174 305
546 3300006358 Ga0068871_100107602 Ga0068871_1001076023 305
547 3300006844 Ga0075428_100064824 Ga0075428_1000648244 305
548 3300006844 Ga0075428_100148569 Ga0075428_1001485693 305
549 3300006846 Ga0075430_100005824 Ga0075430_1000058249 305
550 3300006847 Ga0075431_100002400 Ga0075431_1000024009 305
551 3300006847 Ga0075431_100134669 Ga0075431_1001346692 305
552 3300006847 Ga0075431_100243672 Ga0075431_1002436722 305
553 3300006847 Ga0075431_100363120 Ga0075431_1003631201 305
554 3300006847 Ga0075431_100431028 Ga0075431_1004310281 305
555 3300006852 Ga0075433_10224420 Ga0075433_102244202 305
556 3300006852 Ga0075433_10252385 Ga0075433_102523852 305
557 3300006871 Ga0075434_100063233 Ga0075434_1000632333 305
558 3300006880 Ga0075429_100050163 Ga0075429_1000501633 305
559 3300006880 Ga0075429_100091904 Ga0075429_1000919042 305
560 3300006880 Ga0075429_100094474 Ga0075429_1000944744 305
561 3300006881 Ga0068865_100056511 Ga0068865_1000565112 305
562 3300006881 Ga0068865_100260300 Ga0068865_1002603002 305
563 3300006931 Ga0097620_100114917 Ga0097620_1001149172 305
564 3300006931 Ga0097620_100309232 Ga0097620_1003092322 305
565 3300006931 Ga0097620_100341549 Ga0097620_1003415491 305
566 3300009093 Ga0105240_10043874 Ga0105240_100438742 305
567 3300009093 Ga0105240_10064765 Ga0105240_100647652 305
568 3300009094 Ga0111539_10031210 Ga0111539_100312105 305
569 3300009094 Ga0111539_10277409 Ga0111539_102774091 305
570 3300009094 Ga0111539_10675418 Ga0111539_106754181 305
571 3300009147 Ga0114129_10093237 Ga0114129_100932375 305
572 3300009147 Ga0114129_10176339 Ga0114129_101763393 305
573 3300009147 Ga0114129_10381086 Ga0114129_103810862 305
574 3300009148 Ga0105243_10232472 Ga0105243_102324722 305
575 3300009174 Ga0105241_10004396 Ga0105241_100043965 305
576 3300009174 Ga0105241_10166884 Ga0105241_101668842 305
577 3300009176 Ga0105242_10003021 Ga0105242_100030215 305
578 3300009176 Ga0105242_10006100 Ga0105242_100061007 305
579 3300009177 Ga0105248_10185968 Ga0105248_101859684 305
580 3300009177 Ga0105248_10448313 Ga0105248_104483132 305
581 3300009545 Ga0105237_10009302 Ga0105237_100093026 305
582 3300009551 Ga0105238_10459933 Ga0105238_104599331 305
583 3300009553 Ga0105249_10021095 Ga0105249_100210954 305
584 3300009553 Ga0105249_10058553 Ga0105249_100585534 305
585 3300009553 Ga0105249_10060141 Ga0105249_100601413 305
586 3300010375 Ga0105239_10012617 Ga0105239_100126175 305
587 3300011119 Ga0105246_10042738 Ga0105246_100427382 305
588 3300013100 Ga0157373_10007196 Ga0157373_100071964 305
589 3300013100 Ga0157373_10217816 Ga0157373_102178161 305
590 3300013100 Ga0157373_10341215 Ga0157373_103412151 305
591 3300013102 Ga0157371_10015347 Ga0157371_100153471 305
592 3300013102 Ga0157371_10030981 Ga0157371_100309813 305
593 3300013102 Ga0157371_10079361 Ga0157371_100793613 305
594 3300013104 Ga0157370_10005480 Ga0157370_100054807 305
595 3300013104 Ga0157370_10011127 Ga0157370_100111277 305
596 3300013104 Ga0157370_10102080 Ga0157370_101020803 305
597 3300013104 Ga0157370_10248094 Ga0157370_102480942 305
598 3300013104 Ga0157370_10509787 Ga0157370_105097871 305
599 3300013296 Ga0157374_10022899 Ga0157374_100228993 305
600 3300013296 Ga0157374_10053519 Ga0157374_100535195 305
601 3300013296 Ga0157374_10162036 Ga0157374_101620363 305
602 3300013296 Ga0157374_10196769 Ga0157374_101967693 305
603 3300013297 Ga0157378_10091891 Ga0157378_100918913 305
604 3300013297 Ga0157378_10284743 Ga0157378_102847432 305
605 3300013306 Ga0163162_10635131 Ga0163162_106351311 305
606 3300013307 Ga0157372_10015460 Ga0157372_100154602 305
607 3300013307 Ga0157372_10055142 Ga0157372_100551422 305
608 3300013307 Ga0157372_10067718 Ga0157372_100677185 305
609 3300013307 Ga0157372_10192125 Ga0157372_101921252 305
610 3300013307 Ga0157372_10334192 Ga0157372_103341921 305
611 3300013307 Ga0157372_10651318 Ga0157372_106513181 305
612 3300013308 Ga0157375_10035272 Ga0157375_100352722 305
613 3300013308 Ga0157375_10392539 Ga0157375_103925392 305
614 3300013308 Ga0157375_10438695 Ga0157375_104386952 305
615 3300013308 Ga0157375_10640445 Ga0157375_106404451 305
616 3300014325 Ga0163163_10008192 Ga0163163_1000819212 305
617 3300014325 Ga0163163_10116640 Ga0163163_101166403 305
618 3300014325 Ga0163163_10378901 Ga0163163_103789011 305
619 3300014326 Ga0157380_10035103 Ga0157380_100351032 305
620 3300014326 Ga0157380_10127011 Ga0157380_101270112 305
621 3300014326 Ga0157380_10205732 Ga0157380_102057322 305
622 3300014326 Ga0157380_10426794 Ga0157380_104267942 305
623 3300014745 Ga0157377_10030983 Ga0157377_100309831 305
624 3300014968 Ga0157379_10167729 Ga0157379_101677292 305
625 3300014968 Ga0157379_10263715 Ga0157379_102637152 305
626 3300014968 Ga0157379_10268109 Ga0157379_102681092 305
627 3300014969 Ga0157376_10081417 Ga0157376_100814172 305
628 3300014969 Ga0157376_10101092 Ga0157376_101010921 305
629 3300014969 Ga0157376_10207736 Ga0157376_102077362 305
630 3300017792 Ga0163161_10018613 Ga0163161_100186132 305
631 3300017792 Ga0163161_10030173 Ga0163161_100301732 305
632 3300025321 Ga0207656_10000483 Ga0207656_1000048312 305
633 3300025903 Ga0207680_10130427 Ga0207680_101304273 305
634 3300025907 Ga0207645_10018735 Ga0207645_100187352 305
635 3300025909 Ga0207705_10000623 Ga0207705_1000062321 305
636 3300025909 Ga0207705_10072838 Ga0207705_100728381 305
637 3300025911 Ga0207654_10028106 Ga0207654_100281061 305
638 3300025911 Ga0207654_10172482 Ga0207654_101724821 305
639 3300025912 Ga0207707_10019903 Ga0207707_100199034 305
640 3300025913 Ga0207695_10005932 Ga0207695_100059328 305
641 3300025913 Ga0207695_10029463 Ga0207695_100294634 305
642 3300025913 Ga0207695_10034212 Ga0207695_100342124 305
643 3300025917 Ga0207660_10033757 Ga0207660_100337571 305
644 3300025917 Ga0207660_10067556 Ga0207660_100675561 305
645 3300025917 Ga0207660_10071945 Ga0207660_100719454 305
646 3300025918 Ga0207662_10002985 Ga0207662_100029857 305
647 3300025918 Ga0207662_10058259 Ga0207662_100582592 305
648 3300025919 Ga0207657_10025421 Ga0207657_100254216 305
649 3300025920 Ga0207649_10233776 Ga0207649_102337762 305
650 3300025921 Ga0207652_10002089 Ga0207652_100020893 305
651 3300025921 Ga0207652_10005426 Ga0207652_100054262 305
652 3300025921 Ga0207652_10170678 Ga0207652_101706782 305
653 3300025923 Ga0207681_10108322 Ga0207681_101083222 305
654 3300025923 Ga0207681_10322777 Ga0207681_103227771 305
655 3300025925 Ga0207650_10031978 Ga0207650_100319782 305
656 3300025925 Ga0207650_10085894 Ga0207650_100858942 305
657 3300025925 Ga0207650_10090549 Ga0207650_100905491 305
658 3300025925 Ga0207650_10115851 Ga0207650_101158513 305
659 3300025925 Ga0207650_10148330 Ga0207650_101483302 305
660 3300025925 Ga0207650_10177790 Ga0207650_101777902 305
661 3300025926 Ga0207659_10029299 Ga0207659_100292994 305
662 3300025926 Ga0207659_10286541 Ga0207659_102865412 305
663 3300025932 Ga0207690_10073407 Ga0207690_100734071 305
664 3300025932 Ga0207690_10147506 Ga0207690_101475062 305
665 3300025932 Ga0207690_10263057 Ga0207690_102630571 305
666 3300025932 Ga0207690_10425887 Ga0207690_104258871 305
667 3300025933 Ga0207706_10052994 Ga0207706_100529943 305
668 3300025933 Ga0207706_10077398 Ga0207706_100773982 305
669 3300025933 Ga0207706_10112705 Ga0207706_101127054 305
670 3300025934 Ga0207686_10000884 Ga0207686_100008847 305
671 3300025934 Ga0207686_10171732 Ga0207686_101717321 305
672 3300025936 Ga0207670_10004333 Ga0207670_100043338 305
673 3300025936 Ga0207670_10351037 Ga0207670_103510371 305
674 3300025940 Ga0207691_10019513 Ga0207691_100195136 305
675 3300025942 Ga0207689_10002805 Ga0207689_100028054 305
676 3300025942 Ga0207689_10040689 Ga0207689_100406893 305
677 3300025942 Ga0207689_10244290 Ga0207689_102442901 305
678 3300025944 Ga0207661_10001069 Ga0207661_100010692 305
679 3300025944 Ga0207661_10120313 Ga0207661_101203134 305
680 3300025945 Ga0207679_10013567 Ga0207679_100135674 305
681 3300025945 Ga0207679_10036606 Ga0207679_100366062 305
682 3300025949 Ga0207667_10000049 Ga0207667_10000049131 305
683 3300025949 Ga0207667_10019413 Ga0207667_100194133 305
684 3300025949 Ga0207667_10081514 Ga0207667_100815144 305
685 3300025949 Ga0207667_10198753 Ga0207667_101987532 305
686 3300025949 Ga0207667_10253002 Ga0207667_102530022 305
687 3300025960 Ga0207651_10148977 Ga0207651_101489772 305
688 3300025960 Ga0207651_10294905 Ga0207651_102949051 305
689 3300025961 Ga0207712_10002170 Ga0207712_100021703 305
690 3300025961 Ga0207712_10013251 Ga0207712_100132514 305
691 3300025972 Ga0207668_10032610 Ga0207668_100326102 305
692 3300025972 Ga0207668_10083168 Ga0207668_100831682 305
693 3300025981 Ga0207640_10012544 Ga0207640_100125445 305
694 3300025981 Ga0207640_10069819 Ga0207640_100698192 305
695 3300025981 Ga0207640_10187764 Ga0207640_101877642 305
696 3300025986 Ga0207658_10056336 Ga0207658_100563363 305
697 3300025986 Ga0207658_10132733 Ga0207658_101327332 305
698 3300025986 Ga0207658_10195617 Ga0207658_101956172 305
699 3300025986 Ga0207658_10257330 Ga0207658_102573302 305
700 3300026023 Ga0207677_10038103 Ga0207677_100381033 305
701 3300026035 Ga0207703_10019904 Ga0207703_100199042 305
702 3300026041 Ga0207639_10093975 Ga0207639_100939752 305
703 3300026041 Ga0207639_10257563 Ga0207639_102575632 305
704 3300026088 Ga0207641_10035180 Ga0207641_100351802 305
705 3300026089 Ga0207648_10002623 Ga0207648_1000262312 305
706 3300026095 Ga0207676_10082344 Ga0207676_100823443 305
707 3300026095 Ga0207676_10379983 Ga0207676_103799831 305
708 3300026116 Ga0207674_10033423 Ga0207674_100334235 305
709 3300026116 Ga0207674_10529904 Ga0207674_105299041 305
710 3300026118 Ga0207675_100049100 Ga0207675_1000491006 305
711 3300026118 Ga0207675_100077458 Ga0207675_1000774582 305
712 3300026118 Ga0207675_100429753 Ga0207675_1004297531 305
713 3300026121 Ga0207683_10020712 Ga0207683_100207127 305
714 3300026121 Ga0207683_10124392 Ga0207683_101243922 305
715 3300026142 Ga0207698_10018072 Ga0207698_100180723 305
716 3300026142 Ga0207698_10052775 Ga0207698_100527752 305
717 3300026142 Ga0207698_10327836 Ga0207698_103278361 305
718 3300027876 Ga0209974_10005581 Ga0209974_100055813 305
719 3300028379 Ga0268266_10209886 Ga0268266_102098862 305
720 3300028379 Ga0268266_10269806 Ga0268266_102698062 305
721 3300028379 Ga0268266_10280572 Ga0268266_102805721 305
722 3300028379 Ga0268266_10476697 Ga0268266_104766972 305
723 3300028380 Ga0268265_10219681 Ga0268265_102196812 305
724 3300028381 Ga0268264_10059906 Ga0268264_100599064 305
725 3300028381 Ga0268264_10316568 Ga0268264_103165681 305
726 3300028577 Ga0265318_10000195 Ga0265318_1000019544 305
727 3300028654 Ga0265322_10001230 Ga0265322_100012306 305
728 3300028794 Ga0307515_10000092 Ga0307515_1000009224 305
729 3300031235 Ga0265330_10009657 Ga0265330_100096572 305
730 3300031238 Ga0265332_10036575 Ga0265332_100365752 305
731 3300031240 Ga0265320_10000070 Ga0265320_1000007031 305
732 3300031241 Ga0265325_10033045 Ga0265325_100330452 305
733 3300031242 Ga0265329_10000929 Ga0265329_100009295 305
734 3300031247 Ga0265340_10003007 Ga0265340_100030076 305
735 3300031249 Ga0265339_10087891 Ga0265339_100878911 305
736 3300031250 Ga0265331_10003091 Ga0265331_100030913 305
737 3300031344 Ga0265316_10006923 Ga0265316_100069236 305
738 3300031548 Ga0307408_100040579 Ga0307408_1000405793 305
739 3300031595 Ga0265313_10001878 Ga0265313_100018789 305
740 3300031665 Ga0316575_10001544 Ga0316575_100015442 305
741 3300031665 Ga0316575_10012027 Ga0316575_100120272 305
742 3300031711 Ga0265314_10054940 Ga0265314_100549401 305
743 3300031712 Ga0265342_10000433 Ga0265342_100004339 305
744 3300031727 Ga0316576_10048941 Ga0316576_100489412 305
745 3300031727 Ga0316576_10052550 Ga0316576_100525503 305
746 3300031727 Ga0316576_10198194 Ga0316576_101981941 305
747 3300031852 Ga0307410_10013477 Ga0307410_100134771 305
748 3300031852 Ga0307410_10040082 Ga0307410_100400822 305
749 3300031852 Ga0307410_10123549 Ga0307410_101235492 305
750 3300031903 Ga0307407_10045299 Ga0307407_100452992 305
751 3300031911 Ga0307412_10232205 Ga0307412_102322051 305
752 3300031995 Ga0307409_100085900 Ga0307409_1000859002 305
753 3300032002 Ga0307416_100027174 Ga0307416_1000271741 305
754 3300032002 Ga0307416_100056409 Ga0307416_1000564092 305
755 3300032004 Ga0307414_10367887 Ga0307414_103678871 305
756 3300032005 Ga0307411_10038303 Ga0307411_100383032 305
757 3300032005 Ga0307411_10042060 Ga0307411_100420602 305
758 3300032005 Ga0307411_10189530 Ga0307411_101895301 305
759 3300032126 Ga0307415_100030729 Ga0307415_1000307292 305
760 3300032133 Ga0316583_10004947 Ga0316583_100049474 305
761 3300032133 Ga0316583_10021390 Ga0316583_100213902 305
762 3300032133 Ga0316583_10026515 Ga0316583_100265152 305
763 3300032133 Ga0316583_10035788 Ga0316583_100357882 305
764 3300032133 Ga0316583_10040292 Ga0316583_100402921 305
765 3300032137 Ga0316585_10052164 Ga0316585_100521641 305
766 3300032139 Ga0316580_10001815 Ga0316580_100018153 305
767 3300035172 Ga0373955_0073320 Ga0373955_0073320_319_1269 305
768 3300036401 Ga0373937_0012246 Ga0373937_0012246_1709_2659 305
769 3300036647 Ga0316582_0055855 Ga0316582_0055855_584_1534 305
770 3300037312 Ga0395899_0017367 Ga0395899_0017367_426_1376 305
771 3300037418 Ga0395900_0027156 Ga0395900_0027156_2610_3560 305
772 3300037418 Ga0395900_0124498 Ga0395900_0124498_665_1615 305
773 3300037466 Ga0395898_0085750 Ga0395898_0085750_751_1725 305
774 3300037466 Ga0395898_0154787 Ga0395898_0154787_477_1448 305
775 3300038443 Ga0395901_0001045 Ga0395901_0001045_26730_27680 305
776 3300038443 Ga0395901_0015422 Ga0395901_0015422_1349_2323 305
777 3300042007 Ga0439449_0040168 Ga0439449_0040168_681_1631 305
778 3300042436 Ga0439435_0049817 Ga0439435_0049817_43_1047 305
779 3300042876 Ga0451577_0003018 Ga0451577_0003018_11635_12651 305
780 3300042876 Ga0451577_0147235 Ga0451577_0147235_132_1100 305
781 3300044673 Ga0453683_0049204 Ga0453683_0049204_919_1887 305
782 3300044673 Ga0453683_0204881 Ga0453683_0204881_144_1094 305
783 3300044712 Ga0453684_0000220 Ga0453684_0000220_48571_49521 305
784 3300044712 Ga0453684_0029795 Ga0453684_0029795_4114_5064 305
785 3300044712 Ga0453684_0120717 Ga0453684_0120717_1220_2170 305
786 3300044712 Ga0453684_0187841 Ga0453684_0187841_1350_2300 305
787 3300044712 Ga0453684_0464060 Ga0453684_0464060_444_1394 305
788 3300044712 Ga0453684_0481969 Ga0453684_0481969_328_1296 305
789 3300045051 Ga0451576_0030100 Ga0451576_0030100_3105_4055 305
790 3300045051 Ga0451576_0031338 Ga0451576_0031338_1418_2368 305
791 3300045051 Ga0451576_0255094 Ga0451576_0255094_80_1030 305
792 3300046459 Ga0495629_0105738 Ga0495629_0105738_303_1253 305
793 3300046514 Ga0495618_0038745 Ga0495618_0038745_1048_1998 305
794 3300046517 Ga0495630_0361005 Ga0495630_0361005_46_996 305
795 3300046533 Ga0495640_0081835 Ga0495640_0081835_961_1911 305
796 3300046536 Ga0495587_0034140 Ga0495587_0034140_1075_2025 305
797 3300046536 Ga0495587_0094614 Ga0495587_0094614_648_1613 305
798 3300046537 Ga0495598_0007722 Ga0495598_0007722_814_1764 305
799 3300046615 Ga0495656_0001607 Ga0495656_0001607_1950_2903 305
800 3300046615 Ga0495656_0118129 Ga0495656_0118129_252_1202 305
801 3300046642 Ga0495634_0038710 Ga0495634_0038710_2255_3205 305
802 3300046663 Ga0495635_0014765 Ga0495635_0014765_951_1901 305
803 3300046675 Ga0495657_0220443 Ga0495657_0220443_134_1084 305
804 3300046678 Ga0495599_0119314 Ga0495599_0119314_65_1015 305
805 3300046678 Ga0495599_0189701 Ga0495599_0189701_65_1018 305
806 3300046684 Ga0495669_0006927 Ga0495669_0006927_2971_3939 305
807 3300046691 Ga0495670_0124712 Ga0495670_0124712_257_1207 305
808 3300046809 Ga0495600_0122883 Ga0495600_0122883_324_1274 305
809 3300047315 Ga0495581_0079809 Ga0495581_0079809_890_1855 305
810 3300047317 Ga0495604_0111219 Ga0495604_0111219_447_1397 305
811 3300047317 Ga0495604_0220447 Ga0495604_0220447_293_1243 305
812 3300047444 Ga0495675_0051785 Ga0495675_0051785_246_1211 305
813 3300047471 Ga0495684_0057463 Ga0495684_0057463_1869_2819 305
814 3300048088 Ga0495602_0092839 Ga0495602_0092839_1112_2062 305
815 3300048907 Ga0496104_0088030 Ga0496104_0088030_663_1613 305
816 3300048908 Ga0496105_0087649 Ga0496105_0087649_351_1301 305
817 3300048911 Ga0496108_0057265 Ga0496108_0057265_197_1165 305
818 3300048911 Ga0496108_0161989 Ga0496108_0161989_828_1781 305
819 3300048912 Ga0496109_0130602 Ga0496109_0130602_1315_2283 305
820 3300048915 Ga0496112_0117533 Ga0496112_0117533_32_982 305
821 3300048917 Ga0496114_0058821 Ga0496114_0058821_1807_2757 305
822 3300049569 Ga0501032_0128267 Ga0501032_0128267_120_1070 305
823 3300049570 Ga0501033_0045063 Ga0501033_0045063_296_1246 305
824 3300049570 Ga0501033_0226804 Ga0501033_0226804_80_1030 305
825 3300049571 Ga0501034_0010869 Ga0501034_0010869_6113_7063 305
826 3300049572 Ga0501036_0006252 Ga0501036_0006252_4883_5860 305
827 3300049572 Ga0501036_0115614 Ga0501036_0115614_118_1068 305
828 3300049573 Ga0501037_0014266 Ga0501037_0014266_1056_2006 305
829 3300049573 Ga0501037_0038256 Ga0501037_0038256_21_971 305
830 3300049574 Ga0501038_0069442 Ga0501038_0069442_1810_2760 305
831 3300049574 Ga0501038_0090020 Ga0501038_0090020_695_1672 305
832 3300049574 Ga0501038_0112482 Ga0501038_0112482_761_1711 305
833 3300049574 Ga0501038_0247264 Ga0501038_0247264_232_1182 305
834 3300049575 Ga0501039_0016664 Ga0501039_0016664_3054_4004 305
835 3300049575 Ga0501039_0022435 Ga0501039_0022435_1729_2679 305
836 3300049575 Ga0501039_0084494 Ga0501039_0084494_954_1931 305
837 3300049576 Ga0501040_0001939 Ga0501040_0001939_5133_6110 305
838 3300049576 Ga0501040_0028138 Ga0501040_0028138_2714_3664 305
839 3300049578 Ga0501042_0014495 Ga0501042_0014495_3088_4038 305
840 3300049578 Ga0501042_0095252 Ga0501042_0095252_295_1272 305
841 3300049579 Ga0501043_0150986 Ga0501043_0150986_80_1030 305
842 3300049580 Ga0501046_0018198 Ga0501046_0018198_1057_2007 305
843 3300049580 Ga0501046_0062127 Ga0501046_0062127_1440_2417 305
844 3300049581 Ga0501047_0034670 Ga0501047_0034670_2238_3188 305
845 3300049582 Ga0501048_0009500 Ga0501048_0009500_1117_2094 305
846 3300049582 Ga0501048_0046381 Ga0501048_0046381_293_1243 305
847 3300049582 Ga0501048_0210136 Ga0501048_0210136_417_1367 305
848 3300049584 Ga0501068_0270012 Ga0501068_0270012_34_984 305
849 3300049588 Ga0501072_0022119 Ga0501072_0022119_631_1608 305
850 3300049590 Ga0501074_0095165 Ga0501074_0095165_320_1270 305
851 3300049591 Ga0501075_0008564 Ga0501075_0008564_2775_3740 305
852 3300049591 Ga0501075_0093423 Ga0501075_0093423_1131_2108 305
853 3300049592 Ga0501076_0008547 Ga0501076_0008547_2788_3765 305
854 3300049592 Ga0501076_0033519 Ga0501076_0033519_3027_3986 305
855 3300049592 Ga0501076_0301692 Ga0501076_0301692_225_1175 305
856 3300049592 Ga0501076_0305508 Ga0501076_0305508_183_1133 305
857 3300049593 Ga0501077_0009906 Ga0501077_0009906_4576_5541 305
858 3300049649 Ga0501198_012893 Ga0501198_012893_263_1213 305
859 3300049652 Ga0501202_029143 Ga0501202_029143_147_1097 305
860 3300049661 Ga0501217_000055 Ga0501217_000055_4314_5264 305
861 3300049662 Ga0501222_004506 Ga0501222_004506_790_1740 305
862 3300049663 Ga0501223_001899 Ga0501223_001899_2534_3484 305
863 3300049668 Ga0501233_004326 Ga0501233_004326_29_979 305
864 3300049675 Ga0501243_000975 Ga0501243_000975_942_1892 305
865 3300049688 Ga0501259_001374 Ga0501259_001374_1172_2122 305
866 3300049704 Ga0501221_000337 Ga0501221_000337_3654_4604 305
867 3300049705 Ga0501225_0001107 Ga0501225_0001107_5546_6496 305
868 3300049708 Ga0501245_000875 Ga0501245_000875_2232_3182 305
869 3300049741 Ga0501079_0010716 Ga0501079_0010716_222_1199 305
870 3300049741 Ga0501079_0060330 Ga0501079_0060330_1052_2002 305
871 3300049741 Ga0501079_0146628 Ga0501079_0146628_170_1135 305
872 3300049741 Ga0501079_0158162 Ga0501079_0158162_311_1261 305
873 3300049741 Ga0501079_0188864 Ga0501079_0188864_115_1065 305
874 3300049742 Ga0501080_0014784 Ga0501080_0014784_3767_4744 305
875 3300049743 Ga0501081_0007334 Ga0501081_0007334_5346_6323 305
876 3300049743 Ga0501081_0012374 Ga0501081_0012374_3151_4116 305
877 3300049743 Ga0501081_0135937 Ga0501081_0135937_463_1413 305
878 3300049760 Ga0501263_007208 Ga0501263_007208_30_995 305
879 3300049765 Ga0501268_023281 Ga0501268_023281_68_1033 305
880 3300049822 Ga0501035_0035768 Ga0501035_0035768_2126_3076 305
881 3300049822 Ga0501035_0133458 Ga0501035_0133458_1198_2148 305
882 3300049823 Ga0501044_0002454 Ga0501044_0002454_2104_3054 305
883 3300049824 Ga0501045_0002074 Ga0501045_0002074_7732_8709 305
884 3300049824 Ga0501045_0039920 Ga0501045_0039920_2122_3072 305
885 3300049824 Ga0501045_0043711 Ga0501045_0043711_2023_2973 305
886 3300049824 Ga0501045_0051695 Ga0501045_0051695_1987_2952 305
887 3300050507 nmdc:mga05p37_142569_c1 nmdc:mga05p37_142569_c1_472_1425 305
888 3300050507 nmdc:mga05p37_148017_c1 nmdc:mga05p37_148017_c1_817_1767 305
889 3300050507 nmdc:mga05p37_50876_c1 nmdc:mga05p37_50876_c1_2911_3897 305
890 3300050508 nmdc:mga09592_275417_c1 nmdc:mga09592_275417_c1_319_1305 305
891 3300050508 nmdc:mga09592_40794_c1 nmdc:mga09592_40794_c1_1282_2232 305
892 3300050508 nmdc:mga09592_87369_c1 nmdc:mga09592_87369_c1_1164_2114 305
893 3300050508 nmdc:mga09592_99597_c1 nmdc:mga09592_99597_c1_1150_2100 305
894 3300050509 nmdc:mga0qj67_12488_c1 nmdc:mga0qj67_12488_c1_1678_2628 305
895 3300050509 nmdc:mga0qj67_2698_c1 nmdc:mga0qj67_2698_c1_9999_10949 305
896 3300050509 nmdc:mga0qj67_53056_c1 nmdc:mga0qj67_53056_c1_951_1916 305
897 3300050510 nmdc:mga06r32_354305_c1 nmdc:mga06r32_354305_c1_73_1023 305
898 3300050510 nmdc:mga06r32_418705_c1 nmdc:mga06r32_418705_c1_293_1243 305
899 3300050510 nmdc:mga06r32_47840_c1 nmdc:mga06r32_47840_c1_421_1371 305
900 3300050510 nmdc:mga06r32_55517_c1 nmdc:mga06r32_55517_c1_1506_2492 305
901 3300050510 nmdc:mga06r32_8661_c1 nmdc:mga06r32_8661_c1_5991_6956 305
902 3300050514 nmdc:mga08x19_185705_c1 nmdc:mga08x19_185705_c1_150_1136 305
903 3300050515 nmdc:mga0a205_119095_c1 nmdc:mga0a205_119095_c1_869_1855 305
904 3300050515 nmdc:mga0a205_90561_c1 nmdc:mga0a205_90561_c1_290_1243 305
905 3300053077 Ga0495601_0045849 Ga0495601_0045849_483_1433 305
906 3300053077 Ga0495601_0084683 Ga0495601_0084683_733_1683 305
907 3300053084 Ga0495595_0010711 Ga0495595_0010711_458_1408 305
908 3300053085 Ga0495619_0005570 Ga0495619_0005570_4945_5895 305
909 3300053085 Ga0495619_0023411 Ga0495619_0023411_2054_3004 305
910 3300054114 Ga0501084_0159099 Ga0501084_0159099_58_1008 305
911 3300054114 Ga0501084_0214105 Ga0501084_0214105_241_1218 305
912 3300060353 Ga0501082_0004906 Ga0501082_0004906_5036_6013 305
913 3300060353 Ga0501082_0015866 Ga0501082_0015866_2445_3410 305
914 3300061734 Ga0530510_0002730 Ga0530510_0002730_6095_7072 305
915 3300061734 Ga0530510_0086070 Ga0530510_0086070_284_1234 305
916 3300061734 Ga0530510_0104328 Ga0530510_0104328_680_1645 305
917 3300061734 Ga0530510_0138981 Ga0530510_0138981_128_1078 305
918 3300061734 Ga0530510_0140894 Ga0530510_0140894_171_1121 305

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05368

NmrA

NmrA-like family

35

280

0.89

PF13460

NAD_binding_10

NAD(P)H-binding

39

197

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dxf-assembly2.cif.gz_B crystal structure of the hscarg r37a mutant 0.897 4 301
3dxf-assembly2.cif.gz_B crystal structure of the hscarg r37a mutant 0.8909 4 301
2wmd-assembly1.cif.gz_A-2 crystal structure of nmra-like family domain containing protein 1 in complex with nadp and 2-(4-chloro-phenylamino)-nicotinic acid 0.8858 4 304
3dxf-assembly1.cif.gz_A crystal structure of the hscarg r37a mutant 0.8842 4 301
2wmd-assembly1.cif.gz_A-2 crystal structure of nmra-like family domain containing protein 1 in complex with nadp and 2-(4-chloro-phenylamino)-nicotinic acid 0.883 4 304
ID Description Score Start End Superfamily
3dxfA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8415 4 287 3.40.50.720
3dxfA02 Alpha Beta;Alpha-Beta Complex;UDP-galactose 4-epimerase; domain 1;UDP-galactose 4-epimerase, domain 1 0.8404 156 301 3.90.25.10
5f5lA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8348 3 305 3.40.50.720
3dxfA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8331 4 287 3.40.50.720
5f5lA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8321 3 305 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A533XDF9-F1-model_v4 NmrA/HSCARG family protein 0.9939 137 305
AF-A0A524LHP2-F1-model_v4 NmrA/HSCARG family protein 0.9934 60 305
AF-A0A7Y2CQ11-F1-model_v4 NmrA family NAD(P)-binding protein 0.9864 178 305
AF-A0A838NQV1-F1-model_v4 NmrA family NAD(P)-binding protein 0.9861 165 305
AF-A0A524LHP2-F1-model_v4 NmrA/HSCARG family protein 0.9854 60 305

Feature Viewer

pLDDT pTM Quality
92.36 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map