F485571

General Info

Members Datasets Scaffolds Average Seq Length
914 450 881 312

Family's Representative Sequence

Representative Sequence 3300025912|Ga0207707_10018316|Ga0207707_100183164
Length 357
Sequence LGLGWRHARHEAGGTYGFGVSKEKCRRGVRRVVHDNGEAFRGAVSPLLFVDEHTPVLVGEALAALALQAGGYYVDATFGRGGHTALILQALGREGRLLAIDRDPQAIAAGRQRFADEVRLTLVHASFADLAALVPAHAHGLPCGGVLFDLGVSSPQLDDPRRGFSFRSDGPIDMRMDTSRGEPVSAWLARASLDEIREVISTLGEERFARRIAQAIVATRTEHPLTRTNELAALVSRAVRTREPGKHPATRTFQALRMFINDELGQLNRGLNAAVDVISRGGRLAVISFHSLEDRVVKNFFRDESQIDPVFLDLPAIPPEAQPRLRLVGRKSRPSDAEVKRNPRARSALLRVAEKVV

Samples

Sample ID Description Type Environment
1 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
2 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
3 2547132181 Kosakonia sacchari SP1 Isolate Stem
4 2561511199 Enterobacter sp. R4-368 Isolate Nodule
5 2599185299 Pantoea ananatis NFR11 Isolate Rhizoplane
6 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
7 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
8 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
9 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
10 2602042046 Enterobacter sp. NFIX09 Isolate Rhizoplane
11 2648501693 Pantoea ananatis B1-9 Isolate Rhizosphere
12 2684622997 Pantoea ananatis NFIX48 Isolate Rhizoplane
13 2728369097 Stutzerimonas balearica st101 Isolate Unclassified
14 2734482258 Glomeribacter sp. phylotype 3 Isolate Unclassified
15 2791355010 Kosakonia pseudosacchari NN143 Isolate Unclassified
16 2811995292 Kosakonia oryzae Ola 51 Isolate Unclassified
17 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
18 2847797336 Pantoea ananatis NN08200 Isolate Unclassified
19 2854601825 Dickeya dianthicola SS70 Isolate Stem Tuber
20 2858466076 Pectobacterium polaris SS28 Isolate Stem Tuber
21 2871272651 Pectobacterium carotovorum SS96 Isolate Stem Tuber
22 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
23 2935625433 Kosakonia sp. 1610 Isolate Rhizosphere
24 2974435778 Kosakonia cowanii SORGH_AS 304 Isolate Unclassified
25 2984494565 Pantoea ananatis SORGH_AS197 Isolate Aerial Root
26 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
27 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
28 2990261002 Pantoea ananatis SORGH_AS213 Isolate Aerial Root
29 3000376612 Enterobacteriaceae bacterium 4M9 Isolate Rhizosphere
30 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
31 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
32 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
33 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
34 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
35 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
36 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
37 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
38 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
39 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
40 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
41 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
42 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
43 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
44 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
45 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
46 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
47 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
48 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
49 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
50 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
51 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
52 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
53 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
54 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
55 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
56 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
57 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
58 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
59 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
60 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
61 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
62 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
63 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
64 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
65 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
66 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
67 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
68 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
69 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
70 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
71 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
72 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
73 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
74 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
75 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
76 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
77 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
78 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
79 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
80 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
81 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
82 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
83 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
84 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
85 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
86 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
87 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
88 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
89 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
90 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
91 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
92 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
93 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
94 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
95 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
96 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
97 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
98 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
99 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
100 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
101 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
102 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
103 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
104 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
105 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
106 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
107 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
108 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
109 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
110 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
111 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
112 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
113 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
114 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
115 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
116 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
117 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
118 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
119 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
120 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
121 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
122 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
123 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
124 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
125 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
126 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
127 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
128 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
129 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
130 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
131 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
132 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
133 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
134 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
135 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
136 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
137 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
138 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
139 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
140 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
141 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
142 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
143 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
144 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
145 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
146 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
147 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
148 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
149 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
150 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
151 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
152 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
153 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
154 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
155 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
156 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
157 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
213 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
214 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
215 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
216 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
218 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
219 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
221 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
222 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
223 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
227 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
228 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
229 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
230 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
231 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
232 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
233 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
234 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
235 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
236 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
237 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
238 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
239 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
240 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
241 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
242 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
243 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
244 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
245 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
246 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
247 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
248 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
249 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
250 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
251 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
252 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
253 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
254 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
255 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
256 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
257 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
258 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
259 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
260 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
261 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
262 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
263 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
264 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
265 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
266 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
267 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
268 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
269 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
270 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
271 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
272 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
273 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
274 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
275 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
276 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
277 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
278 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
279 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
280 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
281 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
282 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
283 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
284 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
285 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
286 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
287 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
288 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
289 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
290 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
291 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
292 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
293 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
294 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
295 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
296 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
297 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
298 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
299 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
300 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
301 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
302 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
303 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
304 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
305 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
306 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
307 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
308 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
309 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
310 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
311 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
312 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
313 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
314 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
315 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
316 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
317 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
318 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
319 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
320 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
321 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
322 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
323 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
324 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
325 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
326 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
327 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
328 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
329 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
330 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
331 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
332 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
333 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
334 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
335 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
336 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
337 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
338 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
339 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
340 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
341 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
342 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
343 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
344 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
345 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
346 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
347 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
348 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
349 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
350 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
351 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
352 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
353 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
354 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
355 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
356 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
357 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
358 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
359 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
360 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
361 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
362 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
363 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
364 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
365 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
366 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
367 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
368 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
369 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
370 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
371 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
372 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
373 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
374 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
375 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
376 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
377 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
378 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
379 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
380 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
381 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
382 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
383 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
384 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
385 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
386 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
387 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
388 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
389 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
390 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
391 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
392 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
393 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
394 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
395 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
396 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
397 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
398 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
399 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
400 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
401 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
402 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
403 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
404 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
405 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
406 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
407 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
408 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
409 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
410 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
411 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
412 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
413 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
414 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
415 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
416 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
417 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
418 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
419 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
420 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
421 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
422 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
423 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
424 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
425 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
426 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
427 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
428 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
429 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
430 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
431 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
432 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
433 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
434 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
435 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
436 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
437 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
438 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
439 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
440 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
441 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
442 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
443 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
444 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
445 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
446 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
447 640427133 Stutzerimonas stutzeri A1501 Isolate Rhizosphere
448 651053060 Stutzerimonas stutzeri CMT.A.9 Isolate Rhizosphere
449 8001522603 Methylomicrobium sp. RS1 Isolate Unclassified
450 8016728285 Pseudomonas psychrotolerans SORGH_AS 227 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.51
Metatranscriptomes 0.88
Isolates 3.61

Biome Distribution

Category Percentage (%)
Aerial Root 0.44
Bulb 0
Endosphere 2.95
Nodule 0.66
Rhizoplane 3.5
Rhizosphere 84.46
Stem 0.11
Stem Tuber 0.33
Unclassified 7.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10000036 3300001989 Bacteria 37579
2 JGI25162J39368_1002447 3300002737 Bacteria 7205
3 JGI25162J39368_1002514 3300002737 Bacteria 7013
4 JGI25162J39368_1002516 3300002737 Bacteria 7010
5 JGI25152J39213_1000187 3300002773 Bacteria 41763
6 rootH2_10023964 3300003320 Bacteria 15066
7 Ga0058692_1001649 3300003856 Bacteria 8011
8 Ga0058692_1001730 3300003856 Bacteria 7778
9 Ga0058692_1006192 3300003856 Bacteria 3313
10 Ga0065715_10223441 3300005293 Bacteria 1262
11 Ga0070690_100007666 3300005330 Bacteria 6187
12 Ga0070690_100011534 3300005330 Bacteria 5172
13 Ga0070670_100059524 3300005331 Bacteria 3279
14 Ga0070670_100178451 3300005331 Bacteria 1843
15 Ga0070677_10003986 3300005333 Bacteria 4800
16 Ga0068869_100000179 3300005334 Bacteria 32307
17 Ga0068869_100102967 3300005334 Bacteria 2162
18 Ga0068869_100213838 3300005334 Bacteria 1525
19 Ga0070666_10004842 3300005335 Bacteria 8227
20 Ga0070666_10009494 3300005335 Bacteria 6067
21 Ga0070666_10013205 3300005335 Bacteria 5235
22 Ga0070666_10066444 3300005335 Bacteria 2447
23 Ga0070666_10077658 3300005335 Bacteria 2266
24 Ga0070680_100002041 3300005336 Bacteria 14890
25 Ga0070680_100047098 3300005336 Bacteria 3510
26 Ga0070680_100054104 3300005336 Bacteria 3276
27 Ga0070682_100026425 3300005337 Bacteria 3474
28 Ga0068868_100226032 3300005338 Bacteria 1568
29 Ga0070691_10000201 3300005341 Bacteria 20122
30 Ga0070691_10025383 3300005341 Bacteria 2759
31 Ga0070687_100004423 3300005343 Bacteria 5602
32 Ga0070687_100158552 3300005343 Bacteria 1335
33 Ga0070668_100021905 3300005347 Bacteria 4828
34 Ga0070668_100165739 3300005347 Bacteria 1795
35 Ga0070675_100035869 3300005354 Bacteria 4032
36 Ga0070675_100351868 3300005354 Bacteria 1306
37 Ga0070671_100002044 3300005355 Bacteria 15550
38 Ga0070671_100018662 3300005355 Bacteria 5635
39 Ga0070671_100034652 3300005355 Bacteria 4179
40 Ga0070671_100073677 3300005355 Bacteria 2852
41 Ga0070674_100034839 3300005356 Bacteria 3366
42 Ga0070674_100092380 3300005356 Bacteria 2187
43 Ga0070674_100109440 3300005356 Bacteria 2026
44 Ga0070673_100059240 3300005364 Bacteria 3031
45 Ga0070673_100066144 3300005364 Bacteria 2886
46 Ga0070673_100136437 3300005364 Bacteria 2065
47 Ga0070667_100000184 3300005367 Bacteria 75408
48 Ga0070667_100013808 3300005367 Bacteria 6677
49 Ga0070667_100024865 3300005367 Bacteria 4975
50 Ga0070667_100065708 3300005367 Bacteria 3080
51 Ga0070709_10000132 3300005434 Bacteria 49598
52 Ga0070709_10006539 3300005434 Bacteria 6356
53 Ga0070709_10011218 3300005434 Bacteria 4985
54 Ga0070714_100001047 3300005435 Bacteria 19734
55 Ga0070714_100024629 3300005435 Bacteria 4959
56 Ga0070714_100085145 3300005435 Bacteria 2760
57 Ga0070713_100000696 3300005436 Bacteria 21617
58 Ga0070713_100003974 3300005436 Bacteria 9835
59 Ga0070713_100121978 3300005436 Bacteria 2287
60 Ga0070710_10001105 3300005437 Bacteria 12767
61 Ga0070710_10034787 3300005437 Bacteria 2743
62 Ga0070701_10000441 3300005438 Bacteria 14159
63 Ga0070701_10070603 3300005438 Bacteria 1866
64 Ga0070711_100055982 3300005439 Bacteria 2726
65 Ga0070711_100288281 3300005439 Bacteria 1301
66 Ga0070705_100000428 3300005440 Bacteria 24201
67 Ga0070705_100237544 3300005440 Bacteria 1271
68 Ga0070700_100002394 3300005441 Bacteria 9557
69 Ga0070700_100113612 3300005441 Bacteria 1804
70 Ga0070700_100198944 3300005441 Bacteria 1406
71 Ga0070694_100000620 3300005444 Bacteria 19535
72 Ga0070694_100341638 3300005444 Bacteria 1157
73 Ga0070708_100105955 3300005445 Bacteria 2580
74 Ga0070663_100037888 3300005455 Bacteria 3359
75 Ga0070663_100231036 3300005455 Bacteria 1456
76 Ga0070678_100007333 3300005456 Bacteria 6533
77 Ga0070662_100116940 3300005457 Bacteria 2039
78 Ga0070681_10000131 3300005458 Bacteria 56441
79 Ga0070681_10000231 3300005458 Bacteria 43967
80 Ga0070681_10004886 3300005458 Bacteria 12856
81 Ga0070681_10009857 3300005458 Bacteria 9412
82 Ga0070681_10010910 3300005458 Bacteria 8984
83 Ga0070681_10029157 3300005458 Bacteria 5540
84 Ga0070681_10070970 3300005458 Bacteria 3448
85 Ga0070681_10089146 3300005458 Bacteria 3036
86 Ga0070681_10112367 3300005458 Bacteria 2664
87 Ga0068867_100001899 3300005459 Bacteria 14533
88 Ga0068867_100042614 3300005459 Bacteria 3321
89 Ga0068867_100085315 3300005459 Bacteria 2387
90 Ga0070685_10111860 3300005466 Bacteria 1683
91 Ga0070685_10264085 3300005466 Bacteria 1146
92 Ga0070706_100003733 3300005467 Bacteria 14884
93 Ga0070706_100041096 3300005467 Bacteria 4269
94 Ga0070707_100077507 3300005468 Bacteria 3207
95 Ga0070707_100241824 3300005468 Bacteria 1757
96 Ga0070698_100000354 3300005471 Bacteria 47476
97 Ga0070698_100005850 3300005471 Bacteria 13439
98 Ga0070698_100020872 3300005471 Bacteria 6864
99 Ga0070698_100051215 3300005471 Bacteria 4207
100 Ga0070699_100063452 3300005518 Bacteria 3203
101 Ga0070699_100144625 3300005518 Bacteria 2101
102 Ga0070699_100187509 3300005518 Bacteria 1837
103 Ga0070679_100019019 3300005530 Bacteria 6672
104 Ga0070679_100079717 3300005530 Bacteria 3264
105 Ga0070679_100147308 3300005530 Bacteria 2332
106 Ga0070679_100190653 3300005530 Bacteria 2019
107 Ga0070684_100138929 3300005535 Bacteria 2196
108 Ga0070684_100144282 3300005535 Bacteria 2154
109 Ga0070684_100340440 3300005535 Bacteria 1379
110 Ga0070697_100074834 3300005536 Bacteria 2783
111 Ga0070697_100176041 3300005536 Bacteria 1812
112 Ga0068853_100074893 3300005539 Bacteria 2954
113 Ga0070672_100021356 3300005543 Bacteria 4735
114 Ga0070686_100013640 3300005544 Bacteria 4660
115 Ga0070686_100022906 3300005544 Bacteria 3726
116 Ga0070686_100093129 3300005544 Bacteria 2020
117 Ga0070695_100005505 3300005545 Bacteria 7461
118 Ga0070695_100011219 3300005545 Bacteria 5358
119 Ga0070696_100000037 3300005546 Bacteria 62186
120 Ga0070696_100026580 3300005546 Bacteria 3937
121 Ga0070693_100000225 3300005547 Bacteria 26343
122 Ga0070665_100003573 3300005548 Bacteria 16475
123 Ga0070665_100005905 3300005548 Bacteria 12540
124 Ga0070665_100008678 3300005548 Bacteria 10288
125 Ga0070665_100012130 3300005548 Bacteria 8694
126 Ga0070665_100026498 3300005548 Bacteria 5837
127 Ga0070665_100037380 3300005548 Bacteria 4883
128 Ga0070665_100090572 3300005548 Bacteria 3064
129 Ga0070665_100227305 3300005548 Bacteria 1866
130 Ga0070704_100006185 3300005549 Bacteria 7031
131 Ga0068855_100008724 3300005563 Bacteria 12255
132 Ga0068855_100018159 3300005563 Bacteria 8450
133 Ga0068855_100020453 3300005563 Bacteria 7937
134 Ga0068855_100036225 3300005563 Bacteria 5874
135 Ga0068855_100079790 3300005563 Bacteria 3795
136 Ga0068855_100258503 3300005563 Bacteria 1941
137 Ga0070664_100010321 3300005564 Bacteria 7579
138 Ga0068857_100258121 3300005577 Unclassified 1599
139 Ga0068854_100014490 3300005578 Bacteria 5198
140 Ga0068856_100023424 3300005614 Bacteria 6003
141 Ga0068856_100041447 3300005614 Bacteria 4524
142 Ga0068856_100143811 3300005614 Bacteria 2393
143 Ga0068856_100263674 3300005614 Bacteria 1739
144 Ga0068852_100072254 3300005616 Bacteria 3032
145 Ga0068859_100004269 3300005617 Bacteria 14594
146 Ga0068859_100007815 3300005617 Bacteria 10857
147 Ga0068859_100048836 3300005617 Bacteria 4251
148 Ga0068859_100099223 3300005617 Bacteria 2967
149 Ga0068859_100204778 3300005617 Bacteria 2058
150 Ga0068859_100428480 3300005617 Bacteria 1419
151 Ga0068864_100018240 3300005618 Bacteria 5858
152 Ga0068864_100064649 3300005618 Bacteria 3173
153 Ga0068864_100181691 3300005618 Bacteria 1923
154 Ga0068864_100428436 3300005618 Bacteria 1262
155 Ga0068864_100457037 3300005618 Bacteria 1222
156 Ga0068866_10007417 3300005718 Bacteria 4589
157 Ga0068866_10009466 3300005718 Bacteria 4136
158 Ga0068861_100000538 3300005719 Bacteria 22249
159 Ga0068861_100040357 3300005719 Bacteria 3490
160 Ga0068861_100051338 3300005719 Bacteria 3130
161 Ga0068861_100157116 3300005719 Bacteria 1872
162 Ga0068861_100222452 3300005719 Bacteria 1596
163 Ga0068851_10065242 3300005834 Bacteria 1873
164 Ga0068863_100005874 3300005841 Bacteria 12025
165 Ga0068863_100009793 3300005841 Bacteria 9343
166 Ga0068863_100095074 3300005841 Bacteria 2828
167 Ga0068863_100168201 3300005841 Bacteria 2102
168 Ga0068858_100004263 3300005842 Bacteria 14060
169 Ga0068858_100007132 3300005842 Bacteria 10855
170 Ga0068858_100026808 3300005842 Bacteria 5353
171 Ga0068860_100002783 3300005843 Bacteria 18194
172 Ga0068860_100024367 3300005843 Bacteria 5847
173 Ga0068860_100028398 3300005843 Bacteria 5384
174 Ga0068860_100029624 3300005843 Bacteria 5267
175 Ga0068862_100011319 3300005844 Bacteria 7366
176 Ga0068862_100026123 3300005844 Bacteria 4909
177 Ga0068862_100041886 3300005844 Bacteria 3898
178 Ga0068862_100107325 3300005844 Bacteria 2448
179 Ga0068862_100199098 3300005844 Bacteria 1805
180 Ga0068862_100310143 3300005844 Bacteria 1454
181 Ga0068862_100345359 3300005844 Bacteria 1379
182 Ga0081455_10000679 3300005937 Bacteria 44123
183 Ga0081455_10004105 3300005937 Bacteria 16479
184 Ga0081539_10000006 3300005985 Bacteria 534555
185 Ga0070717_10003728 3300006028 Bacteria 10945
186 Ga0070717_10010793 3300006028 Bacteria 6911
187 Ga0070717_10074698 3300006028 Bacteria 2834
188 Ga0070715_10021861 3300006163 Bacteria 2486
189 Ga0070715_10026537 3300006163 Bacteria 2306
190 Ga0070715_10031022 3300006163 Bacteria 2166
191 Ga0070716_100000088 3300006173 Bacteria 36109
192 Ga0070716_100002763 3300006173 Bacteria 8149
193 Ga0070716_100006147 3300006173 Bacteria 5860
194 Ga0070716_100084949 3300006173 Bacteria 1899
195 Ga0070716_100230181 3300006173 Bacteria 1251
196 Ga0070712_100043363 3300006175 Bacteria 3097
197 Ga0070712_100055963 3300006175 Bacteria 2765
198 Ga0097621_100004518 3300006237 Bacteria 9696
199 Ga0097621_100149636 3300006237 Bacteria 2001
200 Ga0068871_100000772 3300006358 Bacteria 21551
201 Ga0068871_100180168 3300006358 Bacteria 1815
202 Ga0075428_100004730 3300006844 Bacteria 15076
203 Ga0075428_100162789 3300006844 Bacteria 2421
204 Ga0075430_100064425 3300006846 Bacteria 3079
205 Ga0075430_100219712 3300006846 Bacteria 1577
206 Ga0075431_100039561 3300006847 Bacteria 4858
207 Ga0075431_100073118 3300006847 Bacteria 3537
208 Ga0075433_10006653 3300006852 Bacteria 9153
209 Ga0075433_10022836 3300006852 Bacteria 5256
210 Ga0075433_10065305 3300006852 Bacteria 3192
211 Ga0075434_100013542 3300006871 Bacteria 7767
212 Ga0075434_100358853 3300006871 Bacteria 1478
213 Ga0075429_100002677 3300006880 Bacteria 14995
214 Ga0075429_100326419 3300006880 Bacteria 1343
215 Ga0068865_100000628 3300006881 Bacteria 19880
216 Ga0068865_100018665 3300006881 Bacteria 4479
217 Ga0068865_100074213 3300006881 Bacteria 2421
218 Ga0068865_100097540 3300006881 Bacteria 2145
219 Ga0075436_100006378 3300006914 Bacteria 8083
220 Ga0075436_100090533 3300006914 Bacteria 2127
221 Ga0075436_100108320 3300006914 Bacteria 1938
222 Ga0097620_100004269 3300006931 Bacteria 14594
223 Ga0097620_100007814 3300006931 Bacteria 10857
224 Ga0097620_100048836 3300006931 Bacteria 4251
225 Ga0097620_100099227 3300006931 Bacteria 2967
226 Ga0097620_100204784 3300006931 Bacteria 2058
227 Ga0097620_100428449 3300006931 Bacteria 1419
228 Ga0079104_1000308 3300006946 Bacteria 61968
229 Ga0079104_1001380 3300006946 Bacteria 16519
230 Ga0079104_1003875 3300006946 Bacteria 6697
231 Ga0075435_100007394 3300007076 Bacteria 7823
232 Ga0075435_100387134 3300007076 Bacteria 1201
233 Ga0099794_10008883 3300007265 Bacteria 4189
234 Ga0099795_10008084 3300007788 Bacteria 2979
235 Ga0105251_10002158 3300009011 Bacteria 15783
236 Ga0105251_10015033 3300009011 Bacteria 4246
237 Ga0105244_10000293 3300009036 Bacteria 49039
238 Ga0105240_10008075 3300009093 Bacteria 15126
239 Ga0105240_10085320 3300009093 Bacteria 3869
240 Ga0105240_10088147 3300009093 Bacteria 3798
241 Ga0105240_10517562 3300009093 Bacteria 1324
242 Ga0111539_10455538 3300009094 Unclassified 1490
243 Ga0105245_10000951 3300009098 Bacteria 26343
244 Ga0105247_10002396 3300009101 Bacteria 12742
245 Ga0105247_10061333 3300009101 Bacteria 2331
246 Ga0114129_10000841 3300009147 Bacteria 39754
247 Ga0114129_10007905 3300009147 Bacteria 15138
248 Ga0105243_10002746 3300009148 Bacteria 14634
249 Ga0105241_10095262 3300009174 Bacteria 2356
250 Ga0105242_10000779 3300009176 Bacteria 24760
251 Ga0105242_10021808 3300009176 Bacteria 5034
252 Ga0105248_10006682 3300009177 Bacteria 12658
253 Ga0105248_10057294 3300009177 Bacteria 4373
254 Ga0105248_10197860 3300009177 Bacteria 2264
255 Ga0105237_10140737 3300009545 Bacteria 2407
256 Ga0105237_10258577 3300009545 Bacteria 1744
257 Ga0105237_10278974 3300009545 Bacteria 1674
258 Ga0105237_10302991 3300009545 Bacteria 1601
259 Ga0105237_10433665 3300009545 Bacteria 1320
260 Ga0105237_10495323 3300009545 Bacteria 1228
261 Ga0105249_10000995 3300009553 Bacteria 25125
262 Ga0105249_10017575 3300009553 Bacteria 6349
263 Ga0105249_10043968 3300009553 Bacteria 4062
264 Ga0105249_10180346 3300009553 Bacteria 2054
265 Ga0105239_10010533 3300010375 Bacteria 10337
266 Ga0105239_10037988 3300010375 Bacteria 5276
267 Ga0105239_10052409 3300010375 Bacteria 4474
268 Ga0105239_10233331 3300010375 Bacteria 2065
269 Ga0105239_10491273 3300010375 Bacteria 1395
270 Ga0105246_10027556 3300011119 Bacteria 3724
271 Ga0105246_10118887 3300011119 Bacteria 1955
272 Ga0105246_10129408 3300011119 Bacteria 1883
273 Ga0157373_10009701 3300013100 Bacteria 7105
274 Ga0157371_10014930 3300013102 Bacteria 5844
275 Ga0157371_10016478 3300013102 Bacteria 5513
276 Ga0157371_10035692 3300013102 Bacteria 3562
277 Ga0157370_10000452 3300013104 Bacteria 51362
278 Ga0157370_10118437 3300013104 Bacteria 2473
279 Ga0157369_10001732 3300013105 Bacteria 26524
280 Ga0157369_10035219 3300013105 Bacteria 5490
281 Ga0157369_10140326 3300013105 Bacteria 2557
282 Ga0157369_10620257 3300013105 Bacteria 1116
283 Ga0157374_10023374 3300013296 Bacteria 5530
284 Ga0157374_10238651 3300013296 Bacteria 1787
285 Ga0157374_10304336 3300013296 Bacteria 1577
286 Ga0157378_10000590 3300013297 Bacteria 34084
287 Ga0157378_10054853 3300013297 Bacteria 3549
288 Ga0163162_10072025 3300013306 Bacteria 3510
289 Ga0163162_10288648 3300013306 Bacteria 1772
290 Ga0163162_10376876 3300013306 Bacteria 1552
291 Ga0157372_10001062 3300013307 Bacteria 30024
292 Ga0157372_10341051 3300013307 Bacteria 1745
293 Ga0157375_10061997 3300013308 Bacteria 3714
294 Ga0157375_10288654 3300013308 Bacteria 1803
295 Ga0163163_10018471 3300014325 Bacteria 6528
296 Ga0163163_10029120 3300014325 Bacteria 5310
297 Ga0163163_10146475 3300014325 Bacteria 2405
298 Ga0163163_10202981 3300014325 Bacteria 2031
299 Ga0157379_10036534 3300014968 Bacteria 4380
300 Ga0157379_10225498 3300014968 Bacteria 1698
301 Ga0157376_10005783 3300014969 Bacteria 8664
302 Ga0157376_10007674 3300014969 Bacteria 7727
303 Ga0157376_10184983 3300014969 Bacteria 1907
304 Ga0182006_1007687 3300015261 Bacteria 4923
305 Ga0163161_10120572 3300017792 Bacteria 1970
306 Ga0206353_11229857 3300020082 Bacteria 1166
307 Ga0213874_10012646 3300021377 Bacteria 2169
308 Ga0213875_10017205 3300021388 Bacteria 3498
309 Ga0213875_10074012 3300021388 Bacteria 1589
310 Ga0224712_10021090 3300022467 Bacteria 2224
311 Ga0224572_1000869 3300024225 Bacteria 4061
312 Ga0207425_1006279 3300025245 Bacteria 3268
313 Ga0209759_1008745 3300025256 Bacteria 3129
314 Ga0209129_1000008 3300025258 Bacteria 640959
315 Ga0209256_1020720 3300025299 Unclassified 2042
316 Ga0207655_1000026 3300025728 Bacteria 445528
317 Ga0207655_1001273 3300025728 Bacteria 24068
318 Ga0207655_1003937 3300025728 Bacteria 10769
319 Ga0207655_1031276 3300025728 Bacteria 2456
320 Ga0207692_10000891 3300025898 Bacteria 10795
321 Ga0207692_10035485 3300025898 Bacteria 2423
322 Ga0207692_10202050 3300025898 Bacteria 1169
323 Ga0207642_10055381 3300025899 Bacteria 1814
324 Ga0207642_10273093 3300025899 Bacteria 969
325 Ga0207710_10001639 3300025900 Bacteria 10932
326 Ga0207680_10006851 3300025903 Bacteria 5530
327 Ga0207680_10134934 3300025903 Bacteria 1630
328 Ga0207680_10141296 3300025903 Bacteria 1596
329 Ga0207685_10002959 3300025905 Bacteria 4025
330 Ga0207685_10017353 3300025905 Bacteria 2325
331 Ga0207685_10047295 3300025905 Bacteria 1641
332 Ga0207699_10000165 3300025906 Bacteria 40682
333 Ga0207699_10002296 3300025906 Bacteria 9033
334 Ga0207699_10123006 3300025906 Bacteria 1681
335 Ga0207699_10298086 3300025906 Bacteria 1125
336 Ga0207643_10058094 3300025908 Bacteria 2203
337 Ga0207643_10071466 3300025908 Bacteria 1998
338 Ga0207684_10132377 3300025910 Bacteria 2140
339 Ga0207654_10049177 3300025911 Bacteria 2417
340 Ga0207654_10253900 3300025911 Bacteria 1180
341 Ga0207707_10000075 3300025912 Bacteria 101459
342 Ga0207707_10000115 3300025912 Bacteria 81416
343 Ga0207707_10000140 3300025912 Bacteria 74787
344 Ga0207707_10000148 3300025912 Bacteria 73167
345 Ga0207707_10001203 3300025912 Bacteria 24355
346 Ga0207707_10002174 3300025912 Bacteria 17735
347 Ga0207707_10018316 3300025912 Bacteria 6104
348 Ga0207707_10064108 3300025912 Bacteria 3198
349 Ga0207707_10086326 3300025912 Bacteria 2742
350 Ga0207707_10192374 3300025912 Bacteria 1780
351 Ga0207695_10012932 3300025913 Bacteria 9985
352 Ga0207695_10020357 3300025913 Bacteria 7603
353 Ga0207695_10021988 3300025913 Bacteria 7259
354 Ga0207695_10052459 3300025913 Bacteria 4273
355 Ga0207695_10129619 3300025913 Bacteria 2481
356 Ga0207693_10000711 3300025915 Bacteria 29948
357 Ga0207693_10000836 3300025915 Bacteria 27414
358 Ga0207693_10012599 3300025915 Bacteria 6831
359 Ga0207693_10167930 3300025915 Bacteria 1728
360 Ga0207663_10044739 3300025916 Bacteria 2719
361 Ga0207663_10082137 3300025916 Bacteria 2113
362 Ga0207663_10147814 3300025916 Bacteria 1645
363 Ga0207660_10010953 3300025917 Bacteria 5894
364 Ga0207660_10045704 3300025917 Bacteria 3085
365 Ga0207660_10068410 3300025917 Bacteria 2575
366 Ga0207660_10218379 3300025917 Unclassified 1495
367 Ga0207662_10000144 3300025918 Bacteria 34347
368 Ga0207649_10248195 3300025920 Bacteria 1281
369 Ga0207652_10019843 3300025921 Bacteria 5533
370 Ga0207652_10024846 3300025921 Bacteria 4973
371 Ga0207652_10042962 3300025921 Bacteria 3848
372 Ga0207652_10066650 3300025921 Bacteria 3121
373 Ga0207652_10069283 3300025921 Bacteria 3062
374 Ga0207652_10162625 3300025921 Bacteria 2001
375 Ga0207646_10039379 3300025922 Bacteria 4255
376 Ga0207646_10354989 3300025922 Bacteria 1325
377 Ga0207694_10046411 3300025924 Bacteria 3358
378 Ga0207694_10056274 3300025924 Unclassified 3054
379 Ga0207650_10113946 3300025925 Bacteria 2097
380 Ga0207650_10119403 3300025925 Bacteria 2050
381 Ga0207659_10055705 3300025926 Bacteria 2829
382 Ga0207687_10000617 3300025927 Bacteria 23998
383 Ga0207687_10126406 3300025927 Bacteria 1920
384 Ga0207700_10000297 3300025928 Bacteria 29514
385 Ga0207700_10043034 3300025928 Bacteria 3315
386 Ga0207700_10095243 3300025928 Bacteria 2361
387 Ga0207700_10220300 3300025928 Bacteria 1608
388 Ga0207664_10000224 3300025929 Bacteria 42785
389 Ga0207644_10000718 3300025931 Bacteria 20967
390 Ga0207644_10027518 3300025931 Bacteria 3928
391 Ga0207690_10155587 3300025932 Bacteria 1699
392 Ga0207686_10000533 3300025934 Bacteria 24601
393 Ga0207686_10068527 3300025934 Bacteria 2273
394 Ga0207709_10000671 3300025935 Bacteria 27699
395 Ga0207670_10002758 3300025936 Bacteria 9248
396 Ga0207669_10009150 3300025937 Bacteria 4701
397 Ga0207704_10071469 3300025938 Bacteria 2202
398 Ga0207704_10392890 3300025938 Bacteria 1092
399 Ga0207665_10000698 3300025939 Bacteria 22766
400 Ga0207665_10013863 3300025939 Bacteria 5301
401 Ga0207665_10014003 3300025939 Bacteria 5275
402 Ga0207665_10019995 3300025939 Bacteria 4400
403 Ga0207665_10049980 3300025939 Bacteria 2811
404 Ga0207665_10335800 3300025939 Bacteria 1137
405 Ga0207691_10361689 3300025940 Bacteria 1241
406 Ga0207711_10037440 3300025941 Bacteria 4120
407 Ga0207711_10317464 3300025941 Bacteria 1439
408 Ga0207689_10014975 3300025942 Bacteria 6579
409 Ga0207661_10077971 3300025944 Bacteria 2726
410 Ga0207661_10089530 3300025944 Bacteria 2561
411 Ga0207679_10009229 3300025945 Bacteria 6306
412 Ga0207679_10012674 3300025945 Bacteria 5503
413 Ga0207667_10006818 3300025949 Bacteria 13802
414 Ga0207667_10017408 3300025949 Bacteria 8089
415 Ga0207667_10067590 3300025949 Bacteria 3722
416 Ga0207651_10121974 3300025960 Bacteria 1978
417 Ga0207651_10167307 3300025960 Bacteria 1730
418 Ga0207712_10009011 3300025961 Bacteria 6312
419 Ga0207712_10025418 3300025961 Bacteria 3934
420 Ga0207712_10026592 3300025961 Bacteria 3857
421 Ga0207712_10396989 3300025961 Bacteria 1158
422 Ga0207640_10003394 3300025981 Bacteria 8581
423 Ga0207658_10001013 3300025986 Bacteria 22929
424 Ga0207658_10009144 3300025986 Bacteria 6722
425 Ga0207677_10073331 3300026023 Bacteria 2424
426 Ga0207677_10108147 3300026023 Bacteria 2064
427 Ga0207703_10001997 3300026035 Bacteria 17998
428 Ga0207703_10027866 3300026035 Bacteria 4449
429 Ga0207639_10183137 3300026041 Bacteria 1783
430 Ga0207639_10215465 3300026041 Bacteria 1655
431 Ga0207678_10015060 3300026067 Bacteria 6803
432 Ga0207678_10116209 3300026067 Bacteria 2282
433 Ga0207708_10000427 3300026075 Bacteria 32845
434 Ga0207708_10249449 3300026075 Bacteria 1430
435 Ga0207702_10187012 3300026078 Bacteria 1911
436 Ga0207702_10327155 3300026078 Bacteria 1461
437 Ga0207641_10001033 3300026088 Bacteria 28219
438 Ga0207641_10094596 3300026088 Unclassified 2621
439 Ga0207641_10134247 3300026088 Bacteria 2226
440 Ga0207648_10000018 3300026089 Bacteria 148157
441 Ga0207648_10055430 3300026089 Bacteria 3460
442 Ga0207648_10168017 3300026089 Bacteria 1938
443 Ga0207648_10200052 3300026089 Bacteria 1772
444 Ga0207648_10455939 3300026089 Bacteria 1165
445 Ga0207676_10010945 3300026095 Bacteria 6475
446 Ga0207676_10462659 3300026095 Bacteria 1198
447 Ga0207675_100000050 3300026118 Bacteria 83832
448 Ga0207675_100102318 3300026118 Bacteria 2700
449 Ga0207675_100195591 3300026118 Bacteria 1941
450 Ga0207683_10017307 3300026121 Bacteria 6141
451 Ga0207683_10019930 3300026121 Bacteria 5731
452 Ga0207683_10098090 3300026121 Bacteria 2614
453 Ga0207698_10012742 3300026142 Bacteria 5518
454 Ga0207698_10529242 3300026142 Bacteria 1152
455 Ga0209281_1000058 3300027111 Bacteria 300244
456 Ga0209281_1001193 3300027111 Bacteria 17757
457 Ga0209371_1000014 3300027312 Bacteria 661118
458 Ga0209371_1000054 3300027312 Bacteria 259676
459 Ga0209984_1002678 3300027424 Bacteria 2000
460 Ga0209995_1000886 3300027471 Bacteria 4644
461 Ga0209995_1014840 3300027471 Bacteria 1277
462 Ga0209179_1001321 3300027512 Bacteria 2996
463 Ga0209970_1005815 3300027614 Bacteria 2027
464 Ga0209983_1003351 3300027665 Bacteria 3433
465 Ga0209588_1014068 3300027671 Bacteria 2447
466 Ga0209588_1016014 3300027671 Bacteria 2310
467 Ga0209971_1001514 3300027682 Bacteria 5753
468 Ga0209974_10008018 3300027876 Bacteria 3620
469 Ga0207428_10001317 3300027907 Bacteria 26410
470 Ga0268266_10002891 3300028379 Bacteria 17806
471 Ga0268266_10007953 3300028379 Bacteria 9481
472 Ga0268266_10022791 3300028379 Bacteria 5331
473 Ga0268266_10049644 3300028379 Bacteria 3598
474 Ga0268266_10062739 3300028379 Bacteria 3208
475 Ga0268266_10108480 3300028379 Bacteria 2456
476 Ga0268266_10120601 3300028379 Bacteria 2333
477 Ga0268266_10379280 3300028379 Bacteria 1333
478 Ga0268265_10017012 3300028380 Bacteria 5007
479 Ga0268265_10039433 3300028380 Bacteria 3482
480 Ga0268265_10050324 3300028380 Bacteria 3139
481 Ga0268265_10072968 3300028380 Bacteria 2679
482 Ga0268265_10151055 3300028380 Bacteria 1959
483 Ga0268265_10220746 3300028380 Bacteria 1658
484 Ga0268264_10000198 3300028381 Bacteria 122906
485 Ga0268264_10001294 3300028381 Bacteria 23624
486 Ga0268264_10018094 3300028381 Bacteria 5763
487 Ga0268264_10185648 3300028381 Unclassified 1892
488 Ga0307515_10003416 3300028794 Bacteria 33442
489 Ga0265338_10034673 3300028800 Bacteria 4873
490 Ga0268256_1000012 3300030500 Bacteria 794553
491 Ga0268256_1000021 3300030500 Bacteria 542735
492 Ga0307511_10000048 3300030521 Bacteria 98665
493 Ga0307511_10009582 3300030521 Bacteria 9647
494 Ga0265328_10014425 3300031239 Bacteria 3112
495 Ga0265340_10024043 3300031247 Bacteria 3098
496 Ga0265340_10054871 3300031247 Bacteria 1921
497 Ga0265339_10107866 3300031249 Bacteria 1444
498 Ga0265331_10010845 3300031250 Bacteria 5012
499 Ga0265327_10003233 3300031251 Bacteria 15840
500 Ga0307513_10013985 3300031456 Bacteria 9831
501 Ga0307513_10028805 3300031456 Bacteria 6343
502 Ga0307513_10156325 3300031456 Bacteria 2179
503 Ga0307509_10000017 3300031507 Bacteria 265012
504 Ga0307509_10000803 3300031507 Bacteria 53898
505 Ga0307509_10136691 3300031507 Bacteria 2395
506 Ga0307408_100027435 3300031548 Bacteria 3924
507 Ga0316575_10034701 3300031665 Bacteria 1982
508 Ga0316579_10000158 3300031691 Bacteria 19318
509 Ga0316579_10006029 3300031691 Bacteria 4922
510 Ga0316576_10009427 3300031727 Bacteria 6299
511 Ga0316576_10024964 3300031727 Bacteria 4180
512 Ga0316576_10029895 3300031727 Bacteria 3854
513 Ga0316576_10136287 3300031727 Bacteria 1847
514 Ga0316578_10056886 3300031728 Bacteria 2297
515 Ga0316578_10127593 3300031728 Bacteria 1530
516 Ga0316577_10003059 3300031733 Bacteria 8392
517 Ga0316577_10072152 3300031733 Bacteria 1927
518 Ga0307413_10004776 3300031824 Bacteria 5950
519 Ga0307410_10000500 3300031852 Bacteria 15951
520 Ga0307407_10021514 3300031903 Bacteria 3328
521 Ga0307412_10077641 3300031911 Bacteria 2285
522 Ga0307409_100000732 3300031995 Bacteria 14712
523 Ga0307409_100438604 3300031995 Bacteria 1257
524 Ga0307416_100146625 3300032002 Bacteria 2156
525 Ga0307416_100178547 3300032002 Bacteria 1987
526 Ga0307414_10143163 3300032004 Bacteria 1875
527 Ga0307414_10264018 3300032004 Bacteria 1438
528 Ga0307411_10060016 3300032005 Bacteria 2523
529 Ga0307411_10282903 3300032005 Bacteria 1321
530 Ga0316583_10021096 3300032133 Bacteria 2336
531 Ga0316585_10001855 3300032137 Bacteria 5648
532 Ga0316593_10004339 3300032168 Bacteria 3632
533 Ga0316593_10004729 3300032168 Unclassified 3523
534 Ga0316593_10007343 3300032168 Bacteria 3023
535 Ga0316593_10023661 3300032168 Bacteria 1941
536 Ga0316593_10026155 3300032168 Bacteria 1863
537 Ga0316593_10103175 3300032168 Bacteria 1013
538 Ga0307510_10000002 3300033180 Bacteria 801565
539 Ga0307510_10063197 3300033180 Bacteria 3773
540 Ga0373938_0036310 3300034957 Bacteria 1078
541 Ga0373926_0002919 3300035083 Bacteria 5481
542 Ga0373926_0005260 3300035083 Bacteria 4259
543 Ga0373926_0028007 3300035083 Bacteria 1976
544 Ga0373934_0003089 3300035086 Bacteria 6079
545 Ga0373944_0000876 3300035089 Bacteria 7419
546 Ga0373949_0028016 3300035090 Bacteria 1328
547 Ga0373923_0074354 3300035111 Bacteria 1464
548 Ga0373923_0088128 3300035111 Bacteria 1354
549 Ga0373932_0001979 3300035112 Bacteria 5406
550 Ga0373936_0000488 3300035113 Bacteria 13427
551 Ga0373936_0006850 3300035113 Bacteria 4288
552 Ga0373936_0033970 3300035113 Bacteria 2024
553 Ga0373945_0004013 3300035116 Bacteria 4654
554 Ga0373945_0008747 3300035116 Bacteria 3304
555 Ga0373954_0002373 3300035118 Bacteria 7874
556 Ga0373954_0055222 3300035118 Bacteria 1868
557 Ga0373956_0077750 3300035119 Bacteria 1519
558 Ga0373943_0004831 3300035170 Bacteria 6092
559 Ga0373943_0016313 3300035170 Bacteria 3385
560 Ga0373943_0078886 3300035170 Bacteria 1684
561 Ga0373946_0000439 3300035171 Bacteria 13619
562 Ga0373946_0026733 3300035171 Bacteria 2278
563 Ga0373946_0029774 3300035171 Bacteria 2176
564 Ga0373946_0032111 3300035171 Bacteria 2107
565 Ga0373955_0059225 3300035172 Bacteria 2109
566 Ga0373955_0099325 3300035172 Bacteria 1668
567 Ga0316574_0007609 3300035398 Bacteria 5950
568 Ga0316574_0016469 3300035398 Bacteria 4309
569 Ga0316574_0033450 3300035398 Bacteria 3129
570 Ga0316574_0037376 3300035398 Bacteria 2978
571 Ga0316574_0073569 3300035398 Bacteria 2161
572 Ga0316574_0074137 3300035398 Bacteria 2153
573 Ga0316574_0099000 3300035398 Bacteria 1865
574 Ga0316574_0134428 3300035398 Bacteria 1592
575 Ga0373931_0030542 3300035691 Bacteria 2774
576 Ga0373931_0134062 3300035691 Bacteria 1428
577 Ga0373935_0000618 3300035692 Bacteria 18647
578 Ga0373935_0004234 3300035692 Bacteria 8414
579 Ga0373927_0000383 3300035695 Bacteria 34290
580 Ga0373927_0117777 3300035695 Bacteria 1732
581 Ga0373933_0010727 3300035724 Bacteria 5026
582 Ga0373947_0000002 3300035725 Bacteria 383924
583 Ga0373947_0005590 3300035725 Bacteria 7330
584 Ga0373947_0059036 3300035725 Bacteria 2325
585 Ga0373947_0109028 3300035725 Bacteria 1747
586 Ga0373937_0035130 3300036401 Bacteria 4560
587 Ga0316582_0004967 3300036647 Bacteria 6795
588 Ga0316582_0064613 3300036647 Bacteria 2354
589 Ga0316582_0084293 3300036647 Bacteria 2080
590 Ga0316584_0030898 3300036712 Bacteria 3959
591 Ga0316584_0053695 3300036712 Bacteria 3016
592 Ga0316584_0066260 3300036712 Bacteria 2706
593 Ga0373925_0005223 3300037068 Bacteria 9707
594 Ga0373925_0008937 3300037068 Bacteria 7300
595 Ga0373925_0013418 3300037068 Bacteria 5928
596 Ga0373925_0038319 3300037068 Bacteria 3543
597 Ga0395900_0000060 3300037418 Bacteria 205509
598 Ga0395900_0089295 3300037418 Bacteria 3168
599 Ga0395900_0216386 3300037418 Bacteria 1933
600 Ga0395898_0083235 3300037466 Bacteria 3084
601 Ga0436364_0260906 3300037853 Bacteria 21582
602 Ga0400484_23031 3300038725 Bacteria 6518
603 Ga0400484_27744 3300038725 Bacteria 2344
604 Ga0400490_45667 3300038726 Bacteria 1291
605 Ga0400483_055564 3300039062 Bacteria 3939
606 Ga0400483_086083 3300039062 Bacteria 1660
607 Ga0400483_093671 3300039062 Bacteria 1758
608 Ga0400483_201732 3300039062 Bacteria 4012
609 Ga0400483_280570 3300039062 Bacteria 2951
610 Ga0436365_0360171 3300039437 Bacteria 13869
611 Ga0436365_1274404 3300039437 Bacteria 1696
612 Ga0436365_1414349 3300039437 Bacteria 6345
613 Ga0436360_1005797 3300039438 Bacteria 6145
614 Ga0436361_0576483 3300039447 Bacteria 1996
615 Ga0436363_0296494 3300039450 Bacteria 2831
616 Ga0436363_0375975 3300039450 Bacteria 36949
617 Ga0436363_1127370 3300039450 Bacteria 2313
618 Ga0436363_1153079 3300039450 Bacteria 1351
619 Ga0436363_1648012 3300039450 Bacteria 2447
620 Ga0439436_0011487 3300041404 Bacteria 2689
621 Ga0439447_003544 3300041407 Bacteria 5531
622 Ga0451789_1314313 3300041443 Bacteria 3094
623 Ga0451793_0368982 3300041452 Bacteria 1212
624 Ga0451802_1342131 3300041460 Bacteria 1915
625 Ga0451837_0466646 3300041494 Bacteria 1810
626 Ga0451841_0078952 3300041498 Bacteria 1172
627 Ga0439432_002736 3300042006 Bacteria 6589
628 Ga0439432_004394 3300042006 Bacteria 5151
629 Ga0439451_005425 3300042009 Bacteria 2599
630 Ga0439451_007565 3300042009 Bacteria 2211
631 Ga0439452_000004 3300042010 Bacteria 764268
632 Ga0439452_000005 3300042010 Bacteria 646919
633 Ga0439452_000428 3300042010 Bacteria 24279
634 Ga0439452_008326 3300042010 Bacteria 3129
635 Ga0439444_0001930 3300042437 Bacteria 2765
636 Ga0439460_0000378 3300042461 Bacteria 9469
637 Ga0451577_0016678 3300042876 Bacteria 6793
638 Ga0451577_0057889 3300042876 Bacteria 3454
639 Ga0466969_0000960 3300044656 Bacteria 15534
640 Ga0466969_0005735 3300044656 Bacteria 6600
641 Ga0466969_0118262 3300044656 Bacteria 1235
642 Ga0466966_0009008 3300044684 Bacteria 6614
643 Ga0466966_0053439 3300044684 Bacteria 2563
644 Ga0466963_0112886 3300044694 Bacteria 1866
645 Ga0453684_0045609 3300044712 Bacteria 5844
646 Ga0466971_0001123 3300044719 Bacteria 11133
647 Ga0466968_0027250 3300044735 Bacteria 2351
648 Ga0466970_0046170 3300044765 Bacteria 2320
649 Ga0466957_0024169 3300044842 Bacteria 3595
650 Ga0466960_0013133 3300044901 Bacteria 3512
651 Ga0466959_0014029 3300045049 Bacteria 5816
652 Ga0466959_0034640 3300045049 Bacteria 3735
653 Ga0466959_0053806 3300045049 Bacteria 2942
654 Ga0451576_0000217 3300045051 Bacteria 142222
655 Ga0451576_0067931 3300045051 Bacteria 3710
656 Ga0451576_0091467 3300045051 Bacteria 3165
657 Ga0466958_0036183 3300045836 Bacteria 2954
658 Ga0466958_0072990 3300045836 Bacteria 2102
659 Ga0466967_0042746 3300045976 Bacteria 3918
660 Ga0466967_0161509 3300045976 Bacteria 2103
661 Ga0495592_0010288 3300046454 Bacteria 7053
662 Ga0495592_0120274 3300046454 Bacteria 1848
663 Ga0495603_0010466 3300046455 Bacteria 5619
664 Ga0495590_0002047 3300046457 Bacteria 8457
665 Ga0495629_0347594 3300046459 Bacteria 1012
666 Ga0495638_0076082 3300046460 Bacteria 2045
667 Ga0495638_0160552 3300046460 Bacteria 1297
668 Ga0495641_0042287 3300046461 Bacteria 2112
669 Ga0495653_0006412 3300046463 Bacteria 9646
670 Ga0495580_0001506 3300046472 Bacteria 20489
671 Ga0495580_0015225 3300046472 Bacteria 5811
672 Ga0495580_0043965 3300046472 Bacteria 3178
673 Ga0495582_0037643 3300046473 Bacteria 2661
674 Ga0495639_0002165 3300046475 Bacteria 8661
675 Ga0495639_0032526 3300046475 Bacteria 2326
676 Ga0495662_0013627 3300046476 Bacteria 3958
677 Ga0495664_0004691 3300046477 Bacteria 7476
678 Ga0495584_0023980 3300046491 Bacteria 3093
679 Ga0495594_0082982 3300046499 Bacteria 1791
680 Ga0495594_0151865 3300046499 Bacteria 1315
681 Ga0495596_0027282 3300046500 Bacteria 2298
682 Ga0495583_0021099 3300046506 Bacteria 3356
683 Ga0495608_0144824 3300046511 Bacteria 1515
684 Ga0495618_0093151 3300046514 Bacteria 1926
685 Ga0495628_0056228 3300046516 Bacteria 3098
686 Ga0495630_0028591 3300046517 Bacteria 4143
687 Ga0495630_0039960 3300046517 Bacteria 3506
688 Ga0495630_0293994 3300046517 Bacteria 1241
689 Ga0495648_0013861 3300046524 Bacteria 5935
690 Ga0495648_0117804 3300046524 Bacteria 1433
691 Ga0495666_0046639 3300046526 Bacteria 2088
692 Ga0495665_0051846 3300046531 Bacteria 2173
693 Ga0495640_0053821 3300046533 Bacteria 2758
694 Ga0495586_0004720 3300046535 Bacteria 7284
695 Ga0495586_0004892 3300046535 Bacteria 7164
696 Ga0495587_0097364 3300046536 Bacteria 1696
697 Ga0495667_0036525 3300046559 Bacteria 3279
698 Ga0495667_0068892 3300046559 Bacteria 2309
699 Ga0495656_0004463 3300046615 Bacteria 4796
700 Ga0495668_0148242 3300046616 Bacteria 1285
701 Ga0495634_0041752 3300046642 Bacteria 3114
702 Ga0495625_0029573 3300046660 Bacteria 4095
703 Ga0495635_0000464 3300046663 Bacteria 25665
704 Ga0495657_0088806 3300046675 Bacteria 1986
705 Ga0495657_0166310 3300046675 Bacteria 1361
706 Ga0495599_0046240 3300046678 Bacteria 2729
707 Ga0495599_0065356 3300046678 Bacteria 2273
708 Ga0495646_0129415 3300046680 Bacteria 1422
709 Ga0495647_0001482 3300046681 Bacteria 7280
710 Ga0495647_0003243 3300046681 Bacteria 5205
711 Ga0495658_0006801 3300046683 Bacteria 5628
712 Ga0495658_0085759 3300046683 Bacteria 1856
713 Ga0495671_0024188 3300046692 Bacteria 3166
714 Ga0495649_0003326 3300046694 Bacteria 10920
715 Ga0495600_0003135 3300046809 Bacteria 9677
716 Ga0495581_0064804 3300047315 Bacteria 2111
717 Ga0495604_0155405 3300047317 Bacteria 1621
718 Ga0495674_0094152 3300047319 Bacteria 2555
719 Ga0495676_0038206 3300047321 Bacteria 3989
720 Ga0495676_0116557 3300047321 Bacteria 1950
721 Ga0495680_0035758 3300047322 Bacteria 3996
722 Ga0495675_0036099 3300047444 Bacteria 3154
723 Ga0495681_0133669 3300047470 Bacteria 1054
724 Ga0495684_0024315 3300047471 Bacteria 4663
725 Ga0495602_0083747 3300048088 Bacteria 2671
726 Ga0495602_0238165 3300048088 Bacteria 1363
727 Ga0495615_0025199 3300048090 Bacteria 1379
728 Ga0495626_0097765 3300048091 Bacteria 1283
729 Ga0496100_0077976 3300048903 Bacteria 2229
730 Ga0496100_0117923 3300048903 Bacteria 1853
731 Ga0496102_0024944 3300048905 Bacteria 5318
732 Ga0496102_0032576 3300048905 Bacteria 4682
733 Ga0496103_0078166 3300048906 Bacteria 2078
734 Ga0496104_0448094 3300048907 Bacteria 1203
735 Ga0496105_0121352 3300048908 Bacteria 2155
736 Ga0496107_0099375 3300048910 Bacteria 2132
737 Ga0496108_0021701 3300048911 Bacteria 5279
738 Ga0496108_0446951 3300048911 Bacteria 1129
739 Ga0496109_0028132 3300048912 Bacteria 5026
740 Ga0496109_0200936 3300048912 Bacteria 1874
741 Ga0496110_0038938 3300048913 Bacteria 4138
742 Ga0496111_0003521 3300048914 Bacteria 9689
743 Ga0496112_0113896 3300048915 Bacteria 2675
744 Ga0496112_0175623 3300048915 Bacteria 2107
745 Ga0496112_0290370 3300048915 Bacteria 1581
746 Ga0496113_0086931 3300048916 Bacteria 2403
747 Ga0496114_0034713 3300048917 Bacteria 4162
748 Ga0496115_0021506 3300048918 Bacteria 4985
749 Ga0496115_0127037 3300048918 Bacteria 2101
750 Ga0496115_0194916 3300048918 Bacteria 1674
751 Ga0496116_0000217 3300048919 Bacteria 108128
752 Ga0496116_0032636 3300048919 Bacteria 3707
753 Ga0496116_0089752 3300048919 Bacteria 1873
754 Ga0496117_0000135 3300048920 Bacteria 160708
755 Ga0496117_0001101 3300048920 Bacteria 40741
756 Ga0496117_0005290 3300048920 Bacteria 13669
757 Ga0496118_0000098 3300048921 Bacteria 160610
758 Ga0496118_0002338 3300048921 Bacteria 25715
759 Ga0496118_0085298 3300048921 Bacteria 2199
760 Ga0496119_0000026 3300048922 Bacteria 254759
761 Ga0496119_0081790 3300048922 Bacteria 1859
762 Ga0496120_0000543 3300048923 Bacteria 57596
763 Ga0496120_0031913 3300048923 Bacteria 3182
764 Ga0496120_0071899 3300048923 Bacteria 1897
765 Ga0496121_0023475 3300048924 Bacteria 5938
766 Ga0496121_0166063 3300048924 Bacteria 1608
767 Ga0496124_0000142 3300048927 Bacteria 147311
768 Ga0496124_0007498 3300048927 Bacteria 11584
769 Ga0496124_0078346 3300048927 Bacteria 2724
770 Ga0496125_0002765 3300048928 Bacteria 22202
771 Ga0496125_0014965 3300048928 Bacteria 7531
772 Ga0496125_0028906 3300048928 Bacteria 4993
773 Ga0496126_0026574 3300048929 Bacteria 5547
774 Ga0496126_0035411 3300048929 Bacteria 4679
775 Ga0496126_0085718 3300048929 Bacteria 2776
776 Ga0496126_0248437 3300048929 Bacteria 1483
777 Ga0501033_0191500 3300049570 Bacteria 1463
778 Ga0501034_0070053 3300049571 Bacteria 3518
779 Ga0501034_0390282 3300049571 Bacteria 1316
780 Ga0501036_0026800 3300049572 Bacteria 4869
781 Ga0501036_0206502 3300049572 Bacteria 1651
782 Ga0501037_0109540 3300049573 Bacteria 1990
783 Ga0501037_0113504 3300049573 Bacteria 1951
784 Ga0501038_0054535 3300049574 Bacteria 3438
785 Ga0501038_0193941 3300049574 Bacteria 1633
786 Ga0501039_0014722 3300049575 Bacteria 5984
787 Ga0501040_0014832 3300049576 Bacteria 5143
788 Ga0501040_0070544 3300049576 Bacteria 2411
789 Ga0501041_0022500 3300049577 Bacteria 3774
790 Ga0501042_0004832 3300049578 Bacteria 8614
791 Ga0501046_0024641 3300049580 Bacteria 4932
792 Ga0501047_0045918 3300049581 Bacteria 4223
793 Ga0501048_0017183 3300049582 Bacteria 5331
794 Ga0501048_0043811 3300049582 Bacteria 3202
795 Ga0501067_0016549 3300049583 Bacteria 4075
796 Ga0501067_0021788 3300049583 Bacteria 3546
797 Ga0501068_0000804 3300049584 Bacteria 16286
798 Ga0501070_0011456 3300049586 Bacteria 7491
799 Ga0501071_0002075 3300049587 Bacteria 12010
800 Ga0501071_0013048 3300049587 Bacteria 5654
801 Ga0501071_0295976 3300049587 Bacteria 1226
802 Ga0501072_0006963 3300049588 Bacteria 8581
803 Ga0501072_0019946 3300049588 Bacteria 5189
804 Ga0501072_0020139 3300049588 Bacteria 5166
805 Ga0501073_0006025 3300049589 Bacteria 9045
806 Ga0501074_0005572 3300049590 Bacteria 9057
807 Ga0501074_0033465 3300049590 Bacteria 3725
808 Ga0501074_0046875 3300049590 Bacteria 3125
809 Ga0501074_0105954 3300049590 Bacteria 2013
810 Ga0501075_0018337 3300049591 Bacteria 5065
811 Ga0501075_0134707 3300049591 Bacteria 1882
812 Ga0501076_0000300 3300049592 Bacteria 30853
813 Ga0501076_0010795 3300049592 Bacteria 6791
814 Ga0501076_0048350 3300049592 Bacteria 3363
815 Ga0501076_0179238 3300049592 Bacteria 1727
816 Ga0501076_0224221 3300049592 Bacteria 1536
817 Ga0501077_0004667 3300049593 Bacteria 8327
818 Ga0501079_0001458 3300049741 Bacteria 16725
819 Ga0501079_0024720 3300049741 Bacteria 4609
820 Ga0501079_0142134 3300049741 Bacteria 1869
821 Ga0501079_0302674 3300049741 Bacteria 1251
822 Ga0501080_0017301 3300049742 Bacteria 6663
823 Ga0501080_0032012 3300049742 Bacteria 4902
824 Ga0501080_0269684 3300049742 Bacteria 1549
825 Ga0501081_0035049 3300049743 Bacteria 3416
826 Ga0501081_0234111 3300049743 Bacteria 1338
827 Ga0501083_0009175 3300049744 Bacteria 6989
828 Ga0501083_0246352 3300049744 Bacteria 1163
829 Ga0501045_0002979 3300049824 Bacteria 11587
830 Ga0501045_0017362 3300049824 Bacteria 5108
831 Ga0501045_0116759 3300049824 Bacteria 1980
832 nmdc:mga05p37_13712_c1 3300050507 Bacteria 9714
833 nmdc:mga05p37_2253_c1 3300050507 Bacteria 22457
834 nmdc:mga09592_997_c1 3300050508 Bacteria 22431
835 nmdc:mga06r32_55832_c1 3300050510 Bacteria 3789
836 nmdc:mga08y16_6690_c1 3300050511 Bacteria 12097
837 nmdc:mga0n895_1033_c1 3300050512 Bacteria 20242
838 nmdc:mga0n895_250449_c1 3300050512 Bacteria 1798
839 nmdc:mga0n895_266530_c1 3300050512 Bacteria 1738
840 nmdc:mga0rr50_10423_c1 3300050513 Bacteria 5896
841 nmdc:mga0rr50_1805_c1 3300050513 Bacteria 11829
842 nmdc:mga0rr50_202081_c1 3300050513 Bacteria 1633
843 nmdc:mga08x19_100134_c1 3300050514 Bacteria 1922
844 nmdc:mga08x19_4186_c1 3300050514 Bacteria 8549
845 nmdc:mga08x19_5920_c1 3300050514 Bacteria 7233
846 nmdc:mga0a205_24706_c1 3300050515 Bacteria 5716
847 nmdc:mga0a205_25504_c1 3300050515 Bacteria 5632
848 nmdc:mga0a205_38742_c1 3300050515 Bacteria 4587
849 Ga0495601_0001851 3300053077 Bacteria 11771
850 Ga0495595_0025927 3300053084 Bacteria 2600
851 Ga0495619_0032252 3300053085 Bacteria 3398
852 Ga0500583_0014665 3300053092 Bacteria 3076
853 Ga0500583_0042636 3300053092 Bacteria 2068
854 Ga0500651_0135718 3300053093 Bacteria 1485
855 Ga0500641_0063851 3300053096 Bacteria 1537
856 Ga0500556_0000589 3300053104 Bacteria 23953
857 Ga0500562_043559 3300053108 Bacteria 1195
858 Ga0500594_0010636 3300053118 Bacteria 2140
859 Ga0500614_006711 3300053123 Bacteria 2422
860 Ga0500617_019162 3300053124 Bacteria 2988
861 Ga0500642_0128512 3300053130 Bacteria 1187
862 Ga0500652_074859 3300053131 Bacteria 1406
863 Ga0500658_0015386 3300053134 Bacteria 2840
864 Ga0500568_0010327 3300053139 Bacteria 4379
865 Ga0500568_0044626 3300053139 Bacteria 1767
866 Ga0500588_0004664 3300053146 Bacteria 2983
867 Ga0500616_0000018 3300053153 Bacteria 610976
868 Ga0500616_0040981 3300053153 Unclassified 2487
869 Ga0500622_0018631 3300053156 Bacteria 3689
870 Ga0500622_0115656 3300053156 Bacteria 1306
871 Ga0500633_0007765 3300053160 Bacteria 2724
872 Ga0501084_0011370 3300054114 Bacteria 7372
873 Ga0501084_0014474 3300054114 Bacteria 6539
874 Ga0501084_0037220 3300054114 Bacteria 4065
875 Ga0590077_017742 3300059426 Bacteria 1499
876 Ga0501082_0015602 3300060353 Bacteria 6539
877 Ga0501082_0140118 3300060353 Bacteria 2099
878 Ga0501082_0250136 3300060353 Bacteria 1542
879 Ga0530510_0003481 3300061734 Bacteria 10822
880 Ga0530510_0010479 3300061734 Bacteria 6501
881 Ga0530510_0010649 3300061734 Bacteria 6450

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041404 Ga0439436_0011487 Ga0439436_0011487_156_947 258
2 3300049588 Ga0501072_0019946 Ga0501072_0019946_4311_5174 263
3 3300027671 Ga0209588_1016014 Ga0209588_10160143 265
4 3300031727 Ga0316576_10009427 Ga0316576_100094272 277
5 3300036712 Ga0316584_0066260 Ga0316584_0066260_35_1051 277
6 3300005434 Ga0070709_10000132 Ga0070709_1000013239 278
7 3300005435 Ga0070714_100001047 Ga0070714_1000010476 278
8 3300005436 Ga0070713_100000696 Ga0070713_1000006968 278
9 3300005437 Ga0070710_10001105 Ga0070710_100011057 278
10 3300006163 Ga0070715_10021861 Ga0070715_100218614 278
11 3300006173 Ga0070716_100000088 Ga0070716_10000008814 278
12 3300025898 Ga0207692_10000891 Ga0207692_100008914 278
13 3300025906 Ga0207699_10000165 Ga0207699_1000016526 278
14 3300025915 Ga0207693_10000836 Ga0207693_1000083617 278
15 3300025928 Ga0207700_10000297 Ga0207700_1000029714 278
16 3300025929 Ga0207664_10000224 Ga0207664_1000022428 278
17 3300025939 Ga0207665_10000698 Ga0207665_100006986 278
18 3300035083 Ga0373926_0028007 Ga0373926_0028007_135_1094 278
19 3300035692 Ga0373935_0000618 Ga0373935_0000618_7547_8506 278
20 3300035725 Ga0373947_0000002 Ga0373947_0000002_234654_235613 278
21 3300026142 Ga0207698_10529242 Ga0207698_105292421 280
22 3300028379 Ga0268266_10062739 Ga0268266_100627393 280
23 3300044656 Ga0466969_0000960 Ga0466969_0000960_8612_9583 281
24 3300044765 Ga0466970_0046170 Ga0466970_0046170_611_1582 281
25 3300005841 Ga0068863_100095074 Ga0068863_1000950743 282
26 3300009545 Ga0105237_10278974 Ga0105237_102789743 282
27 3300010375 Ga0105239_10010533 Ga0105239_100105332 282
28 3300026088 Ga0207641_10001033 Ga0207641_1000103316 282
29 3300026088 Ga0207641_10094596 Ga0207641_100945963 282
30 3300028380 Ga0268265_10072968 Ga0268265_100729684 282
31 3300028381 Ga0268264_10185648 Ga0268264_101856483 282
32 3300053153 Ga0500616_0000018 Ga0500616_0000018_602287_603213 282
33 3300049581 Ga0501047_0045918 Ga0501047_0045918_3042_3971 283
34 3300006844 Ga0075428_100004730 Ga0075428_10000473012 284
35 3300006846 Ga0075430_100219712 Ga0075430_1002197122 284
36 3300006847 Ga0075431_100073118 Ga0075431_1000731181 284
37 3300006880 Ga0075429_100002677 Ga0075429_10000267718 284
38 3300009147 Ga0114129_10000841 Ga0114129_1000084119 284
39 3300010375 Ga0105239_10491273 Ga0105239_104912732 284
40 3300027907 Ga0207428_10001317 Ga0207428_1000131718 284
41 3300031507 Ga0307509_10000803 Ga0307509_100008032 284
42 3300035112 Ga0373932_0001979 Ga0373932_0001979_2558_3514 284
43 3300050507 nmdc:mga05p37_2253_c1 nmdc:mga05p37_2253_c1_12584_13540 284
44 3300050508 nmdc:mga09592_997_c1 nmdc:mga09592_997_c1_8075_9031 284
45 3300050511 nmdc:mga08y16_6690_c1 nmdc:mga08y16_6690_c1_5939_6895 284
46 3300053130 Ga0500642_0128512 Ga0500642_0128512_28_906 284
47 iso_pu_bacteria 640427133 640487032 284
48 3300005458 Ga0070681_10010910 Ga0070681_100109107 285
49 3300025912 Ga0207707_10064108 Ga0207707_100641082 285
50 3300025917 Ga0207660_10068410 Ga0207660_100684103 285
51 3300025924 Ga0207694_10046411 Ga0207694_100464112 285
52 3300025944 Ga0207661_10089530 Ga0207661_100895303 285
53 3300049590 Ga0501074_0105954 Ga0501074_0105954_617_1549 285
54 3300049824 Ga0501045_0017362 Ga0501045_0017362_299_1231 285
55 3300005535 Ga0070684_100340440 Ga0070684_1003404402 286
56 3300005518 Ga0070699_100063452 Ga0070699_1000634522 287
57 3300031249 Ga0265339_10107866 Ga0265339_101078662 287
58 3300049592 Ga0501076_0179238 Ga0501076_0179238_50_982 287
59 3300025916 Ga0207663_10147814 Ga0207663_101478142 288
60 3300005467 Ga0070706_100041096 Ga0070706_1000410963 289
61 3300005468 Ga0070707_100077507 Ga0070707_1000775072 289
62 3300005471 Ga0070698_100005850 Ga0070698_10000585013 289
63 3300005471 Ga0070698_100020872 Ga0070698_1000208725 289
64 3300005844 Ga0068862_100041886 Ga0068862_1000418864 289
65 3300006028 Ga0070717_10010793 Ga0070717_100107932 289
66 3300009093 Ga0105240_10517562 Ga0105240_105175622 289
67 3300009094 Ga0111539_10455538 Ga0111539_104555382 289
68 3300009553 Ga0105249_10017575 Ga0105249_100175754 289
69 3300025922 Ga0207646_10039379 Ga0207646_100393793 289
70 3300046459 Ga0495629_0347594 Ga0495629_0347594_14_901 289
71 3300060353 Ga0501082_0140118 Ga0501082_0140118_1139_2065 289
72 3300005471 Ga0070698_100051215 Ga0070698_1000512153 290
73 3300006173 Ga0070716_100002763 Ga0070716_1000027635 290
74 3300025939 Ga0207665_10013863 Ga0207665_100138634 290
75 3300031239 Ga0265328_10014425 Ga0265328_100144253 290
76 3300005441 Ga0070700_100198944 Ga0070700_1001989442 291
77 3300005617 Ga0068859_100048836 Ga0068859_1000488362 291
78 3300005719 Ga0068861_100157116 Ga0068861_1001571162 291
79 3300006931 Ga0097620_100048836 Ga0097620_1000488362 291
80 3300013307 Ga0157372_10341051 Ga0157372_103410512 291
81 3300026075 Ga0207708_10249449 Ga0207708_102494491 291
82 3300026089 Ga0207648_10200052 Ga0207648_102000523 291
83 3300028380 Ga0268265_10050324 Ga0268265_100503244 291
84 3300005618 Ga0068864_100457037 Ga0068864_1004570372 293
85 3300005467 Ga0070706_100003733 Ga0070706_1000037333 294
86 3300005471 Ga0070698_100000354 Ga0070698_1000003548 294
87 3300005564 Ga0070664_100010321 Ga0070664_1000103214 294
88 3300006028 Ga0070717_10074698 Ga0070717_100746982 294
89 3300025910 Ga0207684_10132377 Ga0207684_101323773 294
90 3300025920 Ga0207649_10248195 Ga0207649_102481952 294
91 3300025945 Ga0207679_10009229 Ga0207679_100092295 294
92 3300026095 Ga0207676_10462659 Ga0207676_104626591 294
93 3300026118 Ga0207675_100102318 Ga0207675_1001023183 294
94 3300035398 Ga0316574_0033450 Ga0316574_0033450_693_1622 294
95 3300046517 Ga0495630_0293994 Ga0495630_0293994_16_942 294
96 3300046536 Ga0495587_0097364 Ga0495587_0097364_547_1476 294
97 3300046680 Ga0495646_0129415 Ga0495646_0129415_464_1393 294
98 3300047317 Ga0495604_0155405 Ga0495604_0155405_511_1440 294
99 3300005548 Ga0070665_100008678 Ga0070665_10000867811 295
100 3300009093 Ga0105240_10085320 Ga0105240_100853202 295
101 3300027471 Ga0209995_1014840 Ga0209995_10148402 295
102 3300028379 Ga0268266_10002891 Ga0268266_100028918 295
103 3300028380 Ga0268265_10039433 Ga0268265_100394332 295
104 3300044694 Ga0466963_0112886 Ga0466963_0112886_148_1098 295
105 3300045976 Ga0466967_0161509 Ga0466967_0161509_829_1779 295
106 3300048088 Ga0495602_0238165 Ga0495602_0238165_92_1042 295
107 3300048915 Ga0496112_0290370 Ga0496112_0290370_269_1219 295
108 3300048918 Ga0496115_0127037 Ga0496115_0127037_593_1543 295
109 3300053156 Ga0500622_0115656 Ga0500622_0115656_220_1119 295
110 3300005841 Ga0068863_100009793 Ga0068863_1000097935 296
111 3300005844 Ga0068862_100310143 Ga0068862_1003101433 296
112 3300025915 Ga0207693_10167930 Ga0207693_101679301 296
113 3300005341 Ga0070691_10025383 Ga0070691_100253833 297
114 3300039450 Ga0436363_1153079 Ga0436363_1153079_214_1167 297
115 3300042009 Ga0439451_007565 Ga0439451_007565_1236_2186 297
116 3300042437 Ga0439444_0001930 Ga0439444_0001930_403_1353 297
117 3300042461 Ga0439460_0000378 Ga0439460_0000378_6125_7075 297
118 3300049572 Ga0501036_0206502 Ga0501036_0206502_567_1532 297
119 3300049573 Ga0501037_0109540 Ga0501037_0109540_409_1374 297
120 3300049574 Ga0501038_0193941 Ga0501038_0193941_577_1542 297
121 3300049576 Ga0501040_0014832 Ga0501040_0014832_592_1542 297
122 3300049577 Ga0501041_0022500 Ga0501041_0022500_87_1052 297
123 3300049582 Ga0501048_0043811 Ga0501048_0043811_1712_2677 297
124 3300049587 Ga0501071_0013048 Ga0501071_0013048_2942_3907 297
125 3300049590 Ga0501074_0046875 Ga0501074_0046875_2001_2951 297
126 3300049592 Ga0501076_0000300 Ga0501076_0000300_20049_21014 297
127 3300049592 Ga0501076_0224221 Ga0501076_0224221_470_1420 297
128 3300049741 Ga0501079_0024720 Ga0501079_0024720_3002_3967 297
129 3300049742 Ga0501080_0269684 Ga0501080_0269684_467_1432 297
130 3300049743 Ga0501081_0035049 Ga0501081_0035049_2076_3041 297
131 3300049824 Ga0501045_0116759 Ga0501045_0116759_659_1624 297
132 3300054114 Ga0501084_0037220 Ga0501084_0037220_580_1545 297
133 3300060353 Ga0501082_0250136 Ga0501082_0250136_92_1057 297
134 3300061734 Ga0530510_0010479 Ga0530510_0010479_4815_5780 297
135 3300005330 Ga0070690_100011534 Ga0070690_1000115343 298
136 3300005335 Ga0070666_10013205 Ga0070666_100132054 298
137 3300005335 Ga0070666_10066444 Ga0070666_100664442 298
138 3300005336 Ga0070680_100054104 Ga0070680_1000541042 298
139 3300005338 Ga0068868_100226032 Ga0068868_1002260321 298
140 3300005355 Ga0070671_100002044 Ga0070671_1000020443 298
141 3300005356 Ga0070674_100109440 Ga0070674_1001094402 298
142 3300005435 Ga0070714_100024629 Ga0070714_1000246292 298
143 3300005435 Ga0070714_100085145 Ga0070714_1000851453 298
144 3300005436 Ga0070713_100003974 Ga0070713_1000039746 298
145 3300005436 Ga0070713_100121978 Ga0070713_1001219782 298
146 3300005437 Ga0070710_10034787 Ga0070710_100347873 298
147 3300005439 Ga0070711_100055982 Ga0070711_1000559823 298
148 3300005530 Ga0070679_100147308 Ga0070679_1001473082 298
149 3300005536 Ga0070697_100074834 Ga0070697_1000748343 298
150 3300005548 Ga0070665_100012130 Ga0070665_1000121302 298
151 3300005548 Ga0070665_100227305 Ga0070665_1002273052 298
152 3300005614 Ga0068856_100023424 Ga0068856_1000234244 298
153 3300005617 Ga0068859_100004269 Ga0068859_1000042696 298
154 3300005618 Ga0068864_100018240 Ga0068864_1000182405 298
155 3300005719 Ga0068861_100222452 Ga0068861_1002224522 298
156 3300005841 Ga0068863_100005874 Ga0068863_1000058744 298
157 3300005842 Ga0068858_100007132 Ga0068858_1000071326 298
158 3300005843 Ga0068860_100028398 Ga0068860_1000283983 298
159 3300006028 Ga0070717_10003728 Ga0070717_100037289 298
160 3300006173 Ga0070716_100084949 Ga0070716_1000849492 298
161 3300006175 Ga0070712_100055963 Ga0070712_1000559633 298
162 3300006914 Ga0075436_100108320 Ga0075436_1001083202 298
163 3300006931 Ga0097620_100004269 Ga0097620_1000042696 298
164 3300009101 Ga0105247_10002396 Ga0105247_1000239610 298
165 3300009101 Ga0105247_10061333 Ga0105247_100613332 298
166 3300009177 Ga0105248_10006682 Ga0105248_100066823 298
167 3300009545 Ga0105237_10302991 Ga0105237_103029912 298
168 3300009545 Ga0105237_10495323 Ga0105237_104953232 298
169 3300009553 Ga0105249_10043968 Ga0105249_100439682 298
170 3300009553 Ga0105249_10180346 Ga0105249_101803462 298
171 3300011119 Ga0105246_10118887 Ga0105246_101188872 298
172 3300013296 Ga0157374_10238651 Ga0157374_102386513 298
173 3300013306 Ga0163162_10072025 Ga0163162_100720252 298
174 3300014325 Ga0163163_10018471 Ga0163163_100184713 298
175 3300014325 Ga0163163_10029120 Ga0163163_100291205 298
176 3300014325 Ga0163163_10146475 Ga0163163_101464753 298
177 3300014325 Ga0163163_10202981 Ga0163163_102029811 298
178 3300014968 Ga0157379_10036534 Ga0157379_100365343 298
179 3300020082 Ga0206353_11229857 Ga0206353_112298572 298
180 3300021377 Ga0213874_10012646 Ga0213874_100126463 298
181 3300025900 Ga0207710_10001639 Ga0207710_100016398 298
182 3300025903 Ga0207680_10141296 Ga0207680_101412963 298
183 3300025905 Ga0207685_10047295 Ga0207685_100472952 298
184 3300025912 Ga0207707_10000115 Ga0207707_1000011574 298
185 3300025912 Ga0207707_10000140 Ga0207707_1000014071 298
186 3300025912 Ga0207707_10000148 Ga0207707_100001487 298
187 3300025913 Ga0207695_10020357 Ga0207695_100203574 298
188 3300025915 Ga0207693_10012599 Ga0207693_100125994 298
189 3300025916 Ga0207663_10082137 Ga0207663_100821372 298
190 3300025921 Ga0207652_10042962 Ga0207652_100429622 298
191 3300025922 Ga0207646_10354989 Ga0207646_103549891 298
192 3300025928 Ga0207700_10095243 Ga0207700_100952432 298
193 3300025931 Ga0207644_10000718 Ga0207644_1000071817 298
194 3300025939 Ga0207665_10014003 Ga0207665_100140035 298
195 3300025939 Ga0207665_10049980 Ga0207665_100499802 298
196 3300025939 Ga0207665_10335800 Ga0207665_103358001 298
197 3300025941 Ga0207711_10037440 Ga0207711_100374403 298
198 3300025949 Ga0207667_10006818 Ga0207667_1000681813 298
199 3300025961 Ga0207712_10026592 Ga0207712_100265922 298
200 3300026089 Ga0207648_10168017 Ga0207648_101680172 298
201 3300028379 Ga0268266_10049644 Ga0268266_100496442 298
202 3300028381 Ga0268264_10018094 Ga0268264_100180943 298
203 3300028794 Ga0307515_10003416 Ga0307515_1000341617 298
204 3300030521 Ga0307511_10000048 Ga0307511_1000004860 298
205 3300030521 Ga0307511_10009582 Ga0307511_100095824 298
206 3300031247 Ga0265340_10054871 Ga0265340_100548712 298
207 3300031456 Ga0307513_10156325 Ga0307513_101563253 298
208 3300031507 Ga0307509_10000017 Ga0307509_1000001738 298
209 3300031548 Ga0307408_100027435 Ga0307408_1000274352 298
210 3300031911 Ga0307412_10077641 Ga0307412_100776412 298
211 3300032002 Ga0307416_100146625 Ga0307416_1001466253 298
212 3300033180 Ga0307510_10000002 Ga0307510_10000002401 298
213 3300035113 Ga0373936_0033970 Ga0373936_0033970_522_1430 298
214 3300039450 Ga0436363_0375975 Ga0436363_0375975_29326_30234 298
215 3300041452 Ga0451793_0368982 Ga0451793_0368982_159_1076 298
216 3300041498 Ga0451841_0078952 Ga0451841_0078952_22_939 298
217 3300042876 Ga0451577_0057889 Ga0451577_0057889_821_1750 298
218 3300045051 Ga0451576_0091467 Ga0451576_0091467_732_1640 298
219 3300046506 Ga0495583_0021099 Ga0495583_0021099_1792_2700 298
220 3300046524 Ga0495648_0117804 Ga0495648_0117804_468_1376 298
221 3300046660 Ga0495625_0029573 Ga0495625_0029573_663_1571 298
222 3300046692 Ga0495671_0024188 Ga0495671_0024188_316_1224 298
223 3300048903 Ga0496100_0077976 Ga0496100_0077976_536_1444 298
224 3300048905 Ga0496102_0024944 Ga0496102_0024944_3906_4814 298
225 3300048906 Ga0496103_0078166 Ga0496103_0078166_1107_2015 298
226 3300048908 Ga0496105_0121352 Ga0496105_0121352_909_1817 298
227 3300048911 Ga0496108_0446951 Ga0496108_0446951_202_1110 298
228 3300048915 Ga0496112_0175623 Ga0496112_0175623_423_1331 298
229 3300048918 Ga0496115_0194916 Ga0496115_0194916_260_1168 298
230 3300048919 Ga0496116_0032636 Ga0496116_0032636_290_1198 298
231 3300048920 Ga0496117_0000135 Ga0496117_0000135_110426_111334 298
232 3300048921 Ga0496118_0000098 Ga0496118_0000098_49283_50191 298
233 3300048922 Ga0496119_0081790 Ga0496119_0081790_889_1797 298
234 3300048923 Ga0496120_0000543 Ga0496120_0000543_41289_42197 298
235 3300048923 Ga0496120_0071899 Ga0496120_0071899_187_1095 298
236 3300048924 Ga0496121_0023475 Ga0496121_0023475_988_1896 298
237 3300048924 Ga0496121_0166063 Ga0496121_0166063_578_1486 298
238 3300048927 Ga0496124_0078346 Ga0496124_0078346_1057_1965 298
239 3300048928 Ga0496125_0002765 Ga0496125_0002765_3979_4887 298
240 3300048928 Ga0496125_0028906 Ga0496125_0028906_1439_2347 298
241 3300048929 Ga0496126_0026574 Ga0496126_0026574_1893_2801 298
242 3300048929 Ga0496126_0035411 Ga0496126_0035411_2587_3495 298
243 3300053104 Ga0500556_0000589 Ga0500556_0000589_848_1756 298
244 3300005330 Ga0070690_100007666 Ga0070690_1000076664 299
245 3300005334 Ga0068869_100000179 Ga0068869_10000017922 299
246 3300005336 Ga0070680_100002041 Ga0070680_1000020417 299
247 3300005337 Ga0070682_100026425 Ga0070682_1000264252 299
248 3300005341 Ga0070691_10000201 Ga0070691_1000020119 299
249 3300005343 Ga0070687_100004423 Ga0070687_1000044234 299
250 3300005355 Ga0070671_100034652 Ga0070671_1000346523 299
251 3300005438 Ga0070701_10000441 Ga0070701_1000044112 299
252 3300005440 Ga0070705_100000428 Ga0070705_1000004288 299
253 3300005440 Ga0070705_100237544 Ga0070705_1002375442 299
254 3300005441 Ga0070700_100002394 Ga0070700_1000023948 299
255 3300005444 Ga0070694_100000620 Ga0070694_10000062020 299
256 3300005445 Ga0070708_100105955 Ga0070708_1001059552 299
257 3300005457 Ga0070662_100116940 Ga0070662_1001169403 299
258 3300005458 Ga0070681_10000131 Ga0070681_1000013160 299
259 3300005458 Ga0070681_10070970 Ga0070681_100709703 299
260 3300005459 Ga0068867_100001899 Ga0068867_1000018994 299
261 3300005530 Ga0070679_100019019 Ga0070679_1000190196 299
262 3300005530 Ga0070679_100190653 Ga0070679_1001906532 299
263 3300005536 Ga0070697_100176041 Ga0070697_1001760412 299
264 3300005539 Ga0068853_100074893 Ga0068853_1000748934 299
265 3300005544 Ga0070686_100013640 Ga0070686_1000136404 299
266 3300005544 Ga0070686_100093129 Ga0070686_1000931292 299
267 3300005545 Ga0070695_100005505 Ga0070695_1000055055 299
268 3300005545 Ga0070695_100011219 Ga0070695_1000112194 299
269 3300005546 Ga0070696_100000037 Ga0070696_1000000372 299
270 3300005547 Ga0070693_100000225 Ga0070693_10000022512 299
271 3300005549 Ga0070704_100006185 Ga0070704_1000061853 299
272 3300005563 Ga0068855_100036225 Ga0068855_1000362257 299
273 3300005578 Ga0068854_100014490 Ga0068854_1000144903 299
274 3300005614 Ga0068856_100143811 Ga0068856_1001438113 299
275 3300005616 Ga0068852_100072254 Ga0068852_1000722544 299
276 3300005617 Ga0068859_100007815 Ga0068859_1000078159 299
277 3300005718 Ga0068866_10007417 Ga0068866_100074174 299
278 3300005719 Ga0068861_100000538 Ga0068861_1000005387 299
279 3300005842 Ga0068858_100004263 Ga0068858_10000426312 299
280 3300005843 Ga0068860_100029624 Ga0068860_1000296244 299
281 3300005844 Ga0068862_100011319 Ga0068862_1000113194 299
282 3300006173 Ga0070716_100230181 Ga0070716_1002301812 299
283 3300006237 Ga0097621_100004518 Ga0097621_1000045188 299
284 3300006358 Ga0068871_100000772 Ga0068871_10000077210 299
285 3300006852 Ga0075433_10006653 Ga0075433_100066533 299
286 3300006852 Ga0075433_10022836 Ga0075433_100228363 299
287 3300006871 Ga0075434_100013542 Ga0075434_1000135422 299
288 3300006871 Ga0075434_100358853 Ga0075434_1003588532 299
289 3300006881 Ga0068865_100000628 Ga0068865_1000006282 299
290 3300006881 Ga0068865_100097540 Ga0068865_1000975402 299
291 3300006914 Ga0075436_100006378 Ga0075436_1000063787 299
292 3300006931 Ga0097620_100007814 Ga0097620_1000078142 299
293 3300007076 Ga0075435_100007394 Ga0075435_10000739410 299
294 3300007076 Ga0075435_100387134 Ga0075435_1003871342 299
295 3300009098 Ga0105245_10000951 Ga0105245_100009516 299
296 3300009148 Ga0105243_10002746 Ga0105243_100027469 299
297 3300009176 Ga0105242_10000779 Ga0105242_100007793 299
298 3300009177 Ga0105248_10197860 Ga0105248_101978601 299
299 3300009553 Ga0105249_10000995 Ga0105249_1000099515 299
300 3300013297 Ga0157378_10000590 Ga0157378_1000059022 299
301 3300014969 Ga0157376_10005783 Ga0157376_100057836 299
302 3300025906 Ga0207699_10123006 Ga0207699_101230063 299
303 3300025908 Ga0207643_10071466 Ga0207643_100714663 299
304 3300025912 Ga0207707_10001203 Ga0207707_100012033 299
305 3300025912 Ga0207707_10192374 Ga0207707_101923742 299
306 3300025917 Ga0207660_10010953 Ga0207660_100109532 299
307 3300025918 Ga0207662_10000144 Ga0207662_1000014423 299
308 3300025921 Ga0207652_10024846 Ga0207652_100248463 299
309 3300025927 Ga0207687_10000617 Ga0207687_100006175 299
310 3300025931 Ga0207644_10027518 Ga0207644_100275184 299
311 3300025934 Ga0207686_10000533 Ga0207686_1000053314 299
312 3300025935 Ga0207709_10000671 Ga0207709_100006717 299
313 3300025936 Ga0207670_10002758 Ga0207670_100027583 299
314 3300025942 Ga0207689_10014975 Ga0207689_100149754 299
315 3300025961 Ga0207712_10025418 Ga0207712_100254183 299
316 3300025981 Ga0207640_10003394 Ga0207640_1000339410 299
317 3300026035 Ga0207703_10027866 Ga0207703_100278664 299
318 3300026041 Ga0207639_10215465 Ga0207639_102154652 299
319 3300026075 Ga0207708_10000427 Ga0207708_100004278 299
320 3300026078 Ga0207702_10327155 Ga0207702_103271552 299
321 3300026089 Ga0207648_10000018 Ga0207648_1000001837 299
322 3300026095 Ga0207676_10010945 Ga0207676_100109457 299
323 3300026118 Ga0207675_100000050 Ga0207675_10000005037 299
324 3300026142 Ga0207698_10012742 Ga0207698_100127424 299
325 3300028380 Ga0268265_10017012 Ga0268265_100170122 299
326 3300028381 Ga0268264_10001294 Ga0268264_1000129422 299
327 3300034957 Ga0373938_0036310 Ga0373938_0036310_99_1055 299
328 3300035083 Ga0373926_0005260 Ga0373926_0005260_1482_2438 299
329 3300035113 Ga0373936_0006850 Ga0373936_0006850_1822_2778 299
330 3300035116 Ga0373945_0008747 Ga0373945_0008747_2178_3134 299
331 3300035171 Ga0373946_0026733 Ga0373946_0026733_358_1314 299
332 3300035691 Ga0373931_0030542 Ga0373931_0030542_967_1932 299
333 3300035691 Ga0373931_0134062 Ga0373931_0134062_92_1057 299
334 3300035695 Ga0373927_0117777 Ga0373927_0117777_462_1418 299
335 3300038725 Ga0400484_27744 Ga0400484_27744_1420_2328 299
336 3300046455 Ga0495603_0010466 Ga0495603_0010466_128_1084 299
337 3300046472 Ga0495580_0001506 Ga0495580_0001506_4272_5228 299
338 3300046475 Ga0495639_0002165 Ga0495639_0002165_6074_7030 299
339 3300046499 Ga0495594_0151865 Ga0495594_0151865_88_1044 299
340 3300046535 Ga0495586_0004720 Ga0495586_0004720_5755_6711 299
341 3300046615 Ga0495656_0004463 Ga0495656_0004463_527_1483 299
342 3300046681 Ga0495647_0001482 Ga0495647_0001482_95_1051 299
343 3300046683 Ga0495658_0006801 Ga0495658_0006801_2867_3823 299
344 3300047321 Ga0495676_0116557 Ga0495676_0116557_332_1288 299
345 3300049583 Ga0501067_0021788 Ga0501067_0021788_1186_2139 299
346 3300049741 Ga0501079_0302674 Ga0501079_0302674_225_1193 299
347 3300050512 nmdc:mga0n895_1033_c1 nmdc:mga0n895_1033_c1_3412_4368 299
348 3300050512 nmdc:mga0n895_250449_c1 nmdc:mga0n895_250449_c1_771_1724 299
349 3300050513 nmdc:mga0rr50_10423_c1 nmdc:mga0rr50_10423_c1_950_1903 299
350 3300050513 nmdc:mga0rr50_1805_c1 nmdc:mga0rr50_1805_c1_3127_4083 299
351 3300050514 nmdc:mga08x19_5920_c1 nmdc:mga08x19_5920_c1_4925_5881 299
352 3300050515 nmdc:mga0a205_24706_c1 nmdc:mga0a205_24706_c1_2479_3432 299
353 3300050515 nmdc:mga0a205_38742_c1 nmdc:mga0a205_38742_c1_1480_2436 299
354 3300059426 Ga0590077_017742 Ga0590077_017742_434_1390 299
355 3300005458 Ga0070681_10000231 Ga0070681_100002312 300
356 3300005563 Ga0068855_100079790 Ga0068855_1000797903 300
357 3300025912 Ga0207707_10000075 Ga0207707_1000007587 300
358 3300025921 Ga0207652_10162625 Ga0207652_101626252 300
359 3300037418 Ga0395900_0000060 Ga0395900_0000060_84099_85055 300
360 3300037466 Ga0395898_0083235 Ga0395898_0083235_51_1007 300
361 3300045051 Ga0451576_0067931 Ga0451576_0067931_831_1796 300
362 iso_pu_bacteria 8001522603 8001525637 300
363 3300025913 Ga0207695_10052459 Ga0207695_100524593 301
364 3300053123 Ga0500614_006711 Ga0500614_006711_38_955 301
365 iso_pu_bacteria 2734482258 2735816575 301
366 3300005335 Ga0070666_10009494 Ga0070666_100094945 302
367 3300005367 Ga0070667_100000184 Ga0070667_10000018453 302
368 3300005617 Ga0068859_100204778 Ga0068859_1002047783 302
369 3300006846 Ga0075430_100064425 Ga0075430_1000644252 302
370 3300006931 Ga0097620_100204784 Ga0097620_1002047843 302
371 3300025903 Ga0207680_10006851 Ga0207680_100068513 302
372 3300025961 Ga0207712_10009011 Ga0207712_100090114 302
373 3300025986 Ga0207658_10001013 Ga0207658_100010133 302
374 3300031665 Ga0316575_10034701 Ga0316575_100347012 302
375 3300031727 Ga0316576_10024964 Ga0316576_100249643 302
376 3300031727 Ga0316576_10029895 Ga0316576_100298954 302
377 3300031727 Ga0316576_10136287 Ga0316576_101362872 302
378 3300031728 Ga0316578_10056886 Ga0316578_100568863 302
379 3300031733 Ga0316577_10072152 Ga0316577_100721523 302
380 3300035398 Ga0316574_0016469 Ga0316574_0016469_2774_3703 302
381 3300035398 Ga0316574_0037376 Ga0316574_0037376_777_1706 302
382 3300035398 Ga0316574_0073569 Ga0316574_0073569_611_1540 302
383 3300035398 Ga0316574_0074137 Ga0316574_0074137_674_1603 302
384 3300035398 Ga0316574_0099000 Ga0316574_0099000_241_1170 302
385 3300035398 Ga0316574_0134428 Ga0316574_0134428_371_1300 302
386 3300036647 Ga0316582_0064613 Ga0316582_0064613_684_1613 302
387 3300036712 Ga0316584_0053695 Ga0316584_0053695_427_1356 302
388 3300005434 Ga0070709_10011218 Ga0070709_100112183 303
389 3300006163 Ga0070715_10026537 Ga0070715_100265372 303
390 3300006852 Ga0075433_10065305 Ga0075433_100653053 303
391 3300006880 Ga0075429_100326419 Ga0075429_1003264192 303
392 3300007265 Ga0099794_10008883 Ga0099794_100088834 303
393 3300009147 Ga0114129_10007905 Ga0114129_100079057 303
394 3300021388 Ga0213875_10017205 Ga0213875_100172052 303
395 3300021388 Ga0213875_10074012 Ga0213875_100740121 303
396 3300022467 Ga0224712_10021090 Ga0224712_100210902 303
397 3300024225 Ga0224572_1000869 Ga0224572_10008692 303
398 3300025299 Ga0209256_1020720 Ga0209256_10207202 303
399 3300025905 Ga0207685_10002959 Ga0207685_100029593 303
400 3300027671 Ga0209588_1014068 Ga0209588_10140683 303
401 3300035170 Ga0373943_0016313 Ga0373943_0016313_2368_3342 303
402 3300035725 Ga0373947_0109028 Ga0373947_0109028_534_1508 303
403 3300037068 Ga0373925_0008937 Ga0373925_0008937_6326_7285 303
404 3300037068 Ga0373925_0013418 Ga0373925_0013418_2106_3062 303
405 3300037853 Ga0436364_0260906 Ga0436364_0260906_20280_21254 303
406 3300039437 Ga0436365_1274404 Ga0436365_1274404_661_1632 303
407 3300046531 Ga0495665_0051846 Ga0495665_0051846_597_1568 303
408 3300049570 Ga0501033_0191500 Ga0501033_0191500_404_1321 303
409 3300049572 Ga0501036_0026800 Ga0501036_0026800_3206_4123 303
410 3300049573 Ga0501037_0113504 Ga0501037_0113504_555_1472 303
411 3300049574 Ga0501038_0054535 Ga0501038_0054535_1940_2857 303
412 3300049575 Ga0501039_0014722 Ga0501039_0014722_2735_3652 303
413 3300049576 Ga0501040_0070544 Ga0501040_0070544_1384_2301 303
414 3300049578 Ga0501042_0004832 Ga0501042_0004832_1230_2147 303
415 3300049580 Ga0501046_0024641 Ga0501046_0024641_182_1099 303
416 3300049582 Ga0501048_0017183 Ga0501048_0017183_617_1534 303
417 3300049587 Ga0501071_0002075 Ga0501071_0002075_5001_5918 303
418 3300049588 Ga0501072_0006963 Ga0501072_0006963_856_1773 303
419 3300049590 Ga0501074_0033465 Ga0501074_0033465_2179_3096 303
420 3300049591 Ga0501075_0018337 Ga0501075_0018337_507_1424 303
421 3300049592 Ga0501076_0010795 Ga0501076_0010795_662_1579 303
422 3300049592 Ga0501076_0048350 Ga0501076_0048350_435_1352 303
423 3300049741 Ga0501079_0142134 Ga0501079_0142134_259_1176 303
424 3300049742 Ga0501080_0032012 Ga0501080_0032012_2117_3034 303
425 3300049743 Ga0501081_0234111 Ga0501081_0234111_392_1309 303
426 3300049744 Ga0501083_0246352 Ga0501083_0246352_78_995 303
427 3300049824 Ga0501045_0002979 Ga0501045_0002979_2171_3088 303
428 3300050507 nmdc:mga05p37_13712_c1 nmdc:mga05p37_13712_c1_6610_7542 303
429 3300050515 nmdc:mga0a205_25504_c1 nmdc:mga0a205_25504_c1_4032_4964 303
430 3300054114 Ga0501084_0014474 Ga0501084_0014474_5071_5988 303
431 3300060353 Ga0501082_0015602 Ga0501082_0015602_4876_5793 303
432 3300061734 Ga0530510_0003481 Ga0530510_0003481_9188_10105 303
433 3300061734 Ga0530510_0010649 Ga0530510_0010649_532_1449 303
434 3300005333 Ga0070677_10003986 Ga0070677_100039864 304
435 3300005334 Ga0068869_100102967 Ga0068869_1001029672 304
436 3300005334 Ga0068869_100213838 Ga0068869_1002138383 304
437 3300005335 Ga0070666_10077658 Ga0070666_100776583 304
438 3300005343 Ga0070687_100158552 Ga0070687_1001585522 304
439 3300005347 Ga0070668_100165739 Ga0070668_1001657393 304
440 3300005354 Ga0070675_100035869 Ga0070675_1000358694 304
441 3300005355 Ga0070671_100018662 Ga0070671_1000186624 304
442 3300005364 Ga0070673_100059240 Ga0070673_1000592402 304
443 3300005367 Ga0070667_100024865 Ga0070667_1000248652 304
444 3300005367 Ga0070667_100065708 Ga0070667_1000657082 304
445 3300005434 Ga0070709_10006539 Ga0070709_100065395 304
446 3300005439 Ga0070711_100288281 Ga0070711_1002882811 304
447 3300005441 Ga0070700_100113612 Ga0070700_1001136121 304
448 3300005459 Ga0068867_100085315 Ga0068867_1000853152 304
449 3300005466 Ga0070685_10111860 Ga0070685_101118602 304
450 3300005468 Ga0070707_100241824 Ga0070707_1002418242 304
451 3300005518 Ga0070699_100144625 Ga0070699_1001446253 304
452 3300005546 Ga0070696_100026580 Ga0070696_1000265804 304
453 3300005548 Ga0070665_100003573 Ga0070665_1000035739 304
454 3300005548 Ga0070665_100037380 Ga0070665_1000373802 304
455 3300005548 Ga0070665_100090572 Ga0070665_1000905723 304
456 3300005563 Ga0068855_100018159 Ga0068855_1000181598 304
457 3300005563 Ga0068855_100020453 Ga0068855_1000204533 304
458 3300005563 Ga0068855_100258503 Ga0068855_1002585032 304
459 3300005614 Ga0068856_100041447 Ga0068856_1000414474 304
460 3300005617 Ga0068859_100099223 Ga0068859_1000992233 304
461 3300005617 Ga0068859_100428480 Ga0068859_1004284802 304
462 3300005618 Ga0068864_100181691 Ga0068864_1001816913 304
463 3300005718 Ga0068866_10009466 Ga0068866_100094663 304
464 3300005719 Ga0068861_100040357 Ga0068861_1000403573 304
465 3300005842 Ga0068858_100026808 Ga0068858_1000268083 304
466 3300005843 Ga0068860_100024367 Ga0068860_1000243672 304
467 3300005844 Ga0068862_100026123 Ga0068862_1000261234 304
468 3300005844 Ga0068862_100107325 Ga0068862_1001073253 304
469 3300005844 Ga0068862_100199098 Ga0068862_1001990982 304
470 3300005844 Ga0068862_100345359 Ga0068862_1003453592 304
471 3300005937 Ga0081455_10000679 Ga0081455_1000067936 304
472 3300005985 Ga0081539_10000006 Ga0081539_10000006390 304
473 3300006163 Ga0070715_10031022 Ga0070715_100310223 304
474 3300006173 Ga0070716_100006147 Ga0070716_1000061473 304
475 3300006175 Ga0070712_100043363 Ga0070712_1000433632 304
476 3300006358 Ga0068871_100180168 Ga0068871_1001801683 304
477 3300006881 Ga0068865_100074213 Ga0068865_1000742132 304
478 3300006931 Ga0097620_100099227 Ga0097620_1000992273 304
479 3300006931 Ga0097620_100428449 Ga0097620_1004284492 304
480 3300007788 Ga0099795_10008084 Ga0099795_100080843 304
481 3300009093 Ga0105240_10008075 Ga0105240_100080756 304
482 3300009093 Ga0105240_10088147 Ga0105240_100881472 304
483 3300009174 Ga0105241_10095262 Ga0105241_100952623 304
484 3300009176 Ga0105242_10021808 Ga0105242_100218084 304
485 3300009177 Ga0105248_10057294 Ga0105248_100572943 304
486 3300009545 Ga0105237_10258577 Ga0105237_102585773 304
487 3300009545 Ga0105237_10433665 Ga0105237_104336652 304
488 3300010375 Ga0105239_10233331 Ga0105239_102333312 304
489 3300011119 Ga0105246_10129408 Ga0105246_101294083 304
490 3300013296 Ga0157374_10023374 Ga0157374_100233742 304
491 3300013296 Ga0157374_10304336 Ga0157374_103043363 304
492 3300013297 Ga0157378_10054853 Ga0157378_100548533 304
493 3300013306 Ga0163162_10288648 Ga0163162_102886482 304
494 3300013306 Ga0163162_10376876 Ga0163162_103768762 304
495 3300013308 Ga0157375_10061997 Ga0157375_100619973 304
496 3300014969 Ga0157376_10184983 Ga0157376_101849833 304
497 3300017792 Ga0163161_10120572 Ga0163161_101205723 304
498 3300025898 Ga0207692_10035485 Ga0207692_100354852 304
499 3300025899 Ga0207642_10055381 Ga0207642_100553812 304
500 3300025899 Ga0207642_10273093 Ga0207642_102730931 304
501 3300025905 Ga0207685_10017353 Ga0207685_100173532 304
502 3300025906 Ga0207699_10002296 Ga0207699_100022968 304
503 3300025911 Ga0207654_10049177 Ga0207654_100491773 304
504 3300025913 Ga0207695_10012932 Ga0207695_100129325 304
505 3300025915 Ga0207693_10000711 Ga0207693_1000071125 304
506 3300025916 Ga0207663_10044739 Ga0207663_100447392 304
507 3300025921 Ga0207652_10066650 Ga0207652_100666502 304
508 3300025921 Ga0207652_10069283 Ga0207652_100692833 304
509 3300025926 Ga0207659_10055705 Ga0207659_100557053 304
510 3300025927 Ga0207687_10126406 Ga0207687_101264062 304
511 3300025928 Ga0207700_10043034 Ga0207700_100430343 304
512 3300025928 Ga0207700_10220300 Ga0207700_102203002 304
513 3300025932 Ga0207690_10155587 Ga0207690_101555873 304
514 3300025934 Ga0207686_10068527 Ga0207686_100685273 304
515 3300025938 Ga0207704_10392890 Ga0207704_103928901 304
516 3300025939 Ga0207665_10019995 Ga0207665_100199953 304
517 3300025944 Ga0207661_10077971 Ga0207661_100779711 304
518 3300025949 Ga0207667_10017408 Ga0207667_100174083 304
519 3300025960 Ga0207651_10167307 Ga0207651_101673072 304
520 3300026023 Ga0207677_10108147 Ga0207677_101081473 304
521 3300026041 Ga0207639_10183137 Ga0207639_101831373 304
522 3300026089 Ga0207648_10455939 Ga0207648_104559391 304
523 3300026118 Ga0207675_100195591 Ga0207675_1001955912 304
524 3300026121 Ga0207683_10019930 Ga0207683_100199304 304
525 3300028379 Ga0268266_10007953 Ga0268266_100079534 304
526 3300028379 Ga0268266_10120601 Ga0268266_101206012 304
527 3300028380 Ga0268265_10151055 Ga0268265_101510551 304
528 3300028380 Ga0268265_10220746 Ga0268265_102207463 304
529 3300031250 Ga0265331_10010845 Ga0265331_100108454 304
530 3300031251 Ga0265327_10003233 Ga0265327_100032332 304
531 3300031456 Ga0307513_10013985 Ga0307513_100139853 304
532 3300031456 Ga0307513_10028805 Ga0307513_100288052 304
533 3300031507 Ga0307509_10136691 Ga0307509_101366912 304
534 3300032168 Ga0316593_10004729 Ga0316593_100047292 304
535 3300032168 Ga0316593_10103175 Ga0316593_101031751 304
536 3300035083 Ga0373926_0002919 Ga0373926_0002919_2304_3341 304
537 3300035089 Ga0373944_0000876 Ga0373944_0000876_5780_6817 304
538 3300035090 Ga0373949_0028016 Ga0373949_0028016_311_1300 304
539 3300035111 Ga0373923_0088128 Ga0373923_0088128_166_1203 304
540 3300035113 Ga0373936_0000488 Ga0373936_0000488_1149_2186 304
541 3300035116 Ga0373945_0004013 Ga0373945_0004013_609_1646 304
542 3300035170 Ga0373943_0004831 Ga0373943_0004831_70_1107 304
543 3300035171 Ga0373946_0000439 Ga0373946_0000439_2304_3341 304
544 3300035172 Ga0373955_0059225 Ga0373955_0059225_1100_2026 304
545 3300035692 Ga0373935_0004234 Ga0373935_0004234_4827_5864 304
546 3300035695 Ga0373927_0000383 Ga0373927_0000383_26430_27467 304
547 3300035725 Ga0373947_0005590 Ga0373947_0005590_2516_3553 304
548 3300036401 Ga0373937_0035130 Ga0373937_0035130_3570_4496 304
549 3300037068 Ga0373925_0005223 Ga0373925_0005223_3850_4887 304
550 3300037418 Ga0395900_0089295 Ga0395900_0089295_1646_2572 304
551 3300037418 Ga0395900_0216386 Ga0395900_0216386_694_1620 304
552 3300039437 Ga0436365_1414349 Ga0436365_1414349_1339_2265 304
553 3300039447 Ga0436361_0576483 Ga0436361_0576483_458_1384 304
554 3300039450 Ga0436363_0296494 Ga0436363_0296494_1244_2170 304
555 3300039450 Ga0436363_1127370 Ga0436363_1127370_365_1291 304
556 3300044656 Ga0466969_0118262 Ga0466969_0118262_96_1022 304
557 3300044684 Ga0466966_0009008 Ga0466966_0009008_4765_5691 304
558 3300044684 Ga0466966_0053439 Ga0466966_0053439_94_1020 304
559 3300044712 Ga0453684_0045609 Ga0453684_0045609_3587_4513 304
560 3300044719 Ga0466971_0001123 Ga0466971_0001123_286_1212 304
561 3300044735 Ga0466968_0027250 Ga0466968_0027250_1141_2067 304
562 3300044842 Ga0466957_0024169 Ga0466957_0024169_1620_2546 304
563 3300045049 Ga0466959_0014029 Ga0466959_0014029_3749_4675 304
564 3300045049 Ga0466959_0053806 Ga0466959_0053806_618_1544 304
565 3300045051 Ga0451576_0000217 Ga0451576_0000217_77850_78776 304
566 3300045836 Ga0466958_0072990 Ga0466958_0072990_820_1746 304
567 3300045976 Ga0466967_0042746 Ga0466967_0042746_414_1400 304
568 3300046457 Ga0495590_0002047 Ga0495590_0002047_2526_3452 304
569 3300046461 Ga0495641_0042287 Ga0495641_0042287_927_1964 304
570 3300046472 Ga0495580_0043965 Ga0495580_0043965_177_1103 304
571 3300046473 Ga0495582_0037643 Ga0495582_0037643_731_1768 304
572 3300046476 Ga0495662_0013627 Ga0495662_0013627_821_1858 304
573 3300046477 Ga0495664_0004691 Ga0495664_0004691_5935_6972 304
574 3300046514 Ga0495618_0093151 Ga0495618_0093151_159_1196 304
575 3300046517 Ga0495630_0028591 Ga0495630_0028591_1981_2907 304
576 3300046517 Ga0495630_0039960 Ga0495630_0039960_2405_3442 304
577 3300046559 Ga0495667_0036525 Ga0495667_0036525_214_1251 304
578 3300046616 Ga0495668_0148242 Ga0495668_0148242_314_1240 304
579 3300046663 Ga0495635_0000464 Ga0495635_0000464_9699_10736 304
580 3300046675 Ga0495657_0166310 Ga0495657_0166310_10_1047 304
581 3300046678 Ga0495599_0046240 Ga0495599_0046240_496_1533 304
582 3300046678 Ga0495599_0065356 Ga0495599_0065356_841_1767 304
583 3300047315 Ga0495581_0064804 Ga0495581_0064804_174_1211 304
584 3300047319 Ga0495674_0094152 Ga0495674_0094152_529_1566 304
585 3300047321 Ga0495676_0038206 Ga0495676_0038206_2563_3600 304
586 3300047322 Ga0495680_0035758 Ga0495680_0035758_421_1458 304
587 3300047470 Ga0495681_0133669 Ga0495681_0133669_49_975 304
588 3300047471 Ga0495684_0024315 Ga0495684_0024315_2684_3721 304
589 3300048088 Ga0495602_0083747 Ga0495602_0083747_959_1885 304
590 3300048090 Ga0495615_0025199 Ga0495615_0025199_401_1327 304
591 3300048091 Ga0495626_0097765 Ga0495626_0097765_124_1050 304
592 3300048903 Ga0496100_0117923 Ga0496100_0117923_789_1715 304
593 3300048905 Ga0496102_0032576 Ga0496102_0032576_3260_4186 304
594 3300048907 Ga0496104_0448094 Ga0496104_0448094_190_1116 304
595 3300048910 Ga0496107_0099375 Ga0496107_0099375_333_1259 304
596 3300048911 Ga0496108_0021701 Ga0496108_0021701_2018_2944 304
597 3300048912 Ga0496109_0028132 Ga0496109_0028132_2033_2959 304
598 3300048912 Ga0496109_0200936 Ga0496109_0200936_433_1359 304
599 3300048913 Ga0496110_0038938 Ga0496110_0038938_2408_3334 304
600 3300048914 Ga0496111_0003521 Ga0496111_0003521_2323_3249 304
601 3300048915 Ga0496112_0113896 Ga0496112_0113896_561_1487 304
602 3300048916 Ga0496113_0086931 Ga0496113_0086931_814_1740 304
603 3300048918 Ga0496115_0021506 Ga0496115_0021506_2080_3006 304
604 3300050512 nmdc:mga0n895_266530_c1 nmdc:mga0n895_266530_c1_750_1676 304
605 3300050513 nmdc:mga0rr50_202081_c1 nmdc:mga0rr50_202081_c1_372_1298 304
606 3300050514 nmdc:mga08x19_100134_c1 nmdc:mga08x19_100134_c1_432_1358 304
607 3300053092 Ga0500583_0014665 Ga0500583_0014665_1163_2089 304
608 3300053092 Ga0500583_0042636 Ga0500583_0042636_378_1304 304
609 3300053093 Ga0500651_0135718 Ga0500651_0135718_394_1320 304
610 3300053096 Ga0500641_0063851 Ga0500641_0063851_580_1506 304
611 3300053118 Ga0500594_0010636 Ga0500594_0010636_896_1822 304
612 3300053124 Ga0500617_019162 Ga0500617_019162_1567_2493 304
613 3300053131 Ga0500652_074859 Ga0500652_074859_470_1396 304
614 3300053134 Ga0500658_0015386 Ga0500658_0015386_487_1413 304
615 3300053139 Ga0500568_0010327 Ga0500568_0010327_3321_4247 304
616 3300053139 Ga0500568_0044626 Ga0500568_0044626_486_1412 304
617 3300053146 Ga0500588_0004664 Ga0500588_0004664_2036_2962 304
618 3300053156 Ga0500622_0018631 Ga0500622_0018631_2004_2930 304
619 3300053160 Ga0500633_0007765 Ga0500633_0007765_912_1838 304
620 iso_pu_bacteria 2510065053 2510283929 304
621 iso_pu_bacteria 2510065058 2510312890 304
622 iso_pu_bacteria 2919125081 2919128136 304
623 iso_pu_bacteria 2984499530 2984503776 304
624 iso_pu_bacteria 2984504281 2984507642 304
625 iso_pu_bacteria 8016728285 8016730218 304
626 3300005331 Ga0070670_100178451 Ga0070670_1001784513 305
627 3300005336 Ga0070680_100047098 Ga0070680_1000470983 305
628 3300005347 Ga0070668_100021905 Ga0070668_1000219053 305
629 3300005354 Ga0070675_100351868 Ga0070675_1003518681 305
630 3300005356 Ga0070674_100092380 Ga0070674_1000923801 305
631 3300005364 Ga0070673_100066144 Ga0070673_1000661442 305
632 3300005364 Ga0070673_100136437 Ga0070673_1001364372 305
633 3300005438 Ga0070701_10070603 Ga0070701_100706033 305
634 3300005455 Ga0070663_100231036 Ga0070663_1002310362 305
635 3300005458 Ga0070681_10009857 Ga0070681_100098578 305
636 3300005458 Ga0070681_10089146 Ga0070681_100891464 305
637 3300005518 Ga0070699_100187509 Ga0070699_1001875092 305
638 3300005535 Ga0070684_100144282 Ga0070684_1001442822 305
639 3300005543 Ga0070672_100021356 Ga0070672_1000213562 305
640 3300005548 Ga0070665_100026498 Ga0070665_1000264984 305
641 3300005618 Ga0068864_100428436 Ga0068864_1004284361 305
642 3300005719 Ga0068861_100051338 Ga0068861_1000513382 305
643 3300005841 Ga0068863_100168201 Ga0068863_1001682012 305
644 3300005937 Ga0081455_10004105 Ga0081455_1000410515 305
645 3300006237 Ga0097621_100149636 Ga0097621_1001496363 305
646 3300006844 Ga0075428_100162789 Ga0075428_1001627892 305
647 3300006847 Ga0075431_100039561 Ga0075431_1000395613 305
648 3300006914 Ga0075436_100090533 Ga0075436_1000905332 305
649 3300010375 Ga0105239_10052409 Ga0105239_100524094 305
650 3300013105 Ga0157369_10140326 Ga0157369_101403262 305
651 3300013105 Ga0157369_10620257 Ga0157369_106202571 305
652 3300014968 Ga0157379_10225498 Ga0157379_102254982 305
653 3300025898 Ga0207692_10202050 Ga0207692_102020501 305
654 3300025906 Ga0207699_10298086 Ga0207699_102980862 305
655 3300025908 Ga0207643_10058094 Ga0207643_100580941 305
656 3300025917 Ga0207660_10045704 Ga0207660_100457043 305
657 3300025925 Ga0207650_10119403 Ga0207650_101194032 305
658 3300025938 Ga0207704_10071469 Ga0207704_100714692 305
659 3300025940 Ga0207691_10361689 Ga0207691_103616891 305
660 3300025960 Ga0207651_10121974 Ga0207651_101219741 305
661 3300026067 Ga0207678_10116209 Ga0207678_101162091 305
662 3300026088 Ga0207641_10134247 Ga0207641_101342472 305
663 3300026121 Ga0207683_10098090 Ga0207683_100980902 305
664 3300028379 Ga0268266_10022791 Ga0268266_100227912 305
665 3300028379 Ga0268266_10108480 Ga0268266_101084803 305
666 3300028379 Ga0268266_10379280 Ga0268266_103792802 305
667 3300031852 Ga0307410_10000500 Ga0307410_100005003 305
668 3300031903 Ga0307407_10021514 Ga0307407_100215143 305
669 3300031995 Ga0307409_100000732 Ga0307409_1000007329 305
670 3300031995 Ga0307409_100438604 Ga0307409_1004386042 305
671 3300032002 Ga0307416_100178547 Ga0307416_1001785472 305
672 3300032004 Ga0307414_10264018 Ga0307414_102640182 305
673 3300032005 Ga0307411_10060016 Ga0307411_100600163 305
674 3300032005 Ga0307411_10282903 Ga0307411_102829032 305
675 3300035086 Ga0373934_0003089 Ga0373934_0003089_3226_4155 305
676 3300035111 Ga0373923_0074354 Ga0373923_0074354_241_1170 305
677 3300035118 Ga0373954_0002373 Ga0373954_0002373_5139_6068 305
678 3300035118 Ga0373954_0055222 Ga0373954_0055222_433_1362 305
679 3300035119 Ga0373956_0077750 Ga0373956_0077750_563_1492 305
680 3300035170 Ga0373943_0078886 Ga0373943_0078886_515_1444 305
681 3300035171 Ga0373946_0032111 Ga0373946_0032111_295_1224 305
682 3300035172 Ga0373955_0099325 Ga0373955_0099325_537_1466 305
683 3300035724 Ga0373933_0010727 Ga0373933_0010727_2022_2951 305
684 3300037068 Ga0373925_0038319 Ga0373925_0038319_1872_2801 305
685 3300041443 Ga0451789_1314313 Ga0451789_1314313_512_1441 305
686 3300042876 Ga0451577_0016678 Ga0451577_0016678_5276_6208 305
687 3300044656 Ga0466969_0005735 Ga0466969_0005735_4545_5519 305
688 3300044901 Ga0466960_0013133 Ga0466960_0013133_205_1149 305
689 3300045049 Ga0466959_0034640 Ga0466959_0034640_683_1675 305
690 3300045836 Ga0466958_0036183 Ga0466958_0036183_473_1447 305
691 3300046454 Ga0495592_0010288 Ga0495592_0010288_1748_2677 305
692 3300046454 Ga0495592_0120274 Ga0495592_0120274_19_948 305
693 3300046460 Ga0495638_0076082 Ga0495638_0076082_827_1756 305
694 3300046463 Ga0495653_0006412 Ga0495653_0006412_3872_4801 305
695 3300046472 Ga0495580_0015225 Ga0495580_0015225_776_1705 305
696 3300046475 Ga0495639_0032526 Ga0495639_0032526_1382_2311 305
697 3300046499 Ga0495594_0082982 Ga0495594_0082982_489_1418 305
698 3300046511 Ga0495608_0144824 Ga0495608_0144824_154_1083 305
699 3300046516 Ga0495628_0056228 Ga0495628_0056228_207_1136 305
700 3300046526 Ga0495666_0046639 Ga0495666_0046639_786_1715 305
701 3300046533 Ga0495640_0053821 Ga0495640_0053821_1590_2519 305
702 3300046535 Ga0495586_0004892 Ga0495586_0004892_687_1616 305
703 3300046559 Ga0495667_0068892 Ga0495667_0068892_1112_2041 305
704 3300046642 Ga0495634_0041752 Ga0495634_0041752_1649_2578 305
705 3300046675 Ga0495657_0088806 Ga0495657_0088806_394_1323 305
706 3300046681 Ga0495647_0003243 Ga0495647_0003243_2785_3714 305
707 3300046683 Ga0495658_0085759 Ga0495658_0085759_537_1466 305
708 3300046694 Ga0495649_0003326 Ga0495649_0003326_5290_6219 305
709 3300046809 Ga0495600_0003135 Ga0495600_0003135_4792_5721 305
710 3300047444 Ga0495675_0036099 Ga0495675_0036099_1985_2914 305
711 3300048917 Ga0496114_0034713 Ga0496114_0034713_853_1782 305
712 3300050510 nmdc:mga06r32_55832_c1 nmdc:mga06r32_55832_c1_32_958 305
713 3300050514 nmdc:mga08x19_4186_c1 nmdc:mga08x19_4186_c1_6123_7052 305
714 3300053077 Ga0495601_0001851 Ga0495601_0001851_8677_9606 305
715 3300053084 Ga0495595_0025927 Ga0495595_0025927_1239_2168 305
716 3300053085 Ga0495619_0032252 Ga0495619_0032252_2342_3271 305
717 3300005335 Ga0070666_10004842 Ga0070666_100048423 306
718 3300005356 Ga0070674_100034839 Ga0070674_1000348393 306
719 3300005367 Ga0070667_100013808 Ga0070667_1000138084 306
720 3300005456 Ga0070678_100007333 Ga0070678_1000073333 306
721 3300005459 Ga0068867_100042614 Ga0068867_1000426143 306
722 3300005466 Ga0070685_10264085 Ga0070685_102640851 306
723 3300005548 Ga0070665_100005905 Ga0070665_1000059057 306
724 3300006881 Ga0068865_100018665 Ga0068865_1000186653 306
725 3300013104 Ga0157370_10118437 Ga0157370_101184371 306
726 3300013308 Ga0157375_10288654 Ga0157375_102886543 306
727 3300014969 Ga0157376_10007674 Ga0157376_100076743 306
728 3300025937 Ga0207669_10009150 Ga0207669_100091502 306
729 3300025986 Ga0207658_10009144 Ga0207658_100091444 306
730 3300026023 Ga0207677_10073331 Ga0207677_100733313 306
731 3300026089 Ga0207648_10055430 Ga0207648_100554303 306
732 3300026121 Ga0207683_10017307 Ga0207683_100173074 306
733 3300027512 Ga0209179_1001321 Ga0209179_10013213 306
734 3300049571 Ga0501034_0070053 Ga0501034_0070053_2234_3175 306
735 iso_pu_bacteria 2728369097 2729146261 306
736 iso_pu_bacteria 651053060 651174904 306
737 3300005293 Ga0065715_10223441 Ga0065715_102234412 307
738 3300005331 Ga0070670_100059524 Ga0070670_1000595243 307
739 3300005355 Ga0070671_100073677 Ga0070671_1000736772 307
740 3300005444 Ga0070694_100341638 Ga0070694_1003416381 307
741 3300005455 Ga0070663_100037888 Ga0070663_1000378883 307
742 3300005458 Ga0070681_10004886 Ga0070681_1000488610 307
743 3300005458 Ga0070681_10029157 Ga0070681_100291572 307
744 3300005458 Ga0070681_10112367 Ga0070681_101123673 307
745 3300005530 Ga0070679_100079717 Ga0070679_1000797172 307
746 3300005535 Ga0070684_100138929 Ga0070684_1001389292 307
747 3300005544 Ga0070686_100022906 Ga0070686_1000229062 307
748 3300005563 Ga0068855_100008724 Ga0068855_1000087245 307
749 3300005577 Ga0068857_100258121 Ga0068857_1002581212 307
750 3300005614 Ga0068856_100263674 Ga0068856_1002636741 307
751 3300005618 Ga0068864_100064649 Ga0068864_1000646493 307
752 3300005834 Ga0068851_10065242 Ga0068851_100652421 307
753 3300005843 Ga0068860_100002783 Ga0068860_10000278312 307
754 3300009545 Ga0105237_10140737 Ga0105237_101407373 307
755 3300013105 Ga0157369_10035219 Ga0157369_100352192 307
756 3300025903 Ga0207680_10134934 Ga0207680_101349342 307
757 3300025911 Ga0207654_10253900 Ga0207654_102539001 307
758 3300025912 Ga0207707_10002174 Ga0207707_1000217413 307
759 3300025912 Ga0207707_10018316 Ga0207707_100183164 307
760 3300025912 Ga0207707_10086326 Ga0207707_100863264 307
761 3300025913 Ga0207695_10021988 Ga0207695_100219886 307
762 3300025913 Ga0207695_10129619 Ga0207695_101296192 307
763 3300025917 Ga0207660_10218379 Ga0207660_102183792 307
764 3300025921 Ga0207652_10019843 Ga0207652_100198433 307
765 3300025924 Ga0207694_10056274 Ga0207694_100562741 307
766 3300025925 Ga0207650_10113946 Ga0207650_101139462 307
767 3300025941 Ga0207711_10317464 Ga0207711_103174641 307
768 3300025945 Ga0207679_10012674 Ga0207679_100126744 307
769 3300025949 Ga0207667_10067590 Ga0207667_100675903 307
770 3300025961 Ga0207712_10396989 Ga0207712_103969891 307
771 3300026035 Ga0207703_10001997 Ga0207703_100019974 307
772 3300026067 Ga0207678_10015060 Ga0207678_100150602 307
773 3300028381 Ga0268264_10000198 Ga0268264_1000019890 307
774 3300028800 Ga0265338_10034673 Ga0265338_100346733 307
775 3300031247 Ga0265340_10024043 Ga0265340_100240433 307
776 3300031691 Ga0316579_10006029 Ga0316579_100060296 307
777 3300031728 Ga0316578_10127593 Ga0316578_101275931 307
778 3300032168 Ga0316593_10004339 Ga0316593_100043393 307
779 3300033180 Ga0307510_10063197 Ga0307510_100631973 307
780 3300035171 Ga0373946_0029774 Ga0373946_0029774_582_1586 307
781 3300035725 Ga0373947_0059036 Ga0373947_0059036_611_1615 307
782 3300039437 Ga0436365_0360171 Ga0436365_0360171_6438_7394 307
783 3300039438 Ga0436360_1005797 Ga0436360_1005797_4292_5245 307
784 3300039450 Ga0436363_1648012 Ga0436363_1648012_59_997 307
785 3300046460 Ga0495638_0160552 Ga0495638_0160552_41_1036 307
786 3300046491 Ga0495584_0023980 Ga0495584_0023980_1616_2551 307
787 3300053153 Ga0500616_0040981 Ga0500616_0040981_1180_2217 307
788 3300002737 JGI25162J39368_1002514 JGI25162J39368_10025146 308
789 3300002737 JGI25162J39368_1002516 JGI25162J39368_10025166 308
790 3300006946 Ga0079104_1003875 Ga0079104_10038755 308
791 3300009011 Ga0105251_10015033 Ga0105251_100150332 308
792 3300010375 Ga0105239_10037988 Ga0105239_100379882 308
793 3300013102 Ga0157371_10014930 Ga0157371_100149301 308
794 3300025256 Ga0209759_1008745 Ga0209759_10087453 308
795 3300025728 Ga0207655_1031276 Ga0207655_10312762 308
796 3300026078 Ga0207702_10187012 Ga0207702_101870122 308
797 3300027424 Ga0209984_1002678 Ga0209984_10026783 308
798 3300027471 Ga0209995_1000886 Ga0209995_10008864 308
799 3300027614 Ga0209970_1005815 Ga0209970_10058151 308
800 3300027665 Ga0209983_1003351 Ga0209983_10033513 308
801 3300027682 Ga0209971_1001514 Ga0209971_10015144 308
802 3300027876 Ga0209974_10008018 Ga0209974_100080183 308
803 3300031691 Ga0316579_10000158 Ga0316579_1000015818 308
804 3300031733 Ga0316577_10003059 Ga0316577_100030597 308
805 3300031824 Ga0307413_10004776 Ga0307413_100047766 308
806 3300032004 Ga0307414_10143163 Ga0307414_101431633 308
807 3300032133 Ga0316583_10021096 Ga0316583_100210962 308
808 3300032137 Ga0316585_10001855 Ga0316585_100018552 308
809 3300032168 Ga0316593_10007343 Ga0316593_100073433 308
810 3300032168 Ga0316593_10026155 Ga0316593_100261553 308
811 3300035398 Ga0316574_0007609 Ga0316574_0007609_3905_4843 308
812 3300036647 Ga0316582_0004967 Ga0316582_0004967_3777_4715 308
813 3300036647 Ga0316582_0084293 Ga0316582_0084293_619_1563 308
814 3300038725 Ga0400484_23031 Ga0400484_23031_830_1765 308
815 3300038726 Ga0400490_45667 Ga0400490_45667_51_986 308
816 3300039062 Ga0400483_055564 Ga0400483_055564_2631_3566 308
817 3300039062 Ga0400483_086083 Ga0400483_086083_112_1047 308
818 3300039062 Ga0400483_093671 Ga0400483_093671_598_1533 308
819 3300039062 Ga0400483_201732 Ga0400483_201732_1882_2817 308
820 3300039062 Ga0400483_280570 Ga0400483_280570_636_1571 308
821 3300041407 Ga0439447_003544 Ga0439447_003544_2711_3658 308
822 3300041460 Ga0451802_1342131 Ga0451802_1342131_611_1549 308
823 3300041494 Ga0451837_0466646 Ga0451837_0466646_528_1466 308
824 3300042006 Ga0439432_004394 Ga0439432_004394_2152_3099 308
825 3300042009 Ga0439451_005425 Ga0439451_005425_725_1672 308
826 3300042010 Ga0439452_008326 Ga0439452_008326_2152_3099 308
827 3300046524 Ga0495648_0013861 Ga0495648_0013861_4956_5897 308
828 3300048929 Ga0496126_0248437 Ga0496126_0248437_267_1211 308
829 3300049571 Ga0501034_0390282 Ga0501034_0390282_297_1244 308
830 3300049583 Ga0501067_0016549 Ga0501067_0016549_2100_3038 308
831 3300049584 Ga0501068_0000804 Ga0501068_0000804_10653_11591 308
832 3300049586 Ga0501070_0011456 Ga0501070_0011456_1876_2814 308
833 3300049587 Ga0501071_0295976 Ga0501071_0295976_275_1213 308
834 3300049588 Ga0501072_0020139 Ga0501072_0020139_998_1936 308
835 3300049589 Ga0501073_0006025 Ga0501073_0006025_5026_5964 308
836 3300049590 Ga0501074_0005572 Ga0501074_0005572_1345_2283 308
837 3300049591 Ga0501075_0134707 Ga0501075_0134707_625_1563 308
838 3300049593 Ga0501077_0004667 Ga0501077_0004667_3576_4514 308
839 3300049741 Ga0501079_0001458 Ga0501079_0001458_2562_3500 308
840 3300049742 Ga0501080_0017301 Ga0501080_0017301_3895_4833 308
841 3300049744 Ga0501083_0009175 Ga0501083_0009175_5014_5952 308
842 3300053108 Ga0500562_043559 Ga0500562_043559_185_1144 308
843 3300054114 Ga0501084_0011370 Ga0501084_0011370_4686_5624 308
844 3300032168 Ga0316593_10023661 Ga0316593_100236612 309
845 3300036712 Ga0316584_0030898 Ga0316584_0030898_864_1802 309
846 iso_pu_bacteria 2599185299 2599928202 309
847 iso_pu_bacteria 2648501693 2650900141 309
848 iso_pu_bacteria 2684622997 2686354381 309
849 iso_pu_bacteria 2847797336 2847801232 309
850 iso_pu_bacteria 2854601825 2854602939 309
851 iso_pu_bacteria 2858466076 2858469617 309
852 iso_pu_bacteria 2871272651 2871273612 309
853 iso_pu_bacteria 2984494565 2984498059 309
854 iso_pu_bacteria 2990261002 2990264427 309
855 iso_pu_bacteria 2547132181 2547696612 310
856 iso_pu_bacteria 2561511199 2562465973 310
857 iso_pu_bacteria 2600255256 2601534023 310
858 iso_pu_bacteria 2600255257 2601540191 310
859 iso_pu_bacteria 2600255310 2601758826 310
860 iso_pu_bacteria 2600255311 2601762823 310
861 iso_pu_bacteria 2602042046 2603640676 310
862 iso_pu_bacteria 2791355010 2792313387 310
863 iso_pu_bacteria 2811995292 2813730563 310
864 iso_pu_bacteria 2814123068 2814698170 310
865 iso_pu_bacteria 2935625433 2935627975 310
866 iso_pu_bacteria 2974435778 2974437004 310
867 iso_pu_bacteria 3000376612 3000380481 310
868 3300001989 JGI24739J22299_10000036 JGI24739J22299_100000364 313
869 3300002737 JGI25162J39368_1002447 JGI25162J39368_10024471 313
870 3300002773 JGI25152J39213_1000187 JGI25152J39213_100018723 313
871 3300003320 rootH2_10023964 rootH2_100239649 313
872 3300003856 Ga0058692_1001649 Ga0058692_10016496 313
873 3300003856 Ga0058692_1001730 Ga0058692_10017303 313
874 3300003856 Ga0058692_1006192 Ga0058692_10061923 313
875 3300006946 Ga0079104_1000308 Ga0079104_10003083 313
876 3300006946 Ga0079104_1001380 Ga0079104_100138017 313
877 3300009011 Ga0105251_10002158 Ga0105251_100021583 313
878 3300009036 Ga0105244_10000293 Ga0105244_1000029314 313
879 3300011119 Ga0105246_10027556 Ga0105246_100275563 313
880 3300013100 Ga0157373_10009701 Ga0157373_100097013 313
881 3300013102 Ga0157371_10016478 Ga0157371_100164783 313
882 3300013102 Ga0157371_10035692 Ga0157371_100356923 313
883 3300013104 Ga0157370_10000452 Ga0157370_100004529 313
884 3300013105 Ga0157369_10001732 Ga0157369_1000173215 313
885 3300013307 Ga0157372_10001062 Ga0157372_1000106216 313
886 3300015261 Ga0182006_1007687 Ga0182006_10076873 313
887 3300025245 Ga0207425_1006279 Ga0207425_10062793 313
888 3300025258 Ga0209129_1000008 Ga0209129_1000008467 313
889 3300025728 Ga0207655_1000026 Ga0207655_1000026372 313
890 3300025728 Ga0207655_1001273 Ga0207655_100127322 313
891 3300025728 Ga0207655_1003937 Ga0207655_10039375 313
892 3300027111 Ga0209281_1000058 Ga0209281_1000058156 313
893 3300027111 Ga0209281_1001193 Ga0209281_100119314 313
894 3300027312 Ga0209371_1000014 Ga0209371_1000014114 313
895 3300027312 Ga0209371_1000054 Ga0209371_100005433 313
896 3300030500 Ga0268256_1000012 Ga0268256_1000012660 313
897 3300030500 Ga0268256_1000021 Ga0268256_1000021108 313
898 3300042006 Ga0439432_002736 Ga0439432_002736_2820_3761 313
899 3300042010 Ga0439452_000004 Ga0439452_000004_635957_636898 313
900 3300042010 Ga0439452_000005 Ga0439452_000005_125262_126206 313
901 3300042010 Ga0439452_000428 Ga0439452_000428_15257_16198 313
902 3300046500 Ga0495596_0027282 Ga0495596_0027282_549_1490 313
903 3300048919 Ga0496116_0000217 Ga0496116_0000217_72367_73308 313
904 3300048919 Ga0496116_0089752 Ga0496116_0089752_671_1615 313
905 3300048920 Ga0496117_0001101 Ga0496117_0001101_34924_35865 313
906 3300048920 Ga0496117_0005290 Ga0496117_0005290_4628_5572 313
907 3300048921 Ga0496118_0002338 Ga0496118_0002338_23429_24370 313
908 3300048921 Ga0496118_0085298 Ga0496118_0085298_585_1529 313
909 3300048922 Ga0496119_0000026 Ga0496119_0000026_35483_36427 313
910 3300048923 Ga0496120_0031913 Ga0496120_0031913_695_1639 313
911 3300048927 Ga0496124_0000142 Ga0496124_0000142_84898_85842 313
912 3300048927 Ga0496124_0007498 Ga0496124_0007498_4455_5396 313
913 3300048928 Ga0496125_0014965 Ga0496125_0014965_6564_7505 313
914 3300048929 Ga0496126_0085718 Ga0496126_0085718_1370_2314 313

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01795

Methyltransf_5

MraW methylase family

51

356

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tka-assembly1.cif.gz_A-2 crystal structure and solution saxs of methyltransferase rsmh from e.coli 0.9838 8 313
3tka-assembly1.cif.gz_A-2 crystal structure and solution saxs of methyltransferase rsmh from e.coli 0.9804 8 313
1wg8-assembly2.cif.gz_B crystal structure of a predicted s-adenosylmethionine-dependent methyltransferase tt1512 from thermus thermophilus hb8. 0.9576 6 311
1wg8-assembly2.cif.gz_B crystal structure of a predicted s-adenosylmethionine-dependent methyltransferase tt1512 from thermus thermophilus hb8. 0.9509 6 311
1n2x-assembly1.cif.gz_A crystal structure analysis of tm0872, a putative sam-dependent methyltransferase, complexed with sam 0.9114 7 310
ID Description Score Start End Superfamily
3tkaA02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative methyltransferase TM0872, insert domain 0.9982 113 213 1.10.150.170
af_P60390_9_313_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9906 9 313 3.40.50.150
af_P60390_9_313_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9874 9 313 3.40.50.150
3tkaA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9727 8 313 3.40.50.150
3tkaA02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative methyltransferase TM0872, insert domain 0.9682 113 213 1.10.150.170
ID Description Score Start End GO Terms
AF-A0A2X1N3B5-F1-model_v4 S-adenosyl-methyltransferase MraW (EC 2.1.1.199) 0.9995 52 252 GO:0005737
GO:0070475
GO:0071424
AF-A0A656GR36-F1-model_v4 deleted 0.9905 75 259
AF-A0A2X2BFM0-F1-model_v4 Ribosomal RNA small subunit methyltransferase H (EC 2.1.1.199) (16S rRNA m(4)C1402 methyltransferase) (rRNA (cytosine-N(4)-)-methyltransferase RsmH) 0.9857 64 313 GO:0005737
GO:0070475
GO:0071424
AF-A0A2S5LTZ9-F1-model_v4 16S rRNA (Cytosine(1402)-N(4))-methyltransferase 0.9855 7 150 GO:0005737
GO:0070475
GO:0071424
AF-A0A257X594-F1-model_v4 16S rRNA (Cytosine(1402)-N(4))-methyltransferase 0.9852 7 250 GO:0005737
GO:0070475
GO:0071424

Feature Viewer

pLDDT pTM Quality
94.07 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map