F485609
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 916 | 360 | 916 | 99 |
Family's Representative Sequence
| Representative Sequence | 3300005338|Ga0068868_100583301|Ga0068868_1005833011 |
| Length | 119 |
| Sequence | MGRSLKKGPFVDTHLLEKIEVMNRAADKKVIKTWSRRSTVIPEMVGHTLAVHNGRKFIPVYVTENMVGHKLGEFAPTRLFKGHTTKVAEKAATVAPTGPSAAATGQGGGKPAGAGSQSS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 2 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 3 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 42 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 50 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 58 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 60 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 61 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 63 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 64 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 65 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 66 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 67 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 68 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 69 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 70 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 71 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 72 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 73 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 74 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 75 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 76 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 77 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 79 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 80 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 82 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 83 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 84 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 85 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 86 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 87 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 88 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 89 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 90 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 91 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 93 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 94 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 95 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 109 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 121 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 181 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 184 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 185 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 186 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 187 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 188 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 189 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 190 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 191 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 192 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 193 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 194 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 195 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 196 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 197 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 198 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 199 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 200 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 201 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 202 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 203 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 204 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 205 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 206 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 207 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 208 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 209 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 210 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 211 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 212 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 213 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 214 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 215 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 216 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 217 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 218 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 219 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 220 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 221 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 222 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 223 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 224 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 225 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 226 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 227 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 228 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 229 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 230 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 231 | 3300042116 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 | Metagenome | Rhizosphere |
| 232 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 233 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 234 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 235 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 236 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 237 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 238 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 239 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 240 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 284 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 285 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 286 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 287 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 288 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 289 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 290 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 291 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 292 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 293 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 294 | 3300049525 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F21_B_7_control | Metagenome | Rhizosphere |
| 295 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 296 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 301 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 304 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 309 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 311 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 314 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 315 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 316 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 317 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 318 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 320 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 321 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 323 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 326 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 327 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 328 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 330 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 331 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 332 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 333 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 334 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 335 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 336 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 337 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 338 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 339 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 340 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 341 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 342 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 343 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 349 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 350 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 351 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 352 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 353 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 354 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 355 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 356 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 357 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 358 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 359 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.24 |
| Metatranscriptomes | 0.76 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.75 |
| Nodule | 0 |
| Rhizoplane | 2.07 |
| Rhizosphere | 95.74 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.44 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0058860_12047537 | 3300004801 | Bacteria | 682 |
| 2 | Ga0058862_12254497 | 3300004803 | Bacteria | 746 |
| 3 | Ga0065714_10257652 | 3300005288 | Bacteria | 763 |
| 4 | Ga0065704_10056506 | 3300005289 | Bacteria | 668 |
| 5 | Ga0065707_10428556 | 3300005295 | Bacteria | 795 |
| 6 | Ga0070658_10015417 | 3300005327 | Bacteria | 6115 |
| 7 | Ga0070676_10662519 | 3300005328 | Bacteria | 759 |
| 8 | Ga0070683_100222088 | 3300005329 | Bacteria | 1796 |
| 9 | Ga0070683_100283868 | 3300005329 | Bacteria | 1575 |
| 10 | Ga0070683_100990462 | 3300005329 | Bacteria | 807 |
| 11 | Ga0070690_100080948 | 3300005330 | Bacteria | 2124 |
| 12 | Ga0070690_100263307 | 3300005330 | Bacteria | 1224 |
| 13 | Ga0068869_100137668 | 3300005334 | Bacteria | 1882 |
| 14 | Ga0068869_101320443 | 3300005334 | Bacteria | 637 |
| 15 | Ga0068869_101494463 | 3300005334 | Bacteria | 600 |
| 16 | Ga0070666_10028665 | 3300005335 | Bacteria | 3654 |
| 17 | Ga0070666_10280388 | 3300005335 | Bacteria | 1184 |
| 18 | Ga0070666_10549870 | 3300005335 | Bacteria | 840 |
| 19 | Ga0070680_100078049 | 3300005336 | Bacteria | 2728 |
| 20 | Ga0070680_100220627 | 3300005336 | Bacteria | 1600 |
| 21 | Ga0070680_101526567 | 3300005336 | Bacteria | 579 |
| 22 | Ga0068868_100583301 | 3300005338 | Bacteria | 989 |
| 23 | Ga0068868_101472963 | 3300005338 | Bacteria | 637 |
| 24 | Ga0068868_102240447 | 3300005338 | Bacteria | 521 |
| 25 | Ga0070660_100002494 | 3300005339 | Bacteria | 12634 |
| 26 | Ga0070660_100519310 | 3300005339 | Bacteria | 992 |
| 27 | Ga0070689_100820233 | 3300005340 | Bacteria | 819 |
| 28 | Ga0070689_102225580 | 3300005340 | Bacteria | 503 |
| 29 | Ga0070691_10002062 | 3300005341 | Bacteria | 8874 |
| 30 | Ga0070691_10209094 | 3300005341 | Bacteria | 1029 |
| 31 | Ga0070687_100081895 | 3300005343 | Bacteria | 1763 |
| 32 | Ga0070661_101318685 | 3300005344 | Bacteria | 606 |
| 33 | Ga0070692_10221517 | 3300005345 | Bacteria | 1119 |
| 34 | Ga0070692_10232948 | 3300005345 | Bacteria | 1094 |
| 35 | Ga0070668_100066366 | 3300005347 | Bacteria | 2800 |
| 36 | Ga0070668_100428978 | 3300005347 | Bacteria | 1133 |
| 37 | Ga0070668_101134675 | 3300005347 | Bacteria | 706 |
| 38 | Ga0070669_100021577 | 3300005353 | Bacteria | 4602 |
| 39 | Ga0070669_100023184 | 3300005353 | Bacteria | 4444 |
| 40 | Ga0070669_100049339 | 3300005353 | Bacteria | 3074 |
| 41 | Ga0070669_100122468 | 3300005353 | Bacteria | 1986 |
| 42 | Ga0070669_100360128 | 3300005353 | Bacteria | 1182 |
| 43 | Ga0070675_100176804 | 3300005354 | Bacteria | 1844 |
| 44 | Ga0070675_100521101 | 3300005354 | Bacteria | 1073 |
| 45 | Ga0070671_101335601 | 3300005355 | Bacteria | 633 |
| 46 | Ga0070671_101448647 | 3300005355 | Bacteria | 607 |
| 47 | Ga0070674_100095772 | 3300005356 | Bacteria | 2152 |
| 48 | Ga0070674_100125476 | 3300005356 | Bacteria | 1905 |
| 49 | Ga0070673_100340219 | 3300005364 | Bacteria | 1329 |
| 50 | Ga0070673_101173994 | 3300005364 | Bacteria | 719 |
| 51 | Ga0070673_101604621 | 3300005364 | Bacteria | 615 |
| 52 | Ga0070688_100288505 | 3300005365 | Bacteria | 1182 |
| 53 | Ga0070659_100864427 | 3300005366 | Bacteria | 789 |
| 54 | Ga0070659_102134373 | 3300005366 | Bacteria | 504 |
| 55 | Ga0070667_100811910 | 3300005367 | Bacteria | 869 |
| 56 | Ga0070667_101348383 | 3300005367 | Bacteria | 669 |
| 57 | Ga0070709_10258210 | 3300005434 | Bacteria | 1258 |
| 58 | Ga0070714_100072180 | 3300005435 | Bacteria | 2988 |
| 59 | Ga0070710_10945356 | 3300005437 | Bacteria | 625 |
| 60 | Ga0070701_10045623 | 3300005438 | Bacteria | 2250 |
| 61 | Ga0070711_101213651 | 3300005439 | Bacteria | 653 |
| 62 | Ga0070705_100100040 | 3300005440 | Bacteria | 1828 |
| 63 | Ga0070705_100124788 | 3300005440 | Bacteria | 1669 |
| 64 | Ga0070705_100177513 | 3300005440 | Bacteria | 1439 |
| 65 | Ga0070705_100301143 | 3300005440 | Bacteria | 1149 |
| 66 | Ga0070705_100955804 | 3300005440 | Bacteria | 693 |
| 67 | Ga0070700_100007525 | 3300005441 | Bacteria | 5888 |
| 68 | Ga0070700_101631704 | 3300005441 | Bacteria | 552 |
| 69 | Ga0070694_100046094 | 3300005444 | Bacteria | 2925 |
| 70 | Ga0070694_100308334 | 3300005444 | Bacteria | 1215 |
| 71 | Ga0070694_100747206 | 3300005444 | Bacteria | 799 |
| 72 | Ga0070694_100958433 | 3300005444 | Bacteria | 709 |
| 73 | Ga0070708_100026666 | 3300005445 | Bacteria | 4949 |
| 74 | Ga0070708_100056686 | 3300005445 | Bacteria | 3486 |
| 75 | Ga0070708_100294516 | 3300005445 | Bacteria | 1528 |
| 76 | Ga0070708_100835308 | 3300005445 | Bacteria | 865 |
| 77 | Ga0070678_100220398 | 3300005456 | Bacteria | 1576 |
| 78 | Ga0070678_100834445 | 3300005456 | Bacteria | 839 |
| 79 | Ga0070678_101079437 | 3300005456 | Bacteria | 741 |
| 80 | Ga0070662_100092319 | 3300005457 | Bacteria | 2275 |
| 81 | Ga0070662_100260871 | 3300005457 | Bacteria | 1396 |
| 82 | Ga0070662_100540528 | 3300005457 | Bacteria | 975 |
| 83 | Ga0070662_100757359 | 3300005457 | Bacteria | 824 |
| 84 | Ga0070662_101269695 | 3300005457 | Bacteria | 633 |
| 85 | Ga0070662_101381348 | 3300005457 | Bacteria | 607 |
| 86 | Ga0070681_10065223 | 3300005458 | Bacteria | 3610 |
| 87 | Ga0070681_10758920 | 3300005458 | Bacteria | 887 |
| 88 | Ga0068867_100045942 | 3300005459 | Bacteria | 3205 |
| 89 | Ga0068867_100178953 | 3300005459 | Bacteria | 1685 |
| 90 | Ga0068867_100223316 | 3300005459 | Bacteria | 1519 |
| 91 | Ga0068867_100705473 | 3300005459 | Bacteria | 891 |
| 92 | Ga0070685_11002339 | 3300005466 | Bacteria | 627 |
| 93 | Ga0070706_100001965 | 3300005467 | Bacteria | 21177 |
| 94 | Ga0070706_100042306 | 3300005467 | Bacteria | 4208 |
| 95 | Ga0070706_100816889 | 3300005467 | Bacteria | 863 |
| 96 | Ga0070706_101253105 | 3300005467 | Bacteria | 681 |
| 97 | Ga0070707_100008827 | 3300005468 | Bacteria | 9346 |
| 98 | Ga0070707_100876942 | 3300005468 | Bacteria | 862 |
| 99 | Ga0070698_100002716 | 3300005471 | Bacteria | 19449 |
| 100 | Ga0070699_100009009 | 3300005518 | Bacteria | 8645 |
| 101 | Ga0070699_100010853 | 3300005518 | Bacteria | 7883 |
| 102 | Ga0070679_100021144 | 3300005530 | Bacteria | 6348 |
| 103 | Ga0070697_100035245 | 3300005536 | Bacteria | 4036 |
| 104 | Ga0070697_100218055 | 3300005536 | Bacteria | 1626 |
| 105 | Ga0070697_100268660 | 3300005536 | Bacteria | 1461 |
| 106 | Ga0070697_100574344 | 3300005536 | Bacteria | 990 |
| 107 | Ga0070697_101664463 | 3300005536 | Bacteria | 571 |
| 108 | Ga0068853_100978962 | 3300005539 | Bacteria | 814 |
| 109 | Ga0070672_101140301 | 3300005543 | Bacteria | 694 |
| 110 | Ga0070686_100002243 | 3300005544 | Bacteria | 10661 |
| 111 | Ga0070686_100313286 | 3300005544 | Bacteria | 1168 |
| 112 | Ga0070686_100518295 | 3300005544 | Bacteria | 928 |
| 113 | Ga0070686_100687758 | 3300005544 | Bacteria | 815 |
| 114 | Ga0070686_101414077 | 3300005544 | Bacteria | 584 |
| 115 | Ga0070695_100014951 | 3300005545 | Bacteria | 4683 |
| 116 | Ga0070695_100088758 | 3300005545 | Bacteria | 2059 |
| 117 | Ga0070695_100114259 | 3300005545 | Bacteria | 1838 |
| 118 | Ga0070695_101400197 | 3300005545 | Bacteria | 580 |
| 119 | Ga0070696_100086961 | 3300005546 | Bacteria | 2220 |
| 120 | Ga0070696_100341200 | 3300005546 | Bacteria | 1158 |
| 121 | Ga0070696_100425290 | 3300005546 | Bacteria | 1044 |
| 122 | Ga0070696_100955133 | 3300005546 | Bacteria | 714 |
| 123 | Ga0070696_101491205 | 3300005546 | Bacteria | 579 |
| 124 | Ga0070693_100390904 | 3300005547 | Bacteria | 962 |
| 125 | Ga0070693_100486478 | 3300005547 | Bacteria | 873 |
| 126 | Ga0070665_100004733 | 3300005548 | Bacteria | 14164 |
| 127 | Ga0070665_100083981 | 3300005548 | Bacteria | 3189 |
| 128 | Ga0070665_100127472 | 3300005548 | Bacteria | 2547 |
| 129 | Ga0070704_100016081 | 3300005549 | Bacteria | 4719 |
| 130 | Ga0070704_100094027 | 3300005549 | Bacteria | 2242 |
| 131 | Ga0070704_100116558 | 3300005549 | Bacteria | 2043 |
| 132 | Ga0070704_100207477 | 3300005549 | Bacteria | 1586 |
| 133 | Ga0070704_100240273 | 3300005549 | Bacteria | 1482 |
| 134 | Ga0070704_100450947 | 3300005549 | Bacteria | 1108 |
| 135 | Ga0070704_102142396 | 3300005549 | Bacteria | 520 |
| 136 | Ga0068855_100037327 | 3300005563 | Bacteria | 5778 |
| 137 | Ga0068855_102152928 | 3300005563 | Bacteria | 561 |
| 138 | Ga0070664_100428998 | 3300005564 | Bacteria | 1211 |
| 139 | Ga0068857_101410487 | 3300005577 | Bacteria | 678 |
| 140 | Ga0068854_100810471 | 3300005578 | Bacteria | 817 |
| 141 | Ga0068854_101861472 | 3300005578 | Bacteria | 553 |
| 142 | Ga0070702_100195821 | 3300005615 | Bacteria | 1334 |
| 143 | Ga0070702_100950307 | 3300005615 | Bacteria | 677 |
| 144 | Ga0068852_100497418 | 3300005616 | Bacteria | 1213 |
| 145 | Ga0068859_100064378 | 3300005617 | Bacteria | 3699 |
| 146 | Ga0068859_102193319 | 3300005617 | Bacteria | 609 |
| 147 | Ga0068859_102388070 | 3300005617 | Bacteria | 583 |
| 148 | Ga0068864_100339216 | 3300005618 | Bacteria | 1416 |
| 149 | Ga0068864_100709023 | 3300005618 | Bacteria | 983 |
| 150 | Ga0068866_10025223 | 3300005718 | Bacteria | 2793 |
| 151 | Ga0068866_11023427 | 3300005718 | Bacteria | 588 |
| 152 | Ga0068866_11184926 | 3300005718 | Bacteria | 551 |
| 153 | Ga0068861_100014830 | 3300005719 | Bacteria | 5476 |
| 154 | Ga0068861_100039337 | 3300005719 | Bacteria | 3528 |
| 155 | Ga0068861_101070073 | 3300005719 | Bacteria | 774 |
| 156 | Ga0068861_101564511 | 3300005719 | Bacteria | 649 |
| 157 | Ga0068861_101973936 | 3300005719 | Bacteria | 582 |
| 158 | Ga0068870_10146720 | 3300005840 | Bacteria | 1386 |
| 159 | Ga0068870_10778808 | 3300005840 | Bacteria | 667 |
| 160 | Ga0068863_100097852 | 3300005841 | Bacteria | 2787 |
| 161 | Ga0068863_100184464 | 3300005841 | Bacteria | 2003 |
| 162 | Ga0068863_101947062 | 3300005841 | Bacteria | 598 |
| 163 | Ga0068858_100008638 | 3300005842 | Bacteria | 9781 |
| 164 | Ga0068858_100083129 | 3300005842 | Bacteria | 2977 |
| 165 | Ga0068858_100497176 | 3300005842 | Bacteria | 1178 |
| 166 | Ga0068858_101028204 | 3300005842 | Bacteria | 808 |
| 167 | Ga0068858_101053517 | 3300005842 | Bacteria | 798 |
| 168 | Ga0068860_100424288 | 3300005843 | Bacteria | 1319 |
| 169 | Ga0068860_100611688 | 3300005843 | Bacteria | 1096 |
| 170 | Ga0068860_101590022 | 3300005843 | Bacteria | 675 |
| 171 | Ga0068862_101281598 | 3300005844 | Bacteria | 733 |
| 172 | Ga0068862_102497059 | 3300005844 | Bacteria | 528 |
| 173 | Ga0081455_10753556 | 3300005937 | Bacteria | 615 |
| 174 | Ga0081539_10001809 | 3300005985 | Bacteria | 33796 |
| 175 | Ga0081539_10367087 | 3300005985 | Bacteria | 602 |
| 176 | Ga0075363_100000313 | 3300006048 | Bacteria | 14335 |
| 177 | Ga0075364_10876024 | 3300006051 | Unclassified | 611 |
| 178 | Ga0075432_10496902 | 3300006058 | Bacteria | 543 |
| 179 | Ga0070716_100709258 | 3300006173 | Bacteria | 770 |
| 180 | Ga0075369_10337499 | 3300006186 | Bacteria | 706 |
| 181 | Ga0075366_10116081 | 3300006195 | Unclassified | 1612 |
| 182 | Ga0097621_100164463 | 3300006237 | Bacteria | 1909 |
| 183 | Ga0097621_100470680 | 3300006237 | Bacteria | 1134 |
| 184 | Ga0075370_10000090 | 3300006353 | Bacteria | 27996 |
| 185 | Ga0068871_100247538 | 3300006358 | Bacteria | 1552 |
| 186 | Ga0068871_100273633 | 3300006358 | Bacteria | 1476 |
| 187 | Ga0068871_102000040 | 3300006358 | Bacteria | 552 |
| 188 | Ga0075428_100003976 | 3300006844 | Bacteria | 16226 |
| 189 | Ga0075428_100041079 | 3300006844 | Bacteria | 5087 |
| 190 | Ga0075428_100052271 | 3300006844 | Bacteria | 4478 |
| 191 | Ga0075428_100068017 | 3300006844 | Bacteria | 3897 |
| 192 | Ga0075430_100000851 | 3300006846 | Bacteria | 23937 |
| 193 | Ga0075430_100004590 | 3300006846 | Bacteria | 11623 |
| 194 | Ga0075430_100037664 | 3300006846 | Bacteria | 4099 |
| 195 | Ga0075430_100045839 | 3300006846 | Bacteria | 3693 |
| 196 | Ga0075430_100226489 | 3300006846 | Bacteria | 1551 |
| 197 | Ga0075431_100000559 | 3300006847 | Bacteria | 31330 |
| 198 | Ga0075431_100004746 | 3300006847 | Bacteria | 13363 |
| 199 | Ga0075431_100011238 | 3300006847 | Bacteria | 9017 |
| 200 | Ga0075431_100028459 | 3300006847 | Bacteria | 5743 |
| 201 | Ga0075431_100038375 | 3300006847 | Bacteria | 4932 |
| 202 | Ga0075431_100079415 | 3300006847 | Bacteria | 3386 |
| 203 | Ga0075431_100179876 | 3300006847 | Bacteria | 2171 |
| 204 | Ga0075431_100599993 | 3300006847 | Bacteria | 1085 |
| 205 | Ga0075431_100633742 | 3300006847 | Bacteria | 1050 |
| 206 | Ga0075433_10120900 | 3300006852 | Bacteria | 2325 |
| 207 | Ga0075433_10224184 | 3300006852 | Bacteria | 1669 |
| 208 | Ga0075433_10370500 | 3300006852 | Bacteria | 1265 |
| 209 | Ga0075433_10500166 | 3300006852 | Bacteria | 1070 |
| 210 | Ga0075433_10846187 | 3300006852 | Bacteria | 799 |
| 211 | Ga0075433_11050999 | 3300006852 | Bacteria | 709 |
| 212 | Ga0075433_11118545 | 3300006852 | Bacteria | 685 |
| 213 | Ga0075433_11368630 | 3300006852 | Bacteria | 612 |
| 214 | Ga0075434_100037241 | 3300006871 | Bacteria | 4816 |
| 215 | Ga0075434_100039528 | 3300006871 | Bacteria | 4675 |
| 216 | Ga0075434_100089001 | 3300006871 | Bacteria | 3089 |
| 217 | Ga0075434_100113212 | 3300006871 | Bacteria | 2725 |
| 218 | Ga0075434_100203297 | 3300006871 | Bacteria | 2001 |
| 219 | Ga0075434_100287390 | 3300006871 | Bacteria | 1664 |
| 220 | Ga0075434_100292687 | 3300006871 | Bacteria | 1648 |
| 221 | Ga0075434_100299949 | 3300006871 | Bacteria | 1627 |
| 222 | Ga0075434_100471709 | 3300006871 | Bacteria | 1276 |
| 223 | Ga0075434_100544981 | 3300006871 | Bacteria | 1180 |
| 224 | Ga0075434_100974893 | 3300006871 | Bacteria | 862 |
| 225 | Ga0075434_101458197 | 3300006871 | Bacteria | 694 |
| 226 | Ga0075434_101463716 | 3300006871 | Bacteria | 692 |
| 227 | Ga0075429_100000843 | 3300006880 | Bacteria | 24082 |
| 228 | Ga0075429_100032187 | 3300006880 | Bacteria | 4557 |
| 229 | Ga0075429_100057615 | 3300006880 | Bacteria | 3383 |
| 230 | Ga0075429_100144453 | 3300006880 | Bacteria | 2082 |
| 231 | Ga0075429_100146367 | 3300006880 | Bacteria | 2067 |
| 232 | Ga0068865_100006729 | 3300006881 | Bacteria | 7032 |
| 233 | Ga0068865_100277192 | 3300006881 | Bacteria | 1334 |
| 234 | Ga0068865_100334604 | 3300006881 | Bacteria | 1222 |
| 235 | Ga0068865_100411019 | 3300006881 | Bacteria | 1110 |
| 236 | Ga0068865_100766952 | 3300006881 | Bacteria | 830 |
| 237 | Ga0068865_101121383 | 3300006881 | Bacteria | 694 |
| 238 | Ga0075436_100111308 | 3300006914 | Bacteria | 1911 |
| 239 | Ga0075436_100133842 | 3300006914 | Bacteria | 1739 |
| 240 | Ga0075436_100198493 | 3300006914 | Bacteria | 1420 |
| 241 | Ga0075436_100286757 | 3300006914 | Bacteria | 1178 |
| 242 | Ga0075436_100533205 | 3300006914 | Bacteria | 861 |
| 243 | Ga0075436_101340573 | 3300006914 | Bacteria | 542 |
| 244 | Ga0097620_100064378 | 3300006931 | Bacteria | 3699 |
| 245 | Ga0097620_102193325 | 3300006931 | Bacteria | 609 |
| 246 | Ga0097620_102388317 | 3300006931 | Bacteria | 583 |
| 247 | Ga0075435_100001694 | 3300007076 | Bacteria | 14328 |
| 248 | Ga0075435_100014113 | 3300007076 | Bacteria | 5961 |
| 249 | Ga0075435_100059076 | 3300007076 | Bacteria | 3108 |
| 250 | Ga0075435_100067393 | 3300007076 | Bacteria | 2914 |
| 251 | Ga0075435_100095281 | 3300007076 | Bacteria | 2461 |
| 252 | Ga0075435_100124387 | 3300007076 | Bacteria | 2154 |
| 253 | Ga0075435_100200060 | 3300007076 | Bacteria | 1693 |
| 254 | Ga0075435_100364233 | 3300007076 | Bacteria | 1240 |
| 255 | Ga0075435_100539713 | 3300007076 | Bacteria | 1009 |
| 256 | Ga0075435_100869758 | 3300007076 | Bacteria | 786 |
| 257 | Ga0099794_10043450 | 3300007265 | Bacteria | 2145 |
| 258 | Ga0099794_10120762 | 3300007265 | Bacteria | 1318 |
| 259 | Ga0099794_10365598 | 3300007265 | Bacteria | 751 |
| 260 | Ga0099795_10431218 | 3300007788 | Bacteria | 604 |
| 261 | Ga0105250_10208141 | 3300009092 | Bacteria | 826 |
| 262 | Ga0105240_10256842 | 3300009093 | Bacteria | 2018 |
| 263 | Ga0105240_11651665 | 3300009093 | Bacteria | 670 |
| 264 | Ga0105240_11799806 | 3300009093 | Bacteria | 638 |
| 265 | Ga0111539_10000675 | 3300009094 | Bacteria | 44135 |
| 266 | Ga0111539_10065945 | 3300009094 | Bacteria | 4277 |
| 267 | Ga0111539_10125011 | 3300009094 | Bacteria | 3014 |
| 268 | Ga0111539_12771457 | 3300009094 | Bacteria | 568 |
| 269 | Ga0105245_10497484 | 3300009098 | Bacteria | 1235 |
| 270 | Ga0105245_11981794 | 3300009098 | Bacteria | 636 |
| 271 | Ga0105247_10087814 | 3300009101 | Bacteria | 1970 |
| 272 | Ga0105247_10281324 | 3300009101 | Bacteria | 1148 |
| 273 | Ga0105247_10333293 | 3300009101 | Bacteria | 1062 |
| 274 | Ga0105247_10434150 | 3300009101 | Bacteria | 943 |
| 275 | Ga0114129_10013876 | 3300009147 | Bacteria | 11480 |
| 276 | Ga0114129_10022212 | 3300009147 | Bacteria | 9007 |
| 277 | Ga0114129_10033145 | 3300009147 | Bacteria | 7299 |
| 278 | Ga0114129_10036838 | 3300009147 | Bacteria | 6907 |
| 279 | Ga0114129_10052918 | 3300009147 | Bacteria | 5697 |
| 280 | Ga0114129_10065603 | 3300009147 | Bacteria | 5067 |
| 281 | Ga0114129_10078309 | 3300009147 | Bacteria | 4598 |
| 282 | Ga0114129_10125293 | 3300009147 | Bacteria | 3533 |
| 283 | Ga0114129_10334100 | 3300009147 | Bacteria | 2011 |
| 284 | Ga0114129_10772632 | 3300009147 | Bacteria | 1228 |
| 285 | Ga0114129_11213939 | 3300009147 | Bacteria | 939 |
| 286 | Ga0114129_11231848 | 3300009147 | Bacteria | 931 |
| 287 | Ga0114129_11811059 | 3300009147 | Bacteria | 742 |
| 288 | Ga0114129_13379342 | 3300009147 | Bacteria | 514 |
| 289 | Ga0105243_10723157 | 3300009148 | Bacteria | 973 |
| 290 | Ga0105243_12463998 | 3300009148 | Bacteria | 559 |
| 291 | Ga0105241_10146349 | 3300009174 | Bacteria | 1928 |
| 292 | Ga0105241_10253151 | 3300009174 | Bacteria | 1494 |
| 293 | Ga0105241_12256884 | 3300009174 | Bacteria | 541 |
| 294 | Ga0105242_10182109 | 3300009176 | Bacteria | 1854 |
| 295 | Ga0105242_10993609 | 3300009176 | Bacteria | 846 |
| 296 | Ga0105242_11360086 | 3300009176 | Bacteria | 736 |
| 297 | Ga0105242_11827768 | 3300009176 | Bacteria | 646 |
| 298 | Ga0105248_10303543 | 3300009177 | Bacteria | 1798 |
| 299 | Ga0105248_11529107 | 3300009177 | Bacteria | 756 |
| 300 | Ga0105248_11822368 | 3300009177 | Bacteria | 690 |
| 301 | Ga0105237_11370124 | 3300009545 | Bacteria | 714 |
| 302 | Ga0105238_10286513 | 3300009551 | Bacteria | 1629 |
| 303 | Ga0105238_10564391 | 3300009551 | Bacteria | 1143 |
| 304 | Ga0105249_10178723 | 3300009553 | Bacteria | 2063 |
| 305 | Ga0105249_10563998 | 3300009553 | Bacteria | 1191 |
| 306 | Ga0105249_10780936 | 3300009553 | Bacteria | 1018 |
| 307 | Ga0105249_10908982 | 3300009553 | Bacteria | 947 |
| 308 | Ga0105249_11620512 | 3300009553 | Bacteria | 720 |
| 309 | Ga0105249_13128416 | 3300009553 | Bacteria | 532 |
| 310 | Ga0105249_13141829 | 3300009553 | Bacteria | 531 |
| 311 | Ga0099796_10144819 | 3300010159 | Bacteria | 931 |
| 312 | Ga0105239_10846450 | 3300010375 | Bacteria | 1049 |
| 313 | Ga0105239_11007720 | 3300010375 | Bacteria | 958 |
| 314 | Ga0105246_12038190 | 3300011119 | Bacteria | 554 |
| 315 | Ga0157370_11146369 | 3300013104 | Bacteria | 702 |
| 316 | Ga0157370_11387810 | 3300013104 | Bacteria | 632 |
| 317 | Ga0157374_10443118 | 3300013296 | Bacteria | 1299 |
| 318 | Ga0157378_10145077 | 3300013297 | Bacteria | 2207 |
| 319 | Ga0157378_11011698 | 3300013297 | Bacteria | 866 |
| 320 | Ga0157378_11372608 | 3300013297 | Bacteria | 749 |
| 321 | Ga0157378_12316347 | 3300013297 | Bacteria | 589 |
| 322 | Ga0157378_12893552 | 3300013297 | Bacteria | 532 |
| 323 | Ga0163162_10017924 | 3300013306 | Bacteria | 6929 |
| 324 | Ga0163162_10069444 | 3300013306 | Bacteria | 3575 |
| 325 | Ga0163162_11337826 | 3300013306 | Bacteria | 814 |
| 326 | Ga0163162_11877311 | 3300013306 | Bacteria | 686 |
| 327 | Ga0157375_10331963 | 3300013308 | Bacteria | 1686 |
| 328 | Ga0157375_11278336 | 3300013308 | Bacteria | 862 |
| 329 | Ga0163163_10127637 | 3300014325 | Bacteria | 2582 |
| 330 | Ga0163163_12571764 | 3300014325 | Bacteria | 567 |
| 331 | Ga0157380_10116123 | 3300014326 | Bacteria | 2258 |
| 332 | Ga0157380_10150317 | 3300014326 | Bacteria | 2012 |
| 333 | Ga0157380_10591588 | 3300014326 | Bacteria | 1096 |
| 334 | Ga0157379_10012114 | 3300014968 | Bacteria | 7532 |
| 335 | Ga0157379_10618542 | 3300014968 | Bacteria | 1012 |
| 336 | Ga0157379_11077913 | 3300014968 | Bacteria | 769 |
| 337 | Ga0157379_11645156 | 3300014968 | Bacteria | 628 |
| 338 | Ga0157379_12465893 | 3300014968 | Bacteria | 520 |
| 339 | Ga0157376_10164129 | 3300014969 | Bacteria | 2016 |
| 340 | Ga0157376_10472409 | 3300014969 | Bacteria | 1227 |
| 341 | Ga0157376_11386194 | 3300014969 | Bacteria | 734 |
| 342 | Ga0182005_1090088 | 3300015265 | Bacteria | 852 |
| 343 | Ga0163161_10378849 | 3300017792 | Bacteria | 1130 |
| 344 | Ga0207697_10125113 | 3300025315 | Bacteria | 1108 |
| 345 | Ga0207656_10492319 | 3300025321 | Bacteria | 622 |
| 346 | Ga0207696_1104691 | 3300025711 | Bacteria | 769 |
| 347 | Ga0207642_10757948 | 3300025899 | Bacteria | 615 |
| 348 | Ga0207710_10072268 | 3300025900 | Bacteria | 1584 |
| 349 | Ga0207680_10222635 | 3300025903 | Bacteria | 1294 |
| 350 | Ga0207685_10356687 | 3300025905 | Bacteria | 739 |
| 351 | Ga0207645_10173020 | 3300025907 | Bacteria | 1416 |
| 352 | Ga0207645_10196243 | 3300025907 | Bacteria | 1327 |
| 353 | Ga0207645_11085791 | 3300025907 | Bacteria | 540 |
| 354 | Ga0207643_10188151 | 3300025908 | Bacteria | 1252 |
| 355 | Ga0207643_10559346 | 3300025908 | Bacteria | 734 |
| 356 | Ga0207705_10077070 | 3300025909 | Bacteria | 2425 |
| 357 | Ga0207684_10000456 | 3300025910 | Bacteria | 53373 |
| 358 | Ga0207684_10032897 | 3300025910 | Bacteria | 4410 |
| 359 | Ga0207684_10773599 | 3300025910 | Bacteria | 813 |
| 360 | Ga0207654_10096575 | 3300025911 | Bacteria | 1813 |
| 361 | Ga0207654_10109396 | 3300025911 | Bacteria | 1717 |
| 362 | Ga0207707_10065987 | 3300025912 | Bacteria | 3152 |
| 363 | Ga0207707_10367221 | 3300025912 | Bacteria | 1238 |
| 364 | Ga0207707_11057600 | 3300025912 | Bacteria | 663 |
| 365 | Ga0207695_10142435 | 3300025913 | Bacteria | 2344 |
| 366 | Ga0207671_10489117 | 3300025914 | Bacteria | 981 |
| 367 | Ga0207660_10007743 | 3300025917 | Bacteria | 6956 |
| 368 | Ga0207660_10359488 | 3300025917 | Bacteria | 1168 |
| 369 | Ga0207662_10077900 | 3300025918 | Bacteria | 2017 |
| 370 | Ga0207657_10023830 | 3300025919 | Bacteria | 5688 |
| 371 | Ga0207652_10387727 | 3300025921 | Bacteria | 1261 |
| 372 | Ga0207652_11093900 | 3300025921 | Bacteria | 697 |
| 373 | Ga0207646_10006057 | 3300025922 | Bacteria | 12598 |
| 374 | Ga0207681_10032040 | 3300025923 | Bacteria | 3438 |
| 375 | Ga0207681_10043484 | 3300025923 | Bacteria | 3007 |
| 376 | Ga0207681_10197103 | 3300025923 | Bacteria | 1544 |
| 377 | Ga0207681_10395255 | 3300025923 | Bacteria | 1115 |
| 378 | Ga0207694_10307553 | 3300025924 | Bacteria | 1306 |
| 379 | Ga0207694_10342428 | 3300025924 | Bacteria | 1236 |
| 380 | Ga0207694_11252620 | 3300025924 | Bacteria | 627 |
| 381 | Ga0207650_10057888 | 3300025925 | Bacteria | 2884 |
| 382 | Ga0207659_10661416 | 3300025926 | Bacteria | 893 |
| 383 | Ga0207659_10814445 | 3300025926 | Bacteria | 802 |
| 384 | Ga0207687_10095098 | 3300025927 | Bacteria | 2182 |
| 385 | Ga0207687_10147298 | 3300025927 | Bacteria | 1792 |
| 386 | Ga0207687_10957950 | 3300025927 | Bacteria | 733 |
| 387 | Ga0207700_10466132 | 3300025928 | Bacteria | 1115 |
| 388 | Ga0207664_10051260 | 3300025929 | Bacteria | 3258 |
| 389 | Ga0207644_11414080 | 3300025931 | Bacteria | 584 |
| 390 | Ga0207690_10530119 | 3300025932 | Bacteria | 955 |
| 391 | Ga0207690_10772675 | 3300025932 | Bacteria | 793 |
| 392 | Ga0207690_11340041 | 3300025932 | Bacteria | 598 |
| 393 | Ga0207690_11651840 | 3300025932 | Bacteria | 535 |
| 394 | Ga0207706_10057499 | 3300025933 | Bacteria | 3426 |
| 395 | Ga0207706_10127122 | 3300025933 | Bacteria | 2241 |
| 396 | Ga0207686_10105604 | 3300025934 | Bacteria | 1889 |
| 397 | Ga0207686_11015734 | 3300025934 | Bacteria | 673 |
| 398 | Ga0207709_10150410 | 3300025935 | Bacteria | 1612 |
| 399 | Ga0207709_10664809 | 3300025935 | Bacteria | 831 |
| 400 | Ga0207669_10009893 | 3300025937 | Bacteria | 4565 |
| 401 | Ga0207669_10070993 | 3300025937 | Bacteria | 2186 |
| 402 | Ga0207669_10088983 | 3300025937 | Bacteria | 2004 |
| 403 | Ga0207669_10335675 | 3300025937 | Bacteria | 1162 |
| 404 | Ga0207704_10107290 | 3300025938 | Bacteria | 1878 |
| 405 | Ga0207704_10174646 | 3300025938 | Bacteria | 1545 |
| 406 | Ga0207704_10216720 | 3300025938 | Bacteria | 1413 |
| 407 | Ga0207704_10670876 | 3300025938 | Bacteria | 856 |
| 408 | Ga0207691_10117491 | 3300025940 | Bacteria | 2360 |
| 409 | Ga0207691_10693142 | 3300025940 | Bacteria | 859 |
| 410 | Ga0207711_10418506 | 3300025941 | Bacteria | 1246 |
| 411 | Ga0207711_10641574 | 3300025941 | Bacteria | 991 |
| 412 | Ga0207711_11239148 | 3300025941 | Bacteria | 688 |
| 413 | Ga0207711_11539441 | 3300025941 | Bacteria | 608 |
| 414 | Ga0207689_10124593 | 3300025942 | Bacteria | 2120 |
| 415 | Ga0207689_11211116 | 3300025942 | Bacteria | 635 |
| 416 | Ga0207661_10248877 | 3300025944 | Bacteria | 1579 |
| 417 | Ga0207661_11715619 | 3300025944 | Bacteria | 573 |
| 418 | Ga0207667_10017864 | 3300025949 | Bacteria | 7972 |
| 419 | Ga0207667_10792538 | 3300025949 | Bacteria | 945 |
| 420 | Ga0207667_11877155 | 3300025949 | Bacteria | 562 |
| 421 | Ga0207651_10238268 | 3300025960 | Bacteria | 1481 |
| 422 | Ga0207651_10472515 | 3300025960 | Bacteria | 1079 |
| 423 | Ga0207651_11337491 | 3300025960 | Bacteria | 644 |
| 424 | Ga0207712_10227141 | 3300025961 | Bacteria | 1496 |
| 425 | Ga0207712_10435288 | 3300025961 | Bacteria | 1109 |
| 426 | Ga0207640_10572189 | 3300025981 | Bacteria | 952 |
| 427 | Ga0207677_10457231 | 3300026023 | Bacteria | 1095 |
| 428 | Ga0207677_11186049 | 3300026023 | Bacteria | 698 |
| 429 | Ga0207677_11647267 | 3300026023 | Bacteria | 594 |
| 430 | Ga0207703_10332310 | 3300026035 | Bacteria | 1394 |
| 431 | Ga0207703_11326844 | 3300026035 | Bacteria | 692 |
| 432 | Ga0207639_11412385 | 3300026041 | Bacteria | 653 |
| 433 | Ga0207678_11008212 | 3300026067 | Bacteria | 737 |
| 434 | Ga0207708_10024133 | 3300026075 | Bacteria | 4599 |
| 435 | Ga0207708_10822962 | 3300026075 | Bacteria | 800 |
| 436 | Ga0207702_10562012 | 3300026078 | Bacteria | 1117 |
| 437 | Ga0207641_10034453 | 3300026088 | Bacteria | 4213 |
| 438 | Ga0207648_10056516 | 3300026089 | Bacteria | 3425 |
| 439 | Ga0207648_10060929 | 3300026089 | Bacteria | 3290 |
| 440 | Ga0207648_10129854 | 3300026089 | Bacteria | 2218 |
| 441 | Ga0207648_10306092 | 3300026089 | Bacteria | 1426 |
| 442 | Ga0207648_10686769 | 3300026089 | Bacteria | 948 |
| 443 | Ga0207676_11100464 | 3300026095 | Bacteria | 785 |
| 444 | Ga0207675_100022779 | 3300026118 | Bacteria | 5829 |
| 445 | Ga0207675_100129766 | 3300026118 | Bacteria | 2390 |
| 446 | Ga0207675_100349149 | 3300026118 | Bacteria | 1450 |
| 447 | Ga0207675_100658556 | 3300026118 | Bacteria | 1054 |
| 448 | Ga0207675_100742488 | 3300026118 | Bacteria | 992 |
| 449 | Ga0207675_100804005 | 3300026118 | Bacteria | 954 |
| 450 | Ga0207675_101922960 | 3300026118 | Bacteria | 610 |
| 451 | Ga0207683_10011262 | 3300026121 | Bacteria | 7625 |
| 452 | Ga0207683_10456429 | 3300026121 | Bacteria | 1178 |
| 453 | Ga0207683_10467409 | 3300026121 | Bacteria | 1163 |
| 454 | Ga0207698_10685870 | 3300026142 | Bacteria | 1018 |
| 455 | Ga0209973_1070917 | 3300027252 | Bacteria | 545 |
| 456 | Ga0209995_1057437 | 3300027471 | Bacteria | 662 |
| 457 | Ga0209983_1069098 | 3300027665 | Bacteria | 786 |
| 458 | Ga0209588_1068174 | 3300027671 | Bacteria | 1149 |
| 459 | Ga0207428_10009686 | 3300027907 | Bacteria | 8632 |
| 460 | Ga0207428_10055654 | 3300027907 | Bacteria | 3144 |
| 461 | Ga0207428_10077225 | 3300027907 | Bacteria | 2607 |
| 462 | Ga0268266_10079314 | 3300028379 | Bacteria | 2858 |
| 463 | Ga0268265_10009567 | 3300028380 | Bacteria | 6545 |
| 464 | Ga0268265_10291710 | 3300028380 | Bacteria | 1465 |
| 465 | Ga0265330_10062935 | 3300031235 | Bacteria | 1613 |
| 466 | Ga0307513_10349382 | 3300031456 | Bacteria | 1227 |
| 467 | Ga0307408_100128636 | 3300031548 | Bacteria | 1973 |
| 468 | Ga0307408_100300990 | 3300031548 | Bacteria | 1343 |
| 469 | Ga0307408_100315007 | 3300031548 | Bacteria | 1316 |
| 470 | Ga0307408_100360495 | 3300031548 | Bacteria | 1236 |
| 471 | Ga0265314_10007579 | 3300031711 | Bacteria | 9400 |
| 472 | Ga0307405_10518890 | 3300031731 | Bacteria | 958 |
| 473 | Ga0307405_11082264 | 3300031731 | Bacteria | 688 |
| 474 | Ga0307413_11168206 | 3300031824 | Bacteria | 668 |
| 475 | Ga0307406_10032354 | 3300031901 | Bacteria | 3193 |
| 476 | Ga0307407_11227243 | 3300031903 | Bacteria | 586 |
| 477 | Ga0307412_10277063 | 3300031911 | Bacteria | 1315 |
| 478 | Ga0307412_10737472 | 3300031911 | Bacteria | 849 |
| 479 | Ga0307409_100867898 | 3300031995 | Bacteria | 914 |
| 480 | Ga0307409_100967154 | 3300031995 | Bacteria | 868 |
| 481 | Ga0307409_102703589 | 3300031995 | Bacteria | 524 |
| 482 | Ga0307416_100069478 | 3300032002 | Bacteria | 2915 |
| 483 | Ga0307416_101553644 | 3300032002 | Bacteria | 767 |
| 484 | Ga0307414_10203566 | 3300032004 | Bacteria | 1612 |
| 485 | Ga0307411_10011154 | 3300032005 | Bacteria | 4834 |
| 486 | Ga0307411_10975335 | 3300032005 | Bacteria | 757 |
| 487 | Ga0307411_11728989 | 3300032005 | Bacteria | 579 |
| 488 | Ga0307415_101096615 | 3300032126 | Bacteria | 745 |
| 489 | Ga0307415_102471341 | 3300032126 | Bacteria | 511 |
| 490 | Ga0373948_0026171 | 3300034817 | Bacteria | 1148 |
| 491 | Ga0373959_0019147 | 3300034820 | Bacteria | 1294 |
| 492 | Ga0373926_0158323 | 3300035083 | Bacteria | 864 |
| 493 | Ga0373929_0186064 | 3300035085 | Bacteria | 575 |
| 494 | Ga0373940_0114535 | 3300035088 | Bacteria | 831 |
| 495 | Ga0373949_0039153 | 3300035090 | Bacteria | 1160 |
| 496 | Ga0373949_0050917 | 3300035090 | Bacteria | 1043 |
| 497 | Ga0373949_0156641 | 3300035090 | Bacteria | 662 |
| 498 | Ga0373932_0192600 | 3300035112 | Bacteria | 721 |
| 499 | Ga0373936_0210280 | 3300035113 | Bacteria | 861 |
| 500 | Ga0373939_0107338 | 3300035114 | Bacteria | 967 |
| 501 | Ga0373939_0368385 | 3300035114 | Bacteria | 588 |
| 502 | Ga0373945_0140338 | 3300035116 | Bacteria | 974 |
| 503 | Ga0373953_0195181 | 3300035117 | Bacteria | 875 |
| 504 | Ga0373953_0290486 | 3300035117 | Bacteria | 713 |
| 505 | Ga0373953_0343095 | 3300035117 | Bacteria | 654 |
| 506 | Ga0373956_0045429 | 3300035119 | Bacteria | 1960 |
| 507 | Ga0373943_0056118 | 3300035170 | Bacteria | 1954 |
| 508 | Ga0373943_0477011 | 3300035170 | Bacteria | 727 |
| 509 | Ga0373946_0032579 | 3300035171 | Bacteria | 2094 |
| 510 | Ga0373955_0134713 | 3300035172 | Bacteria | 1444 |
| 511 | Ga0373942_0216206 | 3300035207 | Bacteria | 641 |
| 512 | Ga0373961_0306054 | 3300035241 | Bacteria | 589 |
| 513 | Ga0373924_0058294 | 3300035410 | Bacteria | 1612 |
| 514 | Ga0373924_0086920 | 3300035410 | Bacteria | 1334 |
| 515 | Ga0373931_0002096 | 3300035691 | Bacteria | 8774 |
| 516 | Ga0373931_0269723 | 3300035691 | Bacteria | 1041 |
| 517 | Ga0373931_0816455 | 3300035691 | Bacteria | 623 |
| 518 | Ga0373931_0867625 | 3300035691 | Bacteria | 605 |
| 519 | Ga0373935_1006005 | 3300035692 | Bacteria | 619 |
| 520 | Ga0373927_0129073 | 3300035695 | Bacteria | 1651 |
| 521 | Ga0373947_0464859 | 3300035725 | Bacteria | 858 |
| 522 | Ga0373947_0756830 | 3300035725 | Bacteria | 663 |
| 523 | Ga0373937_0067221 | 3300036401 | Bacteria | 3302 |
| 524 | Ga0373937_0221033 | 3300036401 | Bacteria | 1783 |
| 525 | Ga0373937_0668610 | 3300036401 | Bacteria | 984 |
| 526 | Ga0373937_2036599 | 3300036401 | Bacteria | 520 |
| 527 | Ga0373925_0069528 | 3300037068 | Bacteria | 2660 |
| 528 | Ga0373925_0430860 | 3300037068 | Bacteria | 1078 |
| 529 | Ga0395900_0534850 | 3300037418 | Bacteria | 1118 |
| 530 | Ga0395901_0226862 | 3300038443 | Bacteria | 1951 |
| 531 | Ga0242420_011734 | 3300038996 | Bacteria | 1475 |
| 532 | Ga0436360_1164604 | 3300039438 | Bacteria | 2135 |
| 533 | Ga0439453_0195091 | 3300041408 | Bacteria | 500 |
| 534 | Ga0451800_1151021 | 3300041459 | Bacteria | 506 |
| 535 | Ga0451802_1108347 | 3300041460 | Bacteria | 818 |
| 536 | Ga0451847_0081879 | 3300041503 | Bacteria | 620 |
| 537 | Ga0451853_0869743 | 3300041512 | Bacteria | 655 |
| 538 | Ga0439463_081758 | 3300042016 | Bacteria | 831 |
| 539 | Ga0450912_004737 | 3300042116 | Bacteria | 1020 |
| 540 | Ga0450923_140390 | 3300042125 | Bacteria | 580 |
| 541 | Ga0439435_0100211 | 3300042436 | Bacteria | 889 |
| 542 | Ga0439435_0206099 | 3300042436 | Bacteria | 650 |
| 543 | Ga0439435_0310367 | 3300042436 | Bacteria | 542 |
| 544 | Ga0439460_0100071 | 3300042461 | Bacteria | 930 |
| 545 | Ga0451577_0205501 | 3300042876 | Bacteria | 1778 |
| 546 | Ga0466965_0272794 | 3300044683 | Bacteria | 912 |
| 547 | Ga0453684_0256633 | 3300044712 | Bacteria | 2005 |
| 548 | Ga0466957_0429856 | 3300044842 | Bacteria | 907 |
| 549 | Ga0451576_0278101 | 3300045051 | Bacteria | 1750 |
| 550 | Ga0451576_0561226 | 3300045051 | Bacteria | 1199 |
| 551 | Ga0495592_0473704 | 3300046454 | Bacteria | 781 |
| 552 | Ga0495603_0043902 | 3300046455 | Bacteria | 2668 |
| 553 | Ga0495603_0150724 | 3300046455 | Bacteria | 1351 |
| 554 | Ga0495603_0245649 | 3300046455 | Bacteria | 1031 |
| 555 | Ga0495603_0312576 | 3300046455 | Bacteria | 902 |
| 556 | Ga0495629_0055216 | 3300046459 | Bacteria | 2778 |
| 557 | Ga0495629_0378373 | 3300046459 | Bacteria | 964 |
| 558 | Ga0495653_0179385 | 3300046463 | Bacteria | 1455 |
| 559 | Ga0495580_0000020 | 3300046472 | Bacteria | 91314 |
| 560 | Ga0495582_0247667 | 3300046473 | Bacteria | 1022 |
| 561 | Ga0495582_0345055 | 3300046473 | Bacteria | 857 |
| 562 | Ga0495639_0101147 | 3300046475 | Bacteria | 1361 |
| 563 | Ga0495662_0321985 | 3300046476 | Bacteria | 760 |
| 564 | Ga0495594_0102795 | 3300046499 | Bacteria | 1608 |
| 565 | Ga0495594_0723366 | 3300046499 | Bacteria | 562 |
| 566 | Ga0495608_0285283 | 3300046511 | Bacteria | 1024 |
| 567 | Ga0495618_0467079 | 3300046514 | Bacteria | 764 |
| 568 | Ga0495628_0265137 | 3300046516 | Bacteria | 1279 |
| 569 | Ga0495630_0267490 | 3300046517 | Bacteria | 1306 |
| 570 | Ga0495644_0223090 | 3300046523 | Bacteria | 729 |
| 571 | Ga0495642_0009559 | 3300046528 | Bacteria | 3711 |
| 572 | Ga0495642_0202337 | 3300046528 | Bacteria | 866 |
| 573 | Ga0495652_0477229 | 3300046529 | Bacteria | 869 |
| 574 | Ga0495640_0065981 | 3300046533 | Bacteria | 2442 |
| 575 | Ga0495586_0088108 | 3300046535 | Bacteria | 1712 |
| 576 | Ga0495586_0141059 | 3300046535 | Bacteria | 1353 |
| 577 | Ga0495587_0220146 | 3300046536 | Bacteria | 1071 |
| 578 | Ga0495598_0084538 | 3300046537 | Bacteria | 1024 |
| 579 | Ga0495598_0200879 | 3300046537 | Bacteria | 720 |
| 580 | Ga0495621_0103056 | 3300046539 | Bacteria | 1088 |
| 581 | Ga0495645_0006287 | 3300046543 | Bacteria | 8236 |
| 582 | Ga0495667_0526525 | 3300046559 | Bacteria | 739 |
| 583 | Ga0495656_0163586 | 3300046615 | Bacteria | 1083 |
| 584 | Ga0495668_0190674 | 3300046616 | Bacteria | 1123 |
| 585 | Ga0495668_0586264 | 3300046616 | Bacteria | 616 |
| 586 | Ga0495634_0100808 | 3300046642 | Bacteria | 1866 |
| 587 | Ga0495634_0765674 | 3300046642 | Bacteria | 552 |
| 588 | Ga0495659_0041994 | 3300046664 | Bacteria | 1636 |
| 589 | Ga0495659_0145914 | 3300046664 | Bacteria | 947 |
| 590 | Ga0495659_0221049 | 3300046664 | Bacteria | 782 |
| 591 | Ga0495588_0348888 | 3300046674 | Bacteria | 778 |
| 592 | Ga0495647_0082963 | 3300046681 | Bacteria | 1302 |
| 593 | Ga0495647_0094351 | 3300046681 | Bacteria | 1231 |
| 594 | Ga0495658_0064706 | 3300046683 | Bacteria | 2107 |
| 595 | Ga0495658_0195497 | 3300046683 | Bacteria | 1259 |
| 596 | Ga0495658_0690527 | 3300046683 | Bacteria | 654 |
| 597 | Ga0495669_0020738 | 3300046684 | Bacteria | 2847 |
| 598 | Ga0495669_0536931 | 3300046684 | Bacteria | 569 |
| 599 | Ga0495670_0092012 | 3300046691 | Bacteria | 1553 |
| 600 | Ga0495671_0187062 | 3300046692 | Bacteria | 1006 |
| 601 | Ga0495589_0433553 | 3300046794 | Bacteria | 602 |
| 602 | Ga0495581_0044555 | 3300047315 | Bacteria | 2566 |
| 603 | Ga0495581_0210608 | 3300047315 | Bacteria | 1137 |
| 604 | Ga0495636_0060520 | 3300047318 | Bacteria | 1600 |
| 605 | Ga0495674_0044793 | 3300047319 | Bacteria | 3932 |
| 606 | Ga0495676_0139896 | 3300047321 | Bacteria | 1736 |
| 607 | Ga0495680_0334380 | 3300047322 | Bacteria | 1058 |
| 608 | Ga0495675_0149748 | 3300047444 | Bacteria | 1442 |
| 609 | Ga0495684_0030504 | 3300047471 | Bacteria | 4140 |
| 610 | Ga0495614_0181095 | 3300048089 | Bacteria | 948 |
| 611 | Ga0495615_0271254 | 3300048090 | Bacteria | 543 |
| 612 | Ga0496100_0113941 | 3300048903 | Bacteria | 1883 |
| 613 | Ga0496100_0881213 | 3300048903 | Bacteria | 703 |
| 614 | Ga0496102_0047759 | 3300048905 | Bacteria | 3891 |
| 615 | Ga0496102_0268575 | 3300048905 | Bacteria | 1608 |
| 616 | Ga0496106_0302602 | 3300048909 | Bacteria | 1283 |
| 617 | Ga0496106_0410272 | 3300048909 | Bacteria | 1089 |
| 618 | Ga0496106_0560420 | 3300048909 | Bacteria | 917 |
| 619 | Ga0496106_0685352 | 3300048909 | Bacteria | 817 |
| 620 | Ga0496107_0210509 | 3300048910 | Bacteria | 1446 |
| 621 | Ga0496107_0608545 | 3300048910 | Bacteria | 807 |
| 622 | Ga0496109_0162123 | 3300048912 | Bacteria | 2095 |
| 623 | Ga0496109_0283991 | 3300048912 | Bacteria | 1560 |
| 624 | Ga0496109_0971550 | 3300048912 | Bacteria | 787 |
| 625 | Ga0496109_1807906 | 3300048912 | Bacteria | 544 |
| 626 | Ga0496110_0515460 | 3300048913 | Bacteria | 1088 |
| 627 | Ga0496114_0321889 | 3300048917 | Bacteria | 1366 |
| 628 | Ga0496114_0543833 | 3300048917 | Bacteria | 1026 |
| 629 | Ga0501309_033728 | 3300049129 | Bacteria | 763 |
| 630 | Ga0501305_055304 | 3300049161 | Bacteria | 674 |
| 631 | Ga0501298_069749 | 3300049521 | Bacteria | 757 |
| 632 | Ga0501299_012854 | 3300049522 | Bacteria | 1436 |
| 633 | Ga0501299_119814 | 3300049522 | Bacteria | 633 |
| 634 | Ga0501302_016186 | 3300049525 | Bacteria | 601 |
| 635 | Ga0501312_100006 | 3300049528 | Bacteria | 543 |
| 636 | Ga0501031_0254315 | 3300049568 | Bacteria | 1142 |
| 637 | Ga0501031_0406451 | 3300049568 | Bacteria | 880 |
| 638 | Ga0501032_0096009 | 3300049569 | Bacteria | 1965 |
| 639 | Ga0501032_0203582 | 3300049569 | Bacteria | 1291 |
| 640 | Ga0501033_0085296 | 3300049570 | Bacteria | 2313 |
| 641 | Ga0501034_0013252 | 3300049571 | Bacteria | 8494 |
| 642 | Ga0501034_0062327 | 3300049571 | Bacteria | 3744 |
| 643 | Ga0501034_0396885 | 3300049571 | Bacteria | 1302 |
| 644 | Ga0501036_0070188 | 3300049572 | Bacteria | 2962 |
| 645 | Ga0501036_0307850 | 3300049572 | Bacteria | 1325 |
| 646 | Ga0501036_0355340 | 3300049572 | Bacteria | 1223 |
| 647 | Ga0501036_0526836 | 3300049572 | Bacteria | 982 |
| 648 | Ga0501036_0617594 | 3300049572 | Bacteria | 898 |
| 649 | Ga0501037_0482433 | 3300049573 | Bacteria | 843 |
| 650 | Ga0501037_0540096 | 3300049573 | Bacteria | 788 |
| 651 | Ga0501037_0847354 | 3300049573 | Bacteria | 601 |
| 652 | Ga0501038_0073380 | 3300049574 | Bacteria | 2898 |
| 653 | Ga0501038_0199273 | 3300049574 | Bacteria | 1607 |
| 654 | Ga0501038_0474785 | 3300049574 | Bacteria | 959 |
| 655 | Ga0501038_0681183 | 3300049574 | Bacteria | 772 |
| 656 | Ga0501038_1154180 | 3300049574 | Bacteria | 564 |
| 657 | Ga0501038_1179308 | 3300049574 | Bacteria | 557 |
| 658 | Ga0501039_0186470 | 3300049575 | Bacteria | 1631 |
| 659 | Ga0501039_0256958 | 3300049575 | Bacteria | 1373 |
| 660 | Ga0501039_0257176 | 3300049575 | Bacteria | 1373 |
| 661 | Ga0501039_0355700 | 3300049575 | Bacteria | 1150 |
| 662 | Ga0501039_0402209 | 3300049575 | Bacteria | 1075 |
| 663 | Ga0501039_0500394 | 3300049575 | Bacteria | 954 |
| 664 | Ga0501039_1536235 | 3300049575 | Bacteria | 511 |
| 665 | Ga0501040_0224705 | 3300049576 | Bacteria | 1336 |
| 666 | Ga0501040_0470201 | 3300049576 | Bacteria | 905 |
| 667 | Ga0501040_0515052 | 3300049576 | Bacteria | 862 |
| 668 | Ga0501040_0695258 | 3300049576 | Bacteria | 735 |
| 669 | Ga0501040_0715140 | 3300049576 | Bacteria | 724 |
| 670 | Ga0501040_0853934 | 3300049576 | Bacteria | 659 |
| 671 | Ga0501041_0027203 | 3300049577 | Bacteria | 3446 |
| 672 | Ga0501041_0447920 | 3300049577 | Bacteria | 820 |
| 673 | Ga0501041_0479686 | 3300049577 | Bacteria | 790 |
| 674 | Ga0501042_0047787 | 3300049578 | Bacteria | 3051 |
| 675 | Ga0501042_0115555 | 3300049578 | Bacteria | 1932 |
| 676 | Ga0501042_0329784 | 3300049578 | Bacteria | 1103 |
| 677 | Ga0501042_0335219 | 3300049578 | Bacteria | 1093 |
| 678 | Ga0501043_0205410 | 3300049579 | Bacteria | 1527 |
| 679 | Ga0501043_0517619 | 3300049579 | Bacteria | 889 |
| 680 | Ga0501043_0553451 | 3300049579 | Bacteria | 854 |
| 681 | Ga0501043_0676949 | 3300049579 | Bacteria | 755 |
| 682 | Ga0501043_1125303 | 3300049579 | Bacteria | 554 |
| 683 | Ga0501043_1313962 | 3300049579 | Bacteria | 504 |
| 684 | Ga0501046_0122797 | 3300049580 | Bacteria | 1975 |
| 685 | Ga0501046_0226235 | 3300049580 | Bacteria | 1383 |
| 686 | Ga0501046_0261729 | 3300049580 | Bacteria | 1271 |
| 687 | Ga0501046_0483405 | 3300049580 | Bacteria | 888 |
| 688 | Ga0501046_0719544 | 3300049580 | Bacteria | 702 |
| 689 | Ga0501047_0025664 | 3300049581 | Bacteria | 5666 |
| 690 | Ga0501047_0042294 | 3300049581 | Bacteria | 4403 |
| 691 | Ga0501047_0049792 | 3300049581 | Bacteria | 4044 |
| 692 | Ga0501047_0228159 | 3300049581 | Bacteria | 1716 |
| 693 | Ga0501047_0809142 | 3300049581 | Bacteria | 752 |
| 694 | Ga0501048_0031213 | 3300049582 | Bacteria | 3854 |
| 695 | Ga0501048_0034967 | 3300049582 | Bacteria | 3620 |
| 696 | Ga0501048_0128505 | 3300049582 | Bacteria | 1792 |
| 697 | Ga0501048_0170574 | 3300049582 | Bacteria | 1541 |
| 698 | Ga0501048_1222170 | 3300049582 | Bacteria | 540 |
| 699 | Ga0501067_0019308 | 3300049583 | Bacteria | 3771 |
| 700 | Ga0501067_0105799 | 3300049583 | Bacteria | 1563 |
| 701 | Ga0501068_0029501 | 3300049584 | Bacteria | 3248 |
| 702 | Ga0501068_0069671 | 3300049584 | Bacteria | 2145 |
| 703 | Ga0501068_0149489 | 3300049584 | Bacteria | 1467 |
| 704 | Ga0501068_0203545 | 3300049584 | Bacteria | 1256 |
| 705 | Ga0501068_0219807 | 3300049584 | Bacteria | 1207 |
| 706 | Ga0501068_0476435 | 3300049584 | Bacteria | 809 |
| 707 | Ga0501068_0782239 | 3300049584 | Bacteria | 625 |
| 708 | Ga0501069_0021172 | 3300049585 | Bacteria | 3528 |
| 709 | Ga0501069_0120453 | 3300049585 | Bacteria | 1498 |
| 710 | Ga0501069_0834116 | 3300049585 | Bacteria | 559 |
| 711 | Ga0501069_0923377 | 3300049585 | Bacteria | 531 |
| 712 | Ga0501070_0302332 | 3300049586 | Bacteria | 1303 |
| 713 | Ga0501070_0523304 | 3300049586 | Bacteria | 951 |
| 714 | Ga0501070_0755299 | 3300049586 | Bacteria | 766 |
| 715 | Ga0501071_0197980 | 3300049587 | Bacteria | 1508 |
| 716 | Ga0501071_0599153 | 3300049587 | Bacteria | 847 |
| 717 | Ga0501071_0677607 | 3300049587 | Bacteria | 794 |
| 718 | Ga0501072_0014068 | 3300049588 | Bacteria | 6132 |
| 719 | Ga0501072_0072312 | 3300049588 | Bacteria | 2725 |
| 720 | Ga0501072_0192588 | 3300049588 | Bacteria | 1626 |
| 721 | Ga0501072_0208710 | 3300049588 | Bacteria | 1556 |
| 722 | Ga0501072_0218665 | 3300049588 | Bacteria | 1518 |
| 723 | Ga0501072_0278892 | 3300049588 | Bacteria | 1329 |
| 724 | Ga0501072_0554453 | 3300049588 | Bacteria | 907 |
| 725 | Ga0501073_0036691 | 3300049589 | Bacteria | 3481 |
| 726 | Ga0501073_0135900 | 3300049589 | Bacteria | 1704 |
| 727 | Ga0501073_0142718 | 3300049589 | Bacteria | 1659 |
| 728 | Ga0501073_0678060 | 3300049589 | Bacteria | 711 |
| 729 | Ga0501074_0049922 | 3300049590 | Bacteria | 3020 |
| 730 | Ga0501074_0323643 | 3300049590 | Bacteria | 1095 |
| 731 | Ga0501074_0610793 | 3300049590 | Bacteria | 771 |
| 732 | Ga0501074_0788219 | 3300049590 | Bacteria | 670 |
| 733 | Ga0501075_0008499 | 3300049591 | Bacteria | 7161 |
| 734 | Ga0501075_0031327 | 3300049591 | Bacteria | 3946 |
| 735 | Ga0501075_0050755 | 3300049591 | Bacteria | 3119 |
| 736 | Ga0501075_0210467 | 3300049591 | Bacteria | 1483 |
| 737 | Ga0501075_0266503 | 3300049591 | Bacteria | 1305 |
| 738 | Ga0501075_0324356 | 3300049591 | Bacteria | 1173 |
| 739 | Ga0501075_0635155 | 3300049591 | Bacteria | 814 |
| 740 | Ga0501076_0030185 | 3300049592 | Bacteria | 4222 |
| 741 | Ga0501076_0044508 | 3300049592 | Bacteria | 3501 |
| 742 | Ga0501076_0054495 | 3300049592 | Bacteria | 3169 |
| 743 | Ga0501076_0108804 | 3300049592 | Bacteria | 2239 |
| 744 | Ga0501076_0147246 | 3300049592 | Bacteria | 1915 |
| 745 | Ga0501076_0207451 | 3300049592 | Bacteria | 1601 |
| 746 | Ga0501076_0442426 | 3300049592 | Bacteria | 1070 |
| 747 | Ga0501076_0604756 | 3300049592 | Bacteria | 904 |
| 748 | Ga0501076_0726136 | 3300049592 | Bacteria | 820 |
| 749 | Ga0501077_0002533 | 3300049593 | Bacteria | 10951 |
| 750 | Ga0501077_0004004 | 3300049593 | Bacteria | 8891 |
| 751 | Ga0501077_0145854 | 3300049593 | Bacteria | 1501 |
| 752 | Ga0501077_0204507 | 3300049593 | Bacteria | 1254 |
| 753 | Ga0501077_0281283 | 3300049593 | Bacteria | 1059 |
| 754 | Ga0501234_064431 | 3300049707 | Bacteria | 625 |
| 755 | Ga0501079_0012904 | 3300049741 | Bacteria | 6377 |
| 756 | Ga0501079_0065568 | 3300049741 | Bacteria | 2802 |
| 757 | Ga0501079_0079995 | 3300049741 | Bacteria | 2527 |
| 758 | Ga0501079_0081872 | 3300049741 | Bacteria | 2496 |
| 759 | Ga0501079_0353864 | 3300049741 | Bacteria | 1151 |
| 760 | Ga0501079_0673534 | 3300049741 | Bacteria | 814 |
| 761 | Ga0501079_0909685 | 3300049741 | Bacteria | 693 |
| 762 | Ga0501080_0241788 | 3300049742 | Bacteria | 1647 |
| 763 | Ga0501080_0722570 | 3300049742 | Bacteria | 877 |
| 764 | Ga0501080_1072019 | 3300049742 | Bacteria | 696 |
| 765 | Ga0501080_1105096 | 3300049742 | Bacteria | 684 |
| 766 | Ga0501080_1364881 | 3300049742 | Bacteria | 605 |
| 767 | Ga0501080_1443530 | 3300049742 | Bacteria | 586 |
| 768 | Ga0501081_0035649 | 3300049743 | Bacteria | 3387 |
| 769 | Ga0501081_0116426 | 3300049743 | Bacteria | 1900 |
| 770 | Ga0501081_0217630 | 3300049743 | Bacteria | 1388 |
| 771 | Ga0501081_0381196 | 3300049743 | Bacteria | 1042 |
| 772 | Ga0501081_0470584 | 3300049743 | Bacteria | 935 |
| 773 | Ga0501081_0676940 | 3300049743 | Bacteria | 774 |
| 774 | Ga0501081_0782753 | 3300049743 | Bacteria | 718 |
| 775 | Ga0501081_1255954 | 3300049743 | Bacteria | 561 |
| 776 | Ga0501083_0018057 | 3300049744 | Bacteria | 4917 |
| 777 | Ga0501083_0090152 | 3300049744 | Bacteria | 2025 |
| 778 | Ga0501083_0192624 | 3300049744 | Bacteria | 1330 |
| 779 | Ga0501083_0306390 | 3300049744 | Bacteria | 1033 |
| 780 | Ga0501035_0376494 | 3300049822 | Bacteria | 1184 |
| 781 | Ga0501035_0401670 | 3300049822 | Bacteria | 1140 |
| 782 | Ga0501035_1024898 | 3300049822 | Bacteria | 648 |
| 783 | Ga0501044_0003452 | 3300049823 | Bacteria | 17800 |
| 784 | Ga0501044_0182996 | 3300049823 | Bacteria | 2061 |
| 785 | Ga0501044_0195408 | 3300049823 | Bacteria | 1983 |
| 786 | Ga0501044_0549969 | 3300049823 | Bacteria | 1051 |
| 787 | Ga0501044_1067231 | 3300049823 | Bacteria | 678 |
| 788 | Ga0501045_0045065 | 3300049824 | Bacteria | 3211 |
| 789 | Ga0501045_0111316 | 3300049824 | Bacteria | 2030 |
| 790 | Ga0501045_0162253 | 3300049824 | Bacteria | 1664 |
| 791 | Ga0501045_0189069 | 3300049824 | Bacteria | 1535 |
| 792 | Ga0501045_0739732 | 3300049824 | Bacteria | 725 |
| 793 | nmdc:mga00v17_121554_c2 | 3300050491 | Bacteria | 939 |
| 794 | nmdc:mga0k408_107084_c1 | 3300050493 | Unclassified | 1212 |
| 795 | nmdc:mga04h51_178292_c1 | 3300050495 | Unclassified | 826 |
| 796 | nmdc:mga07m45_152_c1 | 3300050496 | Bacteria | 27737 |
| 797 | nmdc:mga05p37_14246_c1 | 3300050507 | Bacteria | 9550 |
| 798 | nmdc:mga05p37_1531273_c1 | 3300050507 | Bacteria | 662 |
| 799 | nmdc:mga05p37_2249_c1 | 3300050507 | Bacteria | 22479 |
| 800 | nmdc:mga05p37_2645_c1 | 3300050507 | Bacteria | 20857 |
| 801 | nmdc:mga05p37_34567_c1 | 3300050507 | Bacteria | 6192 |
| 802 | nmdc:mga05p37_35074_c1 | 3300050507 | Bacteria | 6150 |
| 803 | nmdc:mga05p37_43564_c1 | 3300050507 | Bacteria | 5521 |
| 804 | nmdc:mga05p37_43602_c1 | 3300050507 | Bacteria | 5519 |
| 805 | nmdc:mga05p37_47839_c1 | 3300050507 | Bacteria | 5259 |
| 806 | nmdc:mga05p37_551938_c1 | 3300050507 | Bacteria | 1311 |
| 807 | nmdc:mga05p37_602880_c1 | 3300050507 | Bacteria | 1239 |
| 808 | nmdc:mga05p37_65_c1 | 3300050507 | Bacteria | 48888 |
| 809 | nmdc:mga05p37_66375_c1 | 3300050507 | Bacteria | 4438 |
| 810 | nmdc:mga05p37_805015_c1 | 3300050507 | Bacteria | 1027 |
| 811 | nmdc:mga05p37_83387_c1 | 3300050507 | Bacteria | 3938 |
| 812 | nmdc:mga05p37_90559_c1 | 3300050507 | Bacteria | 3769 |
| 813 | nmdc:mga09592_1037801_c1 | 3300050508 | Bacteria | 684 |
| 814 | nmdc:mga09592_105805_c1 | 3300050508 | Bacteria | 2413 |
| 815 | nmdc:mga09592_127446_c1 | 3300050508 | Bacteria | 2189 |
| 816 | nmdc:mga09592_13087_c1 | 3300050508 | Bacteria | 6771 |
| 817 | nmdc:mga09592_44935_c1 | 3300050508 | Bacteria | 3720 |
| 818 | nmdc:mga09592_68878_c1 | 3300050508 | Bacteria | 3002 |
| 819 | nmdc:mga09592_915780_c1 | 3300050508 | Bacteria | 736 |
| 820 | nmdc:mga0qj67_1264138_c1 | 3300050509 | Bacteria | 573 |
| 821 | nmdc:mga0qj67_19800_c1 | 3300050509 | Bacteria | 5146 |
| 822 | nmdc:mga0qj67_2619_c1 | 3300050509 | Bacteria | 12899 |
| 823 | nmdc:mga0qj67_389091_c1 | 3300050509 | Bacteria | 1126 |
| 824 | nmdc:mga0qj67_5121_c1 | 3300050509 | Bacteria | 9545 |
| 825 | nmdc:mga0qj67_652_c1 | 3300050509 | Bacteria | 23881 |
| 826 | nmdc:mga06r32_10547_c1 | 3300050510 | Bacteria | 8332 |
| 827 | nmdc:mga06r32_133332_c1 | 3300050510 | Bacteria | 2458 |
| 828 | nmdc:mga06r32_18264_c1 | 3300050510 | Bacteria | 6419 |
| 829 | nmdc:mga06r32_21776_c1 | 3300050510 | Bacteria | 5917 |
| 830 | nmdc:mga06r32_364376_c1 | 3300050510 | Bacteria | 1429 |
| 831 | nmdc:mga06r32_43766_c1 | 3300050510 | Bacteria | 4261 |
| 832 | nmdc:mga06r32_61409_c1 | 3300050510 | Bacteria | 3617 |
| 833 | nmdc:mga06r32_777101_c1 | 3300050510 | Bacteria | 919 |
| 834 | nmdc:mga08y16_145726_c1 | 3300050511 | Bacteria | 2462 |
| 835 | nmdc:mga08y16_1481107_c1 | 3300050511 | Bacteria | 640 |
| 836 | nmdc:mga08y16_1921394_c1 | 3300050511 | Bacteria | 542 |
| 837 | nmdc:mga08y16_61777_c1 | 3300050511 | Bacteria | 3912 |
| 838 | nmdc:mga08y16_64772_c1 | 3300050511 | Bacteria | 3816 |
| 839 | nmdc:mga0n895_135551_c1 | 3300050512 | Bacteria | 2489 |
| 840 | nmdc:mga0n895_14_c1 | 3300050512 | Bacteria | 102430 |
| 841 | nmdc:mga0n895_23374_c1 | 3300050512 | Bacteria | 5810 |
| 842 | nmdc:mga0n895_23375_c1 | 3300050512 | Bacteria | 5810 |
| 843 | nmdc:mga0n895_253923_c1 | 3300050512 | Bacteria | 1784 |
| 844 | nmdc:mga0n895_352041_c1 | 3300050512 | Bacteria | 1492 |
| 845 | nmdc:mga0n895_376592_c1 | 3300050512 | Bacteria | 1437 |
| 846 | nmdc:mga0n895_525033_c1 | 3300050512 | Bacteria | 1191 |
| 847 | nmdc:mga0n895_680737_c1 | 3300050512 | Bacteria | 1026 |
| 848 | nmdc:mga0n895_708214_c1 | 3300050512 | Bacteria | 1002 |
| 849 | nmdc:mga0n895_880544_c1 | 3300050512 | Bacteria | 882 |
| 850 | nmdc:mga0n895_98_c1 | 3300050512 | Bacteria | 51629 |
| 851 | nmdc:mga0rr50_1329284_c1 | 3300050513 | Bacteria | 609 |
| 852 | nmdc:mga0rr50_133022_c1 | 3300050513 | Bacteria | 1994 |
| 853 | nmdc:mga0rr50_1773_c1 | 3300050513 | Bacteria | 11923 |
| 854 | nmdc:mga0rr50_229957_c1 | 3300050513 | Bacteria | 1534 |
| 855 | nmdc:mga0rr50_402224_c1 | 3300050513 | Bacteria | 1157 |
| 856 | nmdc:mga0rr50_46593_c1 | 3300050513 | Bacteria | 3193 |
| 857 | nmdc:mga0rr50_8258_c1 | 3300050513 | Bacteria | 6472 |
| 858 | nmdc:mga0rr50_826004_c1 | 3300050513 | Bacteria | 791 |
| 859 | nmdc:mga0rr50_88324_c1 | 3300050513 | Bacteria | 2408 |
| 860 | nmdc:mga0rr50_8956_c1 | 3300050513 | Bacteria | 6258 |
| 861 | nmdc:mga08x19_18471_c1 | 3300050514 | Bacteria | 4273 |
| 862 | nmdc:mga08x19_300889_c1 | 3300050514 | Bacteria | 1114 |
| 863 | nmdc:mga08x19_34661_c1 | 3300050514 | Bacteria | 3192 |
| 864 | nmdc:mga08x19_489434_c1 | 3300050514 | Bacteria | 868 |
| 865 | nmdc:mga08x19_495247_c1 | 3300050514 | Bacteria | 862 |
| 866 | nmdc:mga08x19_506405_c1 | 3300050514 | Bacteria | 853 |
| 867 | nmdc:mga08x19_694049_c1 | 3300050514 | Bacteria | 722 |
| 868 | nmdc:mga08x19_83620_c1 | 3300050514 | Bacteria | 2099 |
| 869 | nmdc:mga0a205_115193_c1 | 3300050515 | Bacteria | 2587 |
| 870 | nmdc:mga0a205_225843_c1 | 3300050515 | Bacteria | 1757 |
| 871 | nmdc:mga0a205_294327_c1 | 3300050515 | Bacteria | 1497 |
| 872 | nmdc:mga0a205_354488_c1 | 3300050515 | Bacteria | 1334 |
| 873 | nmdc:mga0a205_52793_c1 | 3300050515 | Bacteria | 3923 |
| 874 | nmdc:mga0a205_534956_c1 | 3300050515 | Bacteria | 1028 |
| 875 | nmdc:mga0a205_59155_c1 | 3300050515 | Bacteria | 3702 |
| 876 | nmdc:mga0a205_972588_c1 | 3300050515 | Bacteria | 696 |
| 877 | Ga0495601_0169537 | 3300053077 | Bacteria | 1427 |
| 878 | Ga0495612_0160040 | 3300053078 | Bacteria | 983 |
| 879 | Ga0495655_0038227 | 3300053083 | Bacteria | 1210 |
| 880 | Ga0495595_0139583 | 3300053084 | Bacteria | 1188 |
| 881 | Ga0495619_0218156 | 3300053085 | Bacteria | 1321 |
| 882 | Ga0500646_0132500 | 3300053090 | Bacteria | 811 |
| 883 | Ga0500651_0209244 | 3300053093 | Bacteria | 1148 |
| 884 | Ga0500555_000474 | 3300053103 | Bacteria | 16656 |
| 885 | Ga0500592_015086 | 3300053116 | Bacteria | 1239 |
| 886 | Ga0500616_0000173 | 3300053153 | Bacteria | 107646 |
| 887 | Ga0500645_002162 | 3300053730 | Bacteria | 9009 |
| 888 | Ga0500599_013758 | 3300053736 | Bacteria | 1097 |
| 889 | Ga0501084_0046060 | 3300054114 | Bacteria | 3652 |
| 890 | Ga0501084_0139906 | 3300054114 | Bacteria | 2038 |
| 891 | Ga0501084_0178706 | 3300054114 | Bacteria | 1791 |
| 892 | Ga0501084_0607380 | 3300054114 | Bacteria | 924 |
| 893 | Ga0501084_0651585 | 3300054114 | Bacteria | 889 |
| 894 | Ga0501084_0738545 | 3300054114 | Bacteria | 830 |
| 895 | Ga0590071_017298 | 3300059421 | Bacteria | 1693 |
| 896 | Ga0587094_103007 | 3300059513 | Bacteria | 553 |
| 897 | Ga0587111_0255005 | 3300060346 | Bacteria | 520 |
| 898 | Ga0501082_0056096 | 3300060353 | Bacteria | 3393 |
| 899 | Ga0501082_0059928 | 3300060353 | Bacteria | 3279 |
| 900 | Ga0501082_0133257 | 3300060353 | Bacteria | 2156 |
| 901 | Ga0501082_0277963 | 3300060353 | Bacteria | 1457 |
| 902 | Ga0501082_0485784 | 3300060353 | Bacteria | 1079 |
| 903 | Ga0501082_0651176 | 3300060353 | Bacteria | 922 |
| 904 | Ga0501082_0907663 | 3300060353 | Bacteria | 770 |
| 905 | Ga0530510_0006450 | 3300061734 | Bacteria | 8169 |
| 906 | Ga0530510_0026290 | 3300061734 | Bacteria | 4165 |
| 907 | Ga0530510_0047756 | 3300061734 | Bacteria | 3093 |
| 908 | Ga0530510_0068221 | 3300061734 | Bacteria | 2580 |
| 909 | Ga0530510_0093023 | 3300061734 | Bacteria | 2201 |
| 910 | Ga0530510_0100688 | 3300061734 | Bacteria | 2112 |
| 911 | Ga0530510_0115637 | 3300061734 | Bacteria | 1967 |
| 912 | Ga0530510_0412994 | 3300061734 | Bacteria | 1018 |
| 913 | Ga0530510_0556282 | 3300061734 | Bacteria | 871 |
| 914 | Ga0530510_0582018 | 3300061734 | Bacteria | 851 |
| 915 | Ga0530510_0672997 | 3300061734 | Bacteria | 788 |
| 916 | Ga0530510_1168134 | 3300061734 | Bacteria | 590 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005340 | Ga0070689_100820233 | Ga0070689_1008202332 | 92 |
| 2 | 3300005842 | Ga0068858_101028204 | Ga0068858_1010282042 | 92 |
| 3 | 3300006358 | Ga0068871_100273633 | Ga0068871_1002736333 | 92 |
| 4 | 3300006881 | Ga0068865_100277192 | Ga0068865_1002771922 | 92 |
| 5 | 3300009176 | Ga0105242_10182109 | Ga0105242_101821093 | 92 |
| 6 | 3300009177 | Ga0105248_11529107 | Ga0105248_115291072 | 92 |
| 7 | 3300013297 | Ga0157378_12316347 | Ga0157378_123163471 | 92 |
| 8 | 3300014968 | Ga0157379_11077913 | Ga0157379_110779132 | 92 |
| 9 | 3300039438 | Ga0436360_1164604 | Ga0436360_1164604_1597_1887 | 92 |
| 10 | 3300005330 | Ga0070690_100080948 | Ga0070690_1000809484 | 93 |
| 11 | 3300005335 | Ga0070666_10028665 | Ga0070666_100286655 | 93 |
| 12 | 3300005338 | Ga0068868_101472963 | Ga0068868_1014729632 | 93 |
| 13 | 3300005339 | Ga0070660_100519310 | Ga0070660_1005193102 | 93 |
| 14 | 3300005343 | Ga0070687_100081895 | Ga0070687_1000818953 | 93 |
| 15 | 3300005457 | Ga0070662_101269695 | Ga0070662_1012696951 | 93 |
| 16 | 3300005544 | Ga0070686_100002243 | Ga0070686_10000224319 | 93 |
| 17 | 3300005546 | Ga0070696_100425290 | Ga0070696_1004252902 | 93 |
| 18 | 3300005578 | Ga0068854_101861472 | Ga0068854_1018614722 | 93 |
| 19 | 3300005842 | Ga0068858_100083129 | Ga0068858_1000831293 | 93 |
| 20 | 3300005842 | Ga0068858_100497176 | Ga0068858_1004971763 | 93 |
| 21 | 3300005842 | Ga0068858_101053517 | Ga0068858_1010535172 | 93 |
| 22 | 3300005843 | Ga0068860_100611688 | Ga0068860_1006116883 | 93 |
| 23 | 3300006173 | Ga0070716_100709258 | Ga0070716_1007092582 | 93 |
| 24 | 3300006871 | Ga0075434_100544981 | Ga0075434_1005449812 | 93 |
| 25 | 3300014968 | Ga0157379_10618542 | Ga0157379_106185422 | 93 |
| 26 | 3300015265 | Ga0182005_1090088 | Ga0182005_10900881 | 93 |
| 27 | 3300025941 | Ga0207711_10641574 | Ga0207711_106415742 | 93 |
| 28 | 3300035117 | Ga0373953_0290486 | Ga0373953_0290486_47_409 | 93 |
| 29 | 3300035117 | Ga0373953_0343095 | Ga0373953_0343095_27_401 | 93 |
| 30 | 3300036401 | Ga0373937_0668610 | Ga0373937_0668610_270_644 | 93 |
| 31 | 3300046459 | Ga0495629_0378373 | Ga0495629_0378373_285_659 | 93 |
| 32 | 3300046516 | Ga0495628_0265137 | Ga0495628_0265137_854_1228 | 93 |
| 33 | 3300049577 | Ga0501041_0447920 | Ga0501041_0447920_188_514 | 93 |
| 34 | 3300050508 | nmdc:mga09592_915780_c1 | nmdc:mga09592_915780_c1_301_687 | 93 |
| 35 | 3300005435 | Ga0070714_100072180 | Ga0070714_1000721804 | 94 |
| 36 | 3300005468 | Ga0070707_100876942 | Ga0070707_1008769422 | 94 |
| 37 | 3300009553 | Ga0105249_10908982 | Ga0105249_109089822 | 94 |
| 38 | 3300025928 | Ga0207700_10466132 | Ga0207700_104661322 | 94 |
| 39 | 3300025929 | Ga0207664_10051260 | Ga0207664_100512605 | 94 |
| 40 | 3300025931 | Ga0207644_11414080 | Ga0207644_114140802 | 94 |
| 41 | 3300026023 | Ga0207677_11186049 | Ga0207677_111860492 | 94 |
| 42 | 3300026035 | Ga0207703_10332310 | Ga0207703_103323103 | 94 |
| 43 | 3300046683 | Ga0495658_0690527 | Ga0495658_0690527_129_464 | 94 |
| 44 | 3300049568 | Ga0501031_0406451 | Ga0501031_0406451_132_452 | 94 |
| 45 | 3300049570 | Ga0501033_0085296 | Ga0501033_0085296_1501_1821 | 94 |
| 46 | 3300049572 | Ga0501036_0355340 | Ga0501036_0355340_447_767 | 94 |
| 47 | 3300049573 | Ga0501037_0847354 | Ga0501037_0847354_55_375 | 94 |
| 48 | 3300049579 | Ga0501043_0517619 | Ga0501043_0517619_444_764 | 94 |
| 49 | 3300049582 | Ga0501048_0031213 | Ga0501048_0031213_214_534 | 94 |
| 50 | 3300049584 | Ga0501068_0782239 | Ga0501068_0782239_74_394 | 94 |
| 51 | 3300049588 | Ga0501072_0278892 | Ga0501072_0278892_279_599 | 94 |
| 52 | 3300049590 | Ga0501074_0049922 | Ga0501074_0049922_2330_2650 | 94 |
| 53 | 3300049742 | Ga0501080_1364881 | Ga0501080_1364881_246_566 | 94 |
| 54 | 3300049744 | Ga0501083_0018057 | Ga0501083_0018057_1778_2098 | 94 |
| 55 | 3300049823 | Ga0501044_0195408 | Ga0501044_0195408_944_1264 | 94 |
| 56 | 3300049824 | Ga0501045_0739732 | Ga0501045_0739732_209_529 | 94 |
| 57 | 3300005329 | Ga0070683_100283868 | Ga0070683_1002838682 | 95 |
| 58 | 3300005330 | Ga0070690_100263307 | Ga0070690_1002633072 | 95 |
| 59 | 3300005335 | Ga0070666_10549870 | Ga0070666_105498701 | 95 |
| 60 | 3300005336 | Ga0070680_101526567 | Ga0070680_1015265672 | 95 |
| 61 | 3300005338 | Ga0068868_102240447 | Ga0068868_1022404471 | 95 |
| 62 | 3300005344 | Ga0070661_101318685 | Ga0070661_1013186852 | 95 |
| 63 | 3300005345 | Ga0070692_10221517 | Ga0070692_102215172 | 95 |
| 64 | 3300005347 | Ga0070668_100066366 | Ga0070668_1000663662 | 95 |
| 65 | 3300005353 | Ga0070669_100023184 | Ga0070669_1000231842 | 95 |
| 66 | 3300005355 | Ga0070671_101335601 | Ga0070671_1013356012 | 95 |
| 67 | 3300005356 | Ga0070674_100125476 | Ga0070674_1001254761 | 95 |
| 68 | 3300005364 | Ga0070673_101604621 | Ga0070673_1016046212 | 95 |
| 69 | 3300005434 | Ga0070709_10258210 | Ga0070709_102582102 | 95 |
| 70 | 3300005438 | Ga0070701_10045623 | Ga0070701_100456232 | 95 |
| 71 | 3300005456 | Ga0070678_101079437 | Ga0070678_1010794371 | 95 |
| 72 | 3300005457 | Ga0070662_100092319 | Ga0070662_1000923193 | 95 |
| 73 | 3300005458 | Ga0070681_10065223 | Ga0070681_100652232 | 95 |
| 74 | 3300005536 | Ga0070697_101664463 | Ga0070697_1016644631 | 95 |
| 75 | 3300005548 | Ga0070665_100004733 | Ga0070665_10000473324 | 95 |
| 76 | 3300005577 | Ga0068857_101410487 | Ga0068857_1014104872 | 95 |
| 77 | 3300005615 | Ga0070702_100195821 | Ga0070702_1001958212 | 95 |
| 78 | 3300005617 | Ga0068859_102388070 | Ga0068859_1023880702 | 95 |
| 79 | 3300005719 | Ga0068861_100039337 | Ga0068861_1000393373 | 95 |
| 80 | 3300005719 | Ga0068861_101070073 | Ga0068861_1010700732 | 95 |
| 81 | 3300005842 | Ga0068858_100008638 | Ga0068858_1000086381 | 95 |
| 82 | 3300005843 | Ga0068860_100424288 | Ga0068860_1004242883 | 95 |
| 83 | 3300006237 | Ga0097621_100470680 | Ga0097621_1004706802 | 95 |
| 84 | 3300006881 | Ga0068865_100766952 | Ga0068865_1007669522 | 95 |
| 85 | 3300006931 | Ga0097620_102388317 | Ga0097620_1023883172 | 95 |
| 86 | 3300009093 | Ga0105240_11651665 | Ga0105240_116516651 | 95 |
| 87 | 3300009093 | Ga0105240_11799806 | Ga0105240_117998061 | 95 |
| 88 | 3300009098 | Ga0105245_10497484 | Ga0105245_104974841 | 95 |
| 89 | 3300009101 | Ga0105247_10281324 | Ga0105247_102813241 | 95 |
| 90 | 3300009148 | Ga0105243_10723157 | Ga0105243_107231572 | 95 |
| 91 | 3300009174 | Ga0105241_10253151 | Ga0105241_102531512 | 95 |
| 92 | 3300009174 | Ga0105241_12256884 | Ga0105241_122568841 | 95 |
| 93 | 3300009553 | Ga0105249_10563998 | Ga0105249_105639981 | 95 |
| 94 | 3300009553 | Ga0105249_11620512 | Ga0105249_116205122 | 95 |
| 95 | 3300010375 | Ga0105239_11007720 | Ga0105239_110077202 | 95 |
| 96 | 3300011119 | Ga0105246_12038190 | Ga0105246_120381901 | 95 |
| 97 | 3300013104 | Ga0157370_11146369 | Ga0157370_111463691 | 95 |
| 98 | 3300013296 | Ga0157374_10443118 | Ga0157374_104431182 | 95 |
| 99 | 3300013306 | Ga0163162_10069444 | Ga0163162_100694445 | 95 |
| 100 | 3300013306 | Ga0163162_11337826 | Ga0163162_113378262 | 95 |
| 101 | 3300013308 | Ga0157375_11278336 | Ga0157375_112783362 | 95 |
| 102 | 3300014326 | Ga0157380_10116123 | Ga0157380_101161233 | 95 |
| 103 | 3300014969 | Ga0157376_10164129 | Ga0157376_101641292 | 95 |
| 104 | 3300025907 | Ga0207645_11085791 | Ga0207645_110857911 | 95 |
| 105 | 3300025912 | Ga0207707_10065987 | Ga0207707_100659873 | 95 |
| 106 | 3300025934 | Ga0207686_11015734 | Ga0207686_110157341 | 95 |
| 107 | 3300025935 | Ga0207709_10664809 | Ga0207709_106648092 | 95 |
| 108 | 3300025937 | Ga0207669_10009893 | Ga0207669_100098939 | 95 |
| 109 | 3300025938 | Ga0207704_10174646 | Ga0207704_101746462 | 95 |
| 110 | 3300025941 | Ga0207711_10418506 | Ga0207711_104185062 | 95 |
| 111 | 3300026041 | Ga0207639_11412385 | Ga0207639_114123852 | 95 |
| 112 | 3300026089 | Ga0207648_10129854 | Ga0207648_101298543 | 95 |
| 113 | 3300042436 | Ga0439435_0206099 | Ga0439435_0206099_268_615 | 95 |
| 114 | 3300046559 | Ga0495667_0526525 | Ga0495667_0526525_45_377 | 95 |
| 115 | 3300004803 | Ga0058862_12254497 | Ga0058862_122544972 | 96 |
| 116 | 3300005289 | Ga0065704_10056506 | Ga0065704_100565062 | 96 |
| 117 | 3300005295 | Ga0065707_10428556 | Ga0065707_104285562 | 96 |
| 118 | 3300005329 | Ga0070683_100222088 | Ga0070683_1002220882 | 96 |
| 119 | 3300005334 | Ga0068869_100137668 | Ga0068869_1001376682 | 96 |
| 120 | 3300005335 | Ga0070666_10280388 | Ga0070666_102803883 | 96 |
| 121 | 3300005336 | Ga0070680_100220627 | Ga0070680_1002206272 | 96 |
| 122 | 3300005340 | Ga0070689_102225580 | Ga0070689_1022255801 | 96 |
| 123 | 3300005341 | Ga0070691_10002062 | Ga0070691_100020628 | 96 |
| 124 | 3300005341 | Ga0070691_10209094 | Ga0070691_102090943 | 96 |
| 125 | 3300005345 | Ga0070692_10232948 | Ga0070692_102329482 | 96 |
| 126 | 3300005347 | Ga0070668_100428978 | Ga0070668_1004289783 | 96 |
| 127 | 3300005347 | Ga0070668_101134675 | Ga0070668_1011346752 | 96 |
| 128 | 3300005353 | Ga0070669_100021577 | Ga0070669_1000215773 | 96 |
| 129 | 3300005353 | Ga0070669_100049339 | Ga0070669_1000493394 | 96 |
| 130 | 3300005353 | Ga0070669_100122468 | Ga0070669_1001224684 | 96 |
| 131 | 3300005355 | Ga0070671_101448647 | Ga0070671_1014486472 | 96 |
| 132 | 3300005364 | Ga0070673_100340219 | Ga0070673_1003402192 | 96 |
| 133 | 3300005366 | Ga0070659_100864427 | Ga0070659_1008644272 | 96 |
| 134 | 3300005367 | Ga0070667_100811910 | Ga0070667_1008119102 | 96 |
| 135 | 3300005367 | Ga0070667_101348383 | Ga0070667_1013483831 | 96 |
| 136 | 3300005439 | Ga0070711_101213651 | Ga0070711_1012136512 | 96 |
| 137 | 3300005440 | Ga0070705_100100040 | Ga0070705_1001000402 | 96 |
| 138 | 3300005440 | Ga0070705_100177513 | Ga0070705_1001775132 | 96 |
| 139 | 3300005440 | Ga0070705_100301143 | Ga0070705_1003011432 | 96 |
| 140 | 3300005440 | Ga0070705_100955804 | Ga0070705_1009558042 | 96 |
| 141 | 3300005441 | Ga0070700_100007525 | Ga0070700_1000075253 | 96 |
| 142 | 3300005444 | Ga0070694_100046094 | Ga0070694_1000460944 | 96 |
| 143 | 3300005444 | Ga0070694_100308334 | Ga0070694_1003083343 | 96 |
| 144 | 3300005444 | Ga0070694_100958433 | Ga0070694_1009584331 | 96 |
| 145 | 3300005445 | Ga0070708_100026666 | Ga0070708_1000266664 | 96 |
| 146 | 3300005445 | Ga0070708_100056686 | Ga0070708_1000566867 | 96 |
| 147 | 3300005445 | Ga0070708_100294516 | Ga0070708_1002945162 | 96 |
| 148 | 3300005445 | Ga0070708_100835308 | Ga0070708_1008353082 | 96 |
| 149 | 3300005456 | Ga0070678_100834445 | Ga0070678_1008344452 | 96 |
| 150 | 3300005457 | Ga0070662_100260871 | Ga0070662_1002608712 | 96 |
| 151 | 3300005457 | Ga0070662_100540528 | Ga0070662_1005405282 | 96 |
| 152 | 3300005458 | Ga0070681_10758920 | Ga0070681_107589202 | 96 |
| 153 | 3300005459 | Ga0068867_100045942 | Ga0068867_1000459421 | 96 |
| 154 | 3300005459 | Ga0068867_100178953 | Ga0068867_1001789533 | 96 |
| 155 | 3300005459 | Ga0068867_100223316 | Ga0068867_1002233163 | 96 |
| 156 | 3300005459 | Ga0068867_100705473 | Ga0068867_1007054732 | 96 |
| 157 | 3300005467 | Ga0070706_100001965 | Ga0070706_10000196531 | 96 |
| 158 | 3300005467 | Ga0070706_100042306 | Ga0070706_1000423067 | 96 |
| 159 | 3300005467 | Ga0070706_100816889 | Ga0070706_1008168891 | 96 |
| 160 | 3300005468 | Ga0070707_100008827 | Ga0070707_10000882716 | 96 |
| 161 | 3300005471 | Ga0070698_100002716 | Ga0070698_1000027166 | 96 |
| 162 | 3300005518 | Ga0070699_100009009 | Ga0070699_10000900917 | 96 |
| 163 | 3300005518 | Ga0070699_100010853 | Ga0070699_10001085312 | 96 |
| 164 | 3300005536 | Ga0070697_100035245 | Ga0070697_1000352453 | 96 |
| 165 | 3300005536 | Ga0070697_100218055 | Ga0070697_1002180552 | 96 |
| 166 | 3300005536 | Ga0070697_100268660 | Ga0070697_1002686602 | 96 |
| 167 | 3300005536 | Ga0070697_100574344 | Ga0070697_1005743442 | 96 |
| 168 | 3300005544 | Ga0070686_100687758 | Ga0070686_1006877581 | 96 |
| 169 | 3300005544 | Ga0070686_101414077 | Ga0070686_1014140771 | 96 |
| 170 | 3300005545 | Ga0070695_100014951 | Ga0070695_1000149514 | 96 |
| 171 | 3300005545 | Ga0070695_100088758 | Ga0070695_1000887582 | 96 |
| 172 | 3300005545 | Ga0070695_101400197 | Ga0070695_1014001972 | 96 |
| 173 | 3300005546 | Ga0070696_100086961 | Ga0070696_1000869614 | 96 |
| 174 | 3300005546 | Ga0070696_100955133 | Ga0070696_1009551332 | 96 |
| 175 | 3300005546 | Ga0070696_101491205 | Ga0070696_1014912052 | 96 |
| 176 | 3300005547 | Ga0070693_100390904 | Ga0070693_1003909042 | 96 |
| 177 | 3300005547 | Ga0070693_100486478 | Ga0070693_1004864781 | 96 |
| 178 | 3300005549 | Ga0070704_100016081 | Ga0070704_1000160817 | 96 |
| 179 | 3300005549 | Ga0070704_100094027 | Ga0070704_1000940273 | 96 |
| 180 | 3300005549 | Ga0070704_100116558 | Ga0070704_1001165584 | 96 |
| 181 | 3300005549 | Ga0070704_100207477 | Ga0070704_1002074771 | 96 |
| 182 | 3300005549 | Ga0070704_100240273 | Ga0070704_1002402732 | 96 |
| 183 | 3300005549 | Ga0070704_102142396 | Ga0070704_1021423961 | 96 |
| 184 | 3300005564 | Ga0070664_100428998 | Ga0070664_1004289983 | 96 |
| 185 | 3300005578 | Ga0068854_100810471 | Ga0068854_1008104712 | 96 |
| 186 | 3300005617 | Ga0068859_100064378 | Ga0068859_1000643788 | 96 |
| 187 | 3300005718 | Ga0068866_10025223 | Ga0068866_100252233 | 96 |
| 188 | 3300005718 | Ga0068866_11184926 | Ga0068866_111849261 | 96 |
| 189 | 3300005719 | Ga0068861_100014830 | Ga0068861_1000148307 | 96 |
| 190 | 3300005719 | Ga0068861_101564511 | Ga0068861_1015645112 | 96 |
| 191 | 3300005719 | Ga0068861_101973936 | Ga0068861_1019739362 | 96 |
| 192 | 3300005840 | Ga0068870_10146720 | Ga0068870_101467202 | 96 |
| 193 | 3300005840 | Ga0068870_10778808 | Ga0068870_107788082 | 96 |
| 194 | 3300005841 | Ga0068863_100097852 | Ga0068863_1000978523 | 96 |
| 195 | 3300005841 | Ga0068863_100184464 | Ga0068863_1001844642 | 96 |
| 196 | 3300005844 | Ga0068862_101281598 | Ga0068862_1012815982 | 96 |
| 197 | 3300005844 | Ga0068862_102497059 | Ga0068862_1024970591 | 96 |
| 198 | 3300005937 | Ga0081455_10753556 | Ga0081455_107535562 | 96 |
| 199 | 3300005985 | Ga0081539_10001809 | Ga0081539_100018097 | 96 |
| 200 | 3300005985 | Ga0081539_10367087 | Ga0081539_103670871 | 96 |
| 201 | 3300006058 | Ga0075432_10496902 | Ga0075432_104969022 | 96 |
| 202 | 3300006844 | Ga0075428_100003976 | Ga0075428_1000039767 | 96 |
| 203 | 3300006844 | Ga0075428_100041079 | Ga0075428_1000410797 | 96 |
| 204 | 3300006844 | Ga0075428_100052271 | Ga0075428_1000522713 | 96 |
| 205 | 3300006844 | Ga0075428_100068017 | Ga0075428_1000680177 | 96 |
| 206 | 3300006846 | Ga0075430_100000851 | Ga0075430_10000085135 | 96 |
| 207 | 3300006846 | Ga0075430_100004590 | Ga0075430_10000459018 | 96 |
| 208 | 3300006846 | Ga0075430_100037664 | Ga0075430_1000376641 | 96 |
| 209 | 3300006846 | Ga0075430_100045839 | Ga0075430_1000458394 | 96 |
| 210 | 3300006846 | Ga0075430_100226489 | Ga0075430_1002264893 | 96 |
| 211 | 3300006847 | Ga0075431_100000559 | Ga0075431_10000055939 | 96 |
| 212 | 3300006847 | Ga0075431_100004746 | Ga0075431_10000474623 | 96 |
| 213 | 3300006847 | Ga0075431_100011238 | Ga0075431_10001123815 | 96 |
| 214 | 3300006847 | Ga0075431_100028459 | Ga0075431_10002845914 | 96 |
| 215 | 3300006847 | Ga0075431_100038375 | Ga0075431_1000383757 | 96 |
| 216 | 3300006847 | Ga0075431_100079415 | Ga0075431_1000794155 | 96 |
| 217 | 3300006847 | Ga0075431_100179876 | Ga0075431_1001798761 | 96 |
| 218 | 3300006847 | Ga0075431_100599993 | Ga0075431_1005999932 | 96 |
| 219 | 3300006847 | Ga0075431_100633742 | Ga0075431_1006337422 | 96 |
| 220 | 3300006852 | Ga0075433_10120900 | Ga0075433_101209002 | 96 |
| 221 | 3300006852 | Ga0075433_10224184 | Ga0075433_102241842 | 96 |
| 222 | 3300006852 | Ga0075433_10370500 | Ga0075433_103705003 | 96 |
| 223 | 3300006852 | Ga0075433_10500166 | Ga0075433_105001662 | 96 |
| 224 | 3300006852 | Ga0075433_10846187 | Ga0075433_108461872 | 96 |
| 225 | 3300006852 | Ga0075433_11050999 | Ga0075433_110509992 | 96 |
| 226 | 3300006852 | Ga0075433_11118545 | Ga0075433_111185452 | 96 |
| 227 | 3300006852 | Ga0075433_11368630 | Ga0075433_113686302 | 96 |
| 228 | 3300006871 | Ga0075434_100037241 | Ga0075434_1000372414 | 96 |
| 229 | 3300006871 | Ga0075434_100039528 | Ga0075434_1000395285 | 96 |
| 230 | 3300006871 | Ga0075434_100089001 | Ga0075434_1000890013 | 96 |
| 231 | 3300006871 | Ga0075434_100113212 | Ga0075434_1001132127 | 96 |
| 232 | 3300006871 | Ga0075434_100203297 | Ga0075434_1002032972 | 96 |
| 233 | 3300006871 | Ga0075434_100287390 | Ga0075434_1002873903 | 96 |
| 234 | 3300006871 | Ga0075434_100292687 | Ga0075434_1002926872 | 96 |
| 235 | 3300006871 | Ga0075434_100299949 | Ga0075434_1002999493 | 96 |
| 236 | 3300006871 | Ga0075434_100471709 | Ga0075434_1004717092 | 96 |
| 237 | 3300006871 | Ga0075434_100974893 | Ga0075434_1009748932 | 96 |
| 238 | 3300006871 | Ga0075434_101458197 | Ga0075434_1014581972 | 96 |
| 239 | 3300006871 | Ga0075434_101463716 | Ga0075434_1014637162 | 96 |
| 240 | 3300006880 | Ga0075429_100000843 | Ga0075429_1000008437 | 96 |
| 241 | 3300006880 | Ga0075429_100032187 | Ga0075429_1000321877 | 96 |
| 242 | 3300006880 | Ga0075429_100057615 | Ga0075429_1000576155 | 96 |
| 243 | 3300006880 | Ga0075429_100144453 | Ga0075429_1001444534 | 96 |
| 244 | 3300006880 | Ga0075429_100146367 | Ga0075429_1001463675 | 96 |
| 245 | 3300006881 | Ga0068865_100006729 | Ga0068865_1000067292 | 96 |
| 246 | 3300006881 | Ga0068865_100411019 | Ga0068865_1004110192 | 96 |
| 247 | 3300006881 | Ga0068865_101121383 | Ga0068865_1011213831 | 96 |
| 248 | 3300006914 | Ga0075436_100111308 | Ga0075436_1001113083 | 96 |
| 249 | 3300006914 | Ga0075436_100133842 | Ga0075436_1001338422 | 96 |
| 250 | 3300006914 | Ga0075436_100198493 | Ga0075436_1001984932 | 96 |
| 251 | 3300006914 | Ga0075436_100286757 | Ga0075436_1002867573 | 96 |
| 252 | 3300006914 | Ga0075436_100533205 | Ga0075436_1005332052 | 96 |
| 253 | 3300006914 | Ga0075436_101340573 | Ga0075436_1013405731 | 96 |
| 254 | 3300006931 | Ga0097620_100064378 | Ga0097620_1000643788 | 96 |
| 255 | 3300007076 | Ga0075435_100001694 | Ga0075435_1000016946 | 96 |
| 256 | 3300007076 | Ga0075435_100014113 | Ga0075435_1000141137 | 96 |
| 257 | 3300007076 | Ga0075435_100059076 | Ga0075435_1000590764 | 96 |
| 258 | 3300007076 | Ga0075435_100067393 | Ga0075435_1000673933 | 96 |
| 259 | 3300007076 | Ga0075435_100095281 | Ga0075435_1000952812 | 96 |
| 260 | 3300007076 | Ga0075435_100124387 | Ga0075435_1001243874 | 96 |
| 261 | 3300007076 | Ga0075435_100200060 | Ga0075435_1002000603 | 96 |
| 262 | 3300007076 | Ga0075435_100364233 | Ga0075435_1003642332 | 96 |
| 263 | 3300007076 | Ga0075435_100539713 | Ga0075435_1005397133 | 96 |
| 264 | 3300007076 | Ga0075435_100869758 | Ga0075435_1008697581 | 96 |
| 265 | 3300007265 | Ga0099794_10043450 | Ga0099794_100434504 | 96 |
| 266 | 3300007265 | Ga0099794_10120762 | Ga0099794_101207622 | 96 |
| 267 | 3300007265 | Ga0099794_10365598 | Ga0099794_103655981 | 96 |
| 268 | 3300009092 | Ga0105250_10208141 | Ga0105250_102081412 | 96 |
| 269 | 3300009094 | Ga0111539_10000675 | Ga0111539_100006757 | 96 |
| 270 | 3300009094 | Ga0111539_10065945 | Ga0111539_100659457 | 96 |
| 271 | 3300009094 | Ga0111539_10125011 | Ga0111539_101250113 | 96 |
| 272 | 3300009094 | Ga0111539_12771457 | Ga0111539_127714572 | 96 |
| 273 | 3300009098 | Ga0105245_11981794 | Ga0105245_119817942 | 96 |
| 274 | 3300009101 | Ga0105247_10087814 | Ga0105247_100878144 | 96 |
| 275 | 3300009101 | Ga0105247_10333293 | Ga0105247_103332932 | 96 |
| 276 | 3300009147 | Ga0114129_10013876 | Ga0114129_1001387618 | 96 |
| 277 | 3300009147 | Ga0114129_10022212 | Ga0114129_100222127 | 96 |
| 278 | 3300009147 | Ga0114129_10033145 | Ga0114129_1003314511 | 96 |
| 279 | 3300009147 | Ga0114129_10036838 | Ga0114129_1003683815 | 96 |
| 280 | 3300009147 | Ga0114129_10052918 | Ga0114129_100529187 | 96 |
| 281 | 3300009147 | Ga0114129_10065603 | Ga0114129_1006560312 | 96 |
| 282 | 3300009147 | Ga0114129_10078309 | Ga0114129_100783097 | 96 |
| 283 | 3300009147 | Ga0114129_10125293 | Ga0114129_101252932 | 96 |
| 284 | 3300009147 | Ga0114129_10334100 | Ga0114129_103341002 | 96 |
| 285 | 3300009147 | Ga0114129_10772632 | Ga0114129_107726322 | 96 |
| 286 | 3300009147 | Ga0114129_11213939 | Ga0114129_112139391 | 96 |
| 287 | 3300009147 | Ga0114129_11231848 | Ga0114129_112318481 | 96 |
| 288 | 3300009147 | Ga0114129_11811059 | Ga0114129_118110592 | 96 |
| 289 | 3300009147 | Ga0114129_13379342 | Ga0114129_133793421 | 96 |
| 290 | 3300009174 | Ga0105241_10146349 | Ga0105241_101463492 | 96 |
| 291 | 3300009176 | Ga0105242_10993609 | Ga0105242_109936092 | 96 |
| 292 | 3300009176 | Ga0105242_11360086 | Ga0105242_113600862 | 96 |
| 293 | 3300009553 | Ga0105249_10178723 | Ga0105249_101787232 | 96 |
| 294 | 3300009553 | Ga0105249_10780936 | Ga0105249_107809362 | 96 |
| 295 | 3300009553 | Ga0105249_13128416 | Ga0105249_131284161 | 96 |
| 296 | 3300009553 | Ga0105249_13141829 | Ga0105249_131418291 | 96 |
| 297 | 3300010375 | Ga0105239_10846450 | Ga0105239_108464502 | 96 |
| 298 | 3300013297 | Ga0157378_10145077 | Ga0157378_101450772 | 96 |
| 299 | 3300013297 | Ga0157378_12893552 | Ga0157378_128935522 | 96 |
| 300 | 3300013306 | Ga0163162_10017924 | Ga0163162_100179245 | 96 |
| 301 | 3300014325 | Ga0163163_12571764 | Ga0163163_125717641 | 96 |
| 302 | 3300014326 | Ga0157380_10150317 | Ga0157380_101503172 | 96 |
| 303 | 3300014326 | Ga0157380_10591588 | Ga0157380_105915882 | 96 |
| 304 | 3300014968 | Ga0157379_11645156 | Ga0157379_116451561 | 96 |
| 305 | 3300017792 | Ga0163161_10378849 | Ga0163161_103788492 | 96 |
| 306 | 3300025907 | Ga0207645_10173020 | Ga0207645_101730202 | 96 |
| 307 | 3300025908 | Ga0207643_10188151 | Ga0207643_101881513 | 96 |
| 308 | 3300025908 | Ga0207643_10559346 | Ga0207643_105593462 | 96 |
| 309 | 3300025910 | Ga0207684_10000456 | Ga0207684_100004567 | 96 |
| 310 | 3300025910 | Ga0207684_10032897 | Ga0207684_100328973 | 96 |
| 311 | 3300025910 | Ga0207684_10773599 | Ga0207684_107735992 | 96 |
| 312 | 3300025911 | Ga0207654_10096575 | Ga0207654_100965754 | 96 |
| 313 | 3300025911 | Ga0207654_10109396 | Ga0207654_101093962 | 96 |
| 314 | 3300025912 | Ga0207707_11057600 | Ga0207707_110576002 | 96 |
| 315 | 3300025917 | Ga0207660_10007743 | Ga0207660_1000774315 | 96 |
| 316 | 3300025917 | Ga0207660_10359488 | Ga0207660_103594882 | 96 |
| 317 | 3300025918 | Ga0207662_10077900 | Ga0207662_100779002 | 96 |
| 318 | 3300025921 | Ga0207652_10387727 | Ga0207652_103877272 | 96 |
| 319 | 3300025922 | Ga0207646_10006057 | Ga0207646_100060577 | 96 |
| 320 | 3300025923 | Ga0207681_10032040 | Ga0207681_100320404 | 96 |
| 321 | 3300025923 | Ga0207681_10043484 | Ga0207681_100434844 | 96 |
| 322 | 3300025923 | Ga0207681_10197103 | Ga0207681_101971033 | 96 |
| 323 | 3300025926 | Ga0207659_10814445 | Ga0207659_108144451 | 96 |
| 324 | 3300025927 | Ga0207687_10957950 | Ga0207687_109579502 | 96 |
| 325 | 3300025932 | Ga0207690_10772675 | Ga0207690_107726752 | 96 |
| 326 | 3300025933 | Ga0207706_10057499 | Ga0207706_100574992 | 96 |
| 327 | 3300025933 | Ga0207706_10127122 | Ga0207706_101271223 | 96 |
| 328 | 3300025935 | Ga0207709_10150410 | Ga0207709_101504102 | 96 |
| 329 | 3300025937 | Ga0207669_10070993 | Ga0207669_100709933 | 96 |
| 330 | 3300025937 | Ga0207669_10088983 | Ga0207669_100889833 | 96 |
| 331 | 3300025938 | Ga0207704_10216720 | Ga0207704_102167202 | 96 |
| 332 | 3300025938 | Ga0207704_10670876 | Ga0207704_106708761 | 96 |
| 333 | 3300025942 | Ga0207689_11211116 | Ga0207689_112111161 | 96 |
| 334 | 3300025960 | Ga0207651_10238268 | Ga0207651_102382683 | 96 |
| 335 | 3300025961 | Ga0207712_10227141 | Ga0207712_102271413 | 96 |
| 336 | 3300026075 | Ga0207708_10024133 | Ga0207708_100241333 | 96 |
| 337 | 3300026088 | Ga0207641_10034453 | Ga0207641_100344535 | 96 |
| 338 | 3300026089 | Ga0207648_10060929 | Ga0207648_100609296 | 96 |
| 339 | 3300026118 | Ga0207675_100022779 | Ga0207675_1000227793 | 96 |
| 340 | 3300026118 | Ga0207675_100129766 | Ga0207675_1001297662 | 96 |
| 341 | 3300026118 | Ga0207675_100658556 | Ga0207675_1006585562 | 96 |
| 342 | 3300026118 | Ga0207675_100804005 | Ga0207675_1008040052 | 96 |
| 343 | 3300027252 | Ga0209973_1070917 | Ga0209973_10709171 | 96 |
| 344 | 3300027665 | Ga0209983_1069098 | Ga0209983_10690982 | 96 |
| 345 | 3300027671 | Ga0209588_1068174 | Ga0209588_10681742 | 96 |
| 346 | 3300027907 | Ga0207428_10009686 | Ga0207428_100096862 | 96 |
| 347 | 3300027907 | Ga0207428_10055654 | Ga0207428_100556544 | 96 |
| 348 | 3300027907 | Ga0207428_10077225 | Ga0207428_100772254 | 96 |
| 349 | 3300028380 | Ga0268265_10009567 | Ga0268265_100095677 | 96 |
| 350 | 3300028380 | Ga0268265_10291710 | Ga0268265_102917102 | 96 |
| 351 | 3300031548 | Ga0307408_100128636 | Ga0307408_1001286361 | 96 |
| 352 | 3300031548 | Ga0307408_100300990 | Ga0307408_1003009903 | 96 |
| 353 | 3300031548 | Ga0307408_100315007 | Ga0307408_1003150072 | 96 |
| 354 | 3300031548 | Ga0307408_100360495 | Ga0307408_1003604953 | 96 |
| 355 | 3300031731 | Ga0307405_10518890 | Ga0307405_105188902 | 96 |
| 356 | 3300031731 | Ga0307405_11082264 | Ga0307405_110822642 | 96 |
| 357 | 3300031824 | Ga0307413_11168206 | Ga0307413_111682061 | 96 |
| 358 | 3300031901 | Ga0307406_10032354 | Ga0307406_100323542 | 96 |
| 359 | 3300031903 | Ga0307407_11227243 | Ga0307407_112272432 | 96 |
| 360 | 3300031911 | Ga0307412_10277063 | Ga0307412_102770632 | 96 |
| 361 | 3300031911 | Ga0307412_10737472 | Ga0307412_107374722 | 96 |
| 362 | 3300031995 | Ga0307409_100867898 | Ga0307409_1008678982 | 96 |
| 363 | 3300031995 | Ga0307409_100967154 | Ga0307409_1009671542 | 96 |
| 364 | 3300031995 | Ga0307409_102703589 | Ga0307409_1027035892 | 96 |
| 365 | 3300032002 | Ga0307416_100069478 | Ga0307416_1000694781 | 96 |
| 366 | 3300032002 | Ga0307416_101553644 | Ga0307416_1015536442 | 96 |
| 367 | 3300032004 | Ga0307414_10203566 | Ga0307414_102035663 | 96 |
| 368 | 3300032005 | Ga0307411_10011154 | Ga0307411_1001115412 | 96 |
| 369 | 3300032005 | Ga0307411_10975335 | Ga0307411_109753352 | 96 |
| 370 | 3300032005 | Ga0307411_11728989 | Ga0307411_117289891 | 96 |
| 371 | 3300032126 | Ga0307415_101096615 | Ga0307415_1010966151 | 96 |
| 372 | 3300034817 | Ga0373948_0026171 | Ga0373948_0026171_771_1064 | 96 |
| 373 | 3300034820 | Ga0373959_0019147 | Ga0373959_0019147_47_340 | 96 |
| 374 | 3300035085 | Ga0373929_0186064 | Ga0373929_0186064_108_401 | 96 |
| 375 | 3300035088 | Ga0373940_0114535 | Ga0373940_0114535_156_449 | 96 |
| 376 | 3300035090 | Ga0373949_0039153 | Ga0373949_0039153_583_876 | 96 |
| 377 | 3300035090 | Ga0373949_0050917 | Ga0373949_0050917_221_514 | 96 |
| 378 | 3300035090 | Ga0373949_0156641 | Ga0373949_0156641_255_548 | 96 |
| 379 | 3300035112 | Ga0373932_0192600 | Ga0373932_0192600_116_409 | 96 |
| 380 | 3300035114 | Ga0373939_0107338 | Ga0373939_0107338_602_895 | 96 |
| 381 | 3300035114 | Ga0373939_0368385 | Ga0373939_0368385_144_437 | 96 |
| 382 | 3300035207 | Ga0373942_0216206 | Ga0373942_0216206_194_487 | 96 |
| 383 | 3300035241 | Ga0373961_0306054 | Ga0373961_0306054_79_372 | 96 |
| 384 | 3300035691 | Ga0373931_0002096 | Ga0373931_0002096_2554_2847 | 96 |
| 385 | 3300035691 | Ga0373931_0269723 | Ga0373931_0269723_415_708 | 96 |
| 386 | 3300035691 | Ga0373931_0867625 | Ga0373931_0867625_16_309 | 96 |
| 387 | 3300036401 | Ga0373937_2036599 | Ga0373937_2036599_169_474 | 96 |
| 388 | 3300037418 | Ga0395900_0534850 | Ga0395900_0534850_418_711 | 96 |
| 389 | 3300038443 | Ga0395901_0226862 | Ga0395901_0226862_348_641 | 96 |
| 390 | 3300038996 | Ga0242420_011734 | Ga0242420_011734_919_1212 | 96 |
| 391 | 3300042116 | Ga0450912_004737 | Ga0450912_004737_446_769 | 96 |
| 392 | 3300042436 | Ga0439435_0100211 | Ga0439435_0100211_368_661 | 96 |
| 393 | 3300042436 | Ga0439435_0310367 | Ga0439435_0310367_190_483 | 96 |
| 394 | 3300042461 | Ga0439460_0100071 | Ga0439460_0100071_459_752 | 96 |
| 395 | 3300042876 | Ga0451577_0205501 | Ga0451577_0205501_738_1031 | 96 |
| 396 | 3300044712 | Ga0453684_0256633 | Ga0453684_0256633_1340_1633 | 96 |
| 397 | 3300045051 | Ga0451576_0278101 | Ga0451576_0278101_1255_1548 | 96 |
| 398 | 3300045051 | Ga0451576_0561226 | Ga0451576_0561226_363_656 | 96 |
| 399 | 3300046455 | Ga0495603_0312576 | Ga0495603_0312576_538_831 | 96 |
| 400 | 3300046472 | Ga0495580_0000020 | Ga0495580_0000020_88124_88417 | 96 |
| 401 | 3300046528 | Ga0495642_0009559 | Ga0495642_0009559_2248_2541 | 96 |
| 402 | 3300046528 | Ga0495642_0202337 | Ga0495642_0202337_562_855 | 96 |
| 403 | 3300046537 | Ga0495598_0084538 | Ga0495598_0084538_511_804 | 96 |
| 404 | 3300046615 | Ga0495656_0163586 | Ga0495656_0163586_771_1064 | 96 |
| 405 | 3300046664 | Ga0495659_0041994 | Ga0495659_0041994_737_1030 | 96 |
| 406 | 3300046664 | Ga0495659_0145914 | Ga0495659_0145914_31_324 | 96 |
| 407 | 3300046664 | Ga0495659_0221049 | Ga0495659_0221049_61_354 | 96 |
| 408 | 3300046684 | Ga0495669_0020738 | Ga0495669_0020738_540_833 | 96 |
| 409 | 3300046691 | Ga0495670_0092012 | Ga0495670_0092012_917_1210 | 96 |
| 410 | 3300047318 | Ga0495636_0060520 | Ga0495636_0060520_620_913 | 96 |
| 411 | 3300048905 | Ga0496102_0047759 | Ga0496102_0047759_2624_2917 | 96 |
| 412 | 3300048905 | Ga0496102_0268575 | Ga0496102_0268575_790_1083 | 96 |
| 413 | 3300048909 | Ga0496106_0410272 | Ga0496106_0410272_81_431 | 96 |
| 414 | 3300048909 | Ga0496106_0560420 | Ga0496106_0560420_149_442 | 96 |
| 415 | 3300048909 | Ga0496106_0685352 | Ga0496106_0685352_317_610 | 96 |
| 416 | 3300048910 | Ga0496107_0210509 | Ga0496107_0210509_341_634 | 96 |
| 417 | 3300048910 | Ga0496107_0608545 | Ga0496107_0608545_244_537 | 96 |
| 418 | 3300048912 | Ga0496109_0283991 | Ga0496109_0283991_1211_1504 | 96 |
| 419 | 3300049129 | Ga0501309_033728 | Ga0501309_033728_21_314 | 96 |
| 420 | 3300049521 | Ga0501298_069749 | Ga0501298_069749_298_591 | 96 |
| 421 | 3300049522 | Ga0501299_012854 | Ga0501299_012854_1045_1338 | 96 |
| 422 | 3300049525 | Ga0501302_016186 | Ga0501302_016186_33_326 | 96 |
| 423 | 3300049528 | Ga0501312_100006 | Ga0501312_100006_192_485 | 96 |
| 424 | 3300049568 | Ga0501031_0254315 | Ga0501031_0254315_484_777 | 96 |
| 425 | 3300049572 | Ga0501036_0070188 | Ga0501036_0070188_2543_2836 | 96 |
| 426 | 3300049572 | Ga0501036_0307850 | Ga0501036_0307850_323_616 | 96 |
| 427 | 3300049573 | Ga0501037_0540096 | Ga0501037_0540096_162_455 | 96 |
| 428 | 3300049574 | Ga0501038_0073380 | Ga0501038_0073380_203_496 | 96 |
| 429 | 3300049574 | Ga0501038_0474785 | Ga0501038_0474785_304_597 | 96 |
| 430 | 3300049574 | Ga0501038_0681183 | Ga0501038_0681183_197_490 | 96 |
| 431 | 3300049574 | Ga0501038_1154180 | Ga0501038_1154180_185_478 | 96 |
| 432 | 3300049574 | Ga0501038_1179308 | Ga0501038_1179308_43_336 | 96 |
| 433 | 3300049575 | Ga0501039_0256958 | Ga0501039_0256958_781_1074 | 96 |
| 434 | 3300049575 | Ga0501039_0257176 | Ga0501039_0257176_169_462 | 96 |
| 435 | 3300049575 | Ga0501039_0402209 | Ga0501039_0402209_80_373 | 96 |
| 436 | 3300049575 | Ga0501039_0500394 | Ga0501039_0500394_415_708 | 96 |
| 437 | 3300049575 | Ga0501039_1536235 | Ga0501039_1536235_76_369 | 96 |
| 438 | 3300049576 | Ga0501040_0224705 | Ga0501040_0224705_553_846 | 96 |
| 439 | 3300049576 | Ga0501040_0470201 | Ga0501040_0470201_478_771 | 96 |
| 440 | 3300049576 | Ga0501040_0515052 | Ga0501040_0515052_236_529 | 96 |
| 441 | 3300049576 | Ga0501040_0695258 | Ga0501040_0695258_157_450 | 96 |
| 442 | 3300049576 | Ga0501040_0715140 | Ga0501040_0715140_51_344 | 96 |
| 443 | 3300049577 | Ga0501041_0027203 | Ga0501041_0027203_518_811 | 96 |
| 444 | 3300049577 | Ga0501041_0479686 | Ga0501041_0479686_337_630 | 96 |
| 445 | 3300049578 | Ga0501042_0047787 | Ga0501042_0047787_405_698 | 96 |
| 446 | 3300049578 | Ga0501042_0115555 | Ga0501042_0115555_1200_1493 | 96 |
| 447 | 3300049578 | Ga0501042_0329784 | Ga0501042_0329784_429_722 | 96 |
| 448 | 3300049578 | Ga0501042_0335219 | Ga0501042_0335219_547_840 | 96 |
| 449 | 3300049579 | Ga0501043_1125303 | Ga0501043_1125303_45_338 | 96 |
| 450 | 3300049579 | Ga0501043_1313962 | Ga0501043_1313962_128_421 | 96 |
| 451 | 3300049580 | Ga0501046_0122797 | Ga0501046_0122797_648_941 | 96 |
| 452 | 3300049580 | Ga0501046_0261729 | Ga0501046_0261729_175_468 | 96 |
| 453 | 3300049580 | Ga0501046_0483405 | Ga0501046_0483405_530_823 | 96 |
| 454 | 3300049581 | Ga0501047_0809142 | Ga0501047_0809142_137_430 | 96 |
| 455 | 3300049582 | Ga0501048_0128505 | Ga0501048_0128505_1125_1418 | 96 |
| 456 | 3300049582 | Ga0501048_0170574 | Ga0501048_0170574_376_669 | 96 |
| 457 | 3300049582 | Ga0501048_1222170 | Ga0501048_1222170_24_317 | 96 |
| 458 | 3300049583 | Ga0501067_0019308 | Ga0501067_0019308_3262_3555 | 96 |
| 459 | 3300049584 | Ga0501068_0029501 | Ga0501068_0029501_2215_2508 | 96 |
| 460 | 3300049584 | Ga0501068_0069671 | Ga0501068_0069671_1097_1390 | 96 |
| 461 | 3300049584 | Ga0501068_0203545 | Ga0501068_0203545_872_1165 | 96 |
| 462 | 3300049584 | Ga0501068_0219807 | Ga0501068_0219807_360_653 | 96 |
| 463 | 3300049584 | Ga0501068_0476435 | Ga0501068_0476435_396_689 | 96 |
| 464 | 3300049585 | Ga0501069_0021172 | Ga0501069_0021172_2489_2782 | 96 |
| 465 | 3300049585 | Ga0501069_0834116 | Ga0501069_0834116_186_479 | 96 |
| 466 | 3300049585 | Ga0501069_0923377 | Ga0501069_0923377_81_374 | 96 |
| 467 | 3300049587 | Ga0501071_0197980 | Ga0501071_0197980_180_473 | 96 |
| 468 | 3300049587 | Ga0501071_0599153 | Ga0501071_0599153_167_460 | 96 |
| 469 | 3300049587 | Ga0501071_0677607 | Ga0501071_0677607_17_310 | 96 |
| 470 | 3300049588 | Ga0501072_0014068 | Ga0501072_0014068_4105_4398 | 96 |
| 471 | 3300049588 | Ga0501072_0072312 | Ga0501072_0072312_1824_2117 | 96 |
| 472 | 3300049588 | Ga0501072_0192588 | Ga0501072_0192588_206_499 | 96 |
| 473 | 3300049588 | Ga0501072_0208710 | Ga0501072_0208710_882_1175 | 96 |
| 474 | 3300049588 | Ga0501072_0218665 | Ga0501072_0218665_30_323 | 96 |
| 475 | 3300049589 | Ga0501073_0678060 | Ga0501073_0678060_108_401 | 96 |
| 476 | 3300049590 | Ga0501074_0323643 | Ga0501074_0323643_282_575 | 96 |
| 477 | 3300049590 | Ga0501074_0610793 | Ga0501074_0610793_296_589 | 96 |
| 478 | 3300049590 | Ga0501074_0788219 | Ga0501074_0788219_132_425 | 96 |
| 479 | 3300049591 | Ga0501075_0008499 | Ga0501075_0008499_2857_3150 | 96 |
| 480 | 3300049591 | Ga0501075_0031327 | Ga0501075_0031327_3026_3319 | 96 |
| 481 | 3300049591 | Ga0501075_0050755 | Ga0501075_0050755_2761_3054 | 96 |
| 482 | 3300049591 | Ga0501075_0210467 | Ga0501075_0210467_217_510 | 96 |
| 483 | 3300049591 | Ga0501075_0266503 | Ga0501075_0266503_334_627 | 96 |
| 484 | 3300049591 | Ga0501075_0324356 | Ga0501075_0324356_571_864 | 96 |
| 485 | 3300049591 | Ga0501075_0635155 | Ga0501075_0635155_428_721 | 96 |
| 486 | 3300049592 | Ga0501076_0030185 | Ga0501076_0030185_596_889 | 96 |
| 487 | 3300049592 | Ga0501076_0044508 | Ga0501076_0044508_2561_2854 | 96 |
| 488 | 3300049592 | Ga0501076_0054495 | Ga0501076_0054495_581_874 | 96 |
| 489 | 3300049592 | Ga0501076_0108804 | Ga0501076_0108804_1504_1797 | 96 |
| 490 | 3300049592 | Ga0501076_0147246 | Ga0501076_0147246_533_826 | 96 |
| 491 | 3300049592 | Ga0501076_0207451 | Ga0501076_0207451_410_703 | 96 |
| 492 | 3300049592 | Ga0501076_0442426 | Ga0501076_0442426_737_1030 | 96 |
| 493 | 3300049592 | Ga0501076_0604756 | Ga0501076_0604756_258_551 | 96 |
| 494 | 3300049592 | Ga0501076_0726136 | Ga0501076_0726136_273_566 | 96 |
| 495 | 3300049593 | Ga0501077_0002533 | Ga0501077_0002533_3944_4237 | 96 |
| 496 | 3300049593 | Ga0501077_0004004 | Ga0501077_0004004_5638_5931 | 96 |
| 497 | 3300049593 | Ga0501077_0145854 | Ga0501077_0145854_555_848 | 96 |
| 498 | 3300049593 | Ga0501077_0204507 | Ga0501077_0204507_750_1043 | 96 |
| 499 | 3300049593 | Ga0501077_0281283 | Ga0501077_0281283_469_762 | 96 |
| 500 | 3300049741 | Ga0501079_0012904 | Ga0501079_0012904_3158_3451 | 96 |
| 501 | 3300049741 | Ga0501079_0065568 | Ga0501079_0065568_1607_1900 | 96 |
| 502 | 3300049741 | Ga0501079_0079995 | Ga0501079_0079995_2106_2399 | 96 |
| 503 | 3300049741 | Ga0501079_0081872 | Ga0501079_0081872_1734_2027 | 96 |
| 504 | 3300049741 | Ga0501079_0353864 | Ga0501079_0353864_60_353 | 96 |
| 505 | 3300049741 | Ga0501079_0673534 | Ga0501079_0673534_43_336 | 96 |
| 506 | 3300049741 | Ga0501079_0909685 | Ga0501079_0909685_162_455 | 96 |
| 507 | 3300049742 | Ga0501080_1072019 | Ga0501080_1072019_76_369 | 96 |
| 508 | 3300049742 | Ga0501080_1105096 | Ga0501080_1105096_262_555 | 96 |
| 509 | 3300049742 | Ga0501080_1443530 | Ga0501080_1443530_201_494 | 96 |
| 510 | 3300049743 | Ga0501081_0035649 | Ga0501081_0035649_521_814 | 96 |
| 511 | 3300049743 | Ga0501081_0116426 | Ga0501081_0116426_567_860 | 96 |
| 512 | 3300049743 | Ga0501081_0217630 | Ga0501081_0217630_836_1129 | 96 |
| 513 | 3300049743 | Ga0501081_0381196 | Ga0501081_0381196_22_315 | 96 |
| 514 | 3300049743 | Ga0501081_0470584 | Ga0501081_0470584_512_805 | 96 |
| 515 | 3300049743 | Ga0501081_0676940 | Ga0501081_0676940_334_627 | 96 |
| 516 | 3300049743 | Ga0501081_1255954 | Ga0501081_1255954_147_440 | 96 |
| 517 | 3300049744 | Ga0501083_0306390 | Ga0501083_0306390_282_575 | 96 |
| 518 | 3300049823 | Ga0501044_1067231 | Ga0501044_1067231_351_644 | 96 |
| 519 | 3300049824 | Ga0501045_0045065 | Ga0501045_0045065_2636_2929 | 96 |
| 520 | 3300049824 | Ga0501045_0111316 | Ga0501045_0111316_291_584 | 96 |
| 521 | 3300049824 | Ga0501045_0162253 | Ga0501045_0162253_699_992 | 96 |
| 522 | 3300049824 | Ga0501045_0189069 | Ga0501045_0189069_1097_1390 | 96 |
| 523 | 3300050507 | nmdc:mga05p37_14246_c1 | nmdc:mga05p37_14246_c1_3008_3301 | 96 |
| 524 | 3300050507 | nmdc:mga05p37_1531273_c1 | nmdc:mga05p37_1531273_c1_354_647 | 96 |
| 525 | 3300050507 | nmdc:mga05p37_2249_c1 | nmdc:mga05p37_2249_c1_4510_4902 | 96 |
| 526 | 3300050507 | nmdc:mga05p37_2645_c1 | nmdc:mga05p37_2645_c1_2048_2341 | 96 |
| 527 | 3300050507 | nmdc:mga05p37_34567_c1 | nmdc:mga05p37_34567_c1_5588_5881 | 96 |
| 528 | 3300050507 | nmdc:mga05p37_35074_c1 | nmdc:mga05p37_35074_c1_3030_3323 | 96 |
| 529 | 3300050507 | nmdc:mga05p37_43564_c1 | nmdc:mga05p37_43564_c1_2891_3184 | 96 |
| 530 | 3300050507 | nmdc:mga05p37_43602_c1 | nmdc:mga05p37_43602_c1_2024_2317 | 96 |
| 531 | 3300050507 | nmdc:mga05p37_47839_c1 | nmdc:mga05p37_47839_c1_3275_3568 | 96 |
| 532 | 3300050507 | nmdc:mga05p37_551938_c1 | nmdc:mga05p37_551938_c1_399_692 | 96 |
| 533 | 3300050507 | nmdc:mga05p37_602880_c1 | nmdc:mga05p37_602880_c1_28_321 | 96 |
| 534 | 3300050507 | nmdc:mga05p37_66375_c1 | nmdc:mga05p37_66375_c1_2622_2915 | 96 |
| 535 | 3300050507 | nmdc:mga05p37_805015_c1 | nmdc:mga05p37_805015_c1_631_924 | 96 |
| 536 | 3300050507 | nmdc:mga05p37_83387_c1 | nmdc:mga05p37_83387_c1_2766_3059 | 96 |
| 537 | 3300050507 | nmdc:mga05p37_90559_c1 | nmdc:mga05p37_90559_c1_902_1195 | 96 |
| 538 | 3300050508 | nmdc:mga09592_1037801_c1 | nmdc:mga09592_1037801_c1_372_665 | 96 |
| 539 | 3300050508 | nmdc:mga09592_105805_c1 | nmdc:mga09592_105805_c1_531_824 | 96 |
| 540 | 3300050508 | nmdc:mga09592_127446_c1 | nmdc:mga09592_127446_c1_864_1157 | 96 |
| 541 | 3300050508 | nmdc:mga09592_13087_c1 | nmdc:mga09592_13087_c1_200_493 | 96 |
| 542 | 3300050508 | nmdc:mga09592_44935_c1 | nmdc:mga09592_44935_c1_1543_1836 | 96 |
| 543 | 3300050508 | nmdc:mga09592_68878_c1 | nmdc:mga09592_68878_c1_1941_2234 | 96 |
| 544 | 3300050509 | nmdc:mga0qj67_1264138_c1 | nmdc:mga0qj67_1264138_c1_197_490 | 96 |
| 545 | 3300050509 | nmdc:mga0qj67_19800_c1 | nmdc:mga0qj67_19800_c1_1982_2275 | 96 |
| 546 | 3300050509 | nmdc:mga0qj67_2619_c1 | nmdc:mga0qj67_2619_c1_3059_3352 | 96 |
| 547 | 3300050509 | nmdc:mga0qj67_389091_c1 | nmdc:mga0qj67_389091_c1_597_890 | 96 |
| 548 | 3300050509 | nmdc:mga0qj67_5121_c1 | nmdc:mga0qj67_5121_c1_679_972 | 96 |
| 549 | 3300050509 | nmdc:mga0qj67_652_c1 | nmdc:mga0qj67_652_c1_2970_3263 | 96 |
| 550 | 3300050510 | nmdc:mga06r32_10547_c1 | nmdc:mga06r32_10547_c1_3176_3469 | 96 |
| 551 | 3300050510 | nmdc:mga06r32_133332_c1 | nmdc:mga06r32_133332_c1_2150_2443 | 96 |
| 552 | 3300050510 | nmdc:mga06r32_18264_c1 | nmdc:mga06r32_18264_c1_2449_2742 | 96 |
| 553 | 3300050510 | nmdc:mga06r32_21776_c1 | nmdc:mga06r32_21776_c1_133_426 | 96 |
| 554 | 3300050510 | nmdc:mga06r32_364376_c1 | nmdc:mga06r32_364376_c1_902_1195 | 96 |
| 555 | 3300050510 | nmdc:mga06r32_43766_c1 | nmdc:mga06r32_43766_c1_3329_3622 | 96 |
| 556 | 3300050510 | nmdc:mga06r32_61409_c1 | nmdc:mga06r32_61409_c1_1409_1702 | 96 |
| 557 | 3300050510 | nmdc:mga06r32_777101_c1 | nmdc:mga06r32_777101_c1_19_312 | 96 |
| 558 | 3300050511 | nmdc:mga08y16_145726_c1 | nmdc:mga08y16_145726_c1_1597_1968 | 96 |
| 559 | 3300050511 | nmdc:mga08y16_1481107_c1 | nmdc:mga08y16_1481107_c1_124_417 | 96 |
| 560 | 3300050511 | nmdc:mga08y16_1921394_c1 | nmdc:mga08y16_1921394_c1_26_319 | 96 |
| 561 | 3300050511 | nmdc:mga08y16_61777_c1 | nmdc:mga08y16_61777_c1_858_1151 | 96 |
| 562 | 3300050511 | nmdc:mga08y16_64772_c1 | nmdc:mga08y16_64772_c1_468_761 | 96 |
| 563 | 3300050512 | nmdc:mga0n895_135551_c1 | nmdc:mga0n895_135551_c1_1637_2002 | 96 |
| 564 | 3300050512 | nmdc:mga0n895_14_c1 | nmdc:mga0n895_14_c1_991_1353 | 96 |
| 565 | 3300050512 | nmdc:mga0n895_23374_c1 | nmdc:mga0n895_23374_c1_2379_2672 | 96 |
| 566 | 3300050512 | nmdc:mga0n895_23375_c1 | nmdc:mga0n895_23375_c1_2662_3033 | 96 |
| 567 | 3300050512 | nmdc:mga0n895_253923_c1 | nmdc:mga0n895_253923_c1_1080_1373 | 96 |
| 568 | 3300050512 | nmdc:mga0n895_352041_c1 | nmdc:mga0n895_352041_c1_679_972 | 96 |
| 569 | 3300050512 | nmdc:mga0n895_376592_c1 | nmdc:mga0n895_376592_c1_601_894 | 96 |
| 570 | 3300050512 | nmdc:mga0n895_525033_c1 | nmdc:mga0n895_525033_c1_221_514 | 96 |
| 571 | 3300050512 | nmdc:mga0n895_680737_c1 | nmdc:mga0n895_680737_c1_230_523 | 96 |
| 572 | 3300050512 | nmdc:mga0n895_708214_c1 | nmdc:mga0n895_708214_c1_227_520 | 96 |
| 573 | 3300050512 | nmdc:mga0n895_880544_c1 | nmdc:mga0n895_880544_c1_518_811 | 96 |
| 574 | 3300050512 | nmdc:mga0n895_98_c1 | nmdc:mga0n895_98_c1_945_1238 | 96 |
| 575 | 3300050513 | nmdc:mga0rr50_1329284_c1 | nmdc:mga0rr50_1329284_c1_200_493 | 96 |
| 576 | 3300050513 | nmdc:mga0rr50_133022_c1 | nmdc:mga0rr50_133022_c1_419_784 | 96 |
| 577 | 3300050513 | nmdc:mga0rr50_1773_c1 | nmdc:mga0rr50_1773_c1_4879_5241 | 96 |
| 578 | 3300050513 | nmdc:mga0rr50_229957_c1 | nmdc:mga0rr50_229957_c1_834_1127 | 96 |
| 579 | 3300050513 | nmdc:mga0rr50_402224_c1 | nmdc:mga0rr50_402224_c1_512_805 | 96 |
| 580 | 3300050513 | nmdc:mga0rr50_8258_c1 | nmdc:mga0rr50_8258_c1_5101_5472 | 96 |
| 581 | 3300050513 | nmdc:mga0rr50_826004_c1 | nmdc:mga0rr50_826004_c1_365_658 | 96 |
| 582 | 3300050513 | nmdc:mga0rr50_88324_c1 | nmdc:mga0rr50_88324_c1_1680_1973 | 96 |
| 583 | 3300050513 | nmdc:mga0rr50_8956_c1 | nmdc:mga0rr50_8956_c1_3017_3310 | 96 |
| 584 | 3300050514 | nmdc:mga08x19_18471_c1 | nmdc:mga08x19_18471_c1_817_1110 | 96 |
| 585 | 3300050514 | nmdc:mga08x19_300889_c1 | nmdc:mga08x19_300889_c1_66_359 | 96 |
| 586 | 3300050514 | nmdc:mga08x19_34661_c1 | nmdc:mga08x19_34661_c1_1616_1981 | 96 |
| 587 | 3300050514 | nmdc:mga08x19_489434_c1 | nmdc:mga08x19_489434_c1_382_675 | 96 |
| 588 | 3300050514 | nmdc:mga08x19_495247_c1 | nmdc:mga08x19_495247_c1_133_426 | 96 |
| 589 | 3300050514 | nmdc:mga08x19_506405_c1 | nmdc:mga08x19_506405_c1_505_798 | 96 |
| 590 | 3300050514 | nmdc:mga08x19_694049_c1 | nmdc:mga08x19_694049_c1_34_330 | 96 |
| 591 | 3300050514 | nmdc:mga08x19_83620_c1 | nmdc:mga08x19_83620_c1_985_1347 | 96 |
| 592 | 3300050515 | nmdc:mga0a205_115193_c1 | nmdc:mga0a205_115193_c1_1497_1790 | 96 |
| 593 | 3300050515 | nmdc:mga0a205_225843_c1 | nmdc:mga0a205_225843_c1_1199_1492 | 96 |
| 594 | 3300050515 | nmdc:mga0a205_294327_c1 | nmdc:mga0a205_294327_c1_317_709 | 96 |
| 595 | 3300050515 | nmdc:mga0a205_354488_c1 | nmdc:mga0a205_354488_c1_560_853 | 96 |
| 596 | 3300050515 | nmdc:mga0a205_52793_c1 | nmdc:mga0a205_52793_c1_1880_2173 | 96 |
| 597 | 3300050515 | nmdc:mga0a205_534956_c1 | nmdc:mga0a205_534956_c1_593_886 | 96 |
| 598 | 3300050515 | nmdc:mga0a205_59155_c1 | nmdc:mga0a205_59155_c1_3017_3388 | 96 |
| 599 | 3300050515 | nmdc:mga0a205_972588_c1 | nmdc:mga0a205_972588_c1_207_500 | 96 |
| 600 | 3300054114 | Ga0501084_0046060 | Ga0501084_0046060_848_1141 | 96 |
| 601 | 3300054114 | Ga0501084_0139906 | Ga0501084_0139906_77_370 | 96 |
| 602 | 3300054114 | Ga0501084_0178706 | Ga0501084_0178706_548_841 | 96 |
| 603 | 3300054114 | Ga0501084_0607380 | Ga0501084_0607380_359_652 | 96 |
| 604 | 3300054114 | Ga0501084_0651585 | Ga0501084_0651585_158_451 | 96 |
| 605 | 3300054114 | Ga0501084_0738545 | Ga0501084_0738545_170_463 | 96 |
| 606 | 3300059421 | Ga0590071_017298 | Ga0590071_017298_39_332 | 96 |
| 607 | 3300059513 | Ga0587094_103007 | Ga0587094_103007_184_477 | 96 |
| 608 | 3300060353 | Ga0501082_0056096 | Ga0501082_0056096_1739_2032 | 96 |
| 609 | 3300060353 | Ga0501082_0277963 | Ga0501082_0277963_382_675 | 96 |
| 610 | 3300060353 | Ga0501082_0485784 | Ga0501082_0485784_221_514 | 96 |
| 611 | 3300060353 | Ga0501082_0651176 | Ga0501082_0651176_195_488 | 96 |
| 612 | 3300060353 | Ga0501082_0907663 | Ga0501082_0907663_197_490 | 96 |
| 613 | 3300061734 | Ga0530510_0006450 | Ga0530510_0006450_4846_5139 | 96 |
| 614 | 3300061734 | Ga0530510_0026290 | Ga0530510_0026290_2384_2677 | 96 |
| 615 | 3300061734 | Ga0530510_0047756 | Ga0530510_0047756_2254_2547 | 96 |
| 616 | 3300061734 | Ga0530510_0068221 | Ga0530510_0068221_150_443 | 96 |
| 617 | 3300061734 | Ga0530510_0093023 | Ga0530510_0093023_1753_2046 | 96 |
| 618 | 3300061734 | Ga0530510_0100688 | Ga0530510_0100688_1338_1631 | 96 |
| 619 | 3300061734 | Ga0530510_0115637 | Ga0530510_0115637_74_367 | 96 |
| 620 | 3300061734 | Ga0530510_0412994 | Ga0530510_0412994_546_839 | 96 |
| 621 | 3300061734 | Ga0530510_0556282 | Ga0530510_0556282_195_488 | 96 |
| 622 | 3300061734 | Ga0530510_0582018 | Ga0530510_0582018_442_735 | 96 |
| 623 | 3300061734 | Ga0530510_0672997 | Ga0530510_0672997_470_763 | 96 |
| 624 | 3300061734 | Ga0530510_1168134 | Ga0530510_1168134_32_325 | 96 |
| 625 | 3300005327 | Ga0070658_10015417 | Ga0070658_100154172 | 97 |
| 626 | 3300005336 | Ga0070680_100078049 | Ga0070680_1000780491 | 97 |
| 627 | 3300005339 | Ga0070660_100002494 | Ga0070660_10000249414 | 97 |
| 628 | 3300005356 | Ga0070674_100095772 | Ga0070674_1000957724 | 97 |
| 629 | 3300005530 | Ga0070679_100021144 | Ga0070679_1000211447 | 97 |
| 630 | 3300005563 | Ga0068855_100037327 | Ga0068855_1000373277 | 97 |
| 631 | 3300005617 | Ga0068859_102193319 | Ga0068859_1021933192 | 97 |
| 632 | 3300005618 | Ga0068864_100709023 | Ga0068864_1007090232 | 97 |
| 633 | 3300006048 | Ga0075363_100000313 | Ga0075363_10000031310 | 97 |
| 634 | 3300006051 | Ga0075364_10876024 | Ga0075364_108760241 | 97 |
| 635 | 3300006195 | Ga0075366_10116081 | Ga0075366_101160812 | 97 |
| 636 | 3300006353 | Ga0075370_10000090 | Ga0075370_1000009026 | 97 |
| 637 | 3300006931 | Ga0097620_102193325 | Ga0097620_1021933252 | 97 |
| 638 | 3300009093 | Ga0105240_10256842 | Ga0105240_102568422 | 97 |
| 639 | 3300013104 | Ga0157370_11387810 | Ga0157370_113878101 | 97 |
| 640 | 3300014325 | Ga0163163_10127637 | Ga0163163_101276372 | 97 |
| 641 | 3300014968 | Ga0157379_10012114 | Ga0157379_100121145 | 97 |
| 642 | 3300025900 | Ga0207710_10072268 | Ga0207710_100722683 | 97 |
| 643 | 3300025903 | Ga0207680_10222635 | Ga0207680_102226353 | 97 |
| 644 | 3300025909 | Ga0207705_10077070 | Ga0207705_100770701 | 97 |
| 645 | 3300025912 | Ga0207707_10367221 | Ga0207707_103672212 | 97 |
| 646 | 3300025913 | Ga0207695_10142435 | Ga0207695_101424354 | 97 |
| 647 | 3300025914 | Ga0207671_10489117 | Ga0207671_104891172 | 97 |
| 648 | 3300025919 | Ga0207657_10023830 | Ga0207657_100238304 | 97 |
| 649 | 3300025927 | Ga0207687_10095098 | Ga0207687_100950984 | 97 |
| 650 | 3300025932 | Ga0207690_10530119 | Ga0207690_105301192 | 97 |
| 651 | 3300025932 | Ga0207690_11340041 | Ga0207690_113400412 | 97 |
| 652 | 3300025934 | Ga0207686_10105604 | Ga0207686_101056042 | 97 |
| 653 | 3300025938 | Ga0207704_10107290 | Ga0207704_101072902 | 97 |
| 654 | 3300025942 | Ga0207689_10124593 | Ga0207689_101245934 | 97 |
| 655 | 3300025944 | Ga0207661_10248877 | Ga0207661_102488773 | 97 |
| 656 | 3300025949 | Ga0207667_10017864 | Ga0207667_100178644 | 97 |
| 657 | 3300026035 | Ga0207703_11326844 | Ga0207703_113268441 | 97 |
| 658 | 3300026067 | Ga0207678_11008212 | Ga0207678_110082121 | 97 |
| 659 | 3300026078 | Ga0207702_10562012 | Ga0207702_105620122 | 97 |
| 660 | 3300026089 | Ga0207648_10056516 | Ga0207648_100565162 | 97 |
| 661 | 3300026089 | Ga0207648_10306092 | Ga0207648_103060922 | 97 |
| 662 | 3300026118 | Ga0207675_100349149 | Ga0207675_1003491492 | 97 |
| 663 | 3300026121 | Ga0207683_10467409 | Ga0207683_104674092 | 97 |
| 664 | 3300027471 | Ga0209995_1057437 | Ga0209995_10574371 | 97 |
| 665 | 3300031235 | Ga0265330_10062935 | Ga0265330_100629352 | 97 |
| 666 | 3300031711 | Ga0265314_10007579 | Ga0265314_1000757918 | 97 |
| 667 | 3300032126 | Ga0307415_102471341 | Ga0307415_1024713411 | 97 |
| 668 | 3300035113 | Ga0373936_0210280 | Ga0373936_0210280_353_685 | 97 |
| 669 | 3300035410 | Ga0373924_0086920 | Ga0373924_0086920_225_557 | 97 |
| 670 | 3300037068 | Ga0373925_0430860 | Ga0373925_0430860_337_687 | 97 |
| 671 | 3300041408 | Ga0439453_0195091 | Ga0439453_0195091_155_457 | 97 |
| 672 | 3300042016 | Ga0439463_081758 | Ga0439463_081758_19_375 | 97 |
| 673 | 3300046463 | Ga0495653_0179385 | Ga0495653_0179385_976_1308 | 97 |
| 674 | 3300046511 | Ga0495608_0285283 | Ga0495608_0285283_427_759 | 97 |
| 675 | 3300046514 | Ga0495618_0467079 | Ga0495618_0467079_172_504 | 97 |
| 676 | 3300046535 | Ga0495586_0088108 | Ga0495586_0088108_361_693 | 97 |
| 677 | 3300046683 | Ga0495658_0195497 | Ga0495658_0195497_767_1099 | 97 |
| 678 | 3300047322 | Ga0495680_0334380 | Ga0495680_0334380_241_573 | 97 |
| 679 | 3300048089 | Ga0495614_0181095 | Ga0495614_0181095_559_885 | 97 |
| 680 | 3300048912 | Ga0496109_1807906 | Ga0496109_1807906_127_477 | 97 |
| 681 | 3300048917 | Ga0496114_0543833 | Ga0496114_0543833_486_815 | 97 |
| 682 | 3300050491 | nmdc:mga00v17_121554_c2 | nmdc:mga00v17_121554_c2_290_589 | 97 |
| 683 | 3300050493 | nmdc:mga0k408_107084_c1 | nmdc:mga0k408_107084_c1_751_1050 | 97 |
| 684 | 3300050495 | nmdc:mga04h51_178292_c1 | nmdc:mga04h51_178292_c1_426_725 | 97 |
| 685 | 3300050496 | nmdc:mga07m45_152_c1 | nmdc:mga07m45_152_c1_10886_11185 | 97 |
| 686 | 3300053077 | Ga0495601_0169537 | Ga0495601_0169537_673_1005 | 97 |
| 687 | 3300053083 | Ga0495655_0038227 | Ga0495655_0038227_545_895 | 97 |
| 688 | 3300053085 | Ga0495619_0218156 | Ga0495619_0218156_53_385 | 97 |
| 689 | 3300005457 | Ga0070662_100757359 | Ga0070662_1007573592 | 98 |
| 690 | 3300005544 | Ga0070686_100518295 | Ga0070686_1005182952 | 98 |
| 691 | 3300009148 | Ga0105243_12463998 | Ga0105243_124639981 | 98 |
| 692 | 3300014968 | Ga0157379_12465893 | Ga0157379_124658932 | 98 |
| 693 | 3300025921 | Ga0207652_11093900 | Ga0207652_110939001 | 98 |
| 694 | 3300025937 | Ga0207669_10335675 | Ga0207669_103356751 | 98 |
| 695 | 3300025940 | Ga0207691_10693142 | Ga0207691_106931422 | 98 |
| 696 | 3300025981 | Ga0207640_10572189 | Ga0207640_105721892 | 98 |
| 697 | 3300026121 | Ga0207683_10456429 | Ga0207683_104564293 | 98 |
| 698 | 3300035691 | Ga0373931_0816455 | Ga0373931_0816455_269_592 | 98 |
| 699 | 3300041503 | Ga0451847_0081879 | Ga0451847_0081879_116_421 | 98 |
| 700 | 3300042125 | Ga0450923_140390 | Ga0450923_140390_102_410 | 98 |
| 701 | 3300046455 | Ga0495603_0245649 | Ga0495603_0245649_654_977 | 98 |
| 702 | 3300048912 | Ga0496109_0162123 | Ga0496109_0162123_1733_2029 | 98 |
| 703 | 3300049161 | Ga0501305_055304 | Ga0501305_055304_274_579 | 98 |
| 704 | 3300049569 | Ga0501032_0203582 | Ga0501032_0203582_753_1067 | 98 |
| 705 | 3300049571 | Ga0501034_0062327 | Ga0501034_0062327_1312_1626 | 98 |
| 706 | 3300049571 | Ga0501034_0396885 | Ga0501034_0396885_329_643 | 98 |
| 707 | 3300049572 | Ga0501036_0526836 | Ga0501036_0526836_212_526 | 98 |
| 708 | 3300049572 | Ga0501036_0617594 | Ga0501036_0617594_229_543 | 98 |
| 709 | 3300049574 | Ga0501038_0199273 | Ga0501038_0199273_431_745 | 98 |
| 710 | 3300049575 | Ga0501039_0186470 | Ga0501039_0186470_429_743 | 98 |
| 711 | 3300049575 | Ga0501039_0355700 | Ga0501039_0355700_597_911 | 98 |
| 712 | 3300049576 | Ga0501040_0853934 | Ga0501040_0853934_133_447 | 98 |
| 713 | 3300049579 | Ga0501043_0205410 | Ga0501043_0205410_362_676 | 98 |
| 714 | 3300049579 | Ga0501043_0553451 | Ga0501043_0553451_250_567 | 98 |
| 715 | 3300049579 | Ga0501043_0676949 | Ga0501043_0676949_211_525 | 98 |
| 716 | 3300049580 | Ga0501046_0226235 | Ga0501046_0226235_218_532 | 98 |
| 717 | 3300049580 | Ga0501046_0719544 | Ga0501046_0719544_53_367 | 98 |
| 718 | 3300049581 | Ga0501047_0042294 | Ga0501047_0042294_2178_2492 | 98 |
| 719 | 3300049581 | Ga0501047_0049792 | Ga0501047_0049792_926_1240 | 98 |
| 720 | 3300049581 | Ga0501047_0228159 | Ga0501047_0228159_781_1095 | 98 |
| 721 | 3300049582 | Ga0501048_0034967 | Ga0501048_0034967_2535_2849 | 98 |
| 722 | 3300049583 | Ga0501067_0105799 | Ga0501067_0105799_880_1194 | 98 |
| 723 | 3300049584 | Ga0501068_0149489 | Ga0501068_0149489_697_1011 | 98 |
| 724 | 3300049585 | Ga0501069_0120453 | Ga0501069_0120453_780_1094 | 98 |
| 725 | 3300049586 | Ga0501070_0523304 | Ga0501070_0523304_591_905 | 98 |
| 726 | 3300049586 | Ga0501070_0755299 | Ga0501070_0755299_209_523 | 98 |
| 727 | 3300049588 | Ga0501072_0554453 | Ga0501072_0554453_364_678 | 98 |
| 728 | 3300049589 | Ga0501073_0036691 | Ga0501073_0036691_373_687 | 98 |
| 729 | 3300049589 | Ga0501073_0135900 | Ga0501073_0135900_1288_1602 | 98 |
| 730 | 3300049589 | Ga0501073_0142718 | Ga0501073_0142718_158_472 | 98 |
| 731 | 3300049742 | Ga0501080_0241788 | Ga0501080_0241788_454_768 | 98 |
| 732 | 3300049742 | Ga0501080_0722570 | Ga0501080_0722570_227_541 | 98 |
| 733 | 3300049743 | Ga0501081_0782753 | Ga0501081_0782753_148_462 | 98 |
| 734 | 3300049744 | Ga0501083_0090152 | Ga0501083_0090152_713_1027 | 98 |
| 735 | 3300049744 | Ga0501083_0192624 | Ga0501083_0192624_267_581 | 98 |
| 736 | 3300049822 | Ga0501035_0376494 | Ga0501035_0376494_741_1055 | 98 |
| 737 | 3300049822 | Ga0501035_1024898 | Ga0501035_1024898_30_347 | 98 |
| 738 | 3300049823 | Ga0501044_0182996 | Ga0501044_0182996_1312_1626 | 98 |
| 739 | 3300049823 | Ga0501044_0549969 | Ga0501044_0549969_284_598 | 98 |
| 740 | 3300050507 | nmdc:mga05p37_65_c1 | nmdc:mga05p37_65_c1_20093_20419 | 98 |
| 741 | 3300053090 | Ga0500646_0132500 | Ga0500646_0132500_239_535 | 98 |
| 742 | 3300053093 | Ga0500651_0209244 | Ga0500651_0209244_688_984 | 98 |
| 743 | 3300053103 | Ga0500555_000474 | Ga0500555_000474_3166_3462 | 98 |
| 744 | 3300053116 | Ga0500592_015086 | Ga0500592_015086_542_838 | 98 |
| 745 | 3300053153 | Ga0500616_0000173 | Ga0500616_0000173_8702_8998 | 98 |
| 746 | 3300053730 | Ga0500645_002162 | Ga0500645_002162_3138_3434 | 98 |
| 747 | 3300053736 | Ga0500599_013758 | Ga0500599_013758_528_824 | 98 |
| 748 | 3300060353 | Ga0501082_0059928 | Ga0501082_0059928_1456_1770 | 98 |
| 749 | 3300004801 | Ga0058860_12047537 | Ga0058860_120475372 | 99 |
| 750 | 3300005288 | Ga0065714_10257652 | Ga0065714_102576522 | 99 |
| 751 | 3300005328 | Ga0070676_10662519 | Ga0070676_106625192 | 99 |
| 752 | 3300005329 | Ga0070683_100990462 | Ga0070683_1009904622 | 99 |
| 753 | 3300005334 | Ga0068869_101320443 | Ga0068869_1013204431 | 99 |
| 754 | 3300005334 | Ga0068869_101494463 | Ga0068869_1014944631 | 99 |
| 755 | 3300005338 | Ga0068868_100583301 | Ga0068868_1005833011 | 99 |
| 756 | 3300005353 | Ga0070669_100360128 | Ga0070669_1003601281 | 99 |
| 757 | 3300005354 | Ga0070675_100176804 | Ga0070675_1001768042 | 99 |
| 758 | 3300005354 | Ga0070675_100521101 | Ga0070675_1005211012 | 99 |
| 759 | 3300005364 | Ga0070673_101173994 | Ga0070673_1011739941 | 99 |
| 760 | 3300005365 | Ga0070688_100288505 | Ga0070688_1002885052 | 99 |
| 761 | 3300005366 | Ga0070659_102134373 | Ga0070659_1021343732 | 99 |
| 762 | 3300005437 | Ga0070710_10945356 | Ga0070710_109453562 | 99 |
| 763 | 3300005440 | Ga0070705_100124788 | Ga0070705_1001247882 | 99 |
| 764 | 3300005441 | Ga0070700_101631704 | Ga0070700_1016317042 | 99 |
| 765 | 3300005444 | Ga0070694_100747206 | Ga0070694_1007472062 | 99 |
| 766 | 3300005456 | Ga0070678_100220398 | Ga0070678_1002203982 | 99 |
| 767 | 3300005457 | Ga0070662_101381348 | Ga0070662_1013813481 | 99 |
| 768 | 3300005466 | Ga0070685_11002339 | Ga0070685_110023392 | 99 |
| 769 | 3300005467 | Ga0070706_101253105 | Ga0070706_1012531052 | 99 |
| 770 | 3300005539 | Ga0068853_100978962 | Ga0068853_1009789622 | 99 |
| 771 | 3300005543 | Ga0070672_101140301 | Ga0070672_1011403011 | 99 |
| 772 | 3300005544 | Ga0070686_100313286 | Ga0070686_1003132862 | 99 |
| 773 | 3300005545 | Ga0070695_100114259 | Ga0070695_1001142592 | 99 |
| 774 | 3300005546 | Ga0070696_100341200 | Ga0070696_1003412001 | 99 |
| 775 | 3300005548 | Ga0070665_100083981 | Ga0070665_1000839815 | 99 |
| 776 | 3300005548 | Ga0070665_100127472 | Ga0070665_1001274725 | 99 |
| 777 | 3300005549 | Ga0070704_100450947 | Ga0070704_1004509472 | 99 |
| 778 | 3300005563 | Ga0068855_102152928 | Ga0068855_1021529282 | 99 |
| 779 | 3300005615 | Ga0070702_100950307 | Ga0070702_1009503072 | 99 |
| 780 | 3300005616 | Ga0068852_100497418 | Ga0068852_1004974182 | 99 |
| 781 | 3300005618 | Ga0068864_100339216 | Ga0068864_1003392161 | 99 |
| 782 | 3300005718 | Ga0068866_11023427 | Ga0068866_110234272 | 99 |
| 783 | 3300005841 | Ga0068863_101947062 | Ga0068863_1019470622 | 99 |
| 784 | 3300005843 | Ga0068860_101590022 | Ga0068860_1015900222 | 99 |
| 785 | 3300006186 | Ga0075369_10337499 | Ga0075369_103374992 | 99 |
| 786 | 3300006237 | Ga0097621_100164463 | Ga0097621_1001644634 | 99 |
| 787 | 3300006358 | Ga0068871_100247538 | Ga0068871_1002475383 | 99 |
| 788 | 3300006358 | Ga0068871_102000040 | Ga0068871_1020000401 | 99 |
| 789 | 3300006881 | Ga0068865_100334604 | Ga0068865_1003346042 | 99 |
| 790 | 3300007788 | Ga0099795_10431218 | Ga0099795_104312182 | 99 |
| 791 | 3300009101 | Ga0105247_10434150 | Ga0105247_104341502 | 99 |
| 792 | 3300009176 | Ga0105242_11827768 | Ga0105242_118277681 | 99 |
| 793 | 3300009177 | Ga0105248_10303543 | Ga0105248_103035432 | 99 |
| 794 | 3300009177 | Ga0105248_11822368 | Ga0105248_118223682 | 99 |
| 795 | 3300009545 | Ga0105237_11370124 | Ga0105237_113701242 | 99 |
| 796 | 3300009551 | Ga0105238_10286513 | Ga0105238_102865133 | 99 |
| 797 | 3300009551 | Ga0105238_10564391 | Ga0105238_105643911 | 99 |
| 798 | 3300010159 | Ga0099796_10144819 | Ga0099796_101448191 | 99 |
| 799 | 3300013297 | Ga0157378_11011698 | Ga0157378_110116981 | 99 |
| 800 | 3300013297 | Ga0157378_11372608 | Ga0157378_113726082 | 99 |
| 801 | 3300013306 | Ga0163162_11877311 | Ga0163162_118773112 | 99 |
| 802 | 3300013308 | Ga0157375_10331963 | Ga0157375_103319633 | 99 |
| 803 | 3300014969 | Ga0157376_10472409 | Ga0157376_104724092 | 99 |
| 804 | 3300014969 | Ga0157376_11386194 | Ga0157376_113861941 | 99 |
| 805 | 3300025315 | Ga0207697_10125113 | Ga0207697_101251132 | 99 |
| 806 | 3300025321 | Ga0207656_10492319 | Ga0207656_104923192 | 99 |
| 807 | 3300025711 | Ga0207696_1104691 | Ga0207696_11046912 | 99 |
| 808 | 3300025899 | Ga0207642_10757948 | Ga0207642_107579482 | 99 |
| 809 | 3300025905 | Ga0207685_10356687 | Ga0207685_103566871 | 99 |
| 810 | 3300025907 | Ga0207645_10196243 | Ga0207645_101962433 | 99 |
| 811 | 3300025923 | Ga0207681_10395255 | Ga0207681_103952553 | 99 |
| 812 | 3300025924 | Ga0207694_10307553 | Ga0207694_103075533 | 99 |
| 813 | 3300025924 | Ga0207694_10342428 | Ga0207694_103424283 | 99 |
| 814 | 3300025924 | Ga0207694_11252620 | Ga0207694_112526202 | 99 |
| 815 | 3300025925 | Ga0207650_10057888 | Ga0207650_100578885 | 99 |
| 816 | 3300025926 | Ga0207659_10661416 | Ga0207659_106614161 | 99 |
| 817 | 3300025927 | Ga0207687_10147298 | Ga0207687_101472983 | 99 |
| 818 | 3300025932 | Ga0207690_11651840 | Ga0207690_116518402 | 99 |
| 819 | 3300025940 | Ga0207691_10117491 | Ga0207691_101174914 | 99 |
| 820 | 3300025941 | Ga0207711_11239148 | Ga0207711_112391481 | 99 |
| 821 | 3300025941 | Ga0207711_11539441 | Ga0207711_115394412 | 99 |
| 822 | 3300025944 | Ga0207661_11715619 | Ga0207661_117156192 | 99 |
| 823 | 3300025949 | Ga0207667_10792538 | Ga0207667_107925382 | 99 |
| 824 | 3300025949 | Ga0207667_11877155 | Ga0207667_118771552 | 99 |
| 825 | 3300025960 | Ga0207651_10472515 | Ga0207651_104725153 | 99 |
| 826 | 3300025960 | Ga0207651_11337491 | Ga0207651_113374912 | 99 |
| 827 | 3300025961 | Ga0207712_10435288 | Ga0207712_104352882 | 99 |
| 828 | 3300026023 | Ga0207677_10457231 | Ga0207677_104572312 | 99 |
| 829 | 3300026023 | Ga0207677_11647267 | Ga0207677_116472672 | 99 |
| 830 | 3300026075 | Ga0207708_10822962 | Ga0207708_108229621 | 99 |
| 831 | 3300026089 | Ga0207648_10686769 | Ga0207648_106867693 | 99 |
| 832 | 3300026095 | Ga0207676_11100464 | Ga0207676_111004642 | 99 |
| 833 | 3300026118 | Ga0207675_100742488 | Ga0207675_1007424883 | 99 |
| 834 | 3300026118 | Ga0207675_101922960 | Ga0207675_1019229602 | 99 |
| 835 | 3300026121 | Ga0207683_10011262 | Ga0207683_100112627 | 99 |
| 836 | 3300026142 | Ga0207698_10685870 | Ga0207698_106858703 | 99 |
| 837 | 3300028379 | Ga0268266_10079314 | Ga0268266_100793142 | 99 |
| 838 | 3300031456 | Ga0307513_10349382 | Ga0307513_103493823 | 99 |
| 839 | 3300035083 | Ga0373926_0158323 | Ga0373926_0158323_270_599 | 99 |
| 840 | 3300035116 | Ga0373945_0140338 | Ga0373945_0140338_476_805 | 99 |
| 841 | 3300035117 | Ga0373953_0195181 | Ga0373953_0195181_18_344 | 99 |
| 842 | 3300035119 | Ga0373956_0045429 | Ga0373956_0045429_739_1065 | 99 |
| 843 | 3300035170 | Ga0373943_0056118 | Ga0373943_0056118_105_434 | 99 |
| 844 | 3300035170 | Ga0373943_0477011 | Ga0373943_0477011_362_661 | 99 |
| 845 | 3300035171 | Ga0373946_0032579 | Ga0373946_0032579_1118_1444 | 99 |
| 846 | 3300035172 | Ga0373955_0134713 | Ga0373955_0134713_935_1261 | 99 |
| 847 | 3300035410 | Ga0373924_0058294 | Ga0373924_0058294_852_1178 | 99 |
| 848 | 3300035692 | Ga0373935_1006005 | Ga0373935_1006005_100_426 | 99 |
| 849 | 3300035695 | Ga0373927_0129073 | Ga0373927_0129073_1145_1471 | 99 |
| 850 | 3300035725 | Ga0373947_0464859 | Ga0373947_0464859_214_540 | 99 |
| 851 | 3300035725 | Ga0373947_0756830 | Ga0373947_0756830_77_376 | 99 |
| 852 | 3300036401 | Ga0373937_0067221 | Ga0373937_0067221_806_1132 | 99 |
| 853 | 3300036401 | Ga0373937_0221033 | Ga0373937_0221033_527_856 | 99 |
| 854 | 3300037068 | Ga0373925_0069528 | Ga0373925_0069528_38_367 | 99 |
| 855 | 3300041459 | Ga0451800_1151021 | Ga0451800_1151021_142_468 | 99 |
| 856 | 3300041460 | Ga0451802_1108347 | Ga0451802_1108347_445_744 | 99 |
| 857 | 3300041512 | Ga0451853_0869743 | Ga0451853_0869743_249_548 | 99 |
| 858 | 3300044683 | Ga0466965_0272794 | Ga0466965_0272794_303_602 | 99 |
| 859 | 3300044842 | Ga0466957_0429856 | Ga0466957_0429856_395_694 | 99 |
| 860 | 3300046454 | Ga0495592_0473704 | Ga0495592_0473704_396_725 | 99 |
| 861 | 3300046455 | Ga0495603_0043902 | Ga0495603_0043902_584_913 | 99 |
| 862 | 3300046455 | Ga0495603_0150724 | Ga0495603_0150724_148_447 | 99 |
| 863 | 3300046459 | Ga0495629_0055216 | Ga0495629_0055216_699_998 | 99 |
| 864 | 3300046473 | Ga0495582_0247667 | Ga0495582_0247667_490_819 | 99 |
| 865 | 3300046473 | Ga0495582_0345055 | Ga0495582_0345055_323_649 | 99 |
| 866 | 3300046475 | Ga0495639_0101147 | Ga0495639_0101147_563_862 | 99 |
| 867 | 3300046476 | Ga0495662_0321985 | Ga0495662_0321985_117_443 | 99 |
| 868 | 3300046499 | Ga0495594_0102795 | Ga0495594_0102795_1052_1381 | 99 |
| 869 | 3300046499 | Ga0495594_0723366 | Ga0495594_0723366_28_327 | 99 |
| 870 | 3300046517 | Ga0495630_0267490 | Ga0495630_0267490_230_556 | 99 |
| 871 | 3300046523 | Ga0495644_0223090 | Ga0495644_0223090_35_394 | 99 |
| 872 | 3300046529 | Ga0495652_0477229 | Ga0495652_0477229_17_343 | 99 |
| 873 | 3300046533 | Ga0495640_0065981 | Ga0495640_0065981_1298_1624 | 99 |
| 874 | 3300046535 | Ga0495586_0141059 | Ga0495586_0141059_334_633 | 99 |
| 875 | 3300046536 | Ga0495587_0220146 | Ga0495587_0220146_341_667 | 99 |
| 876 | 3300046537 | Ga0495598_0200879 | Ga0495598_0200879_197_523 | 99 |
| 877 | 3300046539 | Ga0495621_0103056 | Ga0495621_0103056_267_626 | 99 |
| 878 | 3300046543 | Ga0495645_0006287 | Ga0495645_0006287_1606_1932 | 99 |
| 879 | 3300046616 | Ga0495668_0190674 | Ga0495668_0190674_429_755 | 99 |
| 880 | 3300046616 | Ga0495668_0586264 | Ga0495668_0586264_296_604 | 99 |
| 881 | 3300046642 | Ga0495634_0100808 | Ga0495634_0100808_1033_1359 | 99 |
| 882 | 3300046642 | Ga0495634_0765674 | Ga0495634_0765674_168_467 | 99 |
| 883 | 3300046674 | Ga0495588_0348888 | Ga0495588_0348888_188_514 | 99 |
| 884 | 3300046681 | Ga0495647_0082963 | Ga0495647_0082963_379_705 | 99 |
| 885 | 3300046681 | Ga0495647_0094351 | Ga0495647_0094351_329_628 | 99 |
| 886 | 3300046683 | Ga0495658_0064706 | Ga0495658_0064706_42_341 | 99 |
| 887 | 3300046684 | Ga0495669_0536931 | Ga0495669_0536931_12_338 | 99 |
| 888 | 3300046692 | Ga0495671_0187062 | Ga0495671_0187062_153_479 | 99 |
| 889 | 3300046794 | Ga0495589_0433553 | Ga0495589_0433553_53_352 | 99 |
| 890 | 3300047315 | Ga0495581_0044555 | Ga0495581_0044555_1554_1880 | 99 |
| 891 | 3300047315 | Ga0495581_0210608 | Ga0495581_0210608_451_750 | 99 |
| 892 | 3300047319 | Ga0495674_0044793 | Ga0495674_0044793_329_655 | 99 |
| 893 | 3300047321 | Ga0495676_0139896 | Ga0495676_0139896_925_1254 | 99 |
| 894 | 3300047444 | Ga0495675_0149748 | Ga0495675_0149748_362_688 | 99 |
| 895 | 3300047471 | Ga0495684_0030504 | Ga0495684_0030504_2473_2799 | 99 |
| 896 | 3300048090 | Ga0495615_0271254 | Ga0495615_0271254_68_367 | 99 |
| 897 | 3300048903 | Ga0496100_0113941 | Ga0496100_0113941_1063_1362 | 99 |
| 898 | 3300048903 | Ga0496100_0881213 | Ga0496100_0881213_25_351 | 99 |
| 899 | 3300048909 | Ga0496106_0302602 | Ga0496106_0302602_60_359 | 99 |
| 900 | 3300048912 | Ga0496109_0971550 | Ga0496109_0971550_319_645 | 99 |
| 901 | 3300048913 | Ga0496110_0515460 | Ga0496110_0515460_378_677 | 99 |
| 902 | 3300048917 | Ga0496114_0321889 | Ga0496114_0321889_974_1300 | 99 |
| 903 | 3300049522 | Ga0501299_119814 | Ga0501299_119814_130_429 | 99 |
| 904 | 3300049569 | Ga0501032_0096009 | Ga0501032_0096009_954_1253 | 99 |
| 905 | 3300049571 | Ga0501034_0013252 | Ga0501034_0013252_2980_3279 | 99 |
| 906 | 3300049573 | Ga0501037_0482433 | Ga0501037_0482433_144_443 | 99 |
| 907 | 3300049581 | Ga0501047_0025664 | Ga0501047_0025664_1102_1401 | 99 |
| 908 | 3300049586 | Ga0501070_0302332 | Ga0501070_0302332_847_1146 | 99 |
| 909 | 3300049707 | Ga0501234_064431 | Ga0501234_064431_274_573 | 99 |
| 910 | 3300049822 | Ga0501035_0401670 | Ga0501035_0401670_422_721 | 99 |
| 911 | 3300049823 | Ga0501044_0003452 | Ga0501044_0003452_7345_7644 | 99 |
| 912 | 3300050513 | nmdc:mga0rr50_46593_c1 | nmdc:mga0rr50_46593_c1_2850_3170 | 99 |
| 913 | 3300053078 | Ga0495612_0160040 | Ga0495612_0160040_34_360 | 99 |
| 914 | 3300053084 | Ga0495595_0139583 | Ga0495595_0139583_517_843 | 99 |
| 915 | 3300060346 | Ga0587111_0255005 | Ga0587111_0255005_38_337 | 99 |
| 916 | 3300060353 | Ga0501082_0133257 | Ga0501082_0133257_549_857 | 99 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4v48-assembly1.cif.gz_BS | real space refined coordinates of the 30s and 50s subunits fitted into the low resolution cryo-em map of the initiation-like state of e. coli 70s ribosome | 0.9588 | 12 | 76 |
| 4v48-assembly1.cif.gz_BS | real space refined coordinates of the 30s and 50s subunits fitted into the low resolution cryo-em map of the initiation-like state of e. coli 70s ribosome | 0.9448 | 12 | 76 |
| 3a1p-assembly2.cif.gz_D | structure of ribosome maturation protein rimm and ribosomal protein s19 | 0.9325 | 10 | 83 |
| 3a1p-assembly1.cif.gz_B | structure of ribosome maturation protein rimm and ribosomal protein s19 | 0.9292 | 10 | 83 |
| 8ove-assembly1.cif.gz_AI | cryo-em structure of trypanosoma brucei procyclic form 80s ribosome : tb11cs6h1 snorna mutant | 0.9223 | 13 | 76 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3a1pB00 | Alpha Beta;2-Layer Sandwich;30s Ribosomal Protein S19; Chain A;Ribosomal protein S19/S15 | 0.9292 | 10 | 83 | 3.30.860.10 |
| 2y0uS00 | Alpha Beta;2-Layer Sandwich;30s Ribosomal Protein S19; Chain A;Ribosomal protein S19/S15 | 0.8916 | 4 | 81 | 3.30.860.10 |
| 2wriS00 | Alpha Beta;2-Layer Sandwich;30s Ribosomal Protein S19; Chain A;Ribosomal protein S19/S15 | 0.8816 | 4 | 82 | 3.30.860.10 |
| 2y0uS00 | Alpha Beta;2-Layer Sandwich;30s Ribosomal Protein S19; Chain A;Ribosomal protein S19/S15 | 0.8811 | 4 | 81 | 3.30.860.10 |
| 5zeus00 | Alpha Beta;2-Layer Sandwich;30s Ribosomal Protein S19; Chain A;Ribosomal protein S19/S15 | 0.8792 | 6 | 83 | 3.30.860.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3C1V0E1-F1-model_v4 | Small ribosomal subunit protein uS19 (30S ribosomal protein S19) | 0.9696 | 6 | 72 |
GO:0000028
GO:0003735 GO:0005737 GO:0006412 GO:0015935 GO:0019843 |
| AF-A0A3C1V0E1-F1-model_v4 | Small ribosomal subunit protein uS19 (30S ribosomal protein S19) | 0.9556 | 6 | 72 |
GO:0000028
GO:0003735 GO:0005737 GO:0006412 GO:0015935 GO:0019843 |
| AF-A0A3D0N3C2-F1-model_v4 | Small ribosomal subunit protein uS19 (30S ribosomal protein S19) | 0.929 | 1 | 73 |
GO:0000028
GO:0003735 GO:0005737 GO:0006412 GO:0015935 GO:0019843 |
| AF-A0A7C7UQP5-F1-model_v4 | Small ribosomal subunit protein uS19 (30S ribosomal protein S19) | 0.9245 | 1 | 78 |
GO:0000028
GO:0003735 GO:0005737 GO:0006412 GO:0015935 GO:0019843 |
| AF-A0A6P0Y002-F1-model_v4 | Small ribosomal subunit protein uS19 (30S ribosomal protein S19) | 0.9169 | 1 | 77 |
GO:0000028
GO:0003735 GO:0005737 GO:0006412 GO:0015935 GO:0019843 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar