F485609

General Info

Members Datasets Scaffolds Average Seq Length
916 360 916 99

Family's Representative Sequence

Representative Sequence 3300005338|Ga0068868_100583301|Ga0068868_1005833011
Length 119
Sequence MGRSLKKGPFVDTHLLEKIEVMNRAADKKVIKTWSRRSTVIPEMVGHTLAVHNGRKFIPVYVTENMVGHKLGEFAPTRLFKGHTTKVAEKAATVAPTGPSAAATGQGGGKPAGAGSQSS

Samples

Sample ID Description Type Environment
1 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
2 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
73 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
74 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
75 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
76 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
77 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
78 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
79 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
84 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
85 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
86 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
87 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
88 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
89 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
90 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
91 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
93 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
94 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
95 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
96 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
97 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
99 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
100 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
102 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
103 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
104 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
105 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
106 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
107 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
108 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
109 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
110 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
111 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
112 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
113 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
114 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
115 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
116 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
117 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
118 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
119 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
120 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
121 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
122 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
181 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
184 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
185 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
186 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
187 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
188 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
189 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
190 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
191 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
192 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
193 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
194 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
195 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
196 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
197 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
198 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
199 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
200 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
201 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
202 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
203 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
204 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
205 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
206 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
207 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
208 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
209 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
210 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
211 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
212 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
213 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
214 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
215 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
216 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
217 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
218 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
219 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
220 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
221 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
222 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
223 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
224 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
225 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
226 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
227 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
228 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
229 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
230 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
231 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
232 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
233 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
234 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
235 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
236 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
237 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
238 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
239 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
240 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
241 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
242 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
243 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
244 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
245 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
246 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
247 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
248 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
249 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
250 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
251 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
252 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
253 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
254 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
255 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
256 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
257 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
258 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
259 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
260 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
261 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
262 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
263 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
264 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
265 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
266 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
267 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
268 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
269 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
270 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
271 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
272 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
273 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
274 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
275 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
276 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
277 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
278 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
279 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
280 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
281 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
282 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
283 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
284 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
285 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
286 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
287 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
288 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
289 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
290 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
291 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
292 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
293 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
294 3300049525 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F21_B_7_control Metagenome Rhizosphere
295 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
296 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
297 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
298 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
299 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
300 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
301 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
302 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
303 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
304 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
305 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
306 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
307 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
308 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
309 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
310 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
311 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
312 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
313 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
314 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
315 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
316 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
317 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
318 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
319 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
320 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
321 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
322 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
323 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
324 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
325 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
326 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
327 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
328 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
329 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
330 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
331 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
332 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
333 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
334 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
335 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
336 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
337 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
338 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
339 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
340 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
341 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
342 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
343 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
344 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
345 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
346 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
347 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
348 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
349 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
350 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
351 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
352 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
353 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
354 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
355 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
356 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
357 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
358 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
359 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
360 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.24
Metatranscriptomes 0.76
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.75
Nodule 0
Rhizoplane 2.07
Rhizosphere 95.74
Stem 0
Stem Tuber 0
Unclassified 0.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0058860_12047537 3300004801 Bacteria 682
2 Ga0058862_12254497 3300004803 Bacteria 746
3 Ga0065714_10257652 3300005288 Bacteria 763
4 Ga0065704_10056506 3300005289 Bacteria 668
5 Ga0065707_10428556 3300005295 Bacteria 795
6 Ga0070658_10015417 3300005327 Bacteria 6115
7 Ga0070676_10662519 3300005328 Bacteria 759
8 Ga0070683_100222088 3300005329 Bacteria 1796
9 Ga0070683_100283868 3300005329 Bacteria 1575
10 Ga0070683_100990462 3300005329 Bacteria 807
11 Ga0070690_100080948 3300005330 Bacteria 2124
12 Ga0070690_100263307 3300005330 Bacteria 1224
13 Ga0068869_100137668 3300005334 Bacteria 1882
14 Ga0068869_101320443 3300005334 Bacteria 637
15 Ga0068869_101494463 3300005334 Bacteria 600
16 Ga0070666_10028665 3300005335 Bacteria 3654
17 Ga0070666_10280388 3300005335 Bacteria 1184
18 Ga0070666_10549870 3300005335 Bacteria 840
19 Ga0070680_100078049 3300005336 Bacteria 2728
20 Ga0070680_100220627 3300005336 Bacteria 1600
21 Ga0070680_101526567 3300005336 Bacteria 579
22 Ga0068868_100583301 3300005338 Bacteria 989
23 Ga0068868_101472963 3300005338 Bacteria 637
24 Ga0068868_102240447 3300005338 Bacteria 521
25 Ga0070660_100002494 3300005339 Bacteria 12634
26 Ga0070660_100519310 3300005339 Bacteria 992
27 Ga0070689_100820233 3300005340 Bacteria 819
28 Ga0070689_102225580 3300005340 Bacteria 503
29 Ga0070691_10002062 3300005341 Bacteria 8874
30 Ga0070691_10209094 3300005341 Bacteria 1029
31 Ga0070687_100081895 3300005343 Bacteria 1763
32 Ga0070661_101318685 3300005344 Bacteria 606
33 Ga0070692_10221517 3300005345 Bacteria 1119
34 Ga0070692_10232948 3300005345 Bacteria 1094
35 Ga0070668_100066366 3300005347 Bacteria 2800
36 Ga0070668_100428978 3300005347 Bacteria 1133
37 Ga0070668_101134675 3300005347 Bacteria 706
38 Ga0070669_100021577 3300005353 Bacteria 4602
39 Ga0070669_100023184 3300005353 Bacteria 4444
40 Ga0070669_100049339 3300005353 Bacteria 3074
41 Ga0070669_100122468 3300005353 Bacteria 1986
42 Ga0070669_100360128 3300005353 Bacteria 1182
43 Ga0070675_100176804 3300005354 Bacteria 1844
44 Ga0070675_100521101 3300005354 Bacteria 1073
45 Ga0070671_101335601 3300005355 Bacteria 633
46 Ga0070671_101448647 3300005355 Bacteria 607
47 Ga0070674_100095772 3300005356 Bacteria 2152
48 Ga0070674_100125476 3300005356 Bacteria 1905
49 Ga0070673_100340219 3300005364 Bacteria 1329
50 Ga0070673_101173994 3300005364 Bacteria 719
51 Ga0070673_101604621 3300005364 Bacteria 615
52 Ga0070688_100288505 3300005365 Bacteria 1182
53 Ga0070659_100864427 3300005366 Bacteria 789
54 Ga0070659_102134373 3300005366 Bacteria 504
55 Ga0070667_100811910 3300005367 Bacteria 869
56 Ga0070667_101348383 3300005367 Bacteria 669
57 Ga0070709_10258210 3300005434 Bacteria 1258
58 Ga0070714_100072180 3300005435 Bacteria 2988
59 Ga0070710_10945356 3300005437 Bacteria 625
60 Ga0070701_10045623 3300005438 Bacteria 2250
61 Ga0070711_101213651 3300005439 Bacteria 653
62 Ga0070705_100100040 3300005440 Bacteria 1828
63 Ga0070705_100124788 3300005440 Bacteria 1669
64 Ga0070705_100177513 3300005440 Bacteria 1439
65 Ga0070705_100301143 3300005440 Bacteria 1149
66 Ga0070705_100955804 3300005440 Bacteria 693
67 Ga0070700_100007525 3300005441 Bacteria 5888
68 Ga0070700_101631704 3300005441 Bacteria 552
69 Ga0070694_100046094 3300005444 Bacteria 2925
70 Ga0070694_100308334 3300005444 Bacteria 1215
71 Ga0070694_100747206 3300005444 Bacteria 799
72 Ga0070694_100958433 3300005444 Bacteria 709
73 Ga0070708_100026666 3300005445 Bacteria 4949
74 Ga0070708_100056686 3300005445 Bacteria 3486
75 Ga0070708_100294516 3300005445 Bacteria 1528
76 Ga0070708_100835308 3300005445 Bacteria 865
77 Ga0070678_100220398 3300005456 Bacteria 1576
78 Ga0070678_100834445 3300005456 Bacteria 839
79 Ga0070678_101079437 3300005456 Bacteria 741
80 Ga0070662_100092319 3300005457 Bacteria 2275
81 Ga0070662_100260871 3300005457 Bacteria 1396
82 Ga0070662_100540528 3300005457 Bacteria 975
83 Ga0070662_100757359 3300005457 Bacteria 824
84 Ga0070662_101269695 3300005457 Bacteria 633
85 Ga0070662_101381348 3300005457 Bacteria 607
86 Ga0070681_10065223 3300005458 Bacteria 3610
87 Ga0070681_10758920 3300005458 Bacteria 887
88 Ga0068867_100045942 3300005459 Bacteria 3205
89 Ga0068867_100178953 3300005459 Bacteria 1685
90 Ga0068867_100223316 3300005459 Bacteria 1519
91 Ga0068867_100705473 3300005459 Bacteria 891
92 Ga0070685_11002339 3300005466 Bacteria 627
93 Ga0070706_100001965 3300005467 Bacteria 21177
94 Ga0070706_100042306 3300005467 Bacteria 4208
95 Ga0070706_100816889 3300005467 Bacteria 863
96 Ga0070706_101253105 3300005467 Bacteria 681
97 Ga0070707_100008827 3300005468 Bacteria 9346
98 Ga0070707_100876942 3300005468 Bacteria 862
99 Ga0070698_100002716 3300005471 Bacteria 19449
100 Ga0070699_100009009 3300005518 Bacteria 8645
101 Ga0070699_100010853 3300005518 Bacteria 7883
102 Ga0070679_100021144 3300005530 Bacteria 6348
103 Ga0070697_100035245 3300005536 Bacteria 4036
104 Ga0070697_100218055 3300005536 Bacteria 1626
105 Ga0070697_100268660 3300005536 Bacteria 1461
106 Ga0070697_100574344 3300005536 Bacteria 990
107 Ga0070697_101664463 3300005536 Bacteria 571
108 Ga0068853_100978962 3300005539 Bacteria 814
109 Ga0070672_101140301 3300005543 Bacteria 694
110 Ga0070686_100002243 3300005544 Bacteria 10661
111 Ga0070686_100313286 3300005544 Bacteria 1168
112 Ga0070686_100518295 3300005544 Bacteria 928
113 Ga0070686_100687758 3300005544 Bacteria 815
114 Ga0070686_101414077 3300005544 Bacteria 584
115 Ga0070695_100014951 3300005545 Bacteria 4683
116 Ga0070695_100088758 3300005545 Bacteria 2059
117 Ga0070695_100114259 3300005545 Bacteria 1838
118 Ga0070695_101400197 3300005545 Bacteria 580
119 Ga0070696_100086961 3300005546 Bacteria 2220
120 Ga0070696_100341200 3300005546 Bacteria 1158
121 Ga0070696_100425290 3300005546 Bacteria 1044
122 Ga0070696_100955133 3300005546 Bacteria 714
123 Ga0070696_101491205 3300005546 Bacteria 579
124 Ga0070693_100390904 3300005547 Bacteria 962
125 Ga0070693_100486478 3300005547 Bacteria 873
126 Ga0070665_100004733 3300005548 Bacteria 14164
127 Ga0070665_100083981 3300005548 Bacteria 3189
128 Ga0070665_100127472 3300005548 Bacteria 2547
129 Ga0070704_100016081 3300005549 Bacteria 4719
130 Ga0070704_100094027 3300005549 Bacteria 2242
131 Ga0070704_100116558 3300005549 Bacteria 2043
132 Ga0070704_100207477 3300005549 Bacteria 1586
133 Ga0070704_100240273 3300005549 Bacteria 1482
134 Ga0070704_100450947 3300005549 Bacteria 1108
135 Ga0070704_102142396 3300005549 Bacteria 520
136 Ga0068855_100037327 3300005563 Bacteria 5778
137 Ga0068855_102152928 3300005563 Bacteria 561
138 Ga0070664_100428998 3300005564 Bacteria 1211
139 Ga0068857_101410487 3300005577 Bacteria 678
140 Ga0068854_100810471 3300005578 Bacteria 817
141 Ga0068854_101861472 3300005578 Bacteria 553
142 Ga0070702_100195821 3300005615 Bacteria 1334
143 Ga0070702_100950307 3300005615 Bacteria 677
144 Ga0068852_100497418 3300005616 Bacteria 1213
145 Ga0068859_100064378 3300005617 Bacteria 3699
146 Ga0068859_102193319 3300005617 Bacteria 609
147 Ga0068859_102388070 3300005617 Bacteria 583
148 Ga0068864_100339216 3300005618 Bacteria 1416
149 Ga0068864_100709023 3300005618 Bacteria 983
150 Ga0068866_10025223 3300005718 Bacteria 2793
151 Ga0068866_11023427 3300005718 Bacteria 588
152 Ga0068866_11184926 3300005718 Bacteria 551
153 Ga0068861_100014830 3300005719 Bacteria 5476
154 Ga0068861_100039337 3300005719 Bacteria 3528
155 Ga0068861_101070073 3300005719 Bacteria 774
156 Ga0068861_101564511 3300005719 Bacteria 649
157 Ga0068861_101973936 3300005719 Bacteria 582
158 Ga0068870_10146720 3300005840 Bacteria 1386
159 Ga0068870_10778808 3300005840 Bacteria 667
160 Ga0068863_100097852 3300005841 Bacteria 2787
161 Ga0068863_100184464 3300005841 Bacteria 2003
162 Ga0068863_101947062 3300005841 Bacteria 598
163 Ga0068858_100008638 3300005842 Bacteria 9781
164 Ga0068858_100083129 3300005842 Bacteria 2977
165 Ga0068858_100497176 3300005842 Bacteria 1178
166 Ga0068858_101028204 3300005842 Bacteria 808
167 Ga0068858_101053517 3300005842 Bacteria 798
168 Ga0068860_100424288 3300005843 Bacteria 1319
169 Ga0068860_100611688 3300005843 Bacteria 1096
170 Ga0068860_101590022 3300005843 Bacteria 675
171 Ga0068862_101281598 3300005844 Bacteria 733
172 Ga0068862_102497059 3300005844 Bacteria 528
173 Ga0081455_10753556 3300005937 Bacteria 615
174 Ga0081539_10001809 3300005985 Bacteria 33796
175 Ga0081539_10367087 3300005985 Bacteria 602
176 Ga0075363_100000313 3300006048 Bacteria 14335
177 Ga0075364_10876024 3300006051 Unclassified 611
178 Ga0075432_10496902 3300006058 Bacteria 543
179 Ga0070716_100709258 3300006173 Bacteria 770
180 Ga0075369_10337499 3300006186 Bacteria 706
181 Ga0075366_10116081 3300006195 Unclassified 1612
182 Ga0097621_100164463 3300006237 Bacteria 1909
183 Ga0097621_100470680 3300006237 Bacteria 1134
184 Ga0075370_10000090 3300006353 Bacteria 27996
185 Ga0068871_100247538 3300006358 Bacteria 1552
186 Ga0068871_100273633 3300006358 Bacteria 1476
187 Ga0068871_102000040 3300006358 Bacteria 552
188 Ga0075428_100003976 3300006844 Bacteria 16226
189 Ga0075428_100041079 3300006844 Bacteria 5087
190 Ga0075428_100052271 3300006844 Bacteria 4478
191 Ga0075428_100068017 3300006844 Bacteria 3897
192 Ga0075430_100000851 3300006846 Bacteria 23937
193 Ga0075430_100004590 3300006846 Bacteria 11623
194 Ga0075430_100037664 3300006846 Bacteria 4099
195 Ga0075430_100045839 3300006846 Bacteria 3693
196 Ga0075430_100226489 3300006846 Bacteria 1551
197 Ga0075431_100000559 3300006847 Bacteria 31330
198 Ga0075431_100004746 3300006847 Bacteria 13363
199 Ga0075431_100011238 3300006847 Bacteria 9017
200 Ga0075431_100028459 3300006847 Bacteria 5743
201 Ga0075431_100038375 3300006847 Bacteria 4932
202 Ga0075431_100079415 3300006847 Bacteria 3386
203 Ga0075431_100179876 3300006847 Bacteria 2171
204 Ga0075431_100599993 3300006847 Bacteria 1085
205 Ga0075431_100633742 3300006847 Bacteria 1050
206 Ga0075433_10120900 3300006852 Bacteria 2325
207 Ga0075433_10224184 3300006852 Bacteria 1669
208 Ga0075433_10370500 3300006852 Bacteria 1265
209 Ga0075433_10500166 3300006852 Bacteria 1070
210 Ga0075433_10846187 3300006852 Bacteria 799
211 Ga0075433_11050999 3300006852 Bacteria 709
212 Ga0075433_11118545 3300006852 Bacteria 685
213 Ga0075433_11368630 3300006852 Bacteria 612
214 Ga0075434_100037241 3300006871 Bacteria 4816
215 Ga0075434_100039528 3300006871 Bacteria 4675
216 Ga0075434_100089001 3300006871 Bacteria 3089
217 Ga0075434_100113212 3300006871 Bacteria 2725
218 Ga0075434_100203297 3300006871 Bacteria 2001
219 Ga0075434_100287390 3300006871 Bacteria 1664
220 Ga0075434_100292687 3300006871 Bacteria 1648
221 Ga0075434_100299949 3300006871 Bacteria 1627
222 Ga0075434_100471709 3300006871 Bacteria 1276
223 Ga0075434_100544981 3300006871 Bacteria 1180
224 Ga0075434_100974893 3300006871 Bacteria 862
225 Ga0075434_101458197 3300006871 Bacteria 694
226 Ga0075434_101463716 3300006871 Bacteria 692
227 Ga0075429_100000843 3300006880 Bacteria 24082
228 Ga0075429_100032187 3300006880 Bacteria 4557
229 Ga0075429_100057615 3300006880 Bacteria 3383
230 Ga0075429_100144453 3300006880 Bacteria 2082
231 Ga0075429_100146367 3300006880 Bacteria 2067
232 Ga0068865_100006729 3300006881 Bacteria 7032
233 Ga0068865_100277192 3300006881 Bacteria 1334
234 Ga0068865_100334604 3300006881 Bacteria 1222
235 Ga0068865_100411019 3300006881 Bacteria 1110
236 Ga0068865_100766952 3300006881 Bacteria 830
237 Ga0068865_101121383 3300006881 Bacteria 694
238 Ga0075436_100111308 3300006914 Bacteria 1911
239 Ga0075436_100133842 3300006914 Bacteria 1739
240 Ga0075436_100198493 3300006914 Bacteria 1420
241 Ga0075436_100286757 3300006914 Bacteria 1178
242 Ga0075436_100533205 3300006914 Bacteria 861
243 Ga0075436_101340573 3300006914 Bacteria 542
244 Ga0097620_100064378 3300006931 Bacteria 3699
245 Ga0097620_102193325 3300006931 Bacteria 609
246 Ga0097620_102388317 3300006931 Bacteria 583
247 Ga0075435_100001694 3300007076 Bacteria 14328
248 Ga0075435_100014113 3300007076 Bacteria 5961
249 Ga0075435_100059076 3300007076 Bacteria 3108
250 Ga0075435_100067393 3300007076 Bacteria 2914
251 Ga0075435_100095281 3300007076 Bacteria 2461
252 Ga0075435_100124387 3300007076 Bacteria 2154
253 Ga0075435_100200060 3300007076 Bacteria 1693
254 Ga0075435_100364233 3300007076 Bacteria 1240
255 Ga0075435_100539713 3300007076 Bacteria 1009
256 Ga0075435_100869758 3300007076 Bacteria 786
257 Ga0099794_10043450 3300007265 Bacteria 2145
258 Ga0099794_10120762 3300007265 Bacteria 1318
259 Ga0099794_10365598 3300007265 Bacteria 751
260 Ga0099795_10431218 3300007788 Bacteria 604
261 Ga0105250_10208141 3300009092 Bacteria 826
262 Ga0105240_10256842 3300009093 Bacteria 2018
263 Ga0105240_11651665 3300009093 Bacteria 670
264 Ga0105240_11799806 3300009093 Bacteria 638
265 Ga0111539_10000675 3300009094 Bacteria 44135
266 Ga0111539_10065945 3300009094 Bacteria 4277
267 Ga0111539_10125011 3300009094 Bacteria 3014
268 Ga0111539_12771457 3300009094 Bacteria 568
269 Ga0105245_10497484 3300009098 Bacteria 1235
270 Ga0105245_11981794 3300009098 Bacteria 636
271 Ga0105247_10087814 3300009101 Bacteria 1970
272 Ga0105247_10281324 3300009101 Bacteria 1148
273 Ga0105247_10333293 3300009101 Bacteria 1062
274 Ga0105247_10434150 3300009101 Bacteria 943
275 Ga0114129_10013876 3300009147 Bacteria 11480
276 Ga0114129_10022212 3300009147 Bacteria 9007
277 Ga0114129_10033145 3300009147 Bacteria 7299
278 Ga0114129_10036838 3300009147 Bacteria 6907
279 Ga0114129_10052918 3300009147 Bacteria 5697
280 Ga0114129_10065603 3300009147 Bacteria 5067
281 Ga0114129_10078309 3300009147 Bacteria 4598
282 Ga0114129_10125293 3300009147 Bacteria 3533
283 Ga0114129_10334100 3300009147 Bacteria 2011
284 Ga0114129_10772632 3300009147 Bacteria 1228
285 Ga0114129_11213939 3300009147 Bacteria 939
286 Ga0114129_11231848 3300009147 Bacteria 931
287 Ga0114129_11811059 3300009147 Bacteria 742
288 Ga0114129_13379342 3300009147 Bacteria 514
289 Ga0105243_10723157 3300009148 Bacteria 973
290 Ga0105243_12463998 3300009148 Bacteria 559
291 Ga0105241_10146349 3300009174 Bacteria 1928
292 Ga0105241_10253151 3300009174 Bacteria 1494
293 Ga0105241_12256884 3300009174 Bacteria 541
294 Ga0105242_10182109 3300009176 Bacteria 1854
295 Ga0105242_10993609 3300009176 Bacteria 846
296 Ga0105242_11360086 3300009176 Bacteria 736
297 Ga0105242_11827768 3300009176 Bacteria 646
298 Ga0105248_10303543 3300009177 Bacteria 1798
299 Ga0105248_11529107 3300009177 Bacteria 756
300 Ga0105248_11822368 3300009177 Bacteria 690
301 Ga0105237_11370124 3300009545 Bacteria 714
302 Ga0105238_10286513 3300009551 Bacteria 1629
303 Ga0105238_10564391 3300009551 Bacteria 1143
304 Ga0105249_10178723 3300009553 Bacteria 2063
305 Ga0105249_10563998 3300009553 Bacteria 1191
306 Ga0105249_10780936 3300009553 Bacteria 1018
307 Ga0105249_10908982 3300009553 Bacteria 947
308 Ga0105249_11620512 3300009553 Bacteria 720
309 Ga0105249_13128416 3300009553 Bacteria 532
310 Ga0105249_13141829 3300009553 Bacteria 531
311 Ga0099796_10144819 3300010159 Bacteria 931
312 Ga0105239_10846450 3300010375 Bacteria 1049
313 Ga0105239_11007720 3300010375 Bacteria 958
314 Ga0105246_12038190 3300011119 Bacteria 554
315 Ga0157370_11146369 3300013104 Bacteria 702
316 Ga0157370_11387810 3300013104 Bacteria 632
317 Ga0157374_10443118 3300013296 Bacteria 1299
318 Ga0157378_10145077 3300013297 Bacteria 2207
319 Ga0157378_11011698 3300013297 Bacteria 866
320 Ga0157378_11372608 3300013297 Bacteria 749
321 Ga0157378_12316347 3300013297 Bacteria 589
322 Ga0157378_12893552 3300013297 Bacteria 532
323 Ga0163162_10017924 3300013306 Bacteria 6929
324 Ga0163162_10069444 3300013306 Bacteria 3575
325 Ga0163162_11337826 3300013306 Bacteria 814
326 Ga0163162_11877311 3300013306 Bacteria 686
327 Ga0157375_10331963 3300013308 Bacteria 1686
328 Ga0157375_11278336 3300013308 Bacteria 862
329 Ga0163163_10127637 3300014325 Bacteria 2582
330 Ga0163163_12571764 3300014325 Bacteria 567
331 Ga0157380_10116123 3300014326 Bacteria 2258
332 Ga0157380_10150317 3300014326 Bacteria 2012
333 Ga0157380_10591588 3300014326 Bacteria 1096
334 Ga0157379_10012114 3300014968 Bacteria 7532
335 Ga0157379_10618542 3300014968 Bacteria 1012
336 Ga0157379_11077913 3300014968 Bacteria 769
337 Ga0157379_11645156 3300014968 Bacteria 628
338 Ga0157379_12465893 3300014968 Bacteria 520
339 Ga0157376_10164129 3300014969 Bacteria 2016
340 Ga0157376_10472409 3300014969 Bacteria 1227
341 Ga0157376_11386194 3300014969 Bacteria 734
342 Ga0182005_1090088 3300015265 Bacteria 852
343 Ga0163161_10378849 3300017792 Bacteria 1130
344 Ga0207697_10125113 3300025315 Bacteria 1108
345 Ga0207656_10492319 3300025321 Bacteria 622
346 Ga0207696_1104691 3300025711 Bacteria 769
347 Ga0207642_10757948 3300025899 Bacteria 615
348 Ga0207710_10072268 3300025900 Bacteria 1584
349 Ga0207680_10222635 3300025903 Bacteria 1294
350 Ga0207685_10356687 3300025905 Bacteria 739
351 Ga0207645_10173020 3300025907 Bacteria 1416
352 Ga0207645_10196243 3300025907 Bacteria 1327
353 Ga0207645_11085791 3300025907 Bacteria 540
354 Ga0207643_10188151 3300025908 Bacteria 1252
355 Ga0207643_10559346 3300025908 Bacteria 734
356 Ga0207705_10077070 3300025909 Bacteria 2425
357 Ga0207684_10000456 3300025910 Bacteria 53373
358 Ga0207684_10032897 3300025910 Bacteria 4410
359 Ga0207684_10773599 3300025910 Bacteria 813
360 Ga0207654_10096575 3300025911 Bacteria 1813
361 Ga0207654_10109396 3300025911 Bacteria 1717
362 Ga0207707_10065987 3300025912 Bacteria 3152
363 Ga0207707_10367221 3300025912 Bacteria 1238
364 Ga0207707_11057600 3300025912 Bacteria 663
365 Ga0207695_10142435 3300025913 Bacteria 2344
366 Ga0207671_10489117 3300025914 Bacteria 981
367 Ga0207660_10007743 3300025917 Bacteria 6956
368 Ga0207660_10359488 3300025917 Bacteria 1168
369 Ga0207662_10077900 3300025918 Bacteria 2017
370 Ga0207657_10023830 3300025919 Bacteria 5688
371 Ga0207652_10387727 3300025921 Bacteria 1261
372 Ga0207652_11093900 3300025921 Bacteria 697
373 Ga0207646_10006057 3300025922 Bacteria 12598
374 Ga0207681_10032040 3300025923 Bacteria 3438
375 Ga0207681_10043484 3300025923 Bacteria 3007
376 Ga0207681_10197103 3300025923 Bacteria 1544
377 Ga0207681_10395255 3300025923 Bacteria 1115
378 Ga0207694_10307553 3300025924 Bacteria 1306
379 Ga0207694_10342428 3300025924 Bacteria 1236
380 Ga0207694_11252620 3300025924 Bacteria 627
381 Ga0207650_10057888 3300025925 Bacteria 2884
382 Ga0207659_10661416 3300025926 Bacteria 893
383 Ga0207659_10814445 3300025926 Bacteria 802
384 Ga0207687_10095098 3300025927 Bacteria 2182
385 Ga0207687_10147298 3300025927 Bacteria 1792
386 Ga0207687_10957950 3300025927 Bacteria 733
387 Ga0207700_10466132 3300025928 Bacteria 1115
388 Ga0207664_10051260 3300025929 Bacteria 3258
389 Ga0207644_11414080 3300025931 Bacteria 584
390 Ga0207690_10530119 3300025932 Bacteria 955
391 Ga0207690_10772675 3300025932 Bacteria 793
392 Ga0207690_11340041 3300025932 Bacteria 598
393 Ga0207690_11651840 3300025932 Bacteria 535
394 Ga0207706_10057499 3300025933 Bacteria 3426
395 Ga0207706_10127122 3300025933 Bacteria 2241
396 Ga0207686_10105604 3300025934 Bacteria 1889
397 Ga0207686_11015734 3300025934 Bacteria 673
398 Ga0207709_10150410 3300025935 Bacteria 1612
399 Ga0207709_10664809 3300025935 Bacteria 831
400 Ga0207669_10009893 3300025937 Bacteria 4565
401 Ga0207669_10070993 3300025937 Bacteria 2186
402 Ga0207669_10088983 3300025937 Bacteria 2004
403 Ga0207669_10335675 3300025937 Bacteria 1162
404 Ga0207704_10107290 3300025938 Bacteria 1878
405 Ga0207704_10174646 3300025938 Bacteria 1545
406 Ga0207704_10216720 3300025938 Bacteria 1413
407 Ga0207704_10670876 3300025938 Bacteria 856
408 Ga0207691_10117491 3300025940 Bacteria 2360
409 Ga0207691_10693142 3300025940 Bacteria 859
410 Ga0207711_10418506 3300025941 Bacteria 1246
411 Ga0207711_10641574 3300025941 Bacteria 991
412 Ga0207711_11239148 3300025941 Bacteria 688
413 Ga0207711_11539441 3300025941 Bacteria 608
414 Ga0207689_10124593 3300025942 Bacteria 2120
415 Ga0207689_11211116 3300025942 Bacteria 635
416 Ga0207661_10248877 3300025944 Bacteria 1579
417 Ga0207661_11715619 3300025944 Bacteria 573
418 Ga0207667_10017864 3300025949 Bacteria 7972
419 Ga0207667_10792538 3300025949 Bacteria 945
420 Ga0207667_11877155 3300025949 Bacteria 562
421 Ga0207651_10238268 3300025960 Bacteria 1481
422 Ga0207651_10472515 3300025960 Bacteria 1079
423 Ga0207651_11337491 3300025960 Bacteria 644
424 Ga0207712_10227141 3300025961 Bacteria 1496
425 Ga0207712_10435288 3300025961 Bacteria 1109
426 Ga0207640_10572189 3300025981 Bacteria 952
427 Ga0207677_10457231 3300026023 Bacteria 1095
428 Ga0207677_11186049 3300026023 Bacteria 698
429 Ga0207677_11647267 3300026023 Bacteria 594
430 Ga0207703_10332310 3300026035 Bacteria 1394
431 Ga0207703_11326844 3300026035 Bacteria 692
432 Ga0207639_11412385 3300026041 Bacteria 653
433 Ga0207678_11008212 3300026067 Bacteria 737
434 Ga0207708_10024133 3300026075 Bacteria 4599
435 Ga0207708_10822962 3300026075 Bacteria 800
436 Ga0207702_10562012 3300026078 Bacteria 1117
437 Ga0207641_10034453 3300026088 Bacteria 4213
438 Ga0207648_10056516 3300026089 Bacteria 3425
439 Ga0207648_10060929 3300026089 Bacteria 3290
440 Ga0207648_10129854 3300026089 Bacteria 2218
441 Ga0207648_10306092 3300026089 Bacteria 1426
442 Ga0207648_10686769 3300026089 Bacteria 948
443 Ga0207676_11100464 3300026095 Bacteria 785
444 Ga0207675_100022779 3300026118 Bacteria 5829
445 Ga0207675_100129766 3300026118 Bacteria 2390
446 Ga0207675_100349149 3300026118 Bacteria 1450
447 Ga0207675_100658556 3300026118 Bacteria 1054
448 Ga0207675_100742488 3300026118 Bacteria 992
449 Ga0207675_100804005 3300026118 Bacteria 954
450 Ga0207675_101922960 3300026118 Bacteria 610
451 Ga0207683_10011262 3300026121 Bacteria 7625
452 Ga0207683_10456429 3300026121 Bacteria 1178
453 Ga0207683_10467409 3300026121 Bacteria 1163
454 Ga0207698_10685870 3300026142 Bacteria 1018
455 Ga0209973_1070917 3300027252 Bacteria 545
456 Ga0209995_1057437 3300027471 Bacteria 662
457 Ga0209983_1069098 3300027665 Bacteria 786
458 Ga0209588_1068174 3300027671 Bacteria 1149
459 Ga0207428_10009686 3300027907 Bacteria 8632
460 Ga0207428_10055654 3300027907 Bacteria 3144
461 Ga0207428_10077225 3300027907 Bacteria 2607
462 Ga0268266_10079314 3300028379 Bacteria 2858
463 Ga0268265_10009567 3300028380 Bacteria 6545
464 Ga0268265_10291710 3300028380 Bacteria 1465
465 Ga0265330_10062935 3300031235 Bacteria 1613
466 Ga0307513_10349382 3300031456 Bacteria 1227
467 Ga0307408_100128636 3300031548 Bacteria 1973
468 Ga0307408_100300990 3300031548 Bacteria 1343
469 Ga0307408_100315007 3300031548 Bacteria 1316
470 Ga0307408_100360495 3300031548 Bacteria 1236
471 Ga0265314_10007579 3300031711 Bacteria 9400
472 Ga0307405_10518890 3300031731 Bacteria 958
473 Ga0307405_11082264 3300031731 Bacteria 688
474 Ga0307413_11168206 3300031824 Bacteria 668
475 Ga0307406_10032354 3300031901 Bacteria 3193
476 Ga0307407_11227243 3300031903 Bacteria 586
477 Ga0307412_10277063 3300031911 Bacteria 1315
478 Ga0307412_10737472 3300031911 Bacteria 849
479 Ga0307409_100867898 3300031995 Bacteria 914
480 Ga0307409_100967154 3300031995 Bacteria 868
481 Ga0307409_102703589 3300031995 Bacteria 524
482 Ga0307416_100069478 3300032002 Bacteria 2915
483 Ga0307416_101553644 3300032002 Bacteria 767
484 Ga0307414_10203566 3300032004 Bacteria 1612
485 Ga0307411_10011154 3300032005 Bacteria 4834
486 Ga0307411_10975335 3300032005 Bacteria 757
487 Ga0307411_11728989 3300032005 Bacteria 579
488 Ga0307415_101096615 3300032126 Bacteria 745
489 Ga0307415_102471341 3300032126 Bacteria 511
490 Ga0373948_0026171 3300034817 Bacteria 1148
491 Ga0373959_0019147 3300034820 Bacteria 1294
492 Ga0373926_0158323 3300035083 Bacteria 864
493 Ga0373929_0186064 3300035085 Bacteria 575
494 Ga0373940_0114535 3300035088 Bacteria 831
495 Ga0373949_0039153 3300035090 Bacteria 1160
496 Ga0373949_0050917 3300035090 Bacteria 1043
497 Ga0373949_0156641 3300035090 Bacteria 662
498 Ga0373932_0192600 3300035112 Bacteria 721
499 Ga0373936_0210280 3300035113 Bacteria 861
500 Ga0373939_0107338 3300035114 Bacteria 967
501 Ga0373939_0368385 3300035114 Bacteria 588
502 Ga0373945_0140338 3300035116 Bacteria 974
503 Ga0373953_0195181 3300035117 Bacteria 875
504 Ga0373953_0290486 3300035117 Bacteria 713
505 Ga0373953_0343095 3300035117 Bacteria 654
506 Ga0373956_0045429 3300035119 Bacteria 1960
507 Ga0373943_0056118 3300035170 Bacteria 1954
508 Ga0373943_0477011 3300035170 Bacteria 727
509 Ga0373946_0032579 3300035171 Bacteria 2094
510 Ga0373955_0134713 3300035172 Bacteria 1444
511 Ga0373942_0216206 3300035207 Bacteria 641
512 Ga0373961_0306054 3300035241 Bacteria 589
513 Ga0373924_0058294 3300035410 Bacteria 1612
514 Ga0373924_0086920 3300035410 Bacteria 1334
515 Ga0373931_0002096 3300035691 Bacteria 8774
516 Ga0373931_0269723 3300035691 Bacteria 1041
517 Ga0373931_0816455 3300035691 Bacteria 623
518 Ga0373931_0867625 3300035691 Bacteria 605
519 Ga0373935_1006005 3300035692 Bacteria 619
520 Ga0373927_0129073 3300035695 Bacteria 1651
521 Ga0373947_0464859 3300035725 Bacteria 858
522 Ga0373947_0756830 3300035725 Bacteria 663
523 Ga0373937_0067221 3300036401 Bacteria 3302
524 Ga0373937_0221033 3300036401 Bacteria 1783
525 Ga0373937_0668610 3300036401 Bacteria 984
526 Ga0373937_2036599 3300036401 Bacteria 520
527 Ga0373925_0069528 3300037068 Bacteria 2660
528 Ga0373925_0430860 3300037068 Bacteria 1078
529 Ga0395900_0534850 3300037418 Bacteria 1118
530 Ga0395901_0226862 3300038443 Bacteria 1951
531 Ga0242420_011734 3300038996 Bacteria 1475
532 Ga0436360_1164604 3300039438 Bacteria 2135
533 Ga0439453_0195091 3300041408 Bacteria 500
534 Ga0451800_1151021 3300041459 Bacteria 506
535 Ga0451802_1108347 3300041460 Bacteria 818
536 Ga0451847_0081879 3300041503 Bacteria 620
537 Ga0451853_0869743 3300041512 Bacteria 655
538 Ga0439463_081758 3300042016 Bacteria 831
539 Ga0450912_004737 3300042116 Bacteria 1020
540 Ga0450923_140390 3300042125 Bacteria 580
541 Ga0439435_0100211 3300042436 Bacteria 889
542 Ga0439435_0206099 3300042436 Bacteria 650
543 Ga0439435_0310367 3300042436 Bacteria 542
544 Ga0439460_0100071 3300042461 Bacteria 930
545 Ga0451577_0205501 3300042876 Bacteria 1778
546 Ga0466965_0272794 3300044683 Bacteria 912
547 Ga0453684_0256633 3300044712 Bacteria 2005
548 Ga0466957_0429856 3300044842 Bacteria 907
549 Ga0451576_0278101 3300045051 Bacteria 1750
550 Ga0451576_0561226 3300045051 Bacteria 1199
551 Ga0495592_0473704 3300046454 Bacteria 781
552 Ga0495603_0043902 3300046455 Bacteria 2668
553 Ga0495603_0150724 3300046455 Bacteria 1351
554 Ga0495603_0245649 3300046455 Bacteria 1031
555 Ga0495603_0312576 3300046455 Bacteria 902
556 Ga0495629_0055216 3300046459 Bacteria 2778
557 Ga0495629_0378373 3300046459 Bacteria 964
558 Ga0495653_0179385 3300046463 Bacteria 1455
559 Ga0495580_0000020 3300046472 Bacteria 91314
560 Ga0495582_0247667 3300046473 Bacteria 1022
561 Ga0495582_0345055 3300046473 Bacteria 857
562 Ga0495639_0101147 3300046475 Bacteria 1361
563 Ga0495662_0321985 3300046476 Bacteria 760
564 Ga0495594_0102795 3300046499 Bacteria 1608
565 Ga0495594_0723366 3300046499 Bacteria 562
566 Ga0495608_0285283 3300046511 Bacteria 1024
567 Ga0495618_0467079 3300046514 Bacteria 764
568 Ga0495628_0265137 3300046516 Bacteria 1279
569 Ga0495630_0267490 3300046517 Bacteria 1306
570 Ga0495644_0223090 3300046523 Bacteria 729
571 Ga0495642_0009559 3300046528 Bacteria 3711
572 Ga0495642_0202337 3300046528 Bacteria 866
573 Ga0495652_0477229 3300046529 Bacteria 869
574 Ga0495640_0065981 3300046533 Bacteria 2442
575 Ga0495586_0088108 3300046535 Bacteria 1712
576 Ga0495586_0141059 3300046535 Bacteria 1353
577 Ga0495587_0220146 3300046536 Bacteria 1071
578 Ga0495598_0084538 3300046537 Bacteria 1024
579 Ga0495598_0200879 3300046537 Bacteria 720
580 Ga0495621_0103056 3300046539 Bacteria 1088
581 Ga0495645_0006287 3300046543 Bacteria 8236
582 Ga0495667_0526525 3300046559 Bacteria 739
583 Ga0495656_0163586 3300046615 Bacteria 1083
584 Ga0495668_0190674 3300046616 Bacteria 1123
585 Ga0495668_0586264 3300046616 Bacteria 616
586 Ga0495634_0100808 3300046642 Bacteria 1866
587 Ga0495634_0765674 3300046642 Bacteria 552
588 Ga0495659_0041994 3300046664 Bacteria 1636
589 Ga0495659_0145914 3300046664 Bacteria 947
590 Ga0495659_0221049 3300046664 Bacteria 782
591 Ga0495588_0348888 3300046674 Bacteria 778
592 Ga0495647_0082963 3300046681 Bacteria 1302
593 Ga0495647_0094351 3300046681 Bacteria 1231
594 Ga0495658_0064706 3300046683 Bacteria 2107
595 Ga0495658_0195497 3300046683 Bacteria 1259
596 Ga0495658_0690527 3300046683 Bacteria 654
597 Ga0495669_0020738 3300046684 Bacteria 2847
598 Ga0495669_0536931 3300046684 Bacteria 569
599 Ga0495670_0092012 3300046691 Bacteria 1553
600 Ga0495671_0187062 3300046692 Bacteria 1006
601 Ga0495589_0433553 3300046794 Bacteria 602
602 Ga0495581_0044555 3300047315 Bacteria 2566
603 Ga0495581_0210608 3300047315 Bacteria 1137
604 Ga0495636_0060520 3300047318 Bacteria 1600
605 Ga0495674_0044793 3300047319 Bacteria 3932
606 Ga0495676_0139896 3300047321 Bacteria 1736
607 Ga0495680_0334380 3300047322 Bacteria 1058
608 Ga0495675_0149748 3300047444 Bacteria 1442
609 Ga0495684_0030504 3300047471 Bacteria 4140
610 Ga0495614_0181095 3300048089 Bacteria 948
611 Ga0495615_0271254 3300048090 Bacteria 543
612 Ga0496100_0113941 3300048903 Bacteria 1883
613 Ga0496100_0881213 3300048903 Bacteria 703
614 Ga0496102_0047759 3300048905 Bacteria 3891
615 Ga0496102_0268575 3300048905 Bacteria 1608
616 Ga0496106_0302602 3300048909 Bacteria 1283
617 Ga0496106_0410272 3300048909 Bacteria 1089
618 Ga0496106_0560420 3300048909 Bacteria 917
619 Ga0496106_0685352 3300048909 Bacteria 817
620 Ga0496107_0210509 3300048910 Bacteria 1446
621 Ga0496107_0608545 3300048910 Bacteria 807
622 Ga0496109_0162123 3300048912 Bacteria 2095
623 Ga0496109_0283991 3300048912 Bacteria 1560
624 Ga0496109_0971550 3300048912 Bacteria 787
625 Ga0496109_1807906 3300048912 Bacteria 544
626 Ga0496110_0515460 3300048913 Bacteria 1088
627 Ga0496114_0321889 3300048917 Bacteria 1366
628 Ga0496114_0543833 3300048917 Bacteria 1026
629 Ga0501309_033728 3300049129 Bacteria 763
630 Ga0501305_055304 3300049161 Bacteria 674
631 Ga0501298_069749 3300049521 Bacteria 757
632 Ga0501299_012854 3300049522 Bacteria 1436
633 Ga0501299_119814 3300049522 Bacteria 633
634 Ga0501302_016186 3300049525 Bacteria 601
635 Ga0501312_100006 3300049528 Bacteria 543
636 Ga0501031_0254315 3300049568 Bacteria 1142
637 Ga0501031_0406451 3300049568 Bacteria 880
638 Ga0501032_0096009 3300049569 Bacteria 1965
639 Ga0501032_0203582 3300049569 Bacteria 1291
640 Ga0501033_0085296 3300049570 Bacteria 2313
641 Ga0501034_0013252 3300049571 Bacteria 8494
642 Ga0501034_0062327 3300049571 Bacteria 3744
643 Ga0501034_0396885 3300049571 Bacteria 1302
644 Ga0501036_0070188 3300049572 Bacteria 2962
645 Ga0501036_0307850 3300049572 Bacteria 1325
646 Ga0501036_0355340 3300049572 Bacteria 1223
647 Ga0501036_0526836 3300049572 Bacteria 982
648 Ga0501036_0617594 3300049572 Bacteria 898
649 Ga0501037_0482433 3300049573 Bacteria 843
650 Ga0501037_0540096 3300049573 Bacteria 788
651 Ga0501037_0847354 3300049573 Bacteria 601
652 Ga0501038_0073380 3300049574 Bacteria 2898
653 Ga0501038_0199273 3300049574 Bacteria 1607
654 Ga0501038_0474785 3300049574 Bacteria 959
655 Ga0501038_0681183 3300049574 Bacteria 772
656 Ga0501038_1154180 3300049574 Bacteria 564
657 Ga0501038_1179308 3300049574 Bacteria 557
658 Ga0501039_0186470 3300049575 Bacteria 1631
659 Ga0501039_0256958 3300049575 Bacteria 1373
660 Ga0501039_0257176 3300049575 Bacteria 1373
661 Ga0501039_0355700 3300049575 Bacteria 1150
662 Ga0501039_0402209 3300049575 Bacteria 1075
663 Ga0501039_0500394 3300049575 Bacteria 954
664 Ga0501039_1536235 3300049575 Bacteria 511
665 Ga0501040_0224705 3300049576 Bacteria 1336
666 Ga0501040_0470201 3300049576 Bacteria 905
667 Ga0501040_0515052 3300049576 Bacteria 862
668 Ga0501040_0695258 3300049576 Bacteria 735
669 Ga0501040_0715140 3300049576 Bacteria 724
670 Ga0501040_0853934 3300049576 Bacteria 659
671 Ga0501041_0027203 3300049577 Bacteria 3446
672 Ga0501041_0447920 3300049577 Bacteria 820
673 Ga0501041_0479686 3300049577 Bacteria 790
674 Ga0501042_0047787 3300049578 Bacteria 3051
675 Ga0501042_0115555 3300049578 Bacteria 1932
676 Ga0501042_0329784 3300049578 Bacteria 1103
677 Ga0501042_0335219 3300049578 Bacteria 1093
678 Ga0501043_0205410 3300049579 Bacteria 1527
679 Ga0501043_0517619 3300049579 Bacteria 889
680 Ga0501043_0553451 3300049579 Bacteria 854
681 Ga0501043_0676949 3300049579 Bacteria 755
682 Ga0501043_1125303 3300049579 Bacteria 554
683 Ga0501043_1313962 3300049579 Bacteria 504
684 Ga0501046_0122797 3300049580 Bacteria 1975
685 Ga0501046_0226235 3300049580 Bacteria 1383
686 Ga0501046_0261729 3300049580 Bacteria 1271
687 Ga0501046_0483405 3300049580 Bacteria 888
688 Ga0501046_0719544 3300049580 Bacteria 702
689 Ga0501047_0025664 3300049581 Bacteria 5666
690 Ga0501047_0042294 3300049581 Bacteria 4403
691 Ga0501047_0049792 3300049581 Bacteria 4044
692 Ga0501047_0228159 3300049581 Bacteria 1716
693 Ga0501047_0809142 3300049581 Bacteria 752
694 Ga0501048_0031213 3300049582 Bacteria 3854
695 Ga0501048_0034967 3300049582 Bacteria 3620
696 Ga0501048_0128505 3300049582 Bacteria 1792
697 Ga0501048_0170574 3300049582 Bacteria 1541
698 Ga0501048_1222170 3300049582 Bacteria 540
699 Ga0501067_0019308 3300049583 Bacteria 3771
700 Ga0501067_0105799 3300049583 Bacteria 1563
701 Ga0501068_0029501 3300049584 Bacteria 3248
702 Ga0501068_0069671 3300049584 Bacteria 2145
703 Ga0501068_0149489 3300049584 Bacteria 1467
704 Ga0501068_0203545 3300049584 Bacteria 1256
705 Ga0501068_0219807 3300049584 Bacteria 1207
706 Ga0501068_0476435 3300049584 Bacteria 809
707 Ga0501068_0782239 3300049584 Bacteria 625
708 Ga0501069_0021172 3300049585 Bacteria 3528
709 Ga0501069_0120453 3300049585 Bacteria 1498
710 Ga0501069_0834116 3300049585 Bacteria 559
711 Ga0501069_0923377 3300049585 Bacteria 531
712 Ga0501070_0302332 3300049586 Bacteria 1303
713 Ga0501070_0523304 3300049586 Bacteria 951
714 Ga0501070_0755299 3300049586 Bacteria 766
715 Ga0501071_0197980 3300049587 Bacteria 1508
716 Ga0501071_0599153 3300049587 Bacteria 847
717 Ga0501071_0677607 3300049587 Bacteria 794
718 Ga0501072_0014068 3300049588 Bacteria 6132
719 Ga0501072_0072312 3300049588 Bacteria 2725
720 Ga0501072_0192588 3300049588 Bacteria 1626
721 Ga0501072_0208710 3300049588 Bacteria 1556
722 Ga0501072_0218665 3300049588 Bacteria 1518
723 Ga0501072_0278892 3300049588 Bacteria 1329
724 Ga0501072_0554453 3300049588 Bacteria 907
725 Ga0501073_0036691 3300049589 Bacteria 3481
726 Ga0501073_0135900 3300049589 Bacteria 1704
727 Ga0501073_0142718 3300049589 Bacteria 1659
728 Ga0501073_0678060 3300049589 Bacteria 711
729 Ga0501074_0049922 3300049590 Bacteria 3020
730 Ga0501074_0323643 3300049590 Bacteria 1095
731 Ga0501074_0610793 3300049590 Bacteria 771
732 Ga0501074_0788219 3300049590 Bacteria 670
733 Ga0501075_0008499 3300049591 Bacteria 7161
734 Ga0501075_0031327 3300049591 Bacteria 3946
735 Ga0501075_0050755 3300049591 Bacteria 3119
736 Ga0501075_0210467 3300049591 Bacteria 1483
737 Ga0501075_0266503 3300049591 Bacteria 1305
738 Ga0501075_0324356 3300049591 Bacteria 1173
739 Ga0501075_0635155 3300049591 Bacteria 814
740 Ga0501076_0030185 3300049592 Bacteria 4222
741 Ga0501076_0044508 3300049592 Bacteria 3501
742 Ga0501076_0054495 3300049592 Bacteria 3169
743 Ga0501076_0108804 3300049592 Bacteria 2239
744 Ga0501076_0147246 3300049592 Bacteria 1915
745 Ga0501076_0207451 3300049592 Bacteria 1601
746 Ga0501076_0442426 3300049592 Bacteria 1070
747 Ga0501076_0604756 3300049592 Bacteria 904
748 Ga0501076_0726136 3300049592 Bacteria 820
749 Ga0501077_0002533 3300049593 Bacteria 10951
750 Ga0501077_0004004 3300049593 Bacteria 8891
751 Ga0501077_0145854 3300049593 Bacteria 1501
752 Ga0501077_0204507 3300049593 Bacteria 1254
753 Ga0501077_0281283 3300049593 Bacteria 1059
754 Ga0501234_064431 3300049707 Bacteria 625
755 Ga0501079_0012904 3300049741 Bacteria 6377
756 Ga0501079_0065568 3300049741 Bacteria 2802
757 Ga0501079_0079995 3300049741 Bacteria 2527
758 Ga0501079_0081872 3300049741 Bacteria 2496
759 Ga0501079_0353864 3300049741 Bacteria 1151
760 Ga0501079_0673534 3300049741 Bacteria 814
761 Ga0501079_0909685 3300049741 Bacteria 693
762 Ga0501080_0241788 3300049742 Bacteria 1647
763 Ga0501080_0722570 3300049742 Bacteria 877
764 Ga0501080_1072019 3300049742 Bacteria 696
765 Ga0501080_1105096 3300049742 Bacteria 684
766 Ga0501080_1364881 3300049742 Bacteria 605
767 Ga0501080_1443530 3300049742 Bacteria 586
768 Ga0501081_0035649 3300049743 Bacteria 3387
769 Ga0501081_0116426 3300049743 Bacteria 1900
770 Ga0501081_0217630 3300049743 Bacteria 1388
771 Ga0501081_0381196 3300049743 Bacteria 1042
772 Ga0501081_0470584 3300049743 Bacteria 935
773 Ga0501081_0676940 3300049743 Bacteria 774
774 Ga0501081_0782753 3300049743 Bacteria 718
775 Ga0501081_1255954 3300049743 Bacteria 561
776 Ga0501083_0018057 3300049744 Bacteria 4917
777 Ga0501083_0090152 3300049744 Bacteria 2025
778 Ga0501083_0192624 3300049744 Bacteria 1330
779 Ga0501083_0306390 3300049744 Bacteria 1033
780 Ga0501035_0376494 3300049822 Bacteria 1184
781 Ga0501035_0401670 3300049822 Bacteria 1140
782 Ga0501035_1024898 3300049822 Bacteria 648
783 Ga0501044_0003452 3300049823 Bacteria 17800
784 Ga0501044_0182996 3300049823 Bacteria 2061
785 Ga0501044_0195408 3300049823 Bacteria 1983
786 Ga0501044_0549969 3300049823 Bacteria 1051
787 Ga0501044_1067231 3300049823 Bacteria 678
788 Ga0501045_0045065 3300049824 Bacteria 3211
789 Ga0501045_0111316 3300049824 Bacteria 2030
790 Ga0501045_0162253 3300049824 Bacteria 1664
791 Ga0501045_0189069 3300049824 Bacteria 1535
792 Ga0501045_0739732 3300049824 Bacteria 725
793 nmdc:mga00v17_121554_c2 3300050491 Bacteria 939
794 nmdc:mga0k408_107084_c1 3300050493 Unclassified 1212
795 nmdc:mga04h51_178292_c1 3300050495 Unclassified 826
796 nmdc:mga07m45_152_c1 3300050496 Bacteria 27737
797 nmdc:mga05p37_14246_c1 3300050507 Bacteria 9550
798 nmdc:mga05p37_1531273_c1 3300050507 Bacteria 662
799 nmdc:mga05p37_2249_c1 3300050507 Bacteria 22479
800 nmdc:mga05p37_2645_c1 3300050507 Bacteria 20857
801 nmdc:mga05p37_34567_c1 3300050507 Bacteria 6192
802 nmdc:mga05p37_35074_c1 3300050507 Bacteria 6150
803 nmdc:mga05p37_43564_c1 3300050507 Bacteria 5521
804 nmdc:mga05p37_43602_c1 3300050507 Bacteria 5519
805 nmdc:mga05p37_47839_c1 3300050507 Bacteria 5259
806 nmdc:mga05p37_551938_c1 3300050507 Bacteria 1311
807 nmdc:mga05p37_602880_c1 3300050507 Bacteria 1239
808 nmdc:mga05p37_65_c1 3300050507 Bacteria 48888
809 nmdc:mga05p37_66375_c1 3300050507 Bacteria 4438
810 nmdc:mga05p37_805015_c1 3300050507 Bacteria 1027
811 nmdc:mga05p37_83387_c1 3300050507 Bacteria 3938
812 nmdc:mga05p37_90559_c1 3300050507 Bacteria 3769
813 nmdc:mga09592_1037801_c1 3300050508 Bacteria 684
814 nmdc:mga09592_105805_c1 3300050508 Bacteria 2413
815 nmdc:mga09592_127446_c1 3300050508 Bacteria 2189
816 nmdc:mga09592_13087_c1 3300050508 Bacteria 6771
817 nmdc:mga09592_44935_c1 3300050508 Bacteria 3720
818 nmdc:mga09592_68878_c1 3300050508 Bacteria 3002
819 nmdc:mga09592_915780_c1 3300050508 Bacteria 736
820 nmdc:mga0qj67_1264138_c1 3300050509 Bacteria 573
821 nmdc:mga0qj67_19800_c1 3300050509 Bacteria 5146
822 nmdc:mga0qj67_2619_c1 3300050509 Bacteria 12899
823 nmdc:mga0qj67_389091_c1 3300050509 Bacteria 1126
824 nmdc:mga0qj67_5121_c1 3300050509 Bacteria 9545
825 nmdc:mga0qj67_652_c1 3300050509 Bacteria 23881
826 nmdc:mga06r32_10547_c1 3300050510 Bacteria 8332
827 nmdc:mga06r32_133332_c1 3300050510 Bacteria 2458
828 nmdc:mga06r32_18264_c1 3300050510 Bacteria 6419
829 nmdc:mga06r32_21776_c1 3300050510 Bacteria 5917
830 nmdc:mga06r32_364376_c1 3300050510 Bacteria 1429
831 nmdc:mga06r32_43766_c1 3300050510 Bacteria 4261
832 nmdc:mga06r32_61409_c1 3300050510 Bacteria 3617
833 nmdc:mga06r32_777101_c1 3300050510 Bacteria 919
834 nmdc:mga08y16_145726_c1 3300050511 Bacteria 2462
835 nmdc:mga08y16_1481107_c1 3300050511 Bacteria 640
836 nmdc:mga08y16_1921394_c1 3300050511 Bacteria 542
837 nmdc:mga08y16_61777_c1 3300050511 Bacteria 3912
838 nmdc:mga08y16_64772_c1 3300050511 Bacteria 3816
839 nmdc:mga0n895_135551_c1 3300050512 Bacteria 2489
840 nmdc:mga0n895_14_c1 3300050512 Bacteria 102430
841 nmdc:mga0n895_23374_c1 3300050512 Bacteria 5810
842 nmdc:mga0n895_23375_c1 3300050512 Bacteria 5810
843 nmdc:mga0n895_253923_c1 3300050512 Bacteria 1784
844 nmdc:mga0n895_352041_c1 3300050512 Bacteria 1492
845 nmdc:mga0n895_376592_c1 3300050512 Bacteria 1437
846 nmdc:mga0n895_525033_c1 3300050512 Bacteria 1191
847 nmdc:mga0n895_680737_c1 3300050512 Bacteria 1026
848 nmdc:mga0n895_708214_c1 3300050512 Bacteria 1002
849 nmdc:mga0n895_880544_c1 3300050512 Bacteria 882
850 nmdc:mga0n895_98_c1 3300050512 Bacteria 51629
851 nmdc:mga0rr50_1329284_c1 3300050513 Bacteria 609
852 nmdc:mga0rr50_133022_c1 3300050513 Bacteria 1994
853 nmdc:mga0rr50_1773_c1 3300050513 Bacteria 11923
854 nmdc:mga0rr50_229957_c1 3300050513 Bacteria 1534
855 nmdc:mga0rr50_402224_c1 3300050513 Bacteria 1157
856 nmdc:mga0rr50_46593_c1 3300050513 Bacteria 3193
857 nmdc:mga0rr50_8258_c1 3300050513 Bacteria 6472
858 nmdc:mga0rr50_826004_c1 3300050513 Bacteria 791
859 nmdc:mga0rr50_88324_c1 3300050513 Bacteria 2408
860 nmdc:mga0rr50_8956_c1 3300050513 Bacteria 6258
861 nmdc:mga08x19_18471_c1 3300050514 Bacteria 4273
862 nmdc:mga08x19_300889_c1 3300050514 Bacteria 1114
863 nmdc:mga08x19_34661_c1 3300050514 Bacteria 3192
864 nmdc:mga08x19_489434_c1 3300050514 Bacteria 868
865 nmdc:mga08x19_495247_c1 3300050514 Bacteria 862
866 nmdc:mga08x19_506405_c1 3300050514 Bacteria 853
867 nmdc:mga08x19_694049_c1 3300050514 Bacteria 722
868 nmdc:mga08x19_83620_c1 3300050514 Bacteria 2099
869 nmdc:mga0a205_115193_c1 3300050515 Bacteria 2587
870 nmdc:mga0a205_225843_c1 3300050515 Bacteria 1757
871 nmdc:mga0a205_294327_c1 3300050515 Bacteria 1497
872 nmdc:mga0a205_354488_c1 3300050515 Bacteria 1334
873 nmdc:mga0a205_52793_c1 3300050515 Bacteria 3923
874 nmdc:mga0a205_534956_c1 3300050515 Bacteria 1028
875 nmdc:mga0a205_59155_c1 3300050515 Bacteria 3702
876 nmdc:mga0a205_972588_c1 3300050515 Bacteria 696
877 Ga0495601_0169537 3300053077 Bacteria 1427
878 Ga0495612_0160040 3300053078 Bacteria 983
879 Ga0495655_0038227 3300053083 Bacteria 1210
880 Ga0495595_0139583 3300053084 Bacteria 1188
881 Ga0495619_0218156 3300053085 Bacteria 1321
882 Ga0500646_0132500 3300053090 Bacteria 811
883 Ga0500651_0209244 3300053093 Bacteria 1148
884 Ga0500555_000474 3300053103 Bacteria 16656
885 Ga0500592_015086 3300053116 Bacteria 1239
886 Ga0500616_0000173 3300053153 Bacteria 107646
887 Ga0500645_002162 3300053730 Bacteria 9009
888 Ga0500599_013758 3300053736 Bacteria 1097
889 Ga0501084_0046060 3300054114 Bacteria 3652
890 Ga0501084_0139906 3300054114 Bacteria 2038
891 Ga0501084_0178706 3300054114 Bacteria 1791
892 Ga0501084_0607380 3300054114 Bacteria 924
893 Ga0501084_0651585 3300054114 Bacteria 889
894 Ga0501084_0738545 3300054114 Bacteria 830
895 Ga0590071_017298 3300059421 Bacteria 1693
896 Ga0587094_103007 3300059513 Bacteria 553
897 Ga0587111_0255005 3300060346 Bacteria 520
898 Ga0501082_0056096 3300060353 Bacteria 3393
899 Ga0501082_0059928 3300060353 Bacteria 3279
900 Ga0501082_0133257 3300060353 Bacteria 2156
901 Ga0501082_0277963 3300060353 Bacteria 1457
902 Ga0501082_0485784 3300060353 Bacteria 1079
903 Ga0501082_0651176 3300060353 Bacteria 922
904 Ga0501082_0907663 3300060353 Bacteria 770
905 Ga0530510_0006450 3300061734 Bacteria 8169
906 Ga0530510_0026290 3300061734 Bacteria 4165
907 Ga0530510_0047756 3300061734 Bacteria 3093
908 Ga0530510_0068221 3300061734 Bacteria 2580
909 Ga0530510_0093023 3300061734 Bacteria 2201
910 Ga0530510_0100688 3300061734 Bacteria 2112
911 Ga0530510_0115637 3300061734 Bacteria 1967
912 Ga0530510_0412994 3300061734 Bacteria 1018
913 Ga0530510_0556282 3300061734 Bacteria 871
914 Ga0530510_0582018 3300061734 Bacteria 851
915 Ga0530510_0672997 3300061734 Bacteria 788
916 Ga0530510_1168134 3300061734 Bacteria 590

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005340 Ga0070689_100820233 Ga0070689_1008202332 92
2 3300005842 Ga0068858_101028204 Ga0068858_1010282042 92
3 3300006358 Ga0068871_100273633 Ga0068871_1002736333 92
4 3300006881 Ga0068865_100277192 Ga0068865_1002771922 92
5 3300009176 Ga0105242_10182109 Ga0105242_101821093 92
6 3300009177 Ga0105248_11529107 Ga0105248_115291072 92
7 3300013297 Ga0157378_12316347 Ga0157378_123163471 92
8 3300014968 Ga0157379_11077913 Ga0157379_110779132 92
9 3300039438 Ga0436360_1164604 Ga0436360_1164604_1597_1887 92
10 3300005330 Ga0070690_100080948 Ga0070690_1000809484 93
11 3300005335 Ga0070666_10028665 Ga0070666_100286655 93
12 3300005338 Ga0068868_101472963 Ga0068868_1014729632 93
13 3300005339 Ga0070660_100519310 Ga0070660_1005193102 93
14 3300005343 Ga0070687_100081895 Ga0070687_1000818953 93
15 3300005457 Ga0070662_101269695 Ga0070662_1012696951 93
16 3300005544 Ga0070686_100002243 Ga0070686_10000224319 93
17 3300005546 Ga0070696_100425290 Ga0070696_1004252902 93
18 3300005578 Ga0068854_101861472 Ga0068854_1018614722 93
19 3300005842 Ga0068858_100083129 Ga0068858_1000831293 93
20 3300005842 Ga0068858_100497176 Ga0068858_1004971763 93
21 3300005842 Ga0068858_101053517 Ga0068858_1010535172 93
22 3300005843 Ga0068860_100611688 Ga0068860_1006116883 93
23 3300006173 Ga0070716_100709258 Ga0070716_1007092582 93
24 3300006871 Ga0075434_100544981 Ga0075434_1005449812 93
25 3300014968 Ga0157379_10618542 Ga0157379_106185422 93
26 3300015265 Ga0182005_1090088 Ga0182005_10900881 93
27 3300025941 Ga0207711_10641574 Ga0207711_106415742 93
28 3300035117 Ga0373953_0290486 Ga0373953_0290486_47_409 93
29 3300035117 Ga0373953_0343095 Ga0373953_0343095_27_401 93
30 3300036401 Ga0373937_0668610 Ga0373937_0668610_270_644 93
31 3300046459 Ga0495629_0378373 Ga0495629_0378373_285_659 93
32 3300046516 Ga0495628_0265137 Ga0495628_0265137_854_1228 93
33 3300049577 Ga0501041_0447920 Ga0501041_0447920_188_514 93
34 3300050508 nmdc:mga09592_915780_c1 nmdc:mga09592_915780_c1_301_687 93
35 3300005435 Ga0070714_100072180 Ga0070714_1000721804 94
36 3300005468 Ga0070707_100876942 Ga0070707_1008769422 94
37 3300009553 Ga0105249_10908982 Ga0105249_109089822 94
38 3300025928 Ga0207700_10466132 Ga0207700_104661322 94
39 3300025929 Ga0207664_10051260 Ga0207664_100512605 94
40 3300025931 Ga0207644_11414080 Ga0207644_114140802 94
41 3300026023 Ga0207677_11186049 Ga0207677_111860492 94
42 3300026035 Ga0207703_10332310 Ga0207703_103323103 94
43 3300046683 Ga0495658_0690527 Ga0495658_0690527_129_464 94
44 3300049568 Ga0501031_0406451 Ga0501031_0406451_132_452 94
45 3300049570 Ga0501033_0085296 Ga0501033_0085296_1501_1821 94
46 3300049572 Ga0501036_0355340 Ga0501036_0355340_447_767 94
47 3300049573 Ga0501037_0847354 Ga0501037_0847354_55_375 94
48 3300049579 Ga0501043_0517619 Ga0501043_0517619_444_764 94
49 3300049582 Ga0501048_0031213 Ga0501048_0031213_214_534 94
50 3300049584 Ga0501068_0782239 Ga0501068_0782239_74_394 94
51 3300049588 Ga0501072_0278892 Ga0501072_0278892_279_599 94
52 3300049590 Ga0501074_0049922 Ga0501074_0049922_2330_2650 94
53 3300049742 Ga0501080_1364881 Ga0501080_1364881_246_566 94
54 3300049744 Ga0501083_0018057 Ga0501083_0018057_1778_2098 94
55 3300049823 Ga0501044_0195408 Ga0501044_0195408_944_1264 94
56 3300049824 Ga0501045_0739732 Ga0501045_0739732_209_529 94
57 3300005329 Ga0070683_100283868 Ga0070683_1002838682 95
58 3300005330 Ga0070690_100263307 Ga0070690_1002633072 95
59 3300005335 Ga0070666_10549870 Ga0070666_105498701 95
60 3300005336 Ga0070680_101526567 Ga0070680_1015265672 95
61 3300005338 Ga0068868_102240447 Ga0068868_1022404471 95
62 3300005344 Ga0070661_101318685 Ga0070661_1013186852 95
63 3300005345 Ga0070692_10221517 Ga0070692_102215172 95
64 3300005347 Ga0070668_100066366 Ga0070668_1000663662 95
65 3300005353 Ga0070669_100023184 Ga0070669_1000231842 95
66 3300005355 Ga0070671_101335601 Ga0070671_1013356012 95
67 3300005356 Ga0070674_100125476 Ga0070674_1001254761 95
68 3300005364 Ga0070673_101604621 Ga0070673_1016046212 95
69 3300005434 Ga0070709_10258210 Ga0070709_102582102 95
70 3300005438 Ga0070701_10045623 Ga0070701_100456232 95
71 3300005456 Ga0070678_101079437 Ga0070678_1010794371 95
72 3300005457 Ga0070662_100092319 Ga0070662_1000923193 95
73 3300005458 Ga0070681_10065223 Ga0070681_100652232 95
74 3300005536 Ga0070697_101664463 Ga0070697_1016644631 95
75 3300005548 Ga0070665_100004733 Ga0070665_10000473324 95
76 3300005577 Ga0068857_101410487 Ga0068857_1014104872 95
77 3300005615 Ga0070702_100195821 Ga0070702_1001958212 95
78 3300005617 Ga0068859_102388070 Ga0068859_1023880702 95
79 3300005719 Ga0068861_100039337 Ga0068861_1000393373 95
80 3300005719 Ga0068861_101070073 Ga0068861_1010700732 95
81 3300005842 Ga0068858_100008638 Ga0068858_1000086381 95
82 3300005843 Ga0068860_100424288 Ga0068860_1004242883 95
83 3300006237 Ga0097621_100470680 Ga0097621_1004706802 95
84 3300006881 Ga0068865_100766952 Ga0068865_1007669522 95
85 3300006931 Ga0097620_102388317 Ga0097620_1023883172 95
86 3300009093 Ga0105240_11651665 Ga0105240_116516651 95
87 3300009093 Ga0105240_11799806 Ga0105240_117998061 95
88 3300009098 Ga0105245_10497484 Ga0105245_104974841 95
89 3300009101 Ga0105247_10281324 Ga0105247_102813241 95
90 3300009148 Ga0105243_10723157 Ga0105243_107231572 95
91 3300009174 Ga0105241_10253151 Ga0105241_102531512 95
92 3300009174 Ga0105241_12256884 Ga0105241_122568841 95
93 3300009553 Ga0105249_10563998 Ga0105249_105639981 95
94 3300009553 Ga0105249_11620512 Ga0105249_116205122 95
95 3300010375 Ga0105239_11007720 Ga0105239_110077202 95
96 3300011119 Ga0105246_12038190 Ga0105246_120381901 95
97 3300013104 Ga0157370_11146369 Ga0157370_111463691 95
98 3300013296 Ga0157374_10443118 Ga0157374_104431182 95
99 3300013306 Ga0163162_10069444 Ga0163162_100694445 95
100 3300013306 Ga0163162_11337826 Ga0163162_113378262 95
101 3300013308 Ga0157375_11278336 Ga0157375_112783362 95
102 3300014326 Ga0157380_10116123 Ga0157380_101161233 95
103 3300014969 Ga0157376_10164129 Ga0157376_101641292 95
104 3300025907 Ga0207645_11085791 Ga0207645_110857911 95
105 3300025912 Ga0207707_10065987 Ga0207707_100659873 95
106 3300025934 Ga0207686_11015734 Ga0207686_110157341 95
107 3300025935 Ga0207709_10664809 Ga0207709_106648092 95
108 3300025937 Ga0207669_10009893 Ga0207669_100098939 95
109 3300025938 Ga0207704_10174646 Ga0207704_101746462 95
110 3300025941 Ga0207711_10418506 Ga0207711_104185062 95
111 3300026041 Ga0207639_11412385 Ga0207639_114123852 95
112 3300026089 Ga0207648_10129854 Ga0207648_101298543 95
113 3300042436 Ga0439435_0206099 Ga0439435_0206099_268_615 95
114 3300046559 Ga0495667_0526525 Ga0495667_0526525_45_377 95
115 3300004803 Ga0058862_12254497 Ga0058862_122544972 96
116 3300005289 Ga0065704_10056506 Ga0065704_100565062 96
117 3300005295 Ga0065707_10428556 Ga0065707_104285562 96
118 3300005329 Ga0070683_100222088 Ga0070683_1002220882 96
119 3300005334 Ga0068869_100137668 Ga0068869_1001376682 96
120 3300005335 Ga0070666_10280388 Ga0070666_102803883 96
121 3300005336 Ga0070680_100220627 Ga0070680_1002206272 96
122 3300005340 Ga0070689_102225580 Ga0070689_1022255801 96
123 3300005341 Ga0070691_10002062 Ga0070691_100020628 96
124 3300005341 Ga0070691_10209094 Ga0070691_102090943 96
125 3300005345 Ga0070692_10232948 Ga0070692_102329482 96
126 3300005347 Ga0070668_100428978 Ga0070668_1004289783 96
127 3300005347 Ga0070668_101134675 Ga0070668_1011346752 96
128 3300005353 Ga0070669_100021577 Ga0070669_1000215773 96
129 3300005353 Ga0070669_100049339 Ga0070669_1000493394 96
130 3300005353 Ga0070669_100122468 Ga0070669_1001224684 96
131 3300005355 Ga0070671_101448647 Ga0070671_1014486472 96
132 3300005364 Ga0070673_100340219 Ga0070673_1003402192 96
133 3300005366 Ga0070659_100864427 Ga0070659_1008644272 96
134 3300005367 Ga0070667_100811910 Ga0070667_1008119102 96
135 3300005367 Ga0070667_101348383 Ga0070667_1013483831 96
136 3300005439 Ga0070711_101213651 Ga0070711_1012136512 96
137 3300005440 Ga0070705_100100040 Ga0070705_1001000402 96
138 3300005440 Ga0070705_100177513 Ga0070705_1001775132 96
139 3300005440 Ga0070705_100301143 Ga0070705_1003011432 96
140 3300005440 Ga0070705_100955804 Ga0070705_1009558042 96
141 3300005441 Ga0070700_100007525 Ga0070700_1000075253 96
142 3300005444 Ga0070694_100046094 Ga0070694_1000460944 96
143 3300005444 Ga0070694_100308334 Ga0070694_1003083343 96
144 3300005444 Ga0070694_100958433 Ga0070694_1009584331 96
145 3300005445 Ga0070708_100026666 Ga0070708_1000266664 96
146 3300005445 Ga0070708_100056686 Ga0070708_1000566867 96
147 3300005445 Ga0070708_100294516 Ga0070708_1002945162 96
148 3300005445 Ga0070708_100835308 Ga0070708_1008353082 96
149 3300005456 Ga0070678_100834445 Ga0070678_1008344452 96
150 3300005457 Ga0070662_100260871 Ga0070662_1002608712 96
151 3300005457 Ga0070662_100540528 Ga0070662_1005405282 96
152 3300005458 Ga0070681_10758920 Ga0070681_107589202 96
153 3300005459 Ga0068867_100045942 Ga0068867_1000459421 96
154 3300005459 Ga0068867_100178953 Ga0068867_1001789533 96
155 3300005459 Ga0068867_100223316 Ga0068867_1002233163 96
156 3300005459 Ga0068867_100705473 Ga0068867_1007054732 96
157 3300005467 Ga0070706_100001965 Ga0070706_10000196531 96
158 3300005467 Ga0070706_100042306 Ga0070706_1000423067 96
159 3300005467 Ga0070706_100816889 Ga0070706_1008168891 96
160 3300005468 Ga0070707_100008827 Ga0070707_10000882716 96
161 3300005471 Ga0070698_100002716 Ga0070698_1000027166 96
162 3300005518 Ga0070699_100009009 Ga0070699_10000900917 96
163 3300005518 Ga0070699_100010853 Ga0070699_10001085312 96
164 3300005536 Ga0070697_100035245 Ga0070697_1000352453 96
165 3300005536 Ga0070697_100218055 Ga0070697_1002180552 96
166 3300005536 Ga0070697_100268660 Ga0070697_1002686602 96
167 3300005536 Ga0070697_100574344 Ga0070697_1005743442 96
168 3300005544 Ga0070686_100687758 Ga0070686_1006877581 96
169 3300005544 Ga0070686_101414077 Ga0070686_1014140771 96
170 3300005545 Ga0070695_100014951 Ga0070695_1000149514 96
171 3300005545 Ga0070695_100088758 Ga0070695_1000887582 96
172 3300005545 Ga0070695_101400197 Ga0070695_1014001972 96
173 3300005546 Ga0070696_100086961 Ga0070696_1000869614 96
174 3300005546 Ga0070696_100955133 Ga0070696_1009551332 96
175 3300005546 Ga0070696_101491205 Ga0070696_1014912052 96
176 3300005547 Ga0070693_100390904 Ga0070693_1003909042 96
177 3300005547 Ga0070693_100486478 Ga0070693_1004864781 96
178 3300005549 Ga0070704_100016081 Ga0070704_1000160817 96
179 3300005549 Ga0070704_100094027 Ga0070704_1000940273 96
180 3300005549 Ga0070704_100116558 Ga0070704_1001165584 96
181 3300005549 Ga0070704_100207477 Ga0070704_1002074771 96
182 3300005549 Ga0070704_100240273 Ga0070704_1002402732 96
183 3300005549 Ga0070704_102142396 Ga0070704_1021423961 96
184 3300005564 Ga0070664_100428998 Ga0070664_1004289983 96
185 3300005578 Ga0068854_100810471 Ga0068854_1008104712 96
186 3300005617 Ga0068859_100064378 Ga0068859_1000643788 96
187 3300005718 Ga0068866_10025223 Ga0068866_100252233 96
188 3300005718 Ga0068866_11184926 Ga0068866_111849261 96
189 3300005719 Ga0068861_100014830 Ga0068861_1000148307 96
190 3300005719 Ga0068861_101564511 Ga0068861_1015645112 96
191 3300005719 Ga0068861_101973936 Ga0068861_1019739362 96
192 3300005840 Ga0068870_10146720 Ga0068870_101467202 96
193 3300005840 Ga0068870_10778808 Ga0068870_107788082 96
194 3300005841 Ga0068863_100097852 Ga0068863_1000978523 96
195 3300005841 Ga0068863_100184464 Ga0068863_1001844642 96
196 3300005844 Ga0068862_101281598 Ga0068862_1012815982 96
197 3300005844 Ga0068862_102497059 Ga0068862_1024970591 96
198 3300005937 Ga0081455_10753556 Ga0081455_107535562 96
199 3300005985 Ga0081539_10001809 Ga0081539_100018097 96
200 3300005985 Ga0081539_10367087 Ga0081539_103670871 96
201 3300006058 Ga0075432_10496902 Ga0075432_104969022 96
202 3300006844 Ga0075428_100003976 Ga0075428_1000039767 96
203 3300006844 Ga0075428_100041079 Ga0075428_1000410797 96
204 3300006844 Ga0075428_100052271 Ga0075428_1000522713 96
205 3300006844 Ga0075428_100068017 Ga0075428_1000680177 96
206 3300006846 Ga0075430_100000851 Ga0075430_10000085135 96
207 3300006846 Ga0075430_100004590 Ga0075430_10000459018 96
208 3300006846 Ga0075430_100037664 Ga0075430_1000376641 96
209 3300006846 Ga0075430_100045839 Ga0075430_1000458394 96
210 3300006846 Ga0075430_100226489 Ga0075430_1002264893 96
211 3300006847 Ga0075431_100000559 Ga0075431_10000055939 96
212 3300006847 Ga0075431_100004746 Ga0075431_10000474623 96
213 3300006847 Ga0075431_100011238 Ga0075431_10001123815 96
214 3300006847 Ga0075431_100028459 Ga0075431_10002845914 96
215 3300006847 Ga0075431_100038375 Ga0075431_1000383757 96
216 3300006847 Ga0075431_100079415 Ga0075431_1000794155 96
217 3300006847 Ga0075431_100179876 Ga0075431_1001798761 96
218 3300006847 Ga0075431_100599993 Ga0075431_1005999932 96
219 3300006847 Ga0075431_100633742 Ga0075431_1006337422 96
220 3300006852 Ga0075433_10120900 Ga0075433_101209002 96
221 3300006852 Ga0075433_10224184 Ga0075433_102241842 96
222 3300006852 Ga0075433_10370500 Ga0075433_103705003 96
223 3300006852 Ga0075433_10500166 Ga0075433_105001662 96
224 3300006852 Ga0075433_10846187 Ga0075433_108461872 96
225 3300006852 Ga0075433_11050999 Ga0075433_110509992 96
226 3300006852 Ga0075433_11118545 Ga0075433_111185452 96
227 3300006852 Ga0075433_11368630 Ga0075433_113686302 96
228 3300006871 Ga0075434_100037241 Ga0075434_1000372414 96
229 3300006871 Ga0075434_100039528 Ga0075434_1000395285 96
230 3300006871 Ga0075434_100089001 Ga0075434_1000890013 96
231 3300006871 Ga0075434_100113212 Ga0075434_1001132127 96
232 3300006871 Ga0075434_100203297 Ga0075434_1002032972 96
233 3300006871 Ga0075434_100287390 Ga0075434_1002873903 96
234 3300006871 Ga0075434_100292687 Ga0075434_1002926872 96
235 3300006871 Ga0075434_100299949 Ga0075434_1002999493 96
236 3300006871 Ga0075434_100471709 Ga0075434_1004717092 96
237 3300006871 Ga0075434_100974893 Ga0075434_1009748932 96
238 3300006871 Ga0075434_101458197 Ga0075434_1014581972 96
239 3300006871 Ga0075434_101463716 Ga0075434_1014637162 96
240 3300006880 Ga0075429_100000843 Ga0075429_1000008437 96
241 3300006880 Ga0075429_100032187 Ga0075429_1000321877 96
242 3300006880 Ga0075429_100057615 Ga0075429_1000576155 96
243 3300006880 Ga0075429_100144453 Ga0075429_1001444534 96
244 3300006880 Ga0075429_100146367 Ga0075429_1001463675 96
245 3300006881 Ga0068865_100006729 Ga0068865_1000067292 96
246 3300006881 Ga0068865_100411019 Ga0068865_1004110192 96
247 3300006881 Ga0068865_101121383 Ga0068865_1011213831 96
248 3300006914 Ga0075436_100111308 Ga0075436_1001113083 96
249 3300006914 Ga0075436_100133842 Ga0075436_1001338422 96
250 3300006914 Ga0075436_100198493 Ga0075436_1001984932 96
251 3300006914 Ga0075436_100286757 Ga0075436_1002867573 96
252 3300006914 Ga0075436_100533205 Ga0075436_1005332052 96
253 3300006914 Ga0075436_101340573 Ga0075436_1013405731 96
254 3300006931 Ga0097620_100064378 Ga0097620_1000643788 96
255 3300007076 Ga0075435_100001694 Ga0075435_1000016946 96
256 3300007076 Ga0075435_100014113 Ga0075435_1000141137 96
257 3300007076 Ga0075435_100059076 Ga0075435_1000590764 96
258 3300007076 Ga0075435_100067393 Ga0075435_1000673933 96
259 3300007076 Ga0075435_100095281 Ga0075435_1000952812 96
260 3300007076 Ga0075435_100124387 Ga0075435_1001243874 96
261 3300007076 Ga0075435_100200060 Ga0075435_1002000603 96
262 3300007076 Ga0075435_100364233 Ga0075435_1003642332 96
263 3300007076 Ga0075435_100539713 Ga0075435_1005397133 96
264 3300007076 Ga0075435_100869758 Ga0075435_1008697581 96
265 3300007265 Ga0099794_10043450 Ga0099794_100434504 96
266 3300007265 Ga0099794_10120762 Ga0099794_101207622 96
267 3300007265 Ga0099794_10365598 Ga0099794_103655981 96
268 3300009092 Ga0105250_10208141 Ga0105250_102081412 96
269 3300009094 Ga0111539_10000675 Ga0111539_100006757 96
270 3300009094 Ga0111539_10065945 Ga0111539_100659457 96
271 3300009094 Ga0111539_10125011 Ga0111539_101250113 96
272 3300009094 Ga0111539_12771457 Ga0111539_127714572 96
273 3300009098 Ga0105245_11981794 Ga0105245_119817942 96
274 3300009101 Ga0105247_10087814 Ga0105247_100878144 96
275 3300009101 Ga0105247_10333293 Ga0105247_103332932 96
276 3300009147 Ga0114129_10013876 Ga0114129_1001387618 96
277 3300009147 Ga0114129_10022212 Ga0114129_100222127 96
278 3300009147 Ga0114129_10033145 Ga0114129_1003314511 96
279 3300009147 Ga0114129_10036838 Ga0114129_1003683815 96
280 3300009147 Ga0114129_10052918 Ga0114129_100529187 96
281 3300009147 Ga0114129_10065603 Ga0114129_1006560312 96
282 3300009147 Ga0114129_10078309 Ga0114129_100783097 96
283 3300009147 Ga0114129_10125293 Ga0114129_101252932 96
284 3300009147 Ga0114129_10334100 Ga0114129_103341002 96
285 3300009147 Ga0114129_10772632 Ga0114129_107726322 96
286 3300009147 Ga0114129_11213939 Ga0114129_112139391 96
287 3300009147 Ga0114129_11231848 Ga0114129_112318481 96
288 3300009147 Ga0114129_11811059 Ga0114129_118110592 96
289 3300009147 Ga0114129_13379342 Ga0114129_133793421 96
290 3300009174 Ga0105241_10146349 Ga0105241_101463492 96
291 3300009176 Ga0105242_10993609 Ga0105242_109936092 96
292 3300009176 Ga0105242_11360086 Ga0105242_113600862 96
293 3300009553 Ga0105249_10178723 Ga0105249_101787232 96
294 3300009553 Ga0105249_10780936 Ga0105249_107809362 96
295 3300009553 Ga0105249_13128416 Ga0105249_131284161 96
296 3300009553 Ga0105249_13141829 Ga0105249_131418291 96
297 3300010375 Ga0105239_10846450 Ga0105239_108464502 96
298 3300013297 Ga0157378_10145077 Ga0157378_101450772 96
299 3300013297 Ga0157378_12893552 Ga0157378_128935522 96
300 3300013306 Ga0163162_10017924 Ga0163162_100179245 96
301 3300014325 Ga0163163_12571764 Ga0163163_125717641 96
302 3300014326 Ga0157380_10150317 Ga0157380_101503172 96
303 3300014326 Ga0157380_10591588 Ga0157380_105915882 96
304 3300014968 Ga0157379_11645156 Ga0157379_116451561 96
305 3300017792 Ga0163161_10378849 Ga0163161_103788492 96
306 3300025907 Ga0207645_10173020 Ga0207645_101730202 96
307 3300025908 Ga0207643_10188151 Ga0207643_101881513 96
308 3300025908 Ga0207643_10559346 Ga0207643_105593462 96
309 3300025910 Ga0207684_10000456 Ga0207684_100004567 96
310 3300025910 Ga0207684_10032897 Ga0207684_100328973 96
311 3300025910 Ga0207684_10773599 Ga0207684_107735992 96
312 3300025911 Ga0207654_10096575 Ga0207654_100965754 96
313 3300025911 Ga0207654_10109396 Ga0207654_101093962 96
314 3300025912 Ga0207707_11057600 Ga0207707_110576002 96
315 3300025917 Ga0207660_10007743 Ga0207660_1000774315 96
316 3300025917 Ga0207660_10359488 Ga0207660_103594882 96
317 3300025918 Ga0207662_10077900 Ga0207662_100779002 96
318 3300025921 Ga0207652_10387727 Ga0207652_103877272 96
319 3300025922 Ga0207646_10006057 Ga0207646_100060577 96
320 3300025923 Ga0207681_10032040 Ga0207681_100320404 96
321 3300025923 Ga0207681_10043484 Ga0207681_100434844 96
322 3300025923 Ga0207681_10197103 Ga0207681_101971033 96
323 3300025926 Ga0207659_10814445 Ga0207659_108144451 96
324 3300025927 Ga0207687_10957950 Ga0207687_109579502 96
325 3300025932 Ga0207690_10772675 Ga0207690_107726752 96
326 3300025933 Ga0207706_10057499 Ga0207706_100574992 96
327 3300025933 Ga0207706_10127122 Ga0207706_101271223 96
328 3300025935 Ga0207709_10150410 Ga0207709_101504102 96
329 3300025937 Ga0207669_10070993 Ga0207669_100709933 96
330 3300025937 Ga0207669_10088983 Ga0207669_100889833 96
331 3300025938 Ga0207704_10216720 Ga0207704_102167202 96
332 3300025938 Ga0207704_10670876 Ga0207704_106708761 96
333 3300025942 Ga0207689_11211116 Ga0207689_112111161 96
334 3300025960 Ga0207651_10238268 Ga0207651_102382683 96
335 3300025961 Ga0207712_10227141 Ga0207712_102271413 96
336 3300026075 Ga0207708_10024133 Ga0207708_100241333 96
337 3300026088 Ga0207641_10034453 Ga0207641_100344535 96
338 3300026089 Ga0207648_10060929 Ga0207648_100609296 96
339 3300026118 Ga0207675_100022779 Ga0207675_1000227793 96
340 3300026118 Ga0207675_100129766 Ga0207675_1001297662 96
341 3300026118 Ga0207675_100658556 Ga0207675_1006585562 96
342 3300026118 Ga0207675_100804005 Ga0207675_1008040052 96
343 3300027252 Ga0209973_1070917 Ga0209973_10709171 96
344 3300027665 Ga0209983_1069098 Ga0209983_10690982 96
345 3300027671 Ga0209588_1068174 Ga0209588_10681742 96
346 3300027907 Ga0207428_10009686 Ga0207428_100096862 96
347 3300027907 Ga0207428_10055654 Ga0207428_100556544 96
348 3300027907 Ga0207428_10077225 Ga0207428_100772254 96
349 3300028380 Ga0268265_10009567 Ga0268265_100095677 96
350 3300028380 Ga0268265_10291710 Ga0268265_102917102 96
351 3300031548 Ga0307408_100128636 Ga0307408_1001286361 96
352 3300031548 Ga0307408_100300990 Ga0307408_1003009903 96
353 3300031548 Ga0307408_100315007 Ga0307408_1003150072 96
354 3300031548 Ga0307408_100360495 Ga0307408_1003604953 96
355 3300031731 Ga0307405_10518890 Ga0307405_105188902 96
356 3300031731 Ga0307405_11082264 Ga0307405_110822642 96
357 3300031824 Ga0307413_11168206 Ga0307413_111682061 96
358 3300031901 Ga0307406_10032354 Ga0307406_100323542 96
359 3300031903 Ga0307407_11227243 Ga0307407_112272432 96
360 3300031911 Ga0307412_10277063 Ga0307412_102770632 96
361 3300031911 Ga0307412_10737472 Ga0307412_107374722 96
362 3300031995 Ga0307409_100867898 Ga0307409_1008678982 96
363 3300031995 Ga0307409_100967154 Ga0307409_1009671542 96
364 3300031995 Ga0307409_102703589 Ga0307409_1027035892 96
365 3300032002 Ga0307416_100069478 Ga0307416_1000694781 96
366 3300032002 Ga0307416_101553644 Ga0307416_1015536442 96
367 3300032004 Ga0307414_10203566 Ga0307414_102035663 96
368 3300032005 Ga0307411_10011154 Ga0307411_1001115412 96
369 3300032005 Ga0307411_10975335 Ga0307411_109753352 96
370 3300032005 Ga0307411_11728989 Ga0307411_117289891 96
371 3300032126 Ga0307415_101096615 Ga0307415_1010966151 96
372 3300034817 Ga0373948_0026171 Ga0373948_0026171_771_1064 96
373 3300034820 Ga0373959_0019147 Ga0373959_0019147_47_340 96
374 3300035085 Ga0373929_0186064 Ga0373929_0186064_108_401 96
375 3300035088 Ga0373940_0114535 Ga0373940_0114535_156_449 96
376 3300035090 Ga0373949_0039153 Ga0373949_0039153_583_876 96
377 3300035090 Ga0373949_0050917 Ga0373949_0050917_221_514 96
378 3300035090 Ga0373949_0156641 Ga0373949_0156641_255_548 96
379 3300035112 Ga0373932_0192600 Ga0373932_0192600_116_409 96
380 3300035114 Ga0373939_0107338 Ga0373939_0107338_602_895 96
381 3300035114 Ga0373939_0368385 Ga0373939_0368385_144_437 96
382 3300035207 Ga0373942_0216206 Ga0373942_0216206_194_487 96
383 3300035241 Ga0373961_0306054 Ga0373961_0306054_79_372 96
384 3300035691 Ga0373931_0002096 Ga0373931_0002096_2554_2847 96
385 3300035691 Ga0373931_0269723 Ga0373931_0269723_415_708 96
386 3300035691 Ga0373931_0867625 Ga0373931_0867625_16_309 96
387 3300036401 Ga0373937_2036599 Ga0373937_2036599_169_474 96
388 3300037418 Ga0395900_0534850 Ga0395900_0534850_418_711 96
389 3300038443 Ga0395901_0226862 Ga0395901_0226862_348_641 96
390 3300038996 Ga0242420_011734 Ga0242420_011734_919_1212 96
391 3300042116 Ga0450912_004737 Ga0450912_004737_446_769 96
392 3300042436 Ga0439435_0100211 Ga0439435_0100211_368_661 96
393 3300042436 Ga0439435_0310367 Ga0439435_0310367_190_483 96
394 3300042461 Ga0439460_0100071 Ga0439460_0100071_459_752 96
395 3300042876 Ga0451577_0205501 Ga0451577_0205501_738_1031 96
396 3300044712 Ga0453684_0256633 Ga0453684_0256633_1340_1633 96
397 3300045051 Ga0451576_0278101 Ga0451576_0278101_1255_1548 96
398 3300045051 Ga0451576_0561226 Ga0451576_0561226_363_656 96
399 3300046455 Ga0495603_0312576 Ga0495603_0312576_538_831 96
400 3300046472 Ga0495580_0000020 Ga0495580_0000020_88124_88417 96
401 3300046528 Ga0495642_0009559 Ga0495642_0009559_2248_2541 96
402 3300046528 Ga0495642_0202337 Ga0495642_0202337_562_855 96
403 3300046537 Ga0495598_0084538 Ga0495598_0084538_511_804 96
404 3300046615 Ga0495656_0163586 Ga0495656_0163586_771_1064 96
405 3300046664 Ga0495659_0041994 Ga0495659_0041994_737_1030 96
406 3300046664 Ga0495659_0145914 Ga0495659_0145914_31_324 96
407 3300046664 Ga0495659_0221049 Ga0495659_0221049_61_354 96
408 3300046684 Ga0495669_0020738 Ga0495669_0020738_540_833 96
409 3300046691 Ga0495670_0092012 Ga0495670_0092012_917_1210 96
410 3300047318 Ga0495636_0060520 Ga0495636_0060520_620_913 96
411 3300048905 Ga0496102_0047759 Ga0496102_0047759_2624_2917 96
412 3300048905 Ga0496102_0268575 Ga0496102_0268575_790_1083 96
413 3300048909 Ga0496106_0410272 Ga0496106_0410272_81_431 96
414 3300048909 Ga0496106_0560420 Ga0496106_0560420_149_442 96
415 3300048909 Ga0496106_0685352 Ga0496106_0685352_317_610 96
416 3300048910 Ga0496107_0210509 Ga0496107_0210509_341_634 96
417 3300048910 Ga0496107_0608545 Ga0496107_0608545_244_537 96
418 3300048912 Ga0496109_0283991 Ga0496109_0283991_1211_1504 96
419 3300049129 Ga0501309_033728 Ga0501309_033728_21_314 96
420 3300049521 Ga0501298_069749 Ga0501298_069749_298_591 96
421 3300049522 Ga0501299_012854 Ga0501299_012854_1045_1338 96
422 3300049525 Ga0501302_016186 Ga0501302_016186_33_326 96
423 3300049528 Ga0501312_100006 Ga0501312_100006_192_485 96
424 3300049568 Ga0501031_0254315 Ga0501031_0254315_484_777 96
425 3300049572 Ga0501036_0070188 Ga0501036_0070188_2543_2836 96
426 3300049572 Ga0501036_0307850 Ga0501036_0307850_323_616 96
427 3300049573 Ga0501037_0540096 Ga0501037_0540096_162_455 96
428 3300049574 Ga0501038_0073380 Ga0501038_0073380_203_496 96
429 3300049574 Ga0501038_0474785 Ga0501038_0474785_304_597 96
430 3300049574 Ga0501038_0681183 Ga0501038_0681183_197_490 96
431 3300049574 Ga0501038_1154180 Ga0501038_1154180_185_478 96
432 3300049574 Ga0501038_1179308 Ga0501038_1179308_43_336 96
433 3300049575 Ga0501039_0256958 Ga0501039_0256958_781_1074 96
434 3300049575 Ga0501039_0257176 Ga0501039_0257176_169_462 96
435 3300049575 Ga0501039_0402209 Ga0501039_0402209_80_373 96
436 3300049575 Ga0501039_0500394 Ga0501039_0500394_415_708 96
437 3300049575 Ga0501039_1536235 Ga0501039_1536235_76_369 96
438 3300049576 Ga0501040_0224705 Ga0501040_0224705_553_846 96
439 3300049576 Ga0501040_0470201 Ga0501040_0470201_478_771 96
440 3300049576 Ga0501040_0515052 Ga0501040_0515052_236_529 96
441 3300049576 Ga0501040_0695258 Ga0501040_0695258_157_450 96
442 3300049576 Ga0501040_0715140 Ga0501040_0715140_51_344 96
443 3300049577 Ga0501041_0027203 Ga0501041_0027203_518_811 96
444 3300049577 Ga0501041_0479686 Ga0501041_0479686_337_630 96
445 3300049578 Ga0501042_0047787 Ga0501042_0047787_405_698 96
446 3300049578 Ga0501042_0115555 Ga0501042_0115555_1200_1493 96
447 3300049578 Ga0501042_0329784 Ga0501042_0329784_429_722 96
448 3300049578 Ga0501042_0335219 Ga0501042_0335219_547_840 96
449 3300049579 Ga0501043_1125303 Ga0501043_1125303_45_338 96
450 3300049579 Ga0501043_1313962 Ga0501043_1313962_128_421 96
451 3300049580 Ga0501046_0122797 Ga0501046_0122797_648_941 96
452 3300049580 Ga0501046_0261729 Ga0501046_0261729_175_468 96
453 3300049580 Ga0501046_0483405 Ga0501046_0483405_530_823 96
454 3300049581 Ga0501047_0809142 Ga0501047_0809142_137_430 96
455 3300049582 Ga0501048_0128505 Ga0501048_0128505_1125_1418 96
456 3300049582 Ga0501048_0170574 Ga0501048_0170574_376_669 96
457 3300049582 Ga0501048_1222170 Ga0501048_1222170_24_317 96
458 3300049583 Ga0501067_0019308 Ga0501067_0019308_3262_3555 96
459 3300049584 Ga0501068_0029501 Ga0501068_0029501_2215_2508 96
460 3300049584 Ga0501068_0069671 Ga0501068_0069671_1097_1390 96
461 3300049584 Ga0501068_0203545 Ga0501068_0203545_872_1165 96
462 3300049584 Ga0501068_0219807 Ga0501068_0219807_360_653 96
463 3300049584 Ga0501068_0476435 Ga0501068_0476435_396_689 96
464 3300049585 Ga0501069_0021172 Ga0501069_0021172_2489_2782 96
465 3300049585 Ga0501069_0834116 Ga0501069_0834116_186_479 96
466 3300049585 Ga0501069_0923377 Ga0501069_0923377_81_374 96
467 3300049587 Ga0501071_0197980 Ga0501071_0197980_180_473 96
468 3300049587 Ga0501071_0599153 Ga0501071_0599153_167_460 96
469 3300049587 Ga0501071_0677607 Ga0501071_0677607_17_310 96
470 3300049588 Ga0501072_0014068 Ga0501072_0014068_4105_4398 96
471 3300049588 Ga0501072_0072312 Ga0501072_0072312_1824_2117 96
472 3300049588 Ga0501072_0192588 Ga0501072_0192588_206_499 96
473 3300049588 Ga0501072_0208710 Ga0501072_0208710_882_1175 96
474 3300049588 Ga0501072_0218665 Ga0501072_0218665_30_323 96
475 3300049589 Ga0501073_0678060 Ga0501073_0678060_108_401 96
476 3300049590 Ga0501074_0323643 Ga0501074_0323643_282_575 96
477 3300049590 Ga0501074_0610793 Ga0501074_0610793_296_589 96
478 3300049590 Ga0501074_0788219 Ga0501074_0788219_132_425 96
479 3300049591 Ga0501075_0008499 Ga0501075_0008499_2857_3150 96
480 3300049591 Ga0501075_0031327 Ga0501075_0031327_3026_3319 96
481 3300049591 Ga0501075_0050755 Ga0501075_0050755_2761_3054 96
482 3300049591 Ga0501075_0210467 Ga0501075_0210467_217_510 96
483 3300049591 Ga0501075_0266503 Ga0501075_0266503_334_627 96
484 3300049591 Ga0501075_0324356 Ga0501075_0324356_571_864 96
485 3300049591 Ga0501075_0635155 Ga0501075_0635155_428_721 96
486 3300049592 Ga0501076_0030185 Ga0501076_0030185_596_889 96
487 3300049592 Ga0501076_0044508 Ga0501076_0044508_2561_2854 96
488 3300049592 Ga0501076_0054495 Ga0501076_0054495_581_874 96
489 3300049592 Ga0501076_0108804 Ga0501076_0108804_1504_1797 96
490 3300049592 Ga0501076_0147246 Ga0501076_0147246_533_826 96
491 3300049592 Ga0501076_0207451 Ga0501076_0207451_410_703 96
492 3300049592 Ga0501076_0442426 Ga0501076_0442426_737_1030 96
493 3300049592 Ga0501076_0604756 Ga0501076_0604756_258_551 96
494 3300049592 Ga0501076_0726136 Ga0501076_0726136_273_566 96
495 3300049593 Ga0501077_0002533 Ga0501077_0002533_3944_4237 96
496 3300049593 Ga0501077_0004004 Ga0501077_0004004_5638_5931 96
497 3300049593 Ga0501077_0145854 Ga0501077_0145854_555_848 96
498 3300049593 Ga0501077_0204507 Ga0501077_0204507_750_1043 96
499 3300049593 Ga0501077_0281283 Ga0501077_0281283_469_762 96
500 3300049741 Ga0501079_0012904 Ga0501079_0012904_3158_3451 96
501 3300049741 Ga0501079_0065568 Ga0501079_0065568_1607_1900 96
502 3300049741 Ga0501079_0079995 Ga0501079_0079995_2106_2399 96
503 3300049741 Ga0501079_0081872 Ga0501079_0081872_1734_2027 96
504 3300049741 Ga0501079_0353864 Ga0501079_0353864_60_353 96
505 3300049741 Ga0501079_0673534 Ga0501079_0673534_43_336 96
506 3300049741 Ga0501079_0909685 Ga0501079_0909685_162_455 96
507 3300049742 Ga0501080_1072019 Ga0501080_1072019_76_369 96
508 3300049742 Ga0501080_1105096 Ga0501080_1105096_262_555 96
509 3300049742 Ga0501080_1443530 Ga0501080_1443530_201_494 96
510 3300049743 Ga0501081_0035649 Ga0501081_0035649_521_814 96
511 3300049743 Ga0501081_0116426 Ga0501081_0116426_567_860 96
512 3300049743 Ga0501081_0217630 Ga0501081_0217630_836_1129 96
513 3300049743 Ga0501081_0381196 Ga0501081_0381196_22_315 96
514 3300049743 Ga0501081_0470584 Ga0501081_0470584_512_805 96
515 3300049743 Ga0501081_0676940 Ga0501081_0676940_334_627 96
516 3300049743 Ga0501081_1255954 Ga0501081_1255954_147_440 96
517 3300049744 Ga0501083_0306390 Ga0501083_0306390_282_575 96
518 3300049823 Ga0501044_1067231 Ga0501044_1067231_351_644 96
519 3300049824 Ga0501045_0045065 Ga0501045_0045065_2636_2929 96
520 3300049824 Ga0501045_0111316 Ga0501045_0111316_291_584 96
521 3300049824 Ga0501045_0162253 Ga0501045_0162253_699_992 96
522 3300049824 Ga0501045_0189069 Ga0501045_0189069_1097_1390 96
523 3300050507 nmdc:mga05p37_14246_c1 nmdc:mga05p37_14246_c1_3008_3301 96
524 3300050507 nmdc:mga05p37_1531273_c1 nmdc:mga05p37_1531273_c1_354_647 96
525 3300050507 nmdc:mga05p37_2249_c1 nmdc:mga05p37_2249_c1_4510_4902 96
526 3300050507 nmdc:mga05p37_2645_c1 nmdc:mga05p37_2645_c1_2048_2341 96
527 3300050507 nmdc:mga05p37_34567_c1 nmdc:mga05p37_34567_c1_5588_5881 96
528 3300050507 nmdc:mga05p37_35074_c1 nmdc:mga05p37_35074_c1_3030_3323 96
529 3300050507 nmdc:mga05p37_43564_c1 nmdc:mga05p37_43564_c1_2891_3184 96
530 3300050507 nmdc:mga05p37_43602_c1 nmdc:mga05p37_43602_c1_2024_2317 96
531 3300050507 nmdc:mga05p37_47839_c1 nmdc:mga05p37_47839_c1_3275_3568 96
532 3300050507 nmdc:mga05p37_551938_c1 nmdc:mga05p37_551938_c1_399_692 96
533 3300050507 nmdc:mga05p37_602880_c1 nmdc:mga05p37_602880_c1_28_321 96
534 3300050507 nmdc:mga05p37_66375_c1 nmdc:mga05p37_66375_c1_2622_2915 96
535 3300050507 nmdc:mga05p37_805015_c1 nmdc:mga05p37_805015_c1_631_924 96
536 3300050507 nmdc:mga05p37_83387_c1 nmdc:mga05p37_83387_c1_2766_3059 96
537 3300050507 nmdc:mga05p37_90559_c1 nmdc:mga05p37_90559_c1_902_1195 96
538 3300050508 nmdc:mga09592_1037801_c1 nmdc:mga09592_1037801_c1_372_665 96
539 3300050508 nmdc:mga09592_105805_c1 nmdc:mga09592_105805_c1_531_824 96
540 3300050508 nmdc:mga09592_127446_c1 nmdc:mga09592_127446_c1_864_1157 96
541 3300050508 nmdc:mga09592_13087_c1 nmdc:mga09592_13087_c1_200_493 96
542 3300050508 nmdc:mga09592_44935_c1 nmdc:mga09592_44935_c1_1543_1836 96
543 3300050508 nmdc:mga09592_68878_c1 nmdc:mga09592_68878_c1_1941_2234 96
544 3300050509 nmdc:mga0qj67_1264138_c1 nmdc:mga0qj67_1264138_c1_197_490 96
545 3300050509 nmdc:mga0qj67_19800_c1 nmdc:mga0qj67_19800_c1_1982_2275 96
546 3300050509 nmdc:mga0qj67_2619_c1 nmdc:mga0qj67_2619_c1_3059_3352 96
547 3300050509 nmdc:mga0qj67_389091_c1 nmdc:mga0qj67_389091_c1_597_890 96
548 3300050509 nmdc:mga0qj67_5121_c1 nmdc:mga0qj67_5121_c1_679_972 96
549 3300050509 nmdc:mga0qj67_652_c1 nmdc:mga0qj67_652_c1_2970_3263 96
550 3300050510 nmdc:mga06r32_10547_c1 nmdc:mga06r32_10547_c1_3176_3469 96
551 3300050510 nmdc:mga06r32_133332_c1 nmdc:mga06r32_133332_c1_2150_2443 96
552 3300050510 nmdc:mga06r32_18264_c1 nmdc:mga06r32_18264_c1_2449_2742 96
553 3300050510 nmdc:mga06r32_21776_c1 nmdc:mga06r32_21776_c1_133_426 96
554 3300050510 nmdc:mga06r32_364376_c1 nmdc:mga06r32_364376_c1_902_1195 96
555 3300050510 nmdc:mga06r32_43766_c1 nmdc:mga06r32_43766_c1_3329_3622 96
556 3300050510 nmdc:mga06r32_61409_c1 nmdc:mga06r32_61409_c1_1409_1702 96
557 3300050510 nmdc:mga06r32_777101_c1 nmdc:mga06r32_777101_c1_19_312 96
558 3300050511 nmdc:mga08y16_145726_c1 nmdc:mga08y16_145726_c1_1597_1968 96
559 3300050511 nmdc:mga08y16_1481107_c1 nmdc:mga08y16_1481107_c1_124_417 96
560 3300050511 nmdc:mga08y16_1921394_c1 nmdc:mga08y16_1921394_c1_26_319 96
561 3300050511 nmdc:mga08y16_61777_c1 nmdc:mga08y16_61777_c1_858_1151 96
562 3300050511 nmdc:mga08y16_64772_c1 nmdc:mga08y16_64772_c1_468_761 96
563 3300050512 nmdc:mga0n895_135551_c1 nmdc:mga0n895_135551_c1_1637_2002 96
564 3300050512 nmdc:mga0n895_14_c1 nmdc:mga0n895_14_c1_991_1353 96
565 3300050512 nmdc:mga0n895_23374_c1 nmdc:mga0n895_23374_c1_2379_2672 96
566 3300050512 nmdc:mga0n895_23375_c1 nmdc:mga0n895_23375_c1_2662_3033 96
567 3300050512 nmdc:mga0n895_253923_c1 nmdc:mga0n895_253923_c1_1080_1373 96
568 3300050512 nmdc:mga0n895_352041_c1 nmdc:mga0n895_352041_c1_679_972 96
569 3300050512 nmdc:mga0n895_376592_c1 nmdc:mga0n895_376592_c1_601_894 96
570 3300050512 nmdc:mga0n895_525033_c1 nmdc:mga0n895_525033_c1_221_514 96
571 3300050512 nmdc:mga0n895_680737_c1 nmdc:mga0n895_680737_c1_230_523 96
572 3300050512 nmdc:mga0n895_708214_c1 nmdc:mga0n895_708214_c1_227_520 96
573 3300050512 nmdc:mga0n895_880544_c1 nmdc:mga0n895_880544_c1_518_811 96
574 3300050512 nmdc:mga0n895_98_c1 nmdc:mga0n895_98_c1_945_1238 96
575 3300050513 nmdc:mga0rr50_1329284_c1 nmdc:mga0rr50_1329284_c1_200_493 96
576 3300050513 nmdc:mga0rr50_133022_c1 nmdc:mga0rr50_133022_c1_419_784 96
577 3300050513 nmdc:mga0rr50_1773_c1 nmdc:mga0rr50_1773_c1_4879_5241 96
578 3300050513 nmdc:mga0rr50_229957_c1 nmdc:mga0rr50_229957_c1_834_1127 96
579 3300050513 nmdc:mga0rr50_402224_c1 nmdc:mga0rr50_402224_c1_512_805 96
580 3300050513 nmdc:mga0rr50_8258_c1 nmdc:mga0rr50_8258_c1_5101_5472 96
581 3300050513 nmdc:mga0rr50_826004_c1 nmdc:mga0rr50_826004_c1_365_658 96
582 3300050513 nmdc:mga0rr50_88324_c1 nmdc:mga0rr50_88324_c1_1680_1973 96
583 3300050513 nmdc:mga0rr50_8956_c1 nmdc:mga0rr50_8956_c1_3017_3310 96
584 3300050514 nmdc:mga08x19_18471_c1 nmdc:mga08x19_18471_c1_817_1110 96
585 3300050514 nmdc:mga08x19_300889_c1 nmdc:mga08x19_300889_c1_66_359 96
586 3300050514 nmdc:mga08x19_34661_c1 nmdc:mga08x19_34661_c1_1616_1981 96
587 3300050514 nmdc:mga08x19_489434_c1 nmdc:mga08x19_489434_c1_382_675 96
588 3300050514 nmdc:mga08x19_495247_c1 nmdc:mga08x19_495247_c1_133_426 96
589 3300050514 nmdc:mga08x19_506405_c1 nmdc:mga08x19_506405_c1_505_798 96
590 3300050514 nmdc:mga08x19_694049_c1 nmdc:mga08x19_694049_c1_34_330 96
591 3300050514 nmdc:mga08x19_83620_c1 nmdc:mga08x19_83620_c1_985_1347 96
592 3300050515 nmdc:mga0a205_115193_c1 nmdc:mga0a205_115193_c1_1497_1790 96
593 3300050515 nmdc:mga0a205_225843_c1 nmdc:mga0a205_225843_c1_1199_1492 96
594 3300050515 nmdc:mga0a205_294327_c1 nmdc:mga0a205_294327_c1_317_709 96
595 3300050515 nmdc:mga0a205_354488_c1 nmdc:mga0a205_354488_c1_560_853 96
596 3300050515 nmdc:mga0a205_52793_c1 nmdc:mga0a205_52793_c1_1880_2173 96
597 3300050515 nmdc:mga0a205_534956_c1 nmdc:mga0a205_534956_c1_593_886 96
598 3300050515 nmdc:mga0a205_59155_c1 nmdc:mga0a205_59155_c1_3017_3388 96
599 3300050515 nmdc:mga0a205_972588_c1 nmdc:mga0a205_972588_c1_207_500 96
600 3300054114 Ga0501084_0046060 Ga0501084_0046060_848_1141 96
601 3300054114 Ga0501084_0139906 Ga0501084_0139906_77_370 96
602 3300054114 Ga0501084_0178706 Ga0501084_0178706_548_841 96
603 3300054114 Ga0501084_0607380 Ga0501084_0607380_359_652 96
604 3300054114 Ga0501084_0651585 Ga0501084_0651585_158_451 96
605 3300054114 Ga0501084_0738545 Ga0501084_0738545_170_463 96
606 3300059421 Ga0590071_017298 Ga0590071_017298_39_332 96
607 3300059513 Ga0587094_103007 Ga0587094_103007_184_477 96
608 3300060353 Ga0501082_0056096 Ga0501082_0056096_1739_2032 96
609 3300060353 Ga0501082_0277963 Ga0501082_0277963_382_675 96
610 3300060353 Ga0501082_0485784 Ga0501082_0485784_221_514 96
611 3300060353 Ga0501082_0651176 Ga0501082_0651176_195_488 96
612 3300060353 Ga0501082_0907663 Ga0501082_0907663_197_490 96
613 3300061734 Ga0530510_0006450 Ga0530510_0006450_4846_5139 96
614 3300061734 Ga0530510_0026290 Ga0530510_0026290_2384_2677 96
615 3300061734 Ga0530510_0047756 Ga0530510_0047756_2254_2547 96
616 3300061734 Ga0530510_0068221 Ga0530510_0068221_150_443 96
617 3300061734 Ga0530510_0093023 Ga0530510_0093023_1753_2046 96
618 3300061734 Ga0530510_0100688 Ga0530510_0100688_1338_1631 96
619 3300061734 Ga0530510_0115637 Ga0530510_0115637_74_367 96
620 3300061734 Ga0530510_0412994 Ga0530510_0412994_546_839 96
621 3300061734 Ga0530510_0556282 Ga0530510_0556282_195_488 96
622 3300061734 Ga0530510_0582018 Ga0530510_0582018_442_735 96
623 3300061734 Ga0530510_0672997 Ga0530510_0672997_470_763 96
624 3300061734 Ga0530510_1168134 Ga0530510_1168134_32_325 96
625 3300005327 Ga0070658_10015417 Ga0070658_100154172 97
626 3300005336 Ga0070680_100078049 Ga0070680_1000780491 97
627 3300005339 Ga0070660_100002494 Ga0070660_10000249414 97
628 3300005356 Ga0070674_100095772 Ga0070674_1000957724 97
629 3300005530 Ga0070679_100021144 Ga0070679_1000211447 97
630 3300005563 Ga0068855_100037327 Ga0068855_1000373277 97
631 3300005617 Ga0068859_102193319 Ga0068859_1021933192 97
632 3300005618 Ga0068864_100709023 Ga0068864_1007090232 97
633 3300006048 Ga0075363_100000313 Ga0075363_10000031310 97
634 3300006051 Ga0075364_10876024 Ga0075364_108760241 97
635 3300006195 Ga0075366_10116081 Ga0075366_101160812 97
636 3300006353 Ga0075370_10000090 Ga0075370_1000009026 97
637 3300006931 Ga0097620_102193325 Ga0097620_1021933252 97
638 3300009093 Ga0105240_10256842 Ga0105240_102568422 97
639 3300013104 Ga0157370_11387810 Ga0157370_113878101 97
640 3300014325 Ga0163163_10127637 Ga0163163_101276372 97
641 3300014968 Ga0157379_10012114 Ga0157379_100121145 97
642 3300025900 Ga0207710_10072268 Ga0207710_100722683 97
643 3300025903 Ga0207680_10222635 Ga0207680_102226353 97
644 3300025909 Ga0207705_10077070 Ga0207705_100770701 97
645 3300025912 Ga0207707_10367221 Ga0207707_103672212 97
646 3300025913 Ga0207695_10142435 Ga0207695_101424354 97
647 3300025914 Ga0207671_10489117 Ga0207671_104891172 97
648 3300025919 Ga0207657_10023830 Ga0207657_100238304 97
649 3300025927 Ga0207687_10095098 Ga0207687_100950984 97
650 3300025932 Ga0207690_10530119 Ga0207690_105301192 97
651 3300025932 Ga0207690_11340041 Ga0207690_113400412 97
652 3300025934 Ga0207686_10105604 Ga0207686_101056042 97
653 3300025938 Ga0207704_10107290 Ga0207704_101072902 97
654 3300025942 Ga0207689_10124593 Ga0207689_101245934 97
655 3300025944 Ga0207661_10248877 Ga0207661_102488773 97
656 3300025949 Ga0207667_10017864 Ga0207667_100178644 97
657 3300026035 Ga0207703_11326844 Ga0207703_113268441 97
658 3300026067 Ga0207678_11008212 Ga0207678_110082121 97
659 3300026078 Ga0207702_10562012 Ga0207702_105620122 97
660 3300026089 Ga0207648_10056516 Ga0207648_100565162 97
661 3300026089 Ga0207648_10306092 Ga0207648_103060922 97
662 3300026118 Ga0207675_100349149 Ga0207675_1003491492 97
663 3300026121 Ga0207683_10467409 Ga0207683_104674092 97
664 3300027471 Ga0209995_1057437 Ga0209995_10574371 97
665 3300031235 Ga0265330_10062935 Ga0265330_100629352 97
666 3300031711 Ga0265314_10007579 Ga0265314_1000757918 97
667 3300032126 Ga0307415_102471341 Ga0307415_1024713411 97
668 3300035113 Ga0373936_0210280 Ga0373936_0210280_353_685 97
669 3300035410 Ga0373924_0086920 Ga0373924_0086920_225_557 97
670 3300037068 Ga0373925_0430860 Ga0373925_0430860_337_687 97
671 3300041408 Ga0439453_0195091 Ga0439453_0195091_155_457 97
672 3300042016 Ga0439463_081758 Ga0439463_081758_19_375 97
673 3300046463 Ga0495653_0179385 Ga0495653_0179385_976_1308 97
674 3300046511 Ga0495608_0285283 Ga0495608_0285283_427_759 97
675 3300046514 Ga0495618_0467079 Ga0495618_0467079_172_504 97
676 3300046535 Ga0495586_0088108 Ga0495586_0088108_361_693 97
677 3300046683 Ga0495658_0195497 Ga0495658_0195497_767_1099 97
678 3300047322 Ga0495680_0334380 Ga0495680_0334380_241_573 97
679 3300048089 Ga0495614_0181095 Ga0495614_0181095_559_885 97
680 3300048912 Ga0496109_1807906 Ga0496109_1807906_127_477 97
681 3300048917 Ga0496114_0543833 Ga0496114_0543833_486_815 97
682 3300050491 nmdc:mga00v17_121554_c2 nmdc:mga00v17_121554_c2_290_589 97
683 3300050493 nmdc:mga0k408_107084_c1 nmdc:mga0k408_107084_c1_751_1050 97
684 3300050495 nmdc:mga04h51_178292_c1 nmdc:mga04h51_178292_c1_426_725 97
685 3300050496 nmdc:mga07m45_152_c1 nmdc:mga07m45_152_c1_10886_11185 97
686 3300053077 Ga0495601_0169537 Ga0495601_0169537_673_1005 97
687 3300053083 Ga0495655_0038227 Ga0495655_0038227_545_895 97
688 3300053085 Ga0495619_0218156 Ga0495619_0218156_53_385 97
689 3300005457 Ga0070662_100757359 Ga0070662_1007573592 98
690 3300005544 Ga0070686_100518295 Ga0070686_1005182952 98
691 3300009148 Ga0105243_12463998 Ga0105243_124639981 98
692 3300014968 Ga0157379_12465893 Ga0157379_124658932 98
693 3300025921 Ga0207652_11093900 Ga0207652_110939001 98
694 3300025937 Ga0207669_10335675 Ga0207669_103356751 98
695 3300025940 Ga0207691_10693142 Ga0207691_106931422 98
696 3300025981 Ga0207640_10572189 Ga0207640_105721892 98
697 3300026121 Ga0207683_10456429 Ga0207683_104564293 98
698 3300035691 Ga0373931_0816455 Ga0373931_0816455_269_592 98
699 3300041503 Ga0451847_0081879 Ga0451847_0081879_116_421 98
700 3300042125 Ga0450923_140390 Ga0450923_140390_102_410 98
701 3300046455 Ga0495603_0245649 Ga0495603_0245649_654_977 98
702 3300048912 Ga0496109_0162123 Ga0496109_0162123_1733_2029 98
703 3300049161 Ga0501305_055304 Ga0501305_055304_274_579 98
704 3300049569 Ga0501032_0203582 Ga0501032_0203582_753_1067 98
705 3300049571 Ga0501034_0062327 Ga0501034_0062327_1312_1626 98
706 3300049571 Ga0501034_0396885 Ga0501034_0396885_329_643 98
707 3300049572 Ga0501036_0526836 Ga0501036_0526836_212_526 98
708 3300049572 Ga0501036_0617594 Ga0501036_0617594_229_543 98
709 3300049574 Ga0501038_0199273 Ga0501038_0199273_431_745 98
710 3300049575 Ga0501039_0186470 Ga0501039_0186470_429_743 98
711 3300049575 Ga0501039_0355700 Ga0501039_0355700_597_911 98
712 3300049576 Ga0501040_0853934 Ga0501040_0853934_133_447 98
713 3300049579 Ga0501043_0205410 Ga0501043_0205410_362_676 98
714 3300049579 Ga0501043_0553451 Ga0501043_0553451_250_567 98
715 3300049579 Ga0501043_0676949 Ga0501043_0676949_211_525 98
716 3300049580 Ga0501046_0226235 Ga0501046_0226235_218_532 98
717 3300049580 Ga0501046_0719544 Ga0501046_0719544_53_367 98
718 3300049581 Ga0501047_0042294 Ga0501047_0042294_2178_2492 98
719 3300049581 Ga0501047_0049792 Ga0501047_0049792_926_1240 98
720 3300049581 Ga0501047_0228159 Ga0501047_0228159_781_1095 98
721 3300049582 Ga0501048_0034967 Ga0501048_0034967_2535_2849 98
722 3300049583 Ga0501067_0105799 Ga0501067_0105799_880_1194 98
723 3300049584 Ga0501068_0149489 Ga0501068_0149489_697_1011 98
724 3300049585 Ga0501069_0120453 Ga0501069_0120453_780_1094 98
725 3300049586 Ga0501070_0523304 Ga0501070_0523304_591_905 98
726 3300049586 Ga0501070_0755299 Ga0501070_0755299_209_523 98
727 3300049588 Ga0501072_0554453 Ga0501072_0554453_364_678 98
728 3300049589 Ga0501073_0036691 Ga0501073_0036691_373_687 98
729 3300049589 Ga0501073_0135900 Ga0501073_0135900_1288_1602 98
730 3300049589 Ga0501073_0142718 Ga0501073_0142718_158_472 98
731 3300049742 Ga0501080_0241788 Ga0501080_0241788_454_768 98
732 3300049742 Ga0501080_0722570 Ga0501080_0722570_227_541 98
733 3300049743 Ga0501081_0782753 Ga0501081_0782753_148_462 98
734 3300049744 Ga0501083_0090152 Ga0501083_0090152_713_1027 98
735 3300049744 Ga0501083_0192624 Ga0501083_0192624_267_581 98
736 3300049822 Ga0501035_0376494 Ga0501035_0376494_741_1055 98
737 3300049822 Ga0501035_1024898 Ga0501035_1024898_30_347 98
738 3300049823 Ga0501044_0182996 Ga0501044_0182996_1312_1626 98
739 3300049823 Ga0501044_0549969 Ga0501044_0549969_284_598 98
740 3300050507 nmdc:mga05p37_65_c1 nmdc:mga05p37_65_c1_20093_20419 98
741 3300053090 Ga0500646_0132500 Ga0500646_0132500_239_535 98
742 3300053093 Ga0500651_0209244 Ga0500651_0209244_688_984 98
743 3300053103 Ga0500555_000474 Ga0500555_000474_3166_3462 98
744 3300053116 Ga0500592_015086 Ga0500592_015086_542_838 98
745 3300053153 Ga0500616_0000173 Ga0500616_0000173_8702_8998 98
746 3300053730 Ga0500645_002162 Ga0500645_002162_3138_3434 98
747 3300053736 Ga0500599_013758 Ga0500599_013758_528_824 98
748 3300060353 Ga0501082_0059928 Ga0501082_0059928_1456_1770 98
749 3300004801 Ga0058860_12047537 Ga0058860_120475372 99
750 3300005288 Ga0065714_10257652 Ga0065714_102576522 99
751 3300005328 Ga0070676_10662519 Ga0070676_106625192 99
752 3300005329 Ga0070683_100990462 Ga0070683_1009904622 99
753 3300005334 Ga0068869_101320443 Ga0068869_1013204431 99
754 3300005334 Ga0068869_101494463 Ga0068869_1014944631 99
755 3300005338 Ga0068868_100583301 Ga0068868_1005833011 99
756 3300005353 Ga0070669_100360128 Ga0070669_1003601281 99
757 3300005354 Ga0070675_100176804 Ga0070675_1001768042 99
758 3300005354 Ga0070675_100521101 Ga0070675_1005211012 99
759 3300005364 Ga0070673_101173994 Ga0070673_1011739941 99
760 3300005365 Ga0070688_100288505 Ga0070688_1002885052 99
761 3300005366 Ga0070659_102134373 Ga0070659_1021343732 99
762 3300005437 Ga0070710_10945356 Ga0070710_109453562 99
763 3300005440 Ga0070705_100124788 Ga0070705_1001247882 99
764 3300005441 Ga0070700_101631704 Ga0070700_1016317042 99
765 3300005444 Ga0070694_100747206 Ga0070694_1007472062 99
766 3300005456 Ga0070678_100220398 Ga0070678_1002203982 99
767 3300005457 Ga0070662_101381348 Ga0070662_1013813481 99
768 3300005466 Ga0070685_11002339 Ga0070685_110023392 99
769 3300005467 Ga0070706_101253105 Ga0070706_1012531052 99
770 3300005539 Ga0068853_100978962 Ga0068853_1009789622 99
771 3300005543 Ga0070672_101140301 Ga0070672_1011403011 99
772 3300005544 Ga0070686_100313286 Ga0070686_1003132862 99
773 3300005545 Ga0070695_100114259 Ga0070695_1001142592 99
774 3300005546 Ga0070696_100341200 Ga0070696_1003412001 99
775 3300005548 Ga0070665_100083981 Ga0070665_1000839815 99
776 3300005548 Ga0070665_100127472 Ga0070665_1001274725 99
777 3300005549 Ga0070704_100450947 Ga0070704_1004509472 99
778 3300005563 Ga0068855_102152928 Ga0068855_1021529282 99
779 3300005615 Ga0070702_100950307 Ga0070702_1009503072 99
780 3300005616 Ga0068852_100497418 Ga0068852_1004974182 99
781 3300005618 Ga0068864_100339216 Ga0068864_1003392161 99
782 3300005718 Ga0068866_11023427 Ga0068866_110234272 99
783 3300005841 Ga0068863_101947062 Ga0068863_1019470622 99
784 3300005843 Ga0068860_101590022 Ga0068860_1015900222 99
785 3300006186 Ga0075369_10337499 Ga0075369_103374992 99
786 3300006237 Ga0097621_100164463 Ga0097621_1001644634 99
787 3300006358 Ga0068871_100247538 Ga0068871_1002475383 99
788 3300006358 Ga0068871_102000040 Ga0068871_1020000401 99
789 3300006881 Ga0068865_100334604 Ga0068865_1003346042 99
790 3300007788 Ga0099795_10431218 Ga0099795_104312182 99
791 3300009101 Ga0105247_10434150 Ga0105247_104341502 99
792 3300009176 Ga0105242_11827768 Ga0105242_118277681 99
793 3300009177 Ga0105248_10303543 Ga0105248_103035432 99
794 3300009177 Ga0105248_11822368 Ga0105248_118223682 99
795 3300009545 Ga0105237_11370124 Ga0105237_113701242 99
796 3300009551 Ga0105238_10286513 Ga0105238_102865133 99
797 3300009551 Ga0105238_10564391 Ga0105238_105643911 99
798 3300010159 Ga0099796_10144819 Ga0099796_101448191 99
799 3300013297 Ga0157378_11011698 Ga0157378_110116981 99
800 3300013297 Ga0157378_11372608 Ga0157378_113726082 99
801 3300013306 Ga0163162_11877311 Ga0163162_118773112 99
802 3300013308 Ga0157375_10331963 Ga0157375_103319633 99
803 3300014969 Ga0157376_10472409 Ga0157376_104724092 99
804 3300014969 Ga0157376_11386194 Ga0157376_113861941 99
805 3300025315 Ga0207697_10125113 Ga0207697_101251132 99
806 3300025321 Ga0207656_10492319 Ga0207656_104923192 99
807 3300025711 Ga0207696_1104691 Ga0207696_11046912 99
808 3300025899 Ga0207642_10757948 Ga0207642_107579482 99
809 3300025905 Ga0207685_10356687 Ga0207685_103566871 99
810 3300025907 Ga0207645_10196243 Ga0207645_101962433 99
811 3300025923 Ga0207681_10395255 Ga0207681_103952553 99
812 3300025924 Ga0207694_10307553 Ga0207694_103075533 99
813 3300025924 Ga0207694_10342428 Ga0207694_103424283 99
814 3300025924 Ga0207694_11252620 Ga0207694_112526202 99
815 3300025925 Ga0207650_10057888 Ga0207650_100578885 99
816 3300025926 Ga0207659_10661416 Ga0207659_106614161 99
817 3300025927 Ga0207687_10147298 Ga0207687_101472983 99
818 3300025932 Ga0207690_11651840 Ga0207690_116518402 99
819 3300025940 Ga0207691_10117491 Ga0207691_101174914 99
820 3300025941 Ga0207711_11239148 Ga0207711_112391481 99
821 3300025941 Ga0207711_11539441 Ga0207711_115394412 99
822 3300025944 Ga0207661_11715619 Ga0207661_117156192 99
823 3300025949 Ga0207667_10792538 Ga0207667_107925382 99
824 3300025949 Ga0207667_11877155 Ga0207667_118771552 99
825 3300025960 Ga0207651_10472515 Ga0207651_104725153 99
826 3300025960 Ga0207651_11337491 Ga0207651_113374912 99
827 3300025961 Ga0207712_10435288 Ga0207712_104352882 99
828 3300026023 Ga0207677_10457231 Ga0207677_104572312 99
829 3300026023 Ga0207677_11647267 Ga0207677_116472672 99
830 3300026075 Ga0207708_10822962 Ga0207708_108229621 99
831 3300026089 Ga0207648_10686769 Ga0207648_106867693 99
832 3300026095 Ga0207676_11100464 Ga0207676_111004642 99
833 3300026118 Ga0207675_100742488 Ga0207675_1007424883 99
834 3300026118 Ga0207675_101922960 Ga0207675_1019229602 99
835 3300026121 Ga0207683_10011262 Ga0207683_100112627 99
836 3300026142 Ga0207698_10685870 Ga0207698_106858703 99
837 3300028379 Ga0268266_10079314 Ga0268266_100793142 99
838 3300031456 Ga0307513_10349382 Ga0307513_103493823 99
839 3300035083 Ga0373926_0158323 Ga0373926_0158323_270_599 99
840 3300035116 Ga0373945_0140338 Ga0373945_0140338_476_805 99
841 3300035117 Ga0373953_0195181 Ga0373953_0195181_18_344 99
842 3300035119 Ga0373956_0045429 Ga0373956_0045429_739_1065 99
843 3300035170 Ga0373943_0056118 Ga0373943_0056118_105_434 99
844 3300035170 Ga0373943_0477011 Ga0373943_0477011_362_661 99
845 3300035171 Ga0373946_0032579 Ga0373946_0032579_1118_1444 99
846 3300035172 Ga0373955_0134713 Ga0373955_0134713_935_1261 99
847 3300035410 Ga0373924_0058294 Ga0373924_0058294_852_1178 99
848 3300035692 Ga0373935_1006005 Ga0373935_1006005_100_426 99
849 3300035695 Ga0373927_0129073 Ga0373927_0129073_1145_1471 99
850 3300035725 Ga0373947_0464859 Ga0373947_0464859_214_540 99
851 3300035725 Ga0373947_0756830 Ga0373947_0756830_77_376 99
852 3300036401 Ga0373937_0067221 Ga0373937_0067221_806_1132 99
853 3300036401 Ga0373937_0221033 Ga0373937_0221033_527_856 99
854 3300037068 Ga0373925_0069528 Ga0373925_0069528_38_367 99
855 3300041459 Ga0451800_1151021 Ga0451800_1151021_142_468 99
856 3300041460 Ga0451802_1108347 Ga0451802_1108347_445_744 99
857 3300041512 Ga0451853_0869743 Ga0451853_0869743_249_548 99
858 3300044683 Ga0466965_0272794 Ga0466965_0272794_303_602 99
859 3300044842 Ga0466957_0429856 Ga0466957_0429856_395_694 99
860 3300046454 Ga0495592_0473704 Ga0495592_0473704_396_725 99
861 3300046455 Ga0495603_0043902 Ga0495603_0043902_584_913 99
862 3300046455 Ga0495603_0150724 Ga0495603_0150724_148_447 99
863 3300046459 Ga0495629_0055216 Ga0495629_0055216_699_998 99
864 3300046473 Ga0495582_0247667 Ga0495582_0247667_490_819 99
865 3300046473 Ga0495582_0345055 Ga0495582_0345055_323_649 99
866 3300046475 Ga0495639_0101147 Ga0495639_0101147_563_862 99
867 3300046476 Ga0495662_0321985 Ga0495662_0321985_117_443 99
868 3300046499 Ga0495594_0102795 Ga0495594_0102795_1052_1381 99
869 3300046499 Ga0495594_0723366 Ga0495594_0723366_28_327 99
870 3300046517 Ga0495630_0267490 Ga0495630_0267490_230_556 99
871 3300046523 Ga0495644_0223090 Ga0495644_0223090_35_394 99
872 3300046529 Ga0495652_0477229 Ga0495652_0477229_17_343 99
873 3300046533 Ga0495640_0065981 Ga0495640_0065981_1298_1624 99
874 3300046535 Ga0495586_0141059 Ga0495586_0141059_334_633 99
875 3300046536 Ga0495587_0220146 Ga0495587_0220146_341_667 99
876 3300046537 Ga0495598_0200879 Ga0495598_0200879_197_523 99
877 3300046539 Ga0495621_0103056 Ga0495621_0103056_267_626 99
878 3300046543 Ga0495645_0006287 Ga0495645_0006287_1606_1932 99
879 3300046616 Ga0495668_0190674 Ga0495668_0190674_429_755 99
880 3300046616 Ga0495668_0586264 Ga0495668_0586264_296_604 99
881 3300046642 Ga0495634_0100808 Ga0495634_0100808_1033_1359 99
882 3300046642 Ga0495634_0765674 Ga0495634_0765674_168_467 99
883 3300046674 Ga0495588_0348888 Ga0495588_0348888_188_514 99
884 3300046681 Ga0495647_0082963 Ga0495647_0082963_379_705 99
885 3300046681 Ga0495647_0094351 Ga0495647_0094351_329_628 99
886 3300046683 Ga0495658_0064706 Ga0495658_0064706_42_341 99
887 3300046684 Ga0495669_0536931 Ga0495669_0536931_12_338 99
888 3300046692 Ga0495671_0187062 Ga0495671_0187062_153_479 99
889 3300046794 Ga0495589_0433553 Ga0495589_0433553_53_352 99
890 3300047315 Ga0495581_0044555 Ga0495581_0044555_1554_1880 99
891 3300047315 Ga0495581_0210608 Ga0495581_0210608_451_750 99
892 3300047319 Ga0495674_0044793 Ga0495674_0044793_329_655 99
893 3300047321 Ga0495676_0139896 Ga0495676_0139896_925_1254 99
894 3300047444 Ga0495675_0149748 Ga0495675_0149748_362_688 99
895 3300047471 Ga0495684_0030504 Ga0495684_0030504_2473_2799 99
896 3300048090 Ga0495615_0271254 Ga0495615_0271254_68_367 99
897 3300048903 Ga0496100_0113941 Ga0496100_0113941_1063_1362 99
898 3300048903 Ga0496100_0881213 Ga0496100_0881213_25_351 99
899 3300048909 Ga0496106_0302602 Ga0496106_0302602_60_359 99
900 3300048912 Ga0496109_0971550 Ga0496109_0971550_319_645 99
901 3300048913 Ga0496110_0515460 Ga0496110_0515460_378_677 99
902 3300048917 Ga0496114_0321889 Ga0496114_0321889_974_1300 99
903 3300049522 Ga0501299_119814 Ga0501299_119814_130_429 99
904 3300049569 Ga0501032_0096009 Ga0501032_0096009_954_1253 99
905 3300049571 Ga0501034_0013252 Ga0501034_0013252_2980_3279 99
906 3300049573 Ga0501037_0482433 Ga0501037_0482433_144_443 99
907 3300049581 Ga0501047_0025664 Ga0501047_0025664_1102_1401 99
908 3300049586 Ga0501070_0302332 Ga0501070_0302332_847_1146 99
909 3300049707 Ga0501234_064431 Ga0501234_064431_274_573 99
910 3300049822 Ga0501035_0401670 Ga0501035_0401670_422_721 99
911 3300049823 Ga0501044_0003452 Ga0501044_0003452_7345_7644 99
912 3300050513 nmdc:mga0rr50_46593_c1 nmdc:mga0rr50_46593_c1_2850_3170 99
913 3300053078 Ga0495612_0160040 Ga0495612_0160040_34_360 99
914 3300053084 Ga0495595_0139583 Ga0495595_0139583_517_843 99
915 3300060346 Ga0587111_0255005 Ga0587111_0255005_38_337 99
916 3300060353 Ga0501082_0133257 Ga0501082_0133257_549_857 99

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00203

Ribosomal_S19

Ribosomal protein S19

3

83

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
4v48-assembly1.cif.gz_BS real space refined coordinates of the 30s and 50s subunits fitted into the low resolution cryo-em map of the initiation-like state of e. coli 70s ribosome 0.9588 12 76
4v48-assembly1.cif.gz_BS real space refined coordinates of the 30s and 50s subunits fitted into the low resolution cryo-em map of the initiation-like state of e. coli 70s ribosome 0.9448 12 76
3a1p-assembly2.cif.gz_D structure of ribosome maturation protein rimm and ribosomal protein s19 0.9325 10 83
3a1p-assembly1.cif.gz_B structure of ribosome maturation protein rimm and ribosomal protein s19 0.9292 10 83
8ove-assembly1.cif.gz_AI cryo-em structure of trypanosoma brucei procyclic form 80s ribosome : tb11cs6h1 snorna mutant 0.9223 13 76
ID Description Score Start End Superfamily
3a1pB00 Alpha Beta;2-Layer Sandwich;30s Ribosomal Protein S19; Chain A;Ribosomal protein S19/S15 0.9292 10 83 3.30.860.10
2y0uS00 Alpha Beta;2-Layer Sandwich;30s Ribosomal Protein S19; Chain A;Ribosomal protein S19/S15 0.8916 4 81 3.30.860.10
2wriS00 Alpha Beta;2-Layer Sandwich;30s Ribosomal Protein S19; Chain A;Ribosomal protein S19/S15 0.8816 4 82 3.30.860.10
2y0uS00 Alpha Beta;2-Layer Sandwich;30s Ribosomal Protein S19; Chain A;Ribosomal protein S19/S15 0.8811 4 81 3.30.860.10
5zeus00 Alpha Beta;2-Layer Sandwich;30s Ribosomal Protein S19; Chain A;Ribosomal protein S19/S15 0.8792 6 83 3.30.860.10
ID Description Score Start End GO Terms
AF-A0A3C1V0E1-F1-model_v4 Small ribosomal subunit protein uS19 (30S ribosomal protein S19) 0.9696 6 72 GO:0000028
GO:0003735
GO:0005737
GO:0006412
GO:0015935
GO:0019843
AF-A0A3C1V0E1-F1-model_v4 Small ribosomal subunit protein uS19 (30S ribosomal protein S19) 0.9556 6 72 GO:0000028
GO:0003735
GO:0005737
GO:0006412
GO:0015935
GO:0019843
AF-A0A3D0N3C2-F1-model_v4 Small ribosomal subunit protein uS19 (30S ribosomal protein S19) 0.929 1 73 GO:0000028
GO:0003735
GO:0005737
GO:0006412
GO:0015935
GO:0019843
AF-A0A7C7UQP5-F1-model_v4 Small ribosomal subunit protein uS19 (30S ribosomal protein S19) 0.9245 1 78 GO:0000028
GO:0003735
GO:0005737
GO:0006412
GO:0015935
GO:0019843
AF-A0A6P0Y002-F1-model_v4 Small ribosomal subunit protein uS19 (30S ribosomal protein S19) 0.9169 1 77 GO:0000028
GO:0003735
GO:0005737
GO:0006412
GO:0015935
GO:0019843

Feature Viewer

pLDDT pTM Quality
77.98 0.63 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map