F485523
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 912 | 405 | 876 | 492 |
Family's Representative Sequence
| Representative Sequence | 3300053119|Ga0500595_001478|Ga0500595_001478_1575_3242 |
| Length | 555 |
| Sequence | MELYRLFAIGGGFLVSFAFMDLLKAFPHKRELNAVKWLVVSATHNIATLLSEGENSLVAKQYILALDQGTTSSRAMVVDETGAVISIAQHPFKQIFPKPGWVEHSPTEIWSSQSGVATEALAKANLTGRNITTIGITNQRETTVVWDRETGEPVYNAIVWQDRRTAEFCDGLRVNVGGTIQQKTGLIPDAYFSGSKVNWILANVDGARAKAEAGRLAFGTVDSWLIWKLTNGARHVTDVTNASRTMLFNIHTMDWDEELLKLLGVPRSMLPEVVASSGVCATTTGLIAGVPIAGIAGDQQAALFGQMCTSPGMAKCTYGTGAFMLLNTGTQPVASKNRLLTTVAWKIGNTVEYALEGSMLMAGAVVQWLRDELQMIRTSAEIEQLAATVTSSNGVVLVPAFAGLGAPHWDPYARGSLLGLTRGTSRAHIARAALEGIALQATDVLEAMQADSGLPLAQLRVDGGAAANNMLMQIQSDVLGIEVVRPKNAEATVLGAAYLAGLAVGYWPDKDTIARQWQMDRVFKPAMDSRDREKVRGTWRRALERASDWAREEEK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2501025501 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 2 | 2501025504 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 3 | 2510917014 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 4 | 2510917015 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 5 | 2511231026 | Herbaspirillum sp. YR522 | Isolate | Rhizosphere |
| 6 | 2582581278 | Chryseobacterium sp. CF365 | Isolate | Rhizosphere |
| 7 | 2585428183 | Chryseobacterium sp. YR485 | Isolate | Rhizosphere |
| 8 | 2585428187 | Chryseobacterium sp. YR460 | Isolate | Rhizosphere |
| 9 | 2643221554 | Duganella sp. Root1480D1 | Isolate | Unclassified |
| 10 | 2643221638 | Duganella sp. Root336D2 | Isolate | Unclassified |
| 11 | 2643221645 | Massilia sp. Root351 | Isolate | Unclassified |
| 12 | 2643221664 | Massilia sp. Root418 | Isolate | Unclassified |
| 13 | 2738541280 | Massilia sp. GV090 | Isolate | Unclassified |
| 14 | 2738541297 | Duganella sp. GV083 | Isolate | Unclassified |
| 15 | 2738541300 | Massilia sp. GV016 | Isolate | Unclassified |
| 16 | 2738541357 | Duganella sp. GV053 | Isolate | Unclassified |
| 17 | 2738543003 | Duganella sp. GV066 | Isolate | Unclassified |
| 18 | 2738543018 | Massilia sp. GV045 | Isolate | Unclassified |
| 19 | 2738543026 | Duganella sp. GV089 | Isolate | Unclassified |
| 20 | 2738543029 | Duganella sp. GV039 | Isolate | Unclassified |
| 21 | 2738543030 | Massilia sp. GV097 | Isolate | Unclassified |
| 22 | 2739367874 | Chryseobacterium sp. T16E-39 | Isolate | Unclassified |
| 23 | 2765235839 | Chryseobacterium indologenes AA5 | Isolate | Unclassified |
| 24 | 2808606418 | Herbaspirillum sp. SJZ107 | Isolate | Rhizosphere |
| 25 | 2821131069 | Duganella sp. 1224 | Isolate | Unclassified |
| 26 | 2842711865 | Duganella sp. R-73148 | Isolate | Unclassified |
| 27 | 2857553236 | Duganella sp. R-74557 | Isolate | Unclassified |
| 28 | 2857558681 | Duganella sp. R-74565 | Isolate | Unclassified |
| 29 | 2857564685 | Duganella sp. R-74599 | Isolate | Unclassified |
| 30 | 2871720351 | Chryseobacterium sp. KLBC 52 | Isolate | Nodule |
| 31 | 2883087390 | Paraburkholderia guartelaensis CNPSo 3008 | Isolate | Unclassified |
| 32 | 2884215851 | Edaphobacter sp. 12200R-103 | Isolate | Rhizosphere |
| 33 | 2904424332 | Duganella sp. 1411 | Isolate | Rhizosphere |
| 34 | 2919476304 | Duganella sp. 3397 | Isolate | Unclassified |
| 35 | 2945924605 | Chryseobacterium ginsenosidimutans W1I9 | Isolate | Rhizosphere |
| 36 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 37 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 38 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 39 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 40 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 41 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 42 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 43 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 44 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 45 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 46 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 47 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 48 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 49 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 50 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 51 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 52 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 53 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 54 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 55 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 56 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 60 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 63 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 64 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 66 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 67 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 74 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 83 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 84 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 85 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 86 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 87 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 88 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 89 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 90 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 91 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 94 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 95 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 96 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 98 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 99 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 100 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 101 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 102 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 103 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 104 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 105 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 106 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 107 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 108 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 109 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 110 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 111 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 112 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 113 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 114 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 115 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 116 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 117 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 136 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 137 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 138 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 140 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 141 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 142 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 143 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 145 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 147 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 149 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 152 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 201 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 205 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 209 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 210 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 211 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 212 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 213 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 214 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 215 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 216 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 217 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 218 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 219 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 220 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 221 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 222 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 223 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 224 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 225 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 226 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 227 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 228 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 229 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 230 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 231 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 232 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 233 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 234 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 235 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 236 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 237 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 238 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 239 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 240 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 241 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 242 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 243 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 244 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 245 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 246 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 247 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 338 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 339 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 340 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 341 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 342 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 343 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 344 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 345 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 346 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 347 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 348 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 349 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 350 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 351 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 352 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 353 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 356 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 358 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 359 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 360 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 361 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 362 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 363 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 364 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 365 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 366 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 367 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 368 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 369 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 370 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 371 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 372 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 373 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 374 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 375 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 376 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 377 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 378 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 379 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 380 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 381 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 382 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 383 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 384 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 385 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 386 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 387 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 388 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 389 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 390 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 391 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 392 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 393 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 394 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 395 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 398 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 399 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 400 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 401 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 402 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 403 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 404 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 405 | 8057160832 | Larsenimonas rhizosphaerae GH2-1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.05 |
| Metatranscriptomes | 0 |
| Isolates | 3.95 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.88 |
| Nodule | 0.22 |
| Rhizoplane | 1.54 |
| Rhizosphere | 84.98 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.39 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24741J21665_1000554 | 3300001915 | Bacteria | 11423 |
| 2 | JGI24748J21848_1002744 | 3300002074 | Bacteria | 2000 |
| 3 | JGI24034J26672_10000147 | 3300002239 | Bacteria | 10141 |
| 4 | JGI25152J39213_1003586 | 3300002773 | Bacteria | 5254 |
| 5 | JGI25150J39212_1002183 | 3300002774 | Bacteria | 5003 |
| 6 | JGI25150J39212_1010346 | 3300002774 | Bacteria | 1737 |
| 7 | JGI25159J45721_1003997 | 3300002987 | Bacteria | 5022 |
| 8 | JGI25159J45721_1004079 | 3300002987 | Bacteria | 4957 |
| 9 | JGI25159J45721_1005468 | 3300002987 | Bacteria | 3986 |
| 10 | JGI25153J46596_10004507 | 3300003215 | Bacteria | 7497 |
| 11 | rootL2_10159492 | 3300003322 | Bacteria | 6215 |
| 12 | JGI25160J50197_1005006 | 3300003354 | Bacteria | 5609 |
| 13 | JGI25161J50226_1002268 | 3300003374 | Bacteria | 5034 |
| 14 | JGI25161J50226_1002280 | 3300003374 | Bacteria | 5023 |
| 15 | Ga0055529_1000027 | 3300003763 | Bacteria | 292744 |
| 16 | Ga0055529_1001421 | 3300003763 | Bacteria | 7548 |
| 17 | Ga0055526_1005264 | 3300003771 | Bacteria | 7497 |
| 18 | Ga0055526_1008101 | 3300003771 | Bacteria | 5301 |
| 19 | Ga0055526_1008548 | 3300003771 | Bacteria | 5081 |
| 20 | Ga0055526_1009279 | 3300003771 | Bacteria | 4766 |
| 21 | Ga0055537_1004396 | 3300003773 | Bacteria | 4035 |
| 22 | Ga0055524_1000022 | 3300003775 | Bacteria | 224103 |
| 23 | Ga0055524_1002028 | 3300003775 | Bacteria | 10811 |
| 24 | Ga0055524_1004397 | 3300003775 | Bacteria | 6501 |
| 25 | Ga0055524_1006458 | 3300003775 | Bacteria | 5081 |
| 26 | Ga0055534_1000254 | 3300003784 | Bacteria | 37129 |
| 27 | Ga0055534_1002808 | 3300003784 | Bacteria | 5810 |
| 28 | Ga0055528_1000031 | 3300003790 | Bacteria | 120960 |
| 29 | Ga0055530_10006375 | 3300003791 | Bacteria | 5292 |
| 30 | Ga0055530_10006633 | 3300003791 | Bacteria | 5111 |
| 31 | Ga0055543_1003018 | 3300004625 | Bacteria | 5194 |
| 32 | Ga0065165_1002165 | 3300005262 | Bacteria | 17754 |
| 33 | Ga0065165_1002884 | 3300005262 | Bacteria | 13219 |
| 34 | Ga0065165_1029943 | 3300005262 | Bacteria | 1737 |
| 35 | Ga0065704_10093677 | 3300005289 | Bacteria | 2583 |
| 36 | Ga0070658_10000046 | 3300005327 | Bacteria | 130559 |
| 37 | Ga0070658_10006014 | 3300005327 | Bacteria | 9845 |
| 38 | Ga0070658_10094151 | 3300005327 | Bacteria | 2471 |
| 39 | Ga0070676_10004005 | 3300005328 | Bacteria | 7731 |
| 40 | Ga0070676_10006446 | 3300005328 | Bacteria | 6274 |
| 41 | Ga0070683_100000958 | 3300005329 | Bacteria | 21438 |
| 42 | Ga0070683_100013428 | 3300005329 | Bacteria | 7143 |
| 43 | Ga0070683_100032958 | 3300005329 | Bacteria | 4721 |
| 44 | Ga0070683_100034891 | 3300005329 | Bacteria | 4598 |
| 45 | Ga0070690_100033253 | 3300005330 | Bacteria | 3226 |
| 46 | Ga0070670_100084892 | 3300005331 | Bacteria | 2720 |
| 47 | Ga0070670_100132312 | 3300005331 | Bacteria | 2154 |
| 48 | Ga0070666_10115908 | 3300005335 | Bacteria | 1855 |
| 49 | Ga0070682_100000608 | 3300005337 | Bacteria | 21759 |
| 50 | Ga0070682_100038141 | 3300005337 | Bacteria | 2945 |
| 51 | Ga0068868_100019452 | 3300005338 | Bacteria | 5088 |
| 52 | Ga0070660_100051141 | 3300005339 | Bacteria | 3181 |
| 53 | Ga0070689_100035150 | 3300005340 | Bacteria | 3827 |
| 54 | Ga0070689_100036095 | 3300005340 | Bacteria | 3780 |
| 55 | Ga0070687_100005339 | 3300005343 | Bacteria | 5196 |
| 56 | Ga0070661_100001276 | 3300005344 | Bacteria | 17703 |
| 57 | Ga0070668_100054943 | 3300005347 | Bacteria | 3073 |
| 58 | Ga0070669_100000002 | 3300005353 | Bacteria | 506497 |
| 59 | Ga0070669_100021945 | 3300005353 | Bacteria | 4565 |
| 60 | Ga0070675_100080968 | 3300005354 | Bacteria | 2707 |
| 61 | Ga0070671_100020237 | 3300005355 | Bacteria | 5425 |
| 62 | Ga0070674_100000075 | 3300005356 | Bacteria | 45822 |
| 63 | Ga0070674_100024912 | 3300005356 | Bacteria | 3887 |
| 64 | Ga0070674_100059418 | 3300005356 | Bacteria | 2661 |
| 65 | Ga0070688_100072385 | 3300005365 | Bacteria | 2209 |
| 66 | Ga0070659_100002179 | 3300005366 | Bacteria | 13945 |
| 67 | Ga0070659_100110036 | 3300005366 | Bacteria | 2224 |
| 68 | Ga0070667_100127410 | 3300005367 | Bacteria | 2219 |
| 69 | Ga0070714_100001328 | 3300005435 | Bacteria | 17855 |
| 70 | Ga0070713_100033721 | 3300005436 | Bacteria | 4105 |
| 71 | Ga0070700_100012722 | 3300005441 | Bacteria | 4708 |
| 72 | Ga0070700_100047855 | 3300005441 | Bacteria | 2648 |
| 73 | Ga0070708_100013120 | 3300005445 | Bacteria | 6779 |
| 74 | Ga0070708_100083628 | 3300005445 | Bacteria | 2894 |
| 75 | Ga0070708_100103496 | 3300005445 | Bacteria | 2610 |
| 76 | Ga0070663_100142610 | 3300005455 | Bacteria | 1830 |
| 77 | Ga0070662_100033559 | 3300005457 | Bacteria | 3615 |
| 78 | Ga0070662_100052580 | 3300005457 | Bacteria | 2945 |
| 79 | Ga0070662_100077482 | 3300005457 | Bacteria | 2467 |
| 80 | Ga0070681_10010965 | 3300005458 | Bacteria | 8963 |
| 81 | Ga0068867_100169349 | 3300005459 | Bacteria | 1729 |
| 82 | Ga0070706_100002511 | 3300005467 | Bacteria | 18474 |
| 83 | Ga0070706_100011228 | 3300005467 | Bacteria | 8318 |
| 84 | Ga0070706_100025573 | 3300005467 | Bacteria | 5434 |
| 85 | Ga0070707_100009163 | 3300005468 | Bacteria | 9183 |
| 86 | Ga0070698_100007507 | 3300005471 | Bacteria | 11798 |
| 87 | Ga0070698_100083291 | 3300005471 | Bacteria | 3188 |
| 88 | Ga0070679_100008498 | 3300005530 | Bacteria | 9673 |
| 89 | Ga0070679_100032747 | 3300005530 | Bacteria | 5144 |
| 90 | Ga0070679_100096336 | 3300005530 | Bacteria | 2946 |
| 91 | Ga0070684_100017640 | 3300005535 | Bacteria | 5864 |
| 92 | Ga0068853_100000021 | 3300005539 | Bacteria | 149283 |
| 93 | Ga0068853_100015247 | 3300005539 | Bacteria | 6317 |
| 94 | Ga0068853_100094885 | 3300005539 | Bacteria | 2629 |
| 95 | Ga0070686_100030529 | 3300005544 | Bacteria | 3288 |
| 96 | Ga0070696_100035528 | 3300005546 | Bacteria | 3433 |
| 97 | Ga0070665_100005374 | 3300005548 | Bacteria | 13227 |
| 98 | Ga0070704_100006379 | 3300005549 | Bacteria | 6953 |
| 99 | Ga0068855_100003678 | 3300005563 | Bacteria | 18757 |
| 100 | Ga0068855_100012820 | 3300005563 | Bacteria | 10113 |
| 101 | Ga0068854_100000075 | 3300005578 | Bacteria | 71042 |
| 102 | Ga0070702_100013695 | 3300005615 | Bacteria | 4101 |
| 103 | Ga0068852_100041861 | 3300005616 | Bacteria | 3875 |
| 104 | Ga0068866_10000469 | 3300005718 | Bacteria | 18473 |
| 105 | Ga0068866_10019822 | 3300005718 | Bacteria | 3070 |
| 106 | Ga0068861_100009161 | 3300005719 | Bacteria | 6826 |
| 107 | Ga0068851_10061200 | 3300005834 | Bacteria | 1929 |
| 108 | Ga0068870_10003915 | 3300005840 | Bacteria | 6354 |
| 109 | Ga0068863_100212510 | 3300005841 | Bacteria | 1863 |
| 110 | Ga0068858_100095987 | 3300005842 | Bacteria | 2762 |
| 111 | Ga0068858_100123830 | 3300005842 | Bacteria | 2419 |
| 112 | Ga0068860_100002743 | 3300005843 | Bacteria | 18327 |
| 113 | Ga0068860_100112638 | 3300005843 | Bacteria | 2601 |
| 114 | Ga0068862_100000833 | 3300005844 | Bacteria | 30475 |
| 115 | Ga0068862_100016419 | 3300005844 | Bacteria | 6161 |
| 116 | Ga0081538_10000086 | 3300005981 | Bacteria | 89701 |
| 117 | Ga0081538_10005107 | 3300005981 | Bacteria | 11920 |
| 118 | Ga0081538_10056630 | 3300005981 | Bacteria | 2294 |
| 119 | Ga0081539_10001052 | 3300005985 | Bacteria | 50554 |
| 120 | Ga0070717_10000138 | 3300006028 | Bacteria | 54320 |
| 121 | Ga0070717_10187262 | 3300006028 | Bacteria | 1807 |
| 122 | Ga0075365_10003408 | 3300006038 | Bacteria | 8180 |
| 123 | Ga0068871_100078589 | 3300006358 | Bacteria | 2728 |
| 124 | Ga0075428_100005570 | 3300006844 | Bacteria | 13994 |
| 125 | Ga0075430_100009725 | 3300006846 | Bacteria | 8128 |
| 126 | Ga0075431_100002603 | 3300006847 | Bacteria | 17447 |
| 127 | Ga0075431_100017090 | 3300006847 | Bacteria | 7370 |
| 128 | Ga0075431_100067431 | 3300006847 | Bacteria | 3693 |
| 129 | Ga0075431_100122062 | 3300006847 | Bacteria | 2688 |
| 130 | Ga0075433_10049441 | 3300006852 | Bacteria | 3658 |
| 131 | Ga0075434_100001516 | 3300006871 | Bacteria | 19638 |
| 132 | Ga0075435_100097095 | 3300007076 | Bacteria | 2438 |
| 133 | Ga0105244_10008170 | 3300009036 | Bacteria | 6562 |
| 134 | Ga0105240_10003871 | 3300009093 | Bacteria | 23106 |
| 135 | Ga0105240_10039372 | 3300009093 | Bacteria | 6054 |
| 136 | Ga0105240_10039928 | 3300009093 | Bacteria | 6007 |
| 137 | Ga0105240_10055880 | 3300009093 | Bacteria | 4941 |
| 138 | Ga0111539_10002412 | 3300009094 | Bacteria | 24866 |
| 139 | Ga0111539_10022661 | 3300009094 | Bacteria | 7715 |
| 140 | Ga0111539_10043978 | 3300009094 | Bacteria | 5352 |
| 141 | Ga0111539_10091770 | 3300009094 | Bacteria | 3568 |
| 142 | Ga0105245_10223916 | 3300009098 | Bacteria | 1816 |
| 143 | Ga0114129_10000276 | 3300009147 | Bacteria | 58586 |
| 144 | Ga0114129_10004035 | 3300009147 | Bacteria | 20726 |
| 145 | Ga0114129_10037872 | 3300009147 | Bacteria | 6805 |
| 146 | Ga0114129_10060493 | 3300009147 | Bacteria | 5296 |
| 147 | Ga0114129_10192762 | 3300009147 | Bacteria | 2766 |
| 148 | Ga0105243_10083102 | 3300009148 | Bacteria | 2619 |
| 149 | Ga0105242_10013245 | 3300009176 | Bacteria | 6366 |
| 150 | Ga0105242_10024217 | 3300009176 | Bacteria | 4792 |
| 151 | Ga0105242_10121218 | 3300009176 | Bacteria | 2245 |
| 152 | Ga0105248_10061547 | 3300009177 | Bacteria | 4215 |
| 153 | Ga0105248_10302373 | 3300009177 | Bacteria | 1801 |
| 154 | Ga0105238_10051950 | 3300009551 | Bacteria | 4121 |
| 155 | Ga0105249_10023904 | 3300009553 | Bacteria | 5489 |
| 156 | Ga0105249_10094420 | 3300009553 | Bacteria | 2803 |
| 157 | Ga0105249_10145546 | 3300009553 | Bacteria | 2276 |
| 158 | Ga0105249_10172446 | 3300009553 | Bacteria | 2099 |
| 159 | Ga0157370_10025270 | 3300013104 | Bacteria | 5879 |
| 160 | Ga0157370_10025427 | 3300013104 | Bacteria | 5860 |
| 161 | Ga0157370_10030691 | 3300013104 | Bacteria | 5265 |
| 162 | Ga0157370_10090329 | 3300013104 | Bacteria | 2876 |
| 163 | Ga0157369_10008375 | 3300013105 | Bacteria | 11859 |
| 164 | Ga0157369_10009230 | 3300013105 | Bacteria | 11282 |
| 165 | Ga0157369_10056938 | 3300013105 | Bacteria | 4218 |
| 166 | Ga0157369_10085370 | 3300013105 | Bacteria | 3373 |
| 167 | Ga0157374_10005308 | 3300013296 | Bacteria | 10822 |
| 168 | Ga0157374_10128532 | 3300013296 | Bacteria | 2450 |
| 169 | Ga0163162_10000370 | 3300013306 | Bacteria | 40835 |
| 170 | Ga0157372_10006882 | 3300013307 | Bacteria | 12097 |
| 171 | Ga0157372_10008860 | 3300013307 | Bacteria | 10687 |
| 172 | Ga0157372_10041737 | 3300013307 | Bacteria | 5072 |
| 173 | Ga0157375_10001252 | 3300013308 | Bacteria | 21985 |
| 174 | Ga0157375_10050708 | 3300013308 | Bacteria | 4072 |
| 175 | Ga0157380_10079004 | 3300014326 | Bacteria | 2686 |
| 176 | Ga0157379_10038997 | 3300014968 | Bacteria | 4238 |
| 177 | Ga0182006_1000169 | 3300015261 | Bacteria | 68993 |
| 178 | Ga0182005_1000003 | 3300015265 | Bacteria | 683269 |
| 179 | Ga0213872_10000622 | 3300021361 | Bacteria | 26830 |
| 180 | Ga0213872_10001135 | 3300021361 | Bacteria | 18210 |
| 181 | Ga0213872_10009107 | 3300021361 | Bacteria | 4771 |
| 182 | Ga0213872_10038615 | 3300021361 | Bacteria | 2179 |
| 183 | Ga0213872_10040523 | 3300021361 | Bacteria | 2126 |
| 184 | Ga0209436_100529 | 3300025208 | Bacteria | 16608 |
| 185 | Ga0209436_102729 | 3300025208 | Bacteria | 5085 |
| 186 | Ga0209436_111418 | 3300025208 | Bacteria | 1562 |
| 187 | Ga0207425_1000013 | 3300025245 | Bacteria | 497384 |
| 188 | Ga0207425_1001817 | 3300025245 | Bacteria | 8267 |
| 189 | Ga0207425_1002536 | 3300025245 | Bacteria | 6369 |
| 190 | Ga0209646_1000126 | 3300025246 | Bacteria | 132815 |
| 191 | Ga0209129_1000106 | 3300025258 | Bacteria | 156102 |
| 192 | Ga0209129_1006180 | 3300025258 | Bacteria | 3971 |
| 193 | Ga0209565_1000035 | 3300025263 | Bacteria | 298125 |
| 194 | Ga0209565_1001529 | 3300025263 | Bacteria | 9962 |
| 195 | Ga0209565_1015177 | 3300025263 | Bacteria | 1743 |
| 196 | Ga0209565_1017862 | 3300025263 | Bacteria | 1546 |
| 197 | Ga0209455_1000033 | 3300025272 | Bacteria | 504606 |
| 198 | Ga0209455_1004973 | 3300025272 | Bacteria | 4214 |
| 199 | Ga0209673_1000006 | 3300025273 | Bacteria | 650600 |
| 200 | Ga0209130_1001743 | 3300025284 | Bacteria | 12967 |
| 201 | Ga0209130_1002565 | 3300025284 | Bacteria | 8862 |
| 202 | Ga0209130_1004648 | 3300025284 | Bacteria | 5101 |
| 203 | Ga0209675_1000005 | 3300025291 | Bacteria | 849192 |
| 204 | Ga0209675_1001499 | 3300025291 | Bacteria | 13390 |
| 205 | Ga0209675_1013774 | 3300025291 | Bacteria | 2505 |
| 206 | Ga0209025_1001104 | 3300025294 | Bacteria | 38839 |
| 207 | Ga0209564_1000028 | 3300025295 | Bacteria | 510986 |
| 208 | Ga0209564_1000032 | 3300025295 | Bacteria | 464041 |
| 209 | Ga0209564_1000083 | 3300025295 | Bacteria | 259272 |
| 210 | Ga0209564_1000088 | 3300025295 | Bacteria | 250268 |
| 211 | Ga0209564_1002997 | 3300025295 | Bacteria | 12123 |
| 212 | Ga0209758_1000031 | 3300025297 | Bacteria | 497252 |
| 213 | Ga0209758_1000343 | 3300025297 | Bacteria | 85198 |
| 214 | Ga0209050_1000078 | 3300025298 | Bacteria | 278409 |
| 215 | Ga0209050_1003291 | 3300025298 | Bacteria | 12126 |
| 216 | Ga0209256_1000035 | 3300025299 | Bacteria | 386754 |
| 217 | Ga0209256_1000141 | 3300025299 | Bacteria | 152280 |
| 218 | Ga0209256_1000305 | 3300025299 | Bacteria | 85970 |
| 219 | Ga0209256_1000712 | 3300025299 | Bacteria | 44167 |
| 220 | Ga0209256_1006321 | 3300025299 | Bacteria | 6337 |
| 221 | Ga0207426_1002410 | 3300025302 | Bacteria | 12021 |
| 222 | Ga0207426_1011253 | 3300025302 | Bacteria | 3422 |
| 223 | Ga0209051_1010576 | 3300025303 | Bacteria | 4640 |
| 224 | Ga0209257_1000097 | 3300025304 | Bacteria | 259243 |
| 225 | Ga0207697_10011578 | 3300025315 | Bacteria | 3727 |
| 226 | Ga0207642_10000181 | 3300025899 | Bacteria | 18196 |
| 227 | Ga0207680_10079907 | 3300025903 | Bacteria | 2052 |
| 228 | Ga0207643_10001923 | 3300025908 | Bacteria | 11475 |
| 229 | Ga0207643_10011795 | 3300025908 | Bacteria | 4717 |
| 230 | Ga0207705_10000064 | 3300025909 | Bacteria | 141200 |
| 231 | Ga0207705_10000465 | 3300025909 | Bacteria | 34700 |
| 232 | Ga0207705_10003727 | 3300025909 | Bacteria | 11601 |
| 233 | Ga0207705_10006639 | 3300025909 | Bacteria | 8562 |
| 234 | Ga0207705_10032829 | 3300025909 | Bacteria | 3709 |
| 235 | Ga0207684_10002504 | 3300025910 | Bacteria | 18488 |
| 236 | Ga0207684_10028522 | 3300025910 | Bacteria | 4756 |
| 237 | Ga0207684_10056818 | 3300025910 | Bacteria | 3321 |
| 238 | Ga0207684_10094319 | 3300025910 | Bacteria | 2553 |
| 239 | Ga0207695_10000001 | 3300025913 | Bacteria | 2888630 |
| 240 | Ga0207695_10007257 | 3300025913 | Bacteria | 14150 |
| 241 | Ga0207662_10008062 | 3300025918 | Bacteria | 5749 |
| 242 | Ga0207657_10002434 | 3300025919 | Bacteria | 20096 |
| 243 | Ga0207657_10039626 | 3300025919 | Bacteria | 4185 |
| 244 | Ga0207652_10022861 | 3300025921 | Bacteria | 5179 |
| 245 | Ga0207652_10028868 | 3300025921 | Bacteria | 4631 |
| 246 | Ga0207652_10084328 | 3300025921 | Bacteria | 2783 |
| 247 | Ga0207646_10005544 | 3300025922 | Bacteria | 13258 |
| 248 | Ga0207646_10032394 | 3300025922 | Bacteria | 4731 |
| 249 | Ga0207646_10135794 | 3300025922 | Bacteria | 2214 |
| 250 | Ga0207681_10000107 | 3300025923 | Bacteria | 71564 |
| 251 | Ga0207694_10018192 | 3300025924 | Bacteria | 5313 |
| 252 | Ga0207650_10060600 | 3300025925 | Bacteria | 2824 |
| 253 | Ga0207659_10047183 | 3300025926 | Bacteria | 3046 |
| 254 | Ga0207687_10124167 | 3300025927 | Bacteria | 1935 |
| 255 | Ga0207664_10005822 | 3300025929 | Bacteria | 8430 |
| 256 | Ga0207690_10003564 | 3300025932 | Bacteria | 9262 |
| 257 | Ga0207706_10000581 | 3300025933 | Bacteria | 38892 |
| 258 | Ga0207706_10112979 | 3300025933 | Bacteria | 2389 |
| 259 | Ga0207686_10003047 | 3300025934 | Bacteria | 9019 |
| 260 | Ga0207709_10016051 | 3300025935 | Bacteria | 4157 |
| 261 | Ga0207670_10019700 | 3300025936 | Bacteria | 4127 |
| 262 | Ga0207669_10000091 | 3300025937 | Bacteria | 45833 |
| 263 | Ga0207704_10026523 | 3300025938 | Bacteria | 3181 |
| 264 | Ga0207691_10000582 | 3300025940 | Bacteria | 36439 |
| 265 | Ga0207711_10082800 | 3300025941 | Bacteria | 2805 |
| 266 | Ga0207661_10017562 | 3300025944 | Bacteria | 5298 |
| 267 | Ga0207661_10023193 | 3300025944 | Bacteria | 4687 |
| 268 | Ga0207661_10085871 | 3300025944 | Bacteria | 2610 |
| 269 | Ga0207667_10000389 | 3300025949 | Bacteria | 59220 |
| 270 | Ga0207667_10051556 | 3300025949 | Bacteria | 4338 |
| 271 | Ga0207667_10073217 | 3300025949 | Bacteria | 3560 |
| 272 | Ga0207712_10042215 | 3300025961 | Bacteria | 3139 |
| 273 | Ga0207712_10089446 | 3300025961 | Bacteria | 2263 |
| 274 | Ga0207640_10000034 | 3300025981 | Bacteria | 112705 |
| 275 | Ga0207658_10041586 | 3300025986 | Bacteria | 3329 |
| 276 | Ga0207677_10000002 | 3300026023 | Bacteria | 478921 |
| 277 | Ga0207703_10030078 | 3300026035 | Bacteria | 4290 |
| 278 | Ga0207703_10164122 | 3300026035 | Bacteria | 1947 |
| 279 | Ga0207639_10000035 | 3300026041 | Bacteria | 149309 |
| 280 | Ga0207639_10014785 | 3300026041 | Bacteria | 5497 |
| 281 | Ga0207678_10002725 | 3300026067 | Bacteria | 16015 |
| 282 | Ga0207678_10011837 | 3300026067 | Bacteria | 7661 |
| 283 | Ga0207678_10040299 | 3300026067 | Bacteria | 4052 |
| 284 | Ga0207678_10203023 | 3300026067 | Bacteria | 1695 |
| 285 | Ga0207708_10009516 | 3300026075 | Bacteria | 7203 |
| 286 | Ga0207708_10016949 | 3300026075 | Bacteria | 5485 |
| 287 | Ga0207641_10042901 | 3300026088 | Bacteria | 3797 |
| 288 | Ga0207641_10046278 | 3300026088 | Bacteria | 3666 |
| 289 | Ga0207641_10102067 | 3300026088 | Bacteria | 2528 |
| 290 | Ga0207648_10002956 | 3300026089 | Bacteria | 17970 |
| 291 | Ga0207648_10162535 | 3300026089 | Bacteria | 1972 |
| 292 | Ga0207676_10000889 | 3300026095 | Bacteria | 23205 |
| 293 | Ga0207676_10074414 | 3300026095 | Bacteria | 2736 |
| 294 | Ga0207674_10002393 | 3300026116 | Bacteria | 23705 |
| 295 | Ga0207675_100000780 | 3300026118 | Bacteria | 31801 |
| 296 | Ga0207675_100022135 | 3300026118 | Bacteria | 5917 |
| 297 | Ga0207675_100038441 | 3300026118 | Bacteria | 4466 |
| 298 | Ga0207683_10012979 | 3300026121 | Bacteria | 7113 |
| 299 | Ga0207683_10016839 | 3300026121 | Bacteria | 6219 |
| 300 | Ga0207683_10125124 | 3300026121 | Bacteria | 2310 |
| 301 | Ga0207698_10016019 | 3300026142 | Bacteria | 5042 |
| 302 | Ga0207698_10062888 | 3300026142 | Bacteria | 2901 |
| 303 | Ga0209970_1002556 | 3300027614 | Bacteria | 3081 |
| 304 | Ga0210002_1000808 | 3300027617 | Bacteria | 4278 |
| 305 | Ga0209282_1000003 | 3300027666 | Bacteria | 856377 |
| 306 | Ga0209971_1000112 | 3300027682 | Bacteria | 23513 |
| 307 | Ga0209998_10000764 | 3300027717 | Bacteria | 8414 |
| 308 | Ga0209974_10000147 | 3300027876 | Bacteria | 21336 |
| 309 | Ga0207428_10120500 | 3300027907 | Bacteria | 2012 |
| 310 | Ga0268266_10002274 | 3300028379 | Bacteria | 20865 |
| 311 | Ga0268266_10007538 | 3300028379 | Bacteria | 9800 |
| 312 | Ga0268266_10014702 | 3300028379 | Bacteria | 6723 |
| 313 | Ga0268265_10000564 | 3300028380 | Bacteria | 37658 |
| 314 | Ga0268265_10005212 | 3300028380 | Bacteria | 8904 |
| 315 | Ga0268264_10001953 | 3300028381 | Bacteria | 18519 |
| 316 | Ga0268264_10092666 | 3300028381 | Bacteria | 2608 |
| 317 | Ga0265332_10029155 | 3300031238 | Bacteria | 2414 |
| 318 | Ga0265328_10018909 | 3300031239 | Bacteria | 2651 |
| 319 | Ga0265320_10003087 | 3300031240 | Bacteria | 11303 |
| 320 | Ga0265331_10000881 | 3300031250 | Bacteria | 24365 |
| 321 | Ga0265316_10048332 | 3300031344 | Bacteria | 3359 |
| 322 | Ga0307408_100001264 | 3300031548 | Bacteria | 18976 |
| 323 | Ga0307408_100002135 | 3300031548 | Bacteria | 14188 |
| 324 | Ga0307408_100002206 | 3300031548 | Bacteria | 13910 |
| 325 | Ga0307408_100067452 | 3300031548 | Bacteria | 2631 |
| 326 | Ga0265313_10006240 | 3300031595 | Bacteria | 8508 |
| 327 | Ga0316579_10007937 | 3300031691 | Bacteria | 4403 |
| 328 | Ga0265314_10000550 | 3300031711 | Bacteria | 47939 |
| 329 | Ga0265314_10026842 | 3300031711 | Bacteria | 4321 |
| 330 | Ga0265342_10008167 | 3300031712 | Bacteria | 7549 |
| 331 | Ga0307406_10001008 | 3300031901 | Bacteria | 15659 |
| 332 | Ga0307412_10000241 | 3300031911 | Bacteria | 35462 |
| 333 | Ga0307409_100000481 | 3300031995 | Bacteria | 17077 |
| 334 | Ga0307409_100128839 | 3300031995 | Bacteria | 2158 |
| 335 | Ga0307416_100054328 | 3300032002 | Bacteria | 3219 |
| 336 | Ga0307416_100271114 | 3300032002 | Bacteria | 1666 |
| 337 | Ga0307414_10024771 | 3300032004 | Bacteria | 3832 |
| 338 | Ga0307510_10168753 | 3300033180 | Bacteria | 1771 |
| 339 | Ga0373929_0000013 | 3300035085 | Bacteria | 159542 |
| 340 | Ga0373952_0002488 | 3300035092 | Bacteria | 3321 |
| 341 | Ga0373947_0089793 | 3300035725 | Bacteria | 1914 |
| 342 | Ga0373937_0068742 | 3300036401 | Bacteria | 3266 |
| 343 | Ga0316582_0036835 | 3300036647 | Bacteria | 3029 |
| 344 | Ga0395899_0048812 | 3300037312 | Bacteria | 3148 |
| 345 | Ga0395900_0044881 | 3300037418 | Bacteria | 4552 |
| 346 | Ga0395898_0004764 | 3300037466 | Bacteria | 14768 |
| 347 | Ga0395905_0028155 | 3300037471 | Bacteria | 5296 |
| 348 | Ga0436364_0602549 | 3300037853 | Bacteria | 2379 |
| 349 | Ga0395901_0192665 | 3300038443 | Bacteria | 2138 |
| 350 | Ga0436361_0059946 | 3300039447 | Bacteria | 2220 |
| 351 | Ga0436361_0063197 | 3300039447 | Bacteria | 3198 |
| 352 | Ga0436361_0174205 | 3300039447 | Bacteria | 2449 |
| 353 | Ga0436361_0182321 | 3300039447 | Bacteria | 1886 |
| 354 | Ga0436361_0596240 | 3300039447 | Bacteria | 18495 |
| 355 | Ga0436361_0615119 | 3300039447 | Bacteria | 3218 |
| 356 | Ga0436361_0701338 | 3300039447 | Bacteria | 18562 |
| 357 | Ga0439465_0000032 | 3300041413 | Bacteria | 28481 |
| 358 | Ga0451577_0000260 | 3300042876 | Bacteria | 104156 |
| 359 | Ga0466972_0047778 | 3300044658 | Bacteria | 2069 |
| 360 | Ga0453683_0011657 | 3300044673 | Bacteria | 5789 |
| 361 | Ga0453683_0113318 | 3300044673 | Bacteria | 1706 |
| 362 | Ga0466961_0001658 | 3300044693 | Bacteria | 13844 |
| 363 | Ga0466961_0034721 | 3300044693 | Bacteria | 3238 |
| 364 | Ga0453684_0000836 | 3300044712 | Bacteria | 103922 |
| 365 | Ga0453684_0000861 | 3300044712 | Bacteria | 102147 |
| 366 | Ga0453684_0001278 | 3300044712 | Bacteria | 75250 |
| 367 | Ga0453684_0014990 | 3300044712 | Bacteria | 12309 |
| 368 | Ga0453684_0020326 | 3300044712 | Bacteria | 10024 |
| 369 | Ga0453684_0027978 | 3300044712 | Bacteria | 8062 |
| 370 | Ga0453684_0043398 | 3300044712 | Bacteria | 6043 |
| 371 | Ga0453684_0052242 | 3300044712 | Bacteria | 5346 |
| 372 | Ga0453684_0163272 | 3300044712 | Bacteria | 2632 |
| 373 | Ga0466957_0038741 | 3300044842 | Bacteria | 2873 |
| 374 | Ga0466960_0000095 | 3300044901 | Bacteria | 28923 |
| 375 | Ga0466960_0053673 | 3300044901 | Bacteria | 1954 |
| 376 | Ga0451576_0003537 | 3300045051 | Bacteria | 21306 |
| 377 | Ga0451576_0047684 | 3300045051 | Bacteria | 4503 |
| 378 | Ga0466958_0056836 | 3300045836 | Bacteria | 2378 |
| 379 | Ga0466967_0013799 | 3300045976 | Bacteria | 6262 |
| 380 | Ga0466967_0105989 | 3300045976 | Bacteria | 2576 |
| 381 | Ga0495617_000011 | 3300046452 | Bacteria | 301936 |
| 382 | Ga0495617_000014 | 3300046452 | Bacteria | 286979 |
| 383 | Ga0495617_000515 | 3300046452 | Bacteria | 20231 |
| 384 | Ga0495627_000016 | 3300046453 | Bacteria | 318947 |
| 385 | Ga0495627_000763 | 3300046453 | Bacteria | 23901 |
| 386 | Ga0495627_004487 | 3300046453 | Bacteria | 5835 |
| 387 | Ga0495627_019607 | 3300046453 | Bacteria | 2265 |
| 388 | Ga0495592_0000424 | 3300046454 | Bacteria | 32002 |
| 389 | Ga0495603_0081010 | 3300046455 | Bacteria | 1902 |
| 390 | Ga0495590_0000058 | 3300046457 | Bacteria | 93362 |
| 391 | Ga0495591_000132 | 3300046458 | Bacteria | 81947 |
| 392 | Ga0495591_018407 | 3300046458 | Bacteria | 2370 |
| 393 | Ga0495629_0004226 | 3300046459 | Bacteria | 10774 |
| 394 | Ga0495629_0015670 | 3300046459 | Bacteria | 5443 |
| 395 | Ga0495638_0000627 | 3300046460 | Bacteria | 39046 |
| 396 | Ga0495638_0003837 | 3300046460 | Bacteria | 11669 |
| 397 | Ga0495638_0007268 | 3300046460 | Bacteria | 7962 |
| 398 | Ga0495653_0000014 | 3300046463 | Bacteria | 215253 |
| 399 | Ga0495653_0012633 | 3300046463 | Bacteria | 6896 |
| 400 | Ga0495650_0000053 | 3300046471 | Bacteria | 316684 |
| 401 | Ga0495650_0000071 | 3300046471 | Bacteria | 258374 |
| 402 | Ga0495650_0000146 | 3300046471 | Bacteria | 163598 |
| 403 | Ga0495650_0000334 | 3300046471 | Bacteria | 84144 |
| 404 | Ga0495650_0000460 | 3300046471 | Bacteria | 63424 |
| 405 | Ga0495650_0000463 | 3300046471 | Bacteria | 63012 |
| 406 | Ga0495650_0001265 | 3300046471 | Bacteria | 26082 |
| 407 | Ga0495650_0002431 | 3300046471 | Bacteria | 15100 |
| 408 | Ga0495650_0002556 | 3300046471 | Bacteria | 14449 |
| 409 | Ga0495650_0008243 | 3300046471 | Bacteria | 6117 |
| 410 | Ga0495650_0019882 | 3300046471 | Bacteria | 3289 |
| 411 | Ga0495580_0050636 | 3300046472 | Bacteria | 2936 |
| 412 | Ga0495605_0000010 | 3300046474 | Bacteria | 319487 |
| 413 | Ga0495605_0000538 | 3300046474 | Bacteria | 31464 |
| 414 | Ga0495605_0017639 | 3300046474 | Bacteria | 3839 |
| 415 | Ga0495605_0026450 | 3300046474 | Bacteria | 3017 |
| 416 | Ga0495605_0042993 | 3300046474 | Bacteria | 2243 |
| 417 | Ga0495639_0024293 | 3300046475 | Bacteria | 2668 |
| 418 | Ga0495662_0018132 | 3300046476 | Bacteria | 3405 |
| 419 | Ga0495664_0001675 | 3300046477 | Bacteria | 11778 |
| 420 | Ga0495584_0000883 | 3300046491 | Bacteria | 19287 |
| 421 | Ga0495584_0001234 | 3300046491 | Bacteria | 15595 |
| 422 | Ga0495584_0001667 | 3300046491 | Bacteria | 13051 |
| 423 | Ga0495584_0006181 | 3300046491 | Bacteria | 6292 |
| 424 | Ga0495584_0006407 | 3300046491 | Bacteria | 6163 |
| 425 | Ga0495584_0009117 | 3300046491 | Bacteria | 5124 |
| 426 | Ga0495585_0000022 | 3300046492 | Bacteria | 153475 |
| 427 | Ga0495585_0000113 | 3300046492 | Bacteria | 86842 |
| 428 | Ga0495585_0001317 | 3300046492 | Bacteria | 19761 |
| 429 | Ga0495585_0003678 | 3300046492 | Bacteria | 10254 |
| 430 | Ga0495585_0005593 | 3300046492 | Bacteria | 7897 |
| 431 | Ga0495585_0009685 | 3300046492 | Bacteria | 5769 |
| 432 | Ga0495585_0024365 | 3300046492 | Bacteria | 3469 |
| 433 | Ga0495585_0052816 | 3300046492 | Bacteria | 2249 |
| 434 | Ga0495585_0089020 | 3300046492 | Bacteria | 1664 |
| 435 | Ga0495594_0000001 | 3300046499 | Bacteria | 293051 |
| 436 | Ga0495594_0002777 | 3300046499 | Bacteria | 9083 |
| 437 | Ga0495594_0006383 | 3300046499 | Bacteria | 6066 |
| 438 | Ga0495594_0010755 | 3300046499 | Bacteria | 4749 |
| 439 | Ga0495594_0023607 | 3300046499 | Bacteria | 3297 |
| 440 | Ga0495594_0042044 | 3300046499 | Bacteria | 2502 |
| 441 | Ga0495596_0001100 | 3300046500 | Bacteria | 15989 |
| 442 | Ga0495596_0002530 | 3300046500 | Bacteria | 9789 |
| 443 | Ga0495596_0005078 | 3300046500 | Bacteria | 6277 |
| 444 | Ga0495596_0016441 | 3300046500 | Bacteria | 3073 |
| 445 | Ga0495596_0018066 | 3300046500 | Bacteria | 2910 |
| 446 | Ga0495607_0002162 | 3300046501 | Bacteria | 16375 |
| 447 | Ga0495607_0005885 | 3300046501 | Bacteria | 8708 |
| 448 | Ga0495607_0021315 | 3300046501 | Bacteria | 4079 |
| 449 | Ga0495607_0025322 | 3300046501 | Bacteria | 3692 |
| 450 | Ga0495607_0043095 | 3300046501 | Bacteria | 2671 |
| 451 | Ga0495607_0050374 | 3300046501 | Bacteria | 2424 |
| 452 | Ga0495607_0056529 | 3300046501 | Bacteria | 2252 |
| 453 | Ga0495583_0000102 | 3300046506 | Bacteria | 143105 |
| 454 | Ga0495583_0000116 | 3300046506 | Bacteria | 135355 |
| 455 | Ga0495583_0000183 | 3300046506 | Bacteria | 106663 |
| 456 | Ga0495583_0000346 | 3300046506 | Bacteria | 73089 |
| 457 | Ga0495583_0001913 | 3300046506 | Bacteria | 19244 |
| 458 | Ga0495583_0005154 | 3300046506 | Bacteria | 8999 |
| 459 | Ga0495606_0000004 | 3300046507 | Bacteria | 406209 |
| 460 | Ga0495606_0003214 | 3300046507 | Bacteria | 17599 |
| 461 | Ga0495606_0006492 | 3300046507 | Bacteria | 10760 |
| 462 | Ga0495606_0027391 | 3300046507 | Bacteria | 4042 |
| 463 | Ga0495606_0072411 | 3300046507 | Bacteria | 2165 |
| 464 | Ga0495610_0000007 | 3300046512 | Bacteria | 820919 |
| 465 | Ga0495610_0003047 | 3300046512 | Bacteria | 13412 |
| 466 | Ga0495610_0006005 | 3300046512 | Bacteria | 8483 |
| 467 | Ga0495610_0021828 | 3300046512 | Bacteria | 3513 |
| 468 | Ga0495610_0032257 | 3300046512 | Bacteria | 2724 |
| 469 | Ga0495616_0000886 | 3300046513 | Bacteria | 21668 |
| 470 | Ga0495616_0001063 | 3300046513 | Bacteria | 19605 |
| 471 | Ga0495616_0004707 | 3300046513 | Bacteria | 8549 |
| 472 | Ga0495616_0005161 | 3300046513 | Bacteria | 8097 |
| 473 | Ga0495616_0013981 | 3300046513 | Bacteria | 4510 |
| 474 | Ga0495616_0033232 | 3300046513 | Bacteria | 2689 |
| 475 | Ga0495616_0033430 | 3300046513 | Bacteria | 2679 |
| 476 | Ga0495616_0040695 | 3300046513 | Bacteria | 2373 |
| 477 | Ga0495616_0075186 | 3300046513 | Bacteria | 1626 |
| 478 | Ga0495618_0000037 | 3300046514 | Bacteria | 99735 |
| 479 | Ga0495628_0078600 | 3300046516 | Bacteria | 2566 |
| 480 | Ga0495630_0000991 | 3300046517 | Bacteria | 19745 |
| 481 | Ga0495630_0045119 | 3300046517 | Bacteria | 3293 |
| 482 | Ga0495630_0057496 | 3300046517 | Bacteria | 2915 |
| 483 | Ga0495631_0003968 | 3300046518 | Bacteria | 7987 |
| 484 | Ga0495631_0015171 | 3300046518 | Bacteria | 3700 |
| 485 | Ga0495631_0020337 | 3300046518 | Bacteria | 3102 |
| 486 | Ga0495631_0059754 | 3300046518 | Bacteria | 1655 |
| 487 | Ga0495632_0000264 | 3300046519 | Bacteria | 52194 |
| 488 | Ga0495632_0001647 | 3300046519 | Bacteria | 18288 |
| 489 | Ga0495632_0003427 | 3300046519 | Bacteria | 11265 |
| 490 | Ga0495632_0007170 | 3300046519 | Bacteria | 7047 |
| 491 | Ga0495632_0020470 | 3300046519 | Bacteria | 3581 |
| 492 | Ga0495632_0025914 | 3300046519 | Bacteria | 3094 |
| 493 | Ga0495637_0000028 | 3300046520 | Bacteria | 144203 |
| 494 | Ga0495637_0049662 | 3300046520 | Bacteria | 1761 |
| 495 | Ga0495643_0001511 | 3300046522 | Bacteria | 21024 |
| 496 | Ga0495643_0001967 | 3300046522 | Bacteria | 17235 |
| 497 | Ga0495643_0001996 | 3300046522 | Bacteria | 17039 |
| 498 | Ga0495643_0009285 | 3300046522 | Bacteria | 6124 |
| 499 | Ga0495643_0012521 | 3300046522 | Bacteria | 5114 |
| 500 | Ga0495643_0018085 | 3300046522 | Bacteria | 4104 |
| 501 | Ga0495643_0022240 | 3300046522 | Bacteria | 3621 |
| 502 | Ga0495643_0062760 | 3300046522 | Bacteria | 1966 |
| 503 | Ga0495644_0000227 | 3300046523 | Bacteria | 26614 |
| 504 | Ga0495644_0000816 | 3300046523 | Bacteria | 12821 |
| 505 | Ga0495644_0002483 | 3300046523 | Bacteria | 7353 |
| 506 | Ga0495644_0016166 | 3300046523 | Bacteria | 2858 |
| 507 | Ga0495648_0000004 | 3300046524 | Bacteria | 373639 |
| 508 | Ga0495648_0000959 | 3300046524 | Bacteria | 29756 |
| 509 | Ga0495648_0002004 | 3300046524 | Bacteria | 19288 |
| 510 | Ga0495648_0004787 | 3300046524 | Bacteria | 11444 |
| 511 | Ga0495648_0005916 | 3300046524 | Bacteria | 10066 |
| 512 | Ga0495648_0021974 | 3300046524 | Bacteria | 4404 |
| 513 | Ga0495648_0028330 | 3300046524 | Bacteria | 3733 |
| 514 | Ga0495648_0044367 | 3300046524 | Bacteria | 2776 |
| 515 | Ga0495663_0004004 | 3300046525 | Bacteria | 4184 |
| 516 | Ga0495666_0009729 | 3300046526 | Bacteria | 4804 |
| 517 | Ga0495642_0000192 | 3300046528 | Bacteria | 36285 |
| 518 | Ga0495642_0001389 | 3300046528 | Bacteria | 10833 |
| 519 | Ga0495642_0003344 | 3300046528 | Bacteria | 6335 |
| 520 | Ga0495642_0004047 | 3300046528 | Bacteria | 5721 |
| 521 | Ga0495642_0020605 | 3300046528 | Bacteria | 2591 |
| 522 | Ga0495642_0029962 | 3300046528 | Bacteria | 2175 |
| 523 | Ga0495652_0072445 | 3300046529 | Bacteria | 2872 |
| 524 | Ga0495652_0101639 | 3300046529 | Bacteria | 2330 |
| 525 | Ga0495654_0000034 | 3300046530 | Bacteria | 196519 |
| 526 | Ga0495654_0003671 | 3300046530 | Bacteria | 9315 |
| 527 | Ga0495654_0008297 | 3300046530 | Bacteria | 5746 |
| 528 | Ga0495665_0017370 | 3300046531 | Bacteria | 3870 |
| 529 | Ga0495665_0062538 | 3300046531 | Bacteria | 1965 |
| 530 | Ga0495640_0001641 | 3300046533 | Bacteria | 17695 |
| 531 | Ga0495640_0003678 | 3300046533 | Bacteria | 12324 |
| 532 | Ga0495586_0032273 | 3300046535 | Bacteria | 2807 |
| 533 | Ga0495586_0065506 | 3300046535 | Bacteria | 1980 |
| 534 | Ga0495587_0012562 | 3300046536 | Bacteria | 5325 |
| 535 | Ga0495587_0034917 | 3300046536 | Bacteria | 3031 |
| 536 | Ga0495609_0000637 | 3300046538 | Bacteria | 27304 |
| 537 | Ga0495609_0001435 | 3300046538 | Bacteria | 15872 |
| 538 | Ga0495609_0002279 | 3300046538 | Bacteria | 11960 |
| 539 | Ga0495609_0003851 | 3300046538 | Bacteria | 8438 |
| 540 | Ga0495609_0010356 | 3300046538 | Bacteria | 4475 |
| 541 | Ga0495609_0014619 | 3300046538 | Bacteria | 3686 |
| 542 | Ga0495609_0019238 | 3300046538 | Bacteria | 3162 |
| 543 | Ga0495609_0022949 | 3300046538 | Bacteria | 2872 |
| 544 | Ga0495597_0001037 | 3300046542 | Bacteria | 21229 |
| 545 | Ga0495597_0003215 | 3300046542 | Bacteria | 9720 |
| 546 | Ga0495597_0007545 | 3300046542 | Bacteria | 5515 |
| 547 | Ga0495597_0015409 | 3300046542 | Bacteria | 3620 |
| 548 | Ga0495597_0022301 | 3300046542 | Bacteria | 2937 |
| 549 | Ga0495597_0053026 | 3300046542 | Bacteria | 1784 |
| 550 | Ga0495645_0011816 | 3300046543 | Bacteria | 6152 |
| 551 | Ga0495645_0122311 | 3300046543 | Bacteria | 1831 |
| 552 | Ga0495622_0000090 | 3300046557 | Bacteria | 81752 |
| 553 | Ga0495622_0000431 | 3300046557 | Bacteria | 27552 |
| 554 | Ga0495622_0007772 | 3300046557 | Bacteria | 4980 |
| 555 | Ga0495633_0000068 | 3300046558 | Bacteria | 136733 |
| 556 | Ga0495633_0000094 | 3300046558 | Bacteria | 120459 |
| 557 | Ga0495633_0001323 | 3300046558 | Bacteria | 19469 |
| 558 | Ga0495633_0002607 | 3300046558 | Bacteria | 12618 |
| 559 | Ga0495633_0005634 | 3300046558 | Bacteria | 7592 |
| 560 | Ga0495633_0012968 | 3300046558 | Bacteria | 4409 |
| 561 | Ga0495633_0015673 | 3300046558 | Bacteria | 3928 |
| 562 | Ga0495633_0016756 | 3300046558 | Bacteria | 3768 |
| 563 | Ga0495633_0019961 | 3300046558 | Bacteria | 3379 |
| 564 | Ga0495633_0020466 | 3300046558 | Bacteria | 3328 |
| 565 | Ga0495633_0028646 | 3300046558 | Bacteria | 2712 |
| 566 | Ga0495633_0049565 | 3300046558 | Bacteria | 1981 |
| 567 | Ga0495633_0064098 | 3300046558 | Bacteria | 1718 |
| 568 | Ga0495656_0003394 | 3300046615 | Bacteria | 5387 |
| 569 | Ga0495656_0020201 | 3300046615 | Bacteria | 2581 |
| 570 | Ga0495656_0026412 | 3300046615 | Bacteria | 2311 |
| 571 | Ga0495668_0000136 | 3300046616 | Bacteria | 111262 |
| 572 | Ga0495668_0000714 | 3300046616 | Bacteria | 40056 |
| 573 | Ga0495668_0001987 | 3300046616 | Bacteria | 17898 |
| 574 | Ga0495668_0005938 | 3300046616 | Bacteria | 8109 |
| 575 | Ga0495668_0007992 | 3300046616 | Bacteria | 6666 |
| 576 | Ga0495668_0012545 | 3300046616 | Bacteria | 5026 |
| 577 | Ga0495668_0027644 | 3300046616 | Bacteria | 3214 |
| 578 | Ga0495668_0058272 | 3300046616 | Bacteria | 2131 |
| 579 | Ga0495634_0003581 | 3300046642 | Bacteria | 12418 |
| 580 | Ga0495634_0035273 | 3300046642 | Bacteria | 3427 |
| 581 | Ga0495634_0039116 | 3300046642 | Bacteria | 3231 |
| 582 | Ga0495611_0001165 | 3300046648 | Bacteria | 13719 |
| 583 | Ga0495611_0002506 | 3300046648 | Bacteria | 8358 |
| 584 | Ga0495611_0003911 | 3300046648 | Bacteria | 6486 |
| 585 | Ga0495611_0039831 | 3300046648 | Bacteria | 2093 |
| 586 | Ga0495625_0000046 | 3300046660 | Bacteria | 202299 |
| 587 | Ga0495625_0000096 | 3300046660 | Bacteria | 142609 |
| 588 | Ga0495625_0000109 | 3300046660 | Bacteria | 125064 |
| 589 | Ga0495625_0000257 | 3300046660 | Bacteria | 82608 |
| 590 | Ga0495625_0002385 | 3300046660 | Bacteria | 20412 |
| 591 | Ga0495625_0007669 | 3300046660 | Bacteria | 9355 |
| 592 | Ga0495625_0009636 | 3300046660 | Bacteria | 8053 |
| 593 | Ga0495625_0016122 | 3300046660 | Bacteria | 5887 |
| 594 | Ga0495625_0031109 | 3300046660 | Bacteria | 3973 |
| 595 | Ga0495625_0031228 | 3300046660 | Bacteria | 3964 |
| 596 | Ga0495625_0044535 | 3300046660 | Bacteria | 3212 |
| 597 | Ga0495625_0113768 | 3300046660 | Bacteria | 1847 |
| 598 | Ga0495635_0003838 | 3300046663 | Bacteria | 10439 |
| 599 | Ga0495659_0000025 | 3300046664 | Bacteria | 69322 |
| 600 | Ga0495659_0002583 | 3300046664 | Bacteria | 5838 |
| 601 | Ga0495659_0005015 | 3300046664 | Bacteria | 4163 |
| 602 | Ga0495661_0001306 | 3300046665 | Bacteria | 21236 |
| 603 | Ga0495661_0012446 | 3300046665 | Bacteria | 5743 |
| 604 | Ga0495661_0012907 | 3300046665 | Bacteria | 5628 |
| 605 | Ga0495661_0020929 | 3300046665 | Bacteria | 4266 |
| 606 | Ga0495661_0037594 | 3300046665 | Bacteria | 3021 |
| 607 | Ga0495661_0065189 | 3300046665 | Bacteria | 2146 |
| 608 | Ga0495661_0098897 | 3300046665 | Bacteria | 1646 |
| 609 | Ga0495661_0104381 | 3300046665 | Bacteria | 1589 |
| 610 | Ga0495588_0000050 | 3300046674 | Bacteria | 335314 |
| 611 | Ga0495657_0003478 | 3300046675 | Bacteria | 12843 |
| 612 | Ga0495599_0118315 | 3300046678 | Bacteria | 1648 |
| 613 | Ga0495623_0011122 | 3300046679 | Bacteria | 5825 |
| 614 | Ga0495623_0075853 | 3300046679 | Bacteria | 2087 |
| 615 | Ga0495646_0021012 | 3300046680 | Bacteria | 4127 |
| 616 | Ga0495646_0062057 | 3300046680 | Bacteria | 2223 |
| 617 | Ga0495647_0000002 | 3300046681 | Bacteria | 174959 |
| 618 | Ga0495647_0002786 | 3300046681 | Bacteria | 5539 |
| 619 | Ga0495669_0000095 | 3300046684 | Bacteria | 57161 |
| 620 | Ga0495669_0002966 | 3300046684 | Bacteria | 6970 |
| 621 | Ga0495669_0003029 | 3300046684 | Bacteria | 6909 |
| 622 | Ga0495669_0011001 | 3300046684 | Bacteria | 3831 |
| 623 | Ga0495669_0011379 | 3300046684 | Bacteria | 3777 |
| 624 | Ga0495669_0013473 | 3300046684 | Bacteria | 3484 |
| 625 | Ga0495669_0034632 | 3300046684 | Bacteria | 2226 |
| 626 | Ga0495613_0000190 | 3300046689 | Bacteria | 60696 |
| 627 | Ga0495613_0021326 | 3300046689 | Bacteria | 4832 |
| 628 | Ga0495613_0040265 | 3300046689 | Bacteria | 3463 |
| 629 | Ga0495613_0041728 | 3300046689 | Bacteria | 3397 |
| 630 | Ga0495613_0097478 | 3300046689 | Bacteria | 2125 |
| 631 | Ga0495613_0130855 | 3300046689 | Bacteria | 1797 |
| 632 | Ga0495624_0005313 | 3300046690 | Bacteria | 9303 |
| 633 | Ga0495624_0051197 | 3300046690 | Bacteria | 2614 |
| 634 | Ga0495670_0001130 | 3300046691 | Bacteria | 12953 |
| 635 | Ga0495670_0004297 | 3300046691 | Bacteria | 6976 |
| 636 | Ga0495670_0036782 | 3300046691 | Bacteria | 2439 |
| 637 | Ga0495670_0055260 | 3300046691 | Bacteria | 1990 |
| 638 | Ga0495671_0000033 | 3300046692 | Bacteria | 197509 |
| 639 | Ga0495671_0000701 | 3300046692 | Bacteria | 24303 |
| 640 | Ga0495671_0000718 | 3300046692 | Bacteria | 23936 |
| 641 | Ga0495671_0003539 | 3300046692 | Bacteria | 9547 |
| 642 | Ga0495649_0000648 | 3300046694 | Bacteria | 28291 |
| 643 | Ga0495649_0003498 | 3300046694 | Bacteria | 10572 |
| 644 | Ga0495649_0007907 | 3300046694 | Bacteria | 6434 |
| 645 | Ga0495589_0023884 | 3300046794 | Bacteria | 3110 |
| 646 | Ga0495589_0025252 | 3300046794 | Bacteria | 3016 |
| 647 | Ga0495589_0072146 | 3300046794 | Bacteria | 1686 |
| 648 | Ga0495600_0119861 | 3300046809 | Bacteria | 1711 |
| 649 | Ga0495660_0008202 | 3300046810 | Bacteria | 6123 |
| 650 | Ga0495660_0008483 | 3300046810 | Bacteria | 6019 |
| 651 | Ga0495660_0013849 | 3300046810 | Bacteria | 4675 |
| 652 | Ga0495660_0051564 | 3300046810 | Bacteria | 2238 |
| 653 | Ga0495660_0081097 | 3300046810 | Bacteria | 1701 |
| 654 | Ga0495581_0006656 | 3300047315 | Bacteria | 6696 |
| 655 | Ga0495581_0013387 | 3300047315 | Bacteria | 4755 |
| 656 | Ga0495581_0075958 | 3300047315 | Bacteria | 1944 |
| 657 | Ga0495604_0022053 | 3300047317 | Bacteria | 5083 |
| 658 | Ga0495604_0032267 | 3300047317 | Bacteria | 4153 |
| 659 | Ga0495604_0071133 | 3300047317 | Bacteria | 2632 |
| 660 | Ga0495636_0004699 | 3300047318 | Bacteria | 5356 |
| 661 | Ga0495636_0007204 | 3300047318 | Bacteria | 4378 |
| 662 | Ga0495636_0012459 | 3300047318 | Bacteria | 3367 |
| 663 | Ga0495636_0022754 | 3300047318 | Bacteria | 2536 |
| 664 | Ga0495674_0007930 | 3300047319 | Bacteria | 10133 |
| 665 | Ga0495674_0013486 | 3300047319 | Bacteria | 7685 |
| 666 | Ga0495674_0016977 | 3300047319 | Bacteria | 6784 |
| 667 | Ga0495672_0000099 | 3300047320 | Bacteria | 140634 |
| 668 | Ga0495672_0000508 | 3300047320 | Bacteria | 44840 |
| 669 | Ga0495672_0001116 | 3300047320 | Bacteria | 27207 |
| 670 | Ga0495672_0001291 | 3300047320 | Bacteria | 24984 |
| 671 | Ga0495672_0002747 | 3300047320 | Bacteria | 15771 |
| 672 | Ga0495672_0008317 | 3300047320 | Bacteria | 7680 |
| 673 | Ga0495672_0013539 | 3300047320 | Bacteria | 5624 |
| 674 | Ga0495672_0027727 | 3300047320 | Bacteria | 3594 |
| 675 | Ga0495672_0029428 | 3300047320 | Bacteria | 3459 |
| 676 | Ga0495676_0000135 | 3300047321 | Bacteria | 55966 |
| 677 | Ga0495676_0006827 | 3300047321 | Bacteria | 10494 |
| 678 | Ga0495680_0000094 | 3300047322 | Bacteria | 80355 |
| 679 | Ga0495683_0000330 | 3300047323 | Bacteria | 39863 |
| 680 | Ga0495683_0003371 | 3300047323 | Bacteria | 9331 |
| 681 | Ga0495683_0004322 | 3300047323 | Bacteria | 8095 |
| 682 | Ga0495683_0019907 | 3300047323 | Bacteria | 3462 |
| 683 | Ga0495683_0026959 | 3300047323 | Bacteria | 2939 |
| 684 | Ga0495687_000442 | 3300047443 | Bacteria | 51118 |
| 685 | Ga0495687_000609 | 3300047443 | Bacteria | 41802 |
| 686 | Ga0495687_001605 | 3300047443 | Bacteria | 20392 |
| 687 | Ga0495687_016404 | 3300047443 | Bacteria | 3726 |
| 688 | Ga0495687_021690 | 3300047443 | Bacteria | 3100 |
| 689 | Ga0495675_0032829 | 3300047444 | Bacteria | 3311 |
| 690 | Ga0495677_0000445 | 3300047445 | Bacteria | 17692 |
| 691 | Ga0495677_0003116 | 3300047445 | Bacteria | 6459 |
| 692 | Ga0495677_0005109 | 3300047445 | Bacteria | 4997 |
| 693 | Ga0495677_0009064 | 3300047445 | Bacteria | 3679 |
| 694 | Ga0495677_0019627 | 3300047445 | Bacteria | 2450 |
| 695 | Ga0495679_007244 | 3300047446 | Bacteria | 4653 |
| 696 | Ga0495679_032214 | 3300047446 | Bacteria | 1683 |
| 697 | Ga0495685_000110 | 3300047447 | Bacteria | 29273 |
| 698 | Ga0495685_003105 | 3300047447 | Bacteria | 5269 |
| 699 | Ga0495685_017583 | 3300047447 | Bacteria | 2449 |
| 700 | Ga0495673_0000031 | 3300047469 | Bacteria | 447868 |
| 701 | Ga0495673_0000032 | 3300047469 | Bacteria | 375856 |
| 702 | Ga0495673_0005363 | 3300047469 | Bacteria | 7768 |
| 703 | Ga0495673_0009705 | 3300047469 | Bacteria | 5302 |
| 704 | Ga0495681_0001145 | 3300047470 | Bacteria | 20136 |
| 705 | Ga0495681_0006452 | 3300047470 | Bacteria | 7708 |
| 706 | Ga0495681_0011831 | 3300047470 | Bacteria | 5165 |
| 707 | Ga0495681_0019724 | 3300047470 | Bacteria | 3672 |
| 708 | Ga0495681_0037378 | 3300047470 | Bacteria | 2391 |
| 709 | Ga0495686_0000069 | 3300047472 | Bacteria | 217778 |
| 710 | Ga0495686_0002300 | 3300047472 | Bacteria | 18278 |
| 711 | Ga0495686_0003368 | 3300047472 | Bacteria | 13922 |
| 712 | Ga0495686_0004791 | 3300047472 | Bacteria | 10920 |
| 713 | Ga0495686_0006443 | 3300047472 | Bacteria | 8986 |
| 714 | Ga0495686_0075644 | 3300047472 | Bacteria | 2064 |
| 715 | Ga0495593_0010408 | 3300047673 | Bacteria | 5377 |
| 716 | Ga0495602_0018108 | 3300048088 | Bacteria | 7047 |
| 717 | Ga0495614_0027231 | 3300048089 | Bacteria | 2465 |
| 718 | Ga0495626_0002032 | 3300048091 | Bacteria | 14850 |
| 719 | Ga0495626_0005264 | 3300048091 | Bacteria | 7645 |
| 720 | Ga0495626_0006906 | 3300048091 | Bacteria | 6394 |
| 721 | Ga0495626_0012465 | 3300048091 | Bacteria | 4455 |
| 722 | Ga0495626_0018406 | 3300048091 | Bacteria | 3507 |
| 723 | Ga0495626_0029337 | 3300048091 | Bacteria | 2663 |
| 724 | Ga0495626_0029831 | 3300048091 | Bacteria | 2635 |
| 725 | Ga0495626_0048822 | 3300048091 | Bacteria | 1962 |
| 726 | Ga0496100_0059791 | 3300048903 | Bacteria | 2505 |
| 727 | Ga0496101_0010598 | 3300048904 | Bacteria | 6088 |
| 728 | Ga0496101_0017184 | 3300048904 | Bacteria | 4903 |
| 729 | Ga0496102_0000202 | 3300048905 | Bacteria | 80040 |
| 730 | Ga0496102_0016243 | 3300048905 | Bacteria | 6504 |
| 731 | Ga0496102_0157146 | 3300048905 | Bacteria | 2138 |
| 732 | Ga0496103_0003201 | 3300048906 | Bacteria | 10048 |
| 733 | Ga0496103_0003638 | 3300048906 | Bacteria | 9384 |
| 734 | Ga0496103_0048237 | 3300048906 | Bacteria | 2631 |
| 735 | Ga0496106_0002899 | 3300048909 | Bacteria | 12755 |
| 736 | Ga0496108_0180441 | 3300048911 | Bacteria | 1828 |
| 737 | Ga0496109_0005497 | 3300048912 | Bacteria | 10609 |
| 738 | Ga0496113_0012454 | 3300048916 | Bacteria | 5716 |
| 739 | Ga0496115_0142663 | 3300048918 | Bacteria | 1976 |
| 740 | Ga0496116_0008818 | 3300048919 | Bacteria | 8690 |
| 741 | Ga0496119_0060505 | 3300048922 | Bacteria | 2267 |
| 742 | Ga0496120_0029328 | 3300048923 | Bacteria | 3360 |
| 743 | Ga0496121_0012095 | 3300048924 | Bacteria | 9483 |
| 744 | Ga0496123_0002080 | 3300048926 | Bacteria | 25773 |
| 745 | Ga0496123_0009431 | 3300048926 | Bacteria | 8792 |
| 746 | Ga0496124_0053150 | 3300048927 | Bacteria | 3436 |
| 747 | Ga0496126_0000187 | 3300048929 | Bacteria | 139670 |
| 748 | Ga0496126_0004486 | 3300048929 | Bacteria | 16654 |
| 749 | Ga0496126_0131763 | 3300048929 | Bacteria | 2160 |
| 750 | Ga0495678_000001 | 3300049459 | Bacteria | 1060340 |
| 751 | Ga0495678_000189 | 3300049459 | Bacteria | 72122 |
| 752 | Ga0495678_002015 | 3300049459 | Bacteria | 14567 |
| 753 | Ga0495678_004801 | 3300049459 | Bacteria | 7691 |
| 754 | Ga0495678_021395 | 3300049459 | Bacteria | 2849 |
| 755 | Ga0495682_0003258 | 3300049460 | Bacteria | 7268 |
| 756 | Ga0495682_0003425 | 3300049460 | Bacteria | 7054 |
| 757 | Ga0495682_0024853 | 3300049460 | Bacteria | 2231 |
| 758 | Ga0501031_0001950 | 3300049568 | Bacteria | 13011 |
| 759 | Ga0501031_0012585 | 3300049568 | Bacteria | 5526 |
| 760 | Ga0501031_0027934 | 3300049568 | Bacteria | 3677 |
| 761 | Ga0501031_0045196 | 3300049568 | Bacteria | 2873 |
| 762 | Ga0501032_0004384 | 3300049569 | Bacteria | 10650 |
| 763 | Ga0501032_0028519 | 3300049569 | Bacteria | 3836 |
| 764 | Ga0501032_0092269 | 3300049569 | Unclassified | 2009 |
| 765 | Ga0501032_0103092 | 3300049569 | Bacteria | 1890 |
| 766 | Ga0501033_0002590 | 3300049570 | Bacteria | 15242 |
| 767 | Ga0501033_0039477 | 3300049570 | Bacteria | 3525 |
| 768 | Ga0501033_0047393 | 3300049570 | Bacteria | 3195 |
| 769 | Ga0501034_0009548 | 3300049571 | Bacteria | 10156 |
| 770 | Ga0501034_0009621 | 3300049571 | Bacteria | 10111 |
| 771 | Ga0501034_0015686 | 3300049571 | Bacteria | 7780 |
| 772 | Ga0501034_0057136 | 3300049571 | Bacteria | 3923 |
| 773 | Ga0501034_0071738 | 3300049571 | Bacteria | 3472 |
| 774 | Ga0501036_0001005 | 3300049572 | Bacteria | 21286 |
| 775 | Ga0501036_0007597 | 3300049572 | Bacteria | 8847 |
| 776 | Ga0501036_0089364 | 3300049572 | Bacteria | 2603 |
| 777 | Ga0501036_0155760 | 3300049572 | Bacteria | 1927 |
| 778 | Ga0501037_0001188 | 3300049573 | Bacteria | 19235 |
| 779 | Ga0501037_0003642 | 3300049573 | Bacteria | 11179 |
| 780 | Ga0501037_0007930 | 3300049573 | Bacteria | 7780 |
| 781 | Ga0501037_0036042 | 3300049573 | Bacteria | 3646 |
| 782 | Ga0501037_0038007 | 3300049573 | Bacteria | 3549 |
| 783 | Ga0501037_0111887 | 3300049573 | Bacteria | 1966 |
| 784 | Ga0501038_0001420 | 3300049574 | Bacteria | 21939 |
| 785 | Ga0501038_0009183 | 3300049574 | Bacteria | 9074 |
| 786 | Ga0501038_0022293 | 3300049574 | Bacteria | 5677 |
| 787 | Ga0501038_0097457 | 3300049574 | Bacteria | 2453 |
| 788 | Ga0501039_0033825 | 3300049575 | Bacteria | 3944 |
| 789 | Ga0501040_0119531 | 3300049576 | Bacteria | 1848 |
| 790 | Ga0501042_0200488 | 3300049578 | Bacteria | 1439 |
| 791 | Ga0501043_0001312 | 3300049579 | Bacteria | 21759 |
| 792 | Ga0501043_0002199 | 3300049579 | Bacteria | 16623 |
| 793 | Ga0501043_0036562 | 3300049579 | Bacteria | 3863 |
| 794 | Ga0501043_0076784 | 3300049579 | Bacteria | 2624 |
| 795 | Ga0501046_0000091 | 3300049580 | Bacteria | 98095 |
| 796 | Ga0501046_0004508 | 3300049580 | Bacteria | 12624 |
| 797 | Ga0501046_0010400 | 3300049580 | Bacteria | 7994 |
| 798 | Ga0501046_0032465 | 3300049580 | Bacteria | 4227 |
| 799 | Ga0501047_0041763 | 3300049581 | Bacteria | 4431 |
| 800 | Ga0501048_0001715 | 3300049582 | Bacteria | 16710 |
| 801 | Ga0501048_0018291 | 3300049582 | Bacteria | 5155 |
| 802 | Ga0501048_0042549 | 3300049582 | Bacteria | 3252 |
| 803 | Ga0501067_0000947 | 3300049583 | Bacteria | 15527 |
| 804 | Ga0501067_0002401 | 3300049583 | Bacteria | 10347 |
| 805 | Ga0501068_0038203 | 3300049584 | Bacteria | 2875 |
| 806 | Ga0501069_0004044 | 3300049585 | Bacteria | 7573 |
| 807 | Ga0501069_0015659 | 3300049585 | Bacteria | 4065 |
| 808 | Ga0501069_0037108 | 3300049585 | Bacteria | 2689 |
| 809 | Ga0501070_0002702 | 3300049586 | Bacteria | 15486 |
| 810 | Ga0501070_0024937 | 3300049586 | Bacteria | 5015 |
| 811 | Ga0501071_0003555 | 3300049587 | Bacteria | 9759 |
| 812 | Ga0501072_0036737 | 3300049588 | Bacteria | 3841 |
| 813 | Ga0501073_0000994 | 3300049589 | Bacteria | 20456 |
| 814 | Ga0501073_0013712 | 3300049589 | Bacteria | 5895 |
| 815 | Ga0501073_0030634 | 3300049589 | Bacteria | 3840 |
| 816 | Ga0501074_0018785 | 3300049590 | Bacteria | 5022 |
| 817 | Ga0501074_0049217 | 3300049590 | Bacteria | 3043 |
| 818 | Ga0501075_0028843 | 3300049591 | Bacteria | 4100 |
| 819 | Ga0501075_0033578 | 3300049591 | Bacteria | 3818 |
| 820 | Ga0501249_001861 | 3300049679 | Bacteria | 4302 |
| 821 | Ga0501079_0047941 | 3300049741 | Bacteria | 3296 |
| 822 | Ga0501079_0137887 | 3300049741 | Bacteria | 1900 |
| 823 | Ga0501080_0017774 | 3300049742 | Bacteria | 6581 |
| 824 | Ga0501080_0050935 | 3300049742 | Bacteria | 3853 |
| 825 | Ga0501080_0061557 | 3300049742 | Bacteria | 3494 |
| 826 | Ga0501080_0146091 | 3300049742 | Bacteria | 2186 |
| 827 | Ga0501083_0001847 | 3300049744 | Bacteria | 14533 |
| 828 | Ga0501083_0002059 | 3300049744 | Bacteria | 13834 |
| 829 | Ga0501083_0008667 | 3300049744 | Bacteria | 7174 |
| 830 | Ga0501083_0013877 | 3300049744 | Bacteria | 5632 |
| 831 | Ga0501083_0037688 | 3300049744 | Bacteria | 3291 |
| 832 | Ga0501269_000408 | 3300049766 | Bacteria | 9926 |
| 833 | Ga0501035_0001569 | 3300049822 | Bacteria | 23249 |
| 834 | Ga0501035_0019590 | 3300049822 | Bacteria | 6216 |
| 835 | Ga0501035_0079122 | 3300049822 | Bacteria | 2904 |
| 836 | Ga0501035_0169616 | 3300049822 | Unclassified | 1886 |
| 837 | Ga0501044_0000231 | 3300049823 | Bacteria | 70134 |
| 838 | Ga0501044_0082984 | 3300049823 | Bacteria | 3241 |
| 839 | Ga0501044_0117528 | 3300049823 | Bacteria | 2663 |
| 840 | Ga0501045_0021073 | 3300049824 | Bacteria | 4660 |
| 841 | nmdc:mga0yw44_1651_c1 | 3300050492 | Bacteria | 8992 |
| 842 | nmdc:mga05p37_260027_c1 | 3300050507 | Bacteria | 2078 |
| 843 | nmdc:mga05p37_37999_c1 | 3300050507 | Bacteria | 5905 |
| 844 | nmdc:mga05p37_46325_c1 | 3300050507 | Bacteria | 5347 |
| 845 | nmdc:mga05p37_6267_c1 | 3300050507 | Bacteria | 14010 |
| 846 | nmdc:mga09592_81705_c1 | 3300050508 | Bacteria | 2754 |
| 847 | nmdc:mga06r32_25770_c1 | 3300050510 | Bacteria | 5474 |
| 848 | nmdc:mga06r32_34139_c1 | 3300050510 | Bacteria | 4795 |
| 849 | nmdc:mga06r32_60012_c1 | 3300050510 | Bacteria | 3659 |
| 850 | nmdc:mga08y16_152635_c1 | 3300050511 | Bacteria | 2401 |
| 851 | nmdc:mga08y16_224468_c1 | 3300050511 | Bacteria | 1944 |
| 852 | nmdc:mga08y16_25838_c1 | 3300050511 | Bacteria | 6196 |
| 853 | nmdc:mga08y16_30646_c1 | 3300050511 | Bacteria | 5659 |
| 854 | nmdc:mga0n895_86581_c1 | 3300050512 | Bacteria | 3129 |
| 855 | nmdc:mga0rr50_39828_c1 | 3300050513 | Bacteria | 3411 |
| 856 | nmdc:mga0rr50_80450_c1 | 3300050513 | Bacteria | 2512 |
| 857 | nmdc:mga08x19_149369_c1 | 3300050514 | Bacteria | 1581 |
| 858 | nmdc:mga0a205_150114_c1 | 3300050515 | Bacteria | 2230 |
| 859 | nmdc:mga0a205_67743_c1 | 3300050515 | Bacteria | 3448 |
| 860 | Ga0495601_0019403 | 3300053077 | Bacteria | 4146 |
| 861 | Ga0495619_0000347 | 3300053085 | Bacteria | 32351 |
| 862 | Ga0495619_0002573 | 3300053085 | Bacteria | 11856 |
| 863 | Ga0500556_0001367 | 3300053104 | Bacteria | 10718 |
| 864 | Ga0500595_000023 | 3300053119 | Bacteria | 147097 |
| 865 | Ga0500595_001478 | 3300053119 | Bacteria | 12489 |
| 866 | Ga0500618_000613 | 3300053125 | Bacteria | 21774 |
| 867 | Ga0500618_001514 | 3300053125 | Bacteria | 10236 |
| 868 | Ga0500586_001393 | 3300053145 | Bacteria | 5085 |
| 869 | Ga0500616_0002423 | 3300053153 | Bacteria | 15529 |
| 870 | Ga0500616_0006321 | 3300053153 | Bacteria | 7781 |
| 871 | Ga0500636_0048047 | 3300053177 | Bacteria | 2513 |
| 872 | Ga0501084_0104748 | 3300054114 | Bacteria | 2376 |
| 873 | Ga0501084_0120763 | 3300054114 | Bacteria | 2203 |
| 874 | Ga0501084_0128855 | 3300054114 | Bacteria | 2130 |
| 875 | Ga0501082_0003408 | 3300060353 | Bacteria | 13875 |
| 876 | Ga0501082_0094700 | 3300060353 | Bacteria | 2580 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300044712 | Ga0453684_0027978 | Ga0453684_0027978_27_1340 | 413 |
| 2 | 3300036401 | Ga0373937_0068742 | Ga0373937_0068742_1616_2920 | 425 |
| 3 | 3300046516 | Ga0495628_0078600 | Ga0495628_0078600_1250_2554 | 427 |
| 4 | 3300013296 | Ga0157374_10005308 | Ga0157374_100053086 | 431 |
| 5 | 3300046558 | Ga0495633_0016756 | Ga0495633_0016756_45_1388 | 439 |
| 6 | 3300049679 | Ga0501249_001861 | Ga0501249_001861_998_2332 | 439 |
| 7 | 3300046681 | Ga0495647_0000002 | Ga0495647_0000002_41244_42590 | 441 |
| 8 | 3300049741 | Ga0501079_0137887 | Ga0501079_0137887_543_1874 | 441 |
| 9 | 3300046519 | Ga0495632_0003427 | Ga0495632_0003427_9522_11018 | 444 |
| 10 | 3300049578 | Ga0501042_0200488 | Ga0501042_0200488_82_1419 | 444 |
| 11 | 3300031344 | Ga0265316_10048332 | Ga0265316_100483323 | 447 |
| 12 | 3300031595 | Ga0265313_10006240 | Ga0265313_100062405 | 447 |
| 13 | 3300031712 | Ga0265342_10008167 | Ga0265342_100081673 | 447 |
| 14 | 3300046455 | Ga0495603_0081010 | Ga0495603_0081010_19_1389 | 450 |
| 15 | 3300046475 | Ga0495639_0024293 | Ga0495639_0024293_12_1382 | 450 |
| 16 | 3300046642 | Ga0495634_0035273 | Ga0495634_0035273_2043_3413 | 450 |
| 17 | 3300050513 | nmdc:mga0rr50_39828_c1 | nmdc:mga0rr50_39828_c1_1064_2539 | 450 |
| 18 | 3300047472 | Ga0495686_0002300 | Ga0495686_0002300_16257_17759 | 456 |
| 19 | 3300049460 | Ga0495682_0003425 | Ga0495682_0003425_5045_6547 | 456 |
| 20 | 3300046513 | Ga0495616_0001063 | Ga0495616_0001063_165_1664 | 457 |
| 21 | 3300046522 | Ga0495643_0012521 | Ga0495643_0012521_1855_3348 | 457 |
| 22 | 3300046542 | Ga0495597_0022301 | Ga0495597_0022301_220_1707 | 457 |
| 23 | 3300046500 | Ga0495596_0016441 | Ga0495596_0016441_492_1994 | 458 |
| 24 | 3300005546 | Ga0070696_100035528 | Ga0070696_1000355283 | 462 |
| 25 | 3300047445 | Ga0495677_0000445 | Ga0495677_0000445_7474_8967 | 462 |
| 26 | 3300049460 | Ga0495682_0024853 | Ga0495682_0024853_709_2208 | 462 |
| 27 | 3300046533 | Ga0495640_0003678 | Ga0495640_0003678_5913_7385 | 463 |
| 28 | 3300046684 | Ga0495669_0013473 | Ga0495669_0013473_16_1437 | 463 |
| 29 | 3300005337 | Ga0070682_100038141 | Ga0070682_1000381411 | 464 |
| 30 | 3300005544 | Ga0070686_100030529 | Ga0070686_1000305294 | 464 |
| 31 | 3300005843 | Ga0068860_100002743 | Ga0068860_1000027431 | 464 |
| 32 | 3300026121 | Ga0207683_10012979 | Ga0207683_100129791 | 464 |
| 33 | 3300028381 | Ga0268264_10001953 | Ga0268264_100019532 | 464 |
| 34 | 3300048904 | Ga0496101_0017184 | Ga0496101_0017184_1375_2829 | 464 |
| 35 | 3300048909 | Ga0496106_0002899 | Ga0496106_0002899_5024_6478 | 464 |
| 36 | 3300048912 | Ga0496109_0005497 | Ga0496109_0005497_7782_9236 | 464 |
| 37 | 3300005356 | Ga0070674_100000075 | Ga0070674_10000007517 | 465 |
| 38 | 3300005718 | Ga0068866_10000469 | Ga0068866_1000046919 | 465 |
| 39 | 3300009176 | Ga0105242_10013245 | Ga0105242_100132454 | 465 |
| 40 | 3300025899 | Ga0207642_10000181 | Ga0207642_1000018118 | 465 |
| 41 | 3300025935 | Ga0207709_10016051 | Ga0207709_100160513 | 465 |
| 42 | 3300025937 | Ga0207669_10000091 | Ga0207669_1000009138 | 465 |
| 43 | 3300002074 | JGI24748J21848_1002744 | JGI24748J21848_10027441 | 466 |
| 44 | 3300002239 | JGI24034J26672_10000147 | JGI24034J26672_1000014710 | 466 |
| 45 | 3300046506 | Ga0495583_0000102 | Ga0495583_0000102_109184_110677 | 466 |
| 46 | 3300046660 | Ga0495625_0031228 | Ga0495625_0031228_134_1624 | 466 |
| 47 | 3300005467 | Ga0070706_100002511 | Ga0070706_10000251111 | 468 |
| 48 | 3300025910 | Ga0207684_10002504 | Ga0207684_1000250412 | 468 |
| 49 | 3300049744 | Ga0501083_0001847 | Ga0501083_0001847_11175_12662 | 468 |
| 50 | 3300053125 | Ga0500618_000613 | Ga0500618_000613_14318_15823 | 468 |
| 51 | 3300046472 | Ga0495580_0050636 | Ga0495580_0050636_11_1429 | 469 |
| 52 | 3300046558 | Ga0495633_0028646 | Ga0495633_0028646_10_1434 | 469 |
| 53 | 3300006847 | Ga0075431_100002603 | Ga0075431_10000260311 | 470 |
| 54 | 3300042876 | Ga0451577_0000260 | Ga0451577_0000260_28954_30456 | 470 |
| 55 | 3300044712 | Ga0453684_0000836 | Ga0453684_0000836_41285_42787 | 470 |
| 56 | 3300044712 | Ga0453684_0043398 | Ga0453684_0043398_1041_2528 | 470 |
| 57 | 3300045051 | Ga0451576_0047684 | Ga0451576_0047684_1241_2743 | 470 |
| 58 | 3300046679 | Ga0495623_0075853 | Ga0495623_0075853_662_2074 | 470 |
| 59 | 3300005981 | Ga0081538_10005107 | Ga0081538_100051077 | 471 |
| 60 | 3300044712 | Ga0453684_0000861 | Ga0453684_0000861_39025_40512 | 471 |
| 61 | 3300046492 | Ga0495585_0089020 | Ga0495585_0089020_120_1613 | 471 |
| 62 | 3300046538 | Ga0495609_0019238 | Ga0495609_0019238_710_2206 | 471 |
| 63 | 3300046557 | Ga0495622_0000090 | Ga0495622_0000090_61814_63307 | 471 |
| 64 | 3300047443 | Ga0495687_000442 | Ga0495687_000442_36107_37600 | 471 |
| 65 | 3300005842 | Ga0068858_100123830 | Ga0068858_1001238301 | 472 |
| 66 | 3300009553 | Ga0105249_10023904 | Ga0105249_100239045 | 472 |
| 67 | 3300025961 | Ga0207712_10042215 | Ga0207712_100422152 | 472 |
| 68 | 3300037312 | Ga0395899_0048812 | Ga0395899_0048812_672_2126 | 472 |
| 69 | 3300037418 | Ga0395900_0044881 | Ga0395900_0044881_352_1806 | 472 |
| 70 | 3300037466 | Ga0395898_0004764 | Ga0395898_0004764_8023_9477 | 472 |
| 71 | 3300037471 | Ga0395905_0028155 | Ga0395905_0028155_101_1555 | 472 |
| 72 | 3300044712 | Ga0453684_0163272 | Ga0453684_0163272_127_1617 | 473 |
| 73 | 3300005327 | Ga0070658_10094151 | Ga0070658_100941512 | 474 |
| 74 | 3300005329 | Ga0070683_100034891 | Ga0070683_1000348913 | 474 |
| 75 | 3300005344 | Ga0070661_100001276 | Ga0070661_1000012762 | 474 |
| 76 | 3300005530 | Ga0070679_100008498 | Ga0070679_1000084982 | 474 |
| 77 | 3300005539 | Ga0068853_100015247 | Ga0068853_1000152473 | 474 |
| 78 | 3300005563 | Ga0068855_100012820 | Ga0068855_1000128204 | 474 |
| 79 | 3300005616 | Ga0068852_100041861 | Ga0068852_1000418612 | 474 |
| 80 | 3300005834 | Ga0068851_10061200 | Ga0068851_100612001 | 474 |
| 81 | 3300009551 | Ga0105238_10051950 | Ga0105238_100519501 | 474 |
| 82 | 3300013105 | Ga0157369_10008375 | Ga0157369_100083756 | 474 |
| 83 | 3300013307 | Ga0157372_10008860 | Ga0157372_100088604 | 474 |
| 84 | 3300025909 | Ga0207705_10003727 | Ga0207705_100037273 | 474 |
| 85 | 3300025921 | Ga0207652_10084328 | Ga0207652_100843282 | 474 |
| 86 | 3300025924 | Ga0207694_10018192 | Ga0207694_100181921 | 474 |
| 87 | 3300025944 | Ga0207661_10085871 | Ga0207661_100858711 | 474 |
| 88 | 3300025949 | Ga0207667_10051556 | Ga0207667_100515563 | 474 |
| 89 | 3300026041 | Ga0207639_10014785 | Ga0207639_100147854 | 474 |
| 90 | 3300026142 | Ga0207698_10062888 | Ga0207698_100628881 | 474 |
| 91 | 3300039447 | Ga0436361_0596240 | Ga0436361_0596240_11730_13163 | 474 |
| 92 | 3300035085 | Ga0373929_0000013 | Ga0373929_0000013_155518_157005 | 475 |
| 93 | 3300005471 | Ga0070698_100007507 | Ga0070698_1000075074 | 476 |
| 94 | 3300009177 | Ga0105248_10061547 | Ga0105248_100615473 | 476 |
| 95 | 3300013306 | Ga0163162_10000370 | Ga0163162_1000037017 | 476 |
| 96 | 3300039447 | Ga0436361_0182321 | Ga0436361_0182321_43_1473 | 476 |
| 97 | 3300046459 | Ga0495629_0015670 | Ga0495629_0015670_826_2274 | 476 |
| 98 | 3300046471 | Ga0495650_0000071 | Ga0495650_0000071_115097_116545 | 476 |
| 99 | 3300046471 | Ga0495650_0002556 | Ga0495650_0002556_6235_7683 | 476 |
| 100 | 3300046476 | Ga0495662_0018132 | Ga0495662_0018132_1392_2840 | 476 |
| 101 | 3300046477 | Ga0495664_0001675 | Ga0495664_0001675_1805_3253 | 476 |
| 102 | 3300046499 | Ga0495594_0002777 | Ga0495594_0002777_6507_7955 | 476 |
| 103 | 3300046499 | Ga0495594_0010755 | Ga0495594_0010755_879_2327 | 476 |
| 104 | 3300046513 | Ga0495616_0075186 | Ga0495616_0075186_148_1596 | 476 |
| 105 | 3300046518 | Ga0495631_0059754 | Ga0495631_0059754_33_1481 | 476 |
| 106 | 3300046523 | Ga0495644_0000227 | Ga0495644_0000227_15329_16777 | 476 |
| 107 | 3300046529 | Ga0495652_0072445 | Ga0495652_0072445_155_1603 | 476 |
| 108 | 3300046531 | Ga0495665_0062538 | Ga0495665_0062538_47_1495 | 476 |
| 109 | 3300046533 | Ga0495640_0001641 | Ga0495640_0001641_810_2258 | 476 |
| 110 | 3300046538 | Ga0495609_0003851 | Ga0495609_0003851_1593_3041 | 476 |
| 111 | 3300046543 | Ga0495645_0122311 | Ga0495645_0122311_120_1568 | 476 |
| 112 | 3300046558 | Ga0495633_0019961 | Ga0495633_0019961_1541_2989 | 476 |
| 113 | 3300046642 | Ga0495634_0039116 | Ga0495634_0039116_1713_3161 | 476 |
| 114 | 3300046660 | Ga0495625_0044535 | Ga0495625_0044535_205_1647 | 476 |
| 115 | 3300046663 | Ga0495635_0003838 | Ga0495635_0003838_8653_10101 | 476 |
| 116 | 3300046680 | Ga0495646_0021012 | Ga0495646_0021012_282_1730 | 476 |
| 117 | 3300046680 | Ga0495646_0062057 | Ga0495646_0062057_114_1562 | 476 |
| 118 | 3300046684 | Ga0495669_0003029 | Ga0495669_0003029_2074_3522 | 476 |
| 119 | 3300046690 | Ga0495624_0051197 | Ga0495624_0051197_850_2298 | 476 |
| 120 | 3300047315 | Ga0495581_0013387 | Ga0495581_0013387_206_1654 | 476 |
| 121 | 3300047317 | Ga0495604_0022053 | Ga0495604_0022053_858_2306 | 476 |
| 122 | 3300047317 | Ga0495604_0032267 | Ga0495604_0032267_1530_2978 | 476 |
| 123 | 3300047318 | Ga0495636_0022754 | Ga0495636_0022754_772_2220 | 476 |
| 124 | 3300047319 | Ga0495674_0013486 | Ga0495674_0013486_4151_5599 | 476 |
| 125 | 3300047319 | Ga0495674_0016977 | Ga0495674_0016977_2590_4038 | 476 |
| 126 | 3300047321 | Ga0495676_0006827 | Ga0495676_0006827_114_1562 | 476 |
| 127 | 3300048089 | Ga0495614_0027231 | Ga0495614_0027231_904_2352 | 476 |
| 128 | 3300049568 | Ga0501031_0027934 | Ga0501031_0027934_1308_2756 | 476 |
| 129 | 3300049570 | Ga0501033_0039477 | Ga0501033_0039477_897_2345 | 476 |
| 130 | 3300049571 | Ga0501034_0009621 | Ga0501034_0009621_6142_7590 | 476 |
| 131 | 3300049572 | Ga0501036_0001005 | Ga0501036_0001005_2021_3469 | 476 |
| 132 | 3300049573 | Ga0501037_0007930 | Ga0501037_0007930_5315_6763 | 476 |
| 133 | 3300049574 | Ga0501038_0001420 | Ga0501038_0001420_13714_15162 | 476 |
| 134 | 3300049575 | Ga0501039_0033825 | Ga0501039_0033825_1913_3361 | 476 |
| 135 | 3300049579 | Ga0501043_0002199 | Ga0501043_0002199_408_1856 | 476 |
| 136 | 3300049580 | Ga0501046_0000091 | Ga0501046_0000091_66482_67930 | 476 |
| 137 | 3300049582 | Ga0501048_0042549 | Ga0501048_0042549_1712_3160 | 476 |
| 138 | 3300049584 | Ga0501068_0038203 | Ga0501068_0038203_640_2088 | 476 |
| 139 | 3300049589 | Ga0501073_0000994 | Ga0501073_0000994_12715_14163 | 476 |
| 140 | 3300049590 | Ga0501074_0049217 | Ga0501074_0049217_1292_2740 | 476 |
| 141 | 3300049823 | Ga0501044_0000231 | Ga0501044_0000231_24685_26196 | 476 |
| 142 | 3300053119 | Ga0500595_000023 | Ga0500595_000023_95123_96571 | 476 |
| 143 | 3300005327 | Ga0070658_10006014 | Ga0070658_100060143 | 477 |
| 144 | 3300005981 | Ga0081538_10000086 | Ga0081538_1000008625 | 477 |
| 145 | 3300013104 | Ga0157370_10030691 | Ga0157370_100306914 | 477 |
| 146 | 3300025909 | Ga0207705_10006639 | Ga0207705_100066394 | 477 |
| 147 | 3300044673 | Ga0453683_0113318 | Ga0453683_0113318_66_1556 | 477 |
| 148 | 3300046558 | Ga0495633_0001323 | Ga0495633_0001323_17807_19294 | 477 |
| 149 | 3300047320 | Ga0495672_0001116 | Ga0495672_0001116_15306_16769 | 477 |
| 150 | 3300049823 | Ga0501044_0117528 | Ga0501044_0117528_1176_2624 | 477 |
| 151 | 3300003763 | Ga0055529_1001421 | Ga0055529_10014217 | 478 |
| 152 | 3300025272 | Ga0209455_1004973 | Ga0209455_10049731 | 478 |
| 153 | 3300049572 | Ga0501036_0155760 | Ga0501036_0155760_32_1477 | 478 |
| 154 | 3300053125 | Ga0500618_001514 | Ga0500618_001514_1492_3006 | 478 |
| 155 | 3300054114 | Ga0501084_0128855 | Ga0501084_0128855_58_1503 | 478 |
| 156 | 3300005331 | Ga0070670_100132312 | Ga0070670_1001323122 | 479 |
| 157 | 3300005459 | Ga0068867_100169349 | Ga0068867_1001693491 | 479 |
| 158 | 3300009147 | Ga0114129_10000276 | Ga0114129_1000027617 | 479 |
| 159 | 3300026035 | Ga0207703_10164122 | Ga0207703_101641221 | 479 |
| 160 | 3300050507 | nmdc:mga05p37_37999_c1 | nmdc:mga05p37_37999_c1_4007_5497 | 479 |
| 161 | 3300006038 | Ga0075365_10003408 | Ga0075365_100034084 | 480 |
| 162 | 3300046499 | Ga0495594_0000001 | Ga0495594_0000001_81553_82998 | 480 |
| 163 | 3300050492 | nmdc:mga0yw44_1651_c1 | nmdc:mga0yw44_1651_c1_5193_6656 | 480 |
| 164 | 3300005328 | Ga0070676_10004005 | Ga0070676_100040055 | 481 |
| 165 | 3300005329 | Ga0070683_100013428 | Ga0070683_1000134285 | 481 |
| 166 | 3300005340 | Ga0070689_100035150 | Ga0070689_1000351502 | 481 |
| 167 | 3300005354 | Ga0070675_100080968 | Ga0070675_1000809682 | 481 |
| 168 | 3300005355 | Ga0070671_100020237 | Ga0070671_1000202376 | 481 |
| 169 | 3300005356 | Ga0070674_100024912 | Ga0070674_1000249122 | 481 |
| 170 | 3300005365 | Ga0070688_100072385 | Ga0070688_1000723851 | 481 |
| 171 | 3300005367 | Ga0070667_100127410 | Ga0070667_1001274102 | 481 |
| 172 | 3300005441 | Ga0070700_100047855 | Ga0070700_1000478553 | 481 |
| 173 | 3300005457 | Ga0070662_100052580 | Ga0070662_1000525803 | 481 |
| 174 | 3300005535 | Ga0070684_100017640 | Ga0070684_1000176407 | 481 |
| 175 | 3300005615 | Ga0070702_100013695 | Ga0070702_1000136953 | 481 |
| 176 | 3300005718 | Ga0068866_10019822 | Ga0068866_100198223 | 481 |
| 177 | 3300005842 | Ga0068858_100095987 | Ga0068858_1000959873 | 481 |
| 178 | 3300005843 | Ga0068860_100112638 | Ga0068860_1001126382 | 481 |
| 179 | 3300005985 | Ga0081539_10001052 | Ga0081539_1000105222 | 481 |
| 180 | 3300006358 | Ga0068871_100078589 | Ga0068871_1000785893 | 481 |
| 181 | 3300007076 | Ga0075435_100097095 | Ga0075435_1000970952 | 481 |
| 182 | 3300009148 | Ga0105243_10083102 | Ga0105243_100831023 | 481 |
| 183 | 3300009553 | Ga0105249_10145546 | Ga0105249_101455462 | 481 |
| 184 | 3300014326 | Ga0157380_10079004 | Ga0157380_100790043 | 481 |
| 185 | 3300025903 | Ga0207680_10079907 | Ga0207680_100799072 | 481 |
| 186 | 3300025918 | Ga0207662_10008062 | Ga0207662_100080623 | 481 |
| 187 | 3300025926 | Ga0207659_10047183 | Ga0207659_100471833 | 481 |
| 188 | 3300025936 | Ga0207670_10019700 | Ga0207670_100197002 | 481 |
| 189 | 3300025944 | Ga0207661_10023193 | Ga0207661_100231933 | 481 |
| 190 | 3300025986 | Ga0207658_10041586 | Ga0207658_100415862 | 481 |
| 191 | 3300026035 | Ga0207703_10030078 | Ga0207703_100300783 | 481 |
| 192 | 3300026075 | Ga0207708_10009516 | Ga0207708_100095164 | 481 |
| 193 | 3300026088 | Ga0207641_10046278 | Ga0207641_100462782 | 481 |
| 194 | 3300026095 | Ga0207676_10000889 | Ga0207676_100008892 | 481 |
| 195 | 3300028381 | Ga0268264_10092666 | Ga0268264_100926662 | 481 |
| 196 | 3300031995 | Ga0307409_100128839 | Ga0307409_1001288393 | 481 |
| 197 | 3300032002 | Ga0307416_100054328 | Ga0307416_1000543282 | 481 |
| 198 | 3300038443 | Ga0395901_0192665 | Ga0395901_0192665_315_1775 | 481 |
| 199 | 3300045976 | Ga0466967_0105989 | Ga0466967_0105989_1106_2560 | 481 |
| 200 | 3300046454 | Ga0495592_0000424 | Ga0495592_0000424_20599_22122 | 481 |
| 201 | 3300046499 | Ga0495594_0042044 | Ga0495594_0042044_156_1649 | 481 |
| 202 | 3300046514 | Ga0495618_0000037 | Ga0495618_0000037_78445_79908 | 481 |
| 203 | 3300046517 | Ga0495630_0000991 | Ga0495630_0000991_2488_3960 | 481 |
| 204 | 3300046517 | Ga0495630_0057496 | Ga0495630_0057496_110_1582 | 481 |
| 205 | 3300046543 | Ga0495645_0011816 | Ga0495645_0011816_2861_4327 | 481 |
| 206 | 3300046660 | Ga0495625_0000109 | Ga0495625_0000109_31530_32987 | 481 |
| 207 | 3300046675 | Ga0495657_0003478 | Ga0495657_0003478_8863_10335 | 481 |
| 208 | 3300046681 | Ga0495647_0002786 | Ga0495647_0002786_2635_4164 | 481 |
| 209 | 3300046689 | Ga0495613_0000190 | Ga0495613_0000190_20525_22039 | 481 |
| 210 | 3300046689 | Ga0495613_0097478 | Ga0495613_0097478_212_1684 | 481 |
| 211 | 3300047322 | Ga0495680_0000094 | Ga0495680_0000094_71362_72885 | 481 |
| 212 | 3300048916 | Ga0496113_0012454 | Ga0496113_0012454_3149_4606 | 481 |
| 213 | 3300050513 | nmdc:mga0rr50_80450_c1 | nmdc:mga0rr50_80450_c1_670_2178 | 481 |
| 214 | 3300053077 | Ga0495601_0019403 | Ga0495601_0019403_972_2444 | 481 |
| 215 | 3300053085 | Ga0495619_0000347 | Ga0495619_0000347_13936_15405 | 481 |
| 216 | 3300053085 | Ga0495619_0002573 | Ga0495619_0002573_6587_8059 | 481 |
| 217 | 3300005262 | Ga0065165_1002884 | Ga0065165_10028848 | 482 |
| 218 | 3300005329 | Ga0070683_100000958 | Ga0070683_10000095823 | 482 |
| 219 | 3300009147 | Ga0114129_10192762 | Ga0114129_101927623 | 482 |
| 220 | 3300013296 | Ga0157374_10128532 | Ga0157374_101285323 | 482 |
| 221 | 3300014968 | Ga0157379_10038997 | Ga0157379_100389972 | 482 |
| 222 | 3300044901 | Ga0466960_0000095 | Ga0466960_0000095_16291_17745 | 482 |
| 223 | 3300046452 | Ga0495617_000014 | Ga0495617_000014_285123_286622 | 482 |
| 224 | 3300046453 | Ga0495627_000763 | Ga0495627_000763_309_1808 | 482 |
| 225 | 3300046471 | Ga0495650_0000053 | Ga0495650_0000053_100335_101789 | 482 |
| 226 | 3300046474 | Ga0495605_0000538 | Ga0495605_0000538_29612_31111 | 482 |
| 227 | 3300046501 | Ga0495607_0043095 | Ga0495607_0043095_967_2466 | 482 |
| 228 | 3300046513 | Ga0495616_0004707 | Ga0495616_0004707_6944_8443 | 482 |
| 229 | 3300046518 | Ga0495631_0015171 | Ga0495631_0015171_1865_3364 | 482 |
| 230 | 3300046524 | Ga0495648_0004787 | Ga0495648_0004787_337_1836 | 482 |
| 231 | 3300046528 | Ga0495642_0000192 | Ga0495642_0000192_34450_35949 | 482 |
| 232 | 3300046615 | Ga0495656_0020201 | Ga0495656_0020201_903_2402 | 482 |
| 233 | 3300046616 | Ga0495668_0005938 | Ga0495668_0005938_6361_7860 | 482 |
| 234 | 3300046684 | Ga0495669_0034632 | Ga0495669_0034632_250_1749 | 482 |
| 235 | 3300046692 | Ga0495671_0000718 | Ga0495671_0000718_22101_23600 | 482 |
| 236 | 3300046794 | Ga0495589_0025252 | Ga0495589_0025252_333_1832 | 482 |
| 237 | 3300047472 | Ga0495686_0075644 | Ga0495686_0075644_374_1873 | 482 |
| 238 | 3300048922 | Ga0496119_0060505 | Ga0496119_0060505_159_1613 | 482 |
| 239 | 3300049571 | Ga0501034_0009548 | Ga0501034_0009548_7985_9433 | 482 |
| 240 | 3300050507 | nmdc:mga05p37_46325_c1 | nmdc:mga05p37_46325_c1_3235_4722 | 482 |
| 241 | 3300053153 | Ga0500616_0002423 | Ga0500616_0002423_4407_5861 | 482 |
| 242 | 3300005330 | Ga0070690_100033253 | Ga0070690_1000332532 | 483 |
| 243 | 3300005331 | Ga0070670_100084892 | Ga0070670_1000848923 | 483 |
| 244 | 3300005335 | Ga0070666_10115908 | Ga0070666_101159082 | 483 |
| 245 | 3300005338 | Ga0068868_100019452 | Ga0068868_1000194522 | 483 |
| 246 | 3300005445 | Ga0070708_100103496 | Ga0070708_1001034962 | 483 |
| 247 | 3300009094 | Ga0111539_10043978 | Ga0111539_100439785 | 483 |
| 248 | 3300009098 | Ga0105245_10223916 | Ga0105245_102239161 | 483 |
| 249 | 3300025315 | Ga0207697_10011578 | Ga0207697_100115782 | 483 |
| 250 | 3300025908 | Ga0207643_10001923 | Ga0207643_100019238 | 483 |
| 251 | 3300025925 | Ga0207650_10060600 | Ga0207650_100606002 | 483 |
| 252 | 3300025927 | Ga0207687_10124167 | Ga0207687_101241671 | 483 |
| 253 | 3300025938 | Ga0207704_10026523 | Ga0207704_100265232 | 483 |
| 254 | 3300026023 | Ga0207677_10000002 | Ga0207677_10000002396 | 483 |
| 255 | 3300026088 | Ga0207641_10102067 | Ga0207641_101020672 | 483 |
| 256 | 3300026095 | Ga0207676_10074414 | Ga0207676_100744143 | 483 |
| 257 | 3300026118 | Ga0207675_100022135 | Ga0207675_1000221352 | 483 |
| 258 | 3300026121 | Ga0207683_10016839 | Ga0207683_100168395 | 483 |
| 259 | 3300046522 | Ga0495643_0001511 | Ga0495643_0001511_19378_20877 | 483 |
| 260 | 3300048923 | Ga0496120_0029328 | Ga0496120_0029328_1512_2996 | 483 |
| 261 | 3300048926 | Ga0496123_0009431 | Ga0496123_0009431_305_1789 | 483 |
| 262 | 3300053104 | Ga0500556_0001367 | Ga0500556_0001367_7201_8658 | 483 |
| 263 | 3300053153 | Ga0500616_0006321 | Ga0500616_0006321_1871_3328 | 483 |
| 264 | 3300005353 | Ga0070669_100000002 | Ga0070669_100000002400 | 484 |
| 265 | 3300005981 | Ga0081538_10056630 | Ga0081538_100566302 | 484 |
| 266 | 3300025923 | Ga0207681_10000107 | Ga0207681_1000010746 | 484 |
| 267 | 3300031711 | Ga0265314_10026842 | Ga0265314_100268423 | 484 |
| 268 | 3300049572 | Ga0501036_0089364 | Ga0501036_0089364_1111_2568 | 484 |
| 269 | 3300049574 | Ga0501038_0097457 | Ga0501038_0097457_757_2214 | 484 |
| 270 | 3300049576 | Ga0501040_0119531 | Ga0501040_0119531_344_1801 | 484 |
| 271 | 3300049588 | Ga0501072_0036737 | Ga0501072_0036737_2359_3816 | 484 |
| 272 | 3300049591 | Ga0501075_0028843 | Ga0501075_0028843_2317_3774 | 484 |
| 273 | 3300054114 | Ga0501084_0120763 | Ga0501084_0120763_239_1696 | 484 |
| 274 | 3300009094 | Ga0111539_10091770 | Ga0111539_100917704 | 485 |
| 275 | 3300025929 | Ga0207664_10005822 | Ga0207664_100058225 | 485 |
| 276 | 3300048905 | Ga0496102_0157146 | Ga0496102_0157146_80_1555 | 485 |
| 277 | 3300049568 | Ga0501031_0045196 | Ga0501031_0045196_113_1570 | 485 |
| 278 | 3300049569 | Ga0501032_0028519 | Ga0501032_0028519_325_1782 | 485 |
| 279 | 3300049571 | Ga0501034_0071738 | Ga0501034_0071738_1866_3323 | 485 |
| 280 | 3300049579 | Ga0501043_0076784 | Ga0501043_0076784_1018_2475 | 485 |
| 281 | 3300049580 | Ga0501046_0010400 | Ga0501046_0010400_5627_7084 | 485 |
| 282 | 3300049585 | Ga0501069_0004044 | Ga0501069_0004044_3423_4880 | 485 |
| 283 | 3300049589 | Ga0501073_0013712 | Ga0501073_0013712_1786_3243 | 485 |
| 284 | 3300049742 | Ga0501080_0050935 | Ga0501080_0050935_889_2349 | 485 |
| 285 | 3300049742 | Ga0501080_0061557 | Ga0501080_0061557_172_1629 | 485 |
| 286 | 3300049744 | Ga0501083_0008667 | Ga0501083_0008667_2561_4018 | 485 |
| 287 | 3300050511 | nmdc:mga08y16_152635_c1 | nmdc:mga08y16_152635_c1_445_1920 | 485 |
| 288 | 3300054114 | Ga0501084_0104748 | Ga0501084_0104748_574_2031 | 485 |
| 289 | 3300045836 | Ga0466958_0056836 | Ga0466958_0056836_697_2163 | 486 |
| 290 | 3300046452 | Ga0495617_000011 | Ga0495617_000011_25893_27377 | 486 |
| 291 | 3300046458 | Ga0495591_018407 | Ga0495591_018407_132_1625 | 486 |
| 292 | 3300046471 | Ga0495650_0000460 | Ga0495650_0000460_8790_10274 | 486 |
| 293 | 3300046474 | Ga0495605_0017639 | Ga0495605_0017639_2217_3710 | 486 |
| 294 | 3300046492 | Ga0495585_0024365 | Ga0495585_0024365_133_1626 | 486 |
| 295 | 3300046501 | Ga0495607_0021315 | Ga0495607_0021315_47_1540 | 486 |
| 296 | 3300046507 | Ga0495606_0000004 | Ga0495606_0000004_128149_129636 | 486 |
| 297 | 3300046512 | Ga0495610_0000007 | Ga0495610_0000007_530827_532311 | 486 |
| 298 | 3300046512 | Ga0495610_0032257 | Ga0495610_0032257_1099_2592 | 486 |
| 299 | 3300046519 | Ga0495632_0000264 | Ga0495632_0000264_49291_50784 | 486 |
| 300 | 3300046524 | Ga0495648_0021974 | Ga0495648_0021974_116_1600 | 486 |
| 301 | 3300046524 | Ga0495648_0028330 | Ga0495648_0028330_135_1619 | 486 |
| 302 | 3300046524 | Ga0495648_0044367 | Ga0495648_0044367_1151_2644 | 486 |
| 303 | 3300046558 | Ga0495633_0064098 | Ga0495633_0064098_115_1599 | 486 |
| 304 | 3300046616 | Ga0495668_0000714 | Ga0495668_0000714_177_1664 | 486 |
| 305 | 3300046616 | Ga0495668_0007992 | Ga0495668_0007992_5127_6620 | 486 |
| 306 | 3300046616 | Ga0495668_0012545 | Ga0495668_0012545_3300_4784 | 486 |
| 307 | 3300046665 | Ga0495661_0020929 | Ga0495661_0020929_563_2047 | 486 |
| 308 | 3300046692 | Ga0495671_0000033 | Ga0495671_0000033_178933_180417 | 486 |
| 309 | 3300046810 | Ga0495660_0013849 | Ga0495660_0013849_135_1619 | 486 |
| 310 | 3300047320 | Ga0495672_0013539 | Ga0495672_0013539_4032_5525 | 486 |
| 311 | 3300047323 | Ga0495683_0019907 | Ga0495683_0019907_1112_2596 | 486 |
| 312 | 3300047447 | Ga0495685_003105 | Ga0495685_003105_2057_3550 | 486 |
| 313 | 3300047469 | Ga0495673_0000032 | Ga0495673_0000032_317034_318518 | 486 |
| 314 | 3300047472 | Ga0495686_0006443 | Ga0495686_0006443_4239_5726 | 486 |
| 315 | 3300048091 | Ga0495626_0018406 | Ga0495626_0018406_133_1626 | 486 |
| 316 | 3300053145 | Ga0500586_001393 | Ga0500586_001393_226_1710 | 486 |
| 317 | 3300035725 | Ga0373947_0089793 | Ga0373947_0089793_39_1529 | 487 |
| 318 | 3300044693 | Ga0466961_0001658 | Ga0466961_0001658_6181_7653 | 487 |
| 319 | 3300046615 | Ga0495656_0026412 | Ga0495656_0026412_54_1553 | 487 |
| 320 | iso_pu_bacteria | 2643221554 | 2643789810 | 487 |
| 321 | iso_pu_bacteria | 2643221638 | 2644214468 | 487 |
| 322 | iso_pu_bacteria | 2842711865 | 2842713102 | 487 |
| 323 | 3300005435 | Ga0070714_100001328 | Ga0070714_1000013285 | 488 |
| 324 | 3300005445 | Ga0070708_100013120 | Ga0070708_1000131203 | 488 |
| 325 | 3300005467 | Ga0070706_100025573 | Ga0070706_1000255735 | 488 |
| 326 | 3300005468 | Ga0070707_100009163 | Ga0070707_1000091639 | 488 |
| 327 | 3300006028 | Ga0070717_10000138 | Ga0070717_100001389 | 488 |
| 328 | 3300006028 | Ga0070717_10187262 | Ga0070717_101872622 | 488 |
| 329 | 3300025910 | Ga0207684_10028522 | Ga0207684_100285222 | 488 |
| 330 | 3300025922 | Ga0207646_10005544 | Ga0207646_100055445 | 488 |
| 331 | 3300025922 | Ga0207646_10032394 | Ga0207646_100323944 | 488 |
| 332 | 3300046492 | Ga0495585_0009685 | Ga0495585_0009685_2697_4196 | 488 |
| 333 | 3300046513 | Ga0495616_0013981 | Ga0495616_0013981_17_1516 | 488 |
| 334 | 3300046525 | Ga0495663_0004004 | Ga0495663_0004004_1925_3424 | 488 |
| 335 | 3300046542 | Ga0495597_0015409 | Ga0495597_0015409_1361_2860 | 488 |
| 336 | 3300046558 | Ga0495633_0015673 | Ga0495633_0015673_16_1515 | 488 |
| 337 | 3300047318 | Ga0495636_0004699 | Ga0495636_0004699_3580_5076 | 488 |
| 338 | 3300002773 | JGI25152J39213_1003586 | JGI25152J39213_10035863 | 490 |
| 339 | 3300002774 | JGI25150J39212_1002183 | JGI25150J39212_10021831 | 490 |
| 340 | 3300002987 | JGI25159J45721_1003997 | JGI25159J45721_10039974 | 490 |
| 341 | 3300002987 | JGI25159J45721_1004079 | JGI25159J45721_10040793 | 490 |
| 342 | 3300003215 | JGI25153J46596_10004507 | JGI25153J46596_100045076 | 490 |
| 343 | 3300003354 | JGI25160J50197_1005006 | JGI25160J50197_10050064 | 490 |
| 344 | 3300003374 | JGI25161J50226_1002268 | JGI25161J50226_10022684 | 490 |
| 345 | 3300003374 | JGI25161J50226_1002280 | JGI25161J50226_10022803 | 490 |
| 346 | 3300003771 | Ga0055526_1008101 | Ga0055526_10081011 | 490 |
| 347 | 3300003771 | Ga0055526_1008548 | Ga0055526_10085483 | 490 |
| 348 | 3300003773 | Ga0055537_1004396 | Ga0055537_10043961 | 490 |
| 349 | 3300003775 | Ga0055524_1002028 | Ga0055524_10020289 | 490 |
| 350 | 3300003775 | Ga0055524_1004397 | Ga0055524_10043972 | 490 |
| 351 | 3300003775 | Ga0055524_1006458 | Ga0055524_10064583 | 490 |
| 352 | 3300003784 | Ga0055534_1002808 | Ga0055534_10028081 | 490 |
| 353 | 3300003791 | Ga0055530_10006633 | Ga0055530_100066334 | 490 |
| 354 | 3300004625 | Ga0055543_1003018 | Ga0055543_10030181 | 490 |
| 355 | 3300005262 | Ga0065165_1029943 | Ga0065165_10299431 | 490 |
| 356 | 3300013105 | Ga0157369_10085370 | Ga0157369_100853702 | 490 |
| 357 | 3300025208 | Ga0209436_100529 | Ga0209436_1005291 | 490 |
| 358 | 3300025208 | Ga0209436_102729 | Ga0209436_1027294 | 490 |
| 359 | 3300025245 | Ga0207425_1000013 | Ga0207425_1000013270 | 490 |
| 360 | 3300025245 | Ga0207425_1002536 | Ga0207425_10025365 | 490 |
| 361 | 3300025258 | Ga0209129_1000106 | Ga0209129_10001061 | 490 |
| 362 | 3300025258 | Ga0209129_1006180 | Ga0209129_10061801 | 490 |
| 363 | 3300025263 | Ga0209565_1001529 | Ga0209565_10015295 | 490 |
| 364 | 3300025263 | Ga0209565_1015177 | Ga0209565_10151771 | 490 |
| 365 | 3300025263 | Ga0209565_1017862 | Ga0209565_10178621 | 490 |
| 366 | 3300025284 | Ga0209130_1001743 | Ga0209130_10017431 | 490 |
| 367 | 3300025284 | Ga0209130_1004648 | Ga0209130_10046481 | 490 |
| 368 | 3300025291 | Ga0209675_1001499 | Ga0209675_10014996 | 490 |
| 369 | 3300025291 | Ga0209675_1013774 | Ga0209675_10137741 | 490 |
| 370 | 3300025295 | Ga0209564_1000088 | Ga0209564_1000088183 | 490 |
| 371 | 3300025295 | Ga0209564_1002997 | Ga0209564_10029979 | 490 |
| 372 | 3300025297 | Ga0209758_1000031 | Ga0209758_1000031194 | 490 |
| 373 | 3300025298 | Ga0209050_1000078 | Ga0209050_100007898 | 490 |
| 374 | 3300025298 | Ga0209050_1003291 | Ga0209050_10032919 | 490 |
| 375 | 3300025299 | Ga0209256_1000305 | Ga0209256_10003056 | 490 |
| 376 | 3300025299 | Ga0209256_1000712 | Ga0209256_100071234 | 490 |
| 377 | 3300025299 | Ga0209256_1006321 | Ga0209256_10063211 | 490 |
| 378 | 3300025302 | Ga0207426_1002410 | Ga0207426_10024107 | 490 |
| 379 | 3300025303 | Ga0209051_1010576 | Ga0209051_10105763 | 490 |
| 380 | 3300025304 | Ga0209257_1000097 | Ga0209257_100009776 | 490 |
| 381 | 3300031548 | Ga0307408_100002206 | Ga0307408_1000022068 | 490 |
| 382 | 3300031548 | Ga0307408_100067452 | Ga0307408_1000674521 | 490 |
| 383 | 3300044658 | Ga0466972_0047778 | Ga0466972_0047778_548_2032 | 490 |
| 384 | 3300044842 | Ga0466957_0038741 | Ga0466957_0038741_592_2076 | 490 |
| 385 | 3300045976 | Ga0466967_0013799 | Ga0466967_0013799_1080_2558 | 490 |
| 386 | 3300046491 | Ga0495584_0006407 | Ga0495584_0006407_291_1766 | 490 |
| 387 | 3300046492 | Ga0495585_0003678 | Ga0495585_0003678_8587_10062 | 490 |
| 388 | 3300046507 | Ga0495606_0072411 | Ga0495606_0072411_188_1663 | 490 |
| 389 | 3300046512 | Ga0495610_0003047 | Ga0495610_0003047_11085_12560 | 490 |
| 390 | 3300046522 | Ga0495643_0062760 | Ga0495643_0062760_252_1727 | 490 |
| 391 | 3300046538 | Ga0495609_0002279 | Ga0495609_0002279_10337_11815 | 490 |
| 392 | 3300046558 | Ga0495633_0000094 | Ga0495633_0000094_118813_120288 | 490 |
| 393 | 3300047469 | Ga0495673_0009705 | Ga0495673_0009705_1115_2590 | 490 |
| 394 | 3300049744 | Ga0501083_0002059 | Ga0501083_0002059_10589_12064 | 490 |
| 395 | 3300050514 | nmdc:mga08x19_149369_c1 | nmdc:mga08x19_149369_c1_47_1555 | 490 |
| 396 | iso_pu_bacteria | 2511231026 | 2511386024 | 490 |
| 397 | iso_pu_bacteria | 2643221645 | 2644249827 | 490 |
| 398 | iso_pu_bacteria | 2643221664 | 2644358497 | 490 |
| 399 | iso_pu_bacteria | 2738541280 | 2738739434 | 490 |
| 400 | iso_pu_bacteria | 2738541297 | 2738827688 | 490 |
| 401 | iso_pu_bacteria | 2738541300 | 2738846007 | 490 |
| 402 | iso_pu_bacteria | 2738541357 | 2739151484 | 490 |
| 403 | iso_pu_bacteria | 2738543003 | 2739193404 | 490 |
| 404 | iso_pu_bacteria | 2738543018 | 2739275840 | 490 |
| 405 | iso_pu_bacteria | 2738543026 | 2739319880 | 490 |
| 406 | iso_pu_bacteria | 2738543029 | 2739338121 | 490 |
| 407 | iso_pu_bacteria | 2738543030 | 2739344884 | 490 |
| 408 | iso_pu_bacteria | 2808606418 | 2809147249 | 490 |
| 409 | iso_pu_bacteria | 2821131069 | 2821135946 | 490 |
| 410 | iso_pu_bacteria | 2857553236 | 2857555657 | 490 |
| 411 | iso_pu_bacteria | 2857558681 | 2857561846 | 490 |
| 412 | iso_pu_bacteria | 2857564685 | 2857569315 | 490 |
| 413 | iso_pu_bacteria | 2904424332 | 2904429473 | 490 |
| 414 | iso_pu_bacteria | 2919476304 | 2919479297 | 490 |
| 415 | 3300005289 | Ga0065704_10093677 | Ga0065704_100936771 | 491 |
| 416 | 3300021361 | Ga0213872_10001135 | Ga0213872_1000113512 | 491 |
| 417 | 3300031548 | Ga0307408_100002135 | Ga0307408_1000021355 | 491 |
| 418 | 3300031901 | Ga0307406_10001008 | Ga0307406_1000100810 | 491 |
| 419 | 3300031995 | Ga0307409_100000481 | Ga0307409_1000004813 | 491 |
| 420 | 3300032004 | Ga0307414_10024771 | Ga0307414_100247713 | 491 |
| 421 | 3300044693 | Ga0466961_0034721 | Ga0466961_0034721_795_2279 | 491 |
| 422 | 3300046471 | Ga0495650_0008243 | Ga0495650_0008243_4231_5709 | 491 |
| 423 | 3300046694 | Ga0495649_0000648 | Ga0495649_0000648_134_1618 | 491 |
| 424 | 3300047470 | Ga0495681_0001145 | Ga0495681_0001145_18532_20010 | 491 |
| 425 | 3300048924 | Ga0496121_0012095 | Ga0496121_0012095_158_1654 | 491 |
| 426 | iso_pu_bacteria | 2884215851 | 2884219335 | 491 |
| 427 | iso_pu_bacteria | 8057160832 | 8057161380 | 491 |
| 428 | 3300002987 | JGI25159J45721_1005468 | JGI25159J45721_10054684 | 492 |
| 429 | 3300003775 | Ga0055524_1000022 | Ga0055524_1000022223 | 492 |
| 430 | 3300003784 | Ga0055534_1000254 | Ga0055534_100025413 | 492 |
| 431 | 3300003790 | Ga0055528_1000031 | Ga0055528_100003136 | 492 |
| 432 | 3300003791 | Ga0055530_10006375 | Ga0055530_100063751 | 492 |
| 433 | 3300005262 | Ga0065165_1002165 | Ga0065165_10021651 | 492 |
| 434 | 3300005530 | Ga0070679_100032747 | Ga0070679_1000327472 | 492 |
| 435 | 3300006852 | Ga0075433_10049441 | Ga0075433_100494412 | 492 |
| 436 | 3300009147 | Ga0114129_10004035 | Ga0114129_1000403511 | 492 |
| 437 | 3300013105 | Ga0157369_10009230 | Ga0157369_100092302 | 492 |
| 438 | 3300013307 | Ga0157372_10041737 | Ga0157372_100417373 | 492 |
| 439 | 3300025208 | Ga0209436_111418 | Ga0209436_1114181 | 492 |
| 440 | 3300025263 | Ga0209565_1000035 | Ga0209565_1000035145 | 492 |
| 441 | 3300025273 | Ga0209673_1000006 | Ga0209673_1000006235 | 492 |
| 442 | 3300025284 | Ga0209130_1002565 | Ga0209130_10025651 | 492 |
| 443 | 3300025291 | Ga0209675_1000005 | Ga0209675_1000005537 | 492 |
| 444 | 3300025295 | Ga0209564_1000083 | Ga0209564_100008399 | 492 |
| 445 | 3300025299 | Ga0209256_1000035 | Ga0209256_1000035223 | 492 |
| 446 | 3300025299 | Ga0209256_1000141 | Ga0209256_100014113 | 492 |
| 447 | 3300025302 | Ga0207426_1011253 | Ga0207426_10112531 | 492 |
| 448 | 3300025913 | Ga0207695_10000001 | Ga0207695_100000012291 | 492 |
| 449 | 3300025921 | Ga0207652_10022861 | Ga0207652_100228614 | 492 |
| 450 | 3300026142 | Ga0207698_10016019 | Ga0207698_100160194 | 492 |
| 451 | 3300027666 | Ga0209282_1000003 | Ga0209282_1000003189 | 492 |
| 452 | 3300031240 | Ga0265320_10003087 | Ga0265320_100030877 | 492 |
| 453 | 3300044673 | Ga0453683_0011657 | Ga0453683_0011657_4261_5748 | 492 |
| 454 | 3300044712 | Ga0453684_0001278 | Ga0453684_0001278_67869_69356 | 492 |
| 455 | 3300044712 | Ga0453684_0020326 | Ga0453684_0020326_7866_9353 | 492 |
| 456 | 3300044712 | Ga0453684_0052242 | Ga0453684_0052242_679_2166 | 492 |
| 457 | 3300045051 | Ga0451576_0003537 | Ga0451576_0003537_10560_12047 | 492 |
| 458 | 3300046452 | Ga0495617_000515 | Ga0495617_000515_18507_19997 | 492 |
| 459 | 3300046453 | Ga0495627_019607 | Ga0495627_019607_75_1577 | 492 |
| 460 | 3300046458 | Ga0495591_000132 | Ga0495591_000132_66378_67883 | 492 |
| 461 | 3300046460 | Ga0495638_0003837 | Ga0495638_0003837_10160_11650 | 492 |
| 462 | 3300046474 | Ga0495605_0026450 | Ga0495605_0026450_282_1772 | 492 |
| 463 | 3300046491 | Ga0495584_0000883 | Ga0495584_0000883_127_1632 | 492 |
| 464 | 3300046491 | Ga0495584_0001234 | Ga0495584_0001234_566_2065 | 492 |
| 465 | 3300046491 | Ga0495584_0001667 | Ga0495584_0001667_6074_7564 | 492 |
| 466 | 3300046491 | Ga0495584_0009117 | Ga0495584_0009117_55_1548 | 492 |
| 467 | 3300046492 | Ga0495585_0000022 | Ga0495585_0000022_20195_21685 | 492 |
| 468 | 3300046492 | Ga0495585_0000113 | Ga0495585_0000113_19325_20815 | 492 |
| 469 | 3300046492 | Ga0495585_0001317 | Ga0495585_0001317_4993_6492 | 492 |
| 470 | 3300046492 | Ga0495585_0052816 | Ga0495585_0052816_133_1638 | 492 |
| 471 | 3300046500 | Ga0495596_0002530 | Ga0495596_0002530_8199_9701 | 492 |
| 472 | 3300046500 | Ga0495596_0018066 | Ga0495596_0018066_553_2052 | 492 |
| 473 | 3300046501 | Ga0495607_0005885 | Ga0495607_0005885_2718_4208 | 492 |
| 474 | 3300046501 | Ga0495607_0050374 | Ga0495607_0050374_174_1679 | 492 |
| 475 | 3300046501 | Ga0495607_0056529 | Ga0495607_0056529_696_2186 | 492 |
| 476 | 3300046506 | Ga0495583_0000116 | Ga0495583_0000116_17520_19013 | 492 |
| 477 | 3300046506 | Ga0495583_0000183 | Ga0495583_0000183_12092_13582 | 492 |
| 478 | 3300046506 | Ga0495583_0001913 | Ga0495583_0001913_126_1619 | 492 |
| 479 | 3300046506 | Ga0495583_0005154 | Ga0495583_0005154_7354_8859 | 492 |
| 480 | 3300046512 | Ga0495610_0006005 | Ga0495610_0006005_6144_7649 | 492 |
| 481 | 3300046513 | Ga0495616_0000886 | Ga0495616_0000886_19990_21489 | 492 |
| 482 | 3300046513 | Ga0495616_0005161 | Ga0495616_0005161_226_1716 | 492 |
| 483 | 3300046513 | Ga0495616_0033232 | Ga0495616_0033232_922_2412 | 492 |
| 484 | 3300046513 | Ga0495616_0033430 | Ga0495616_0033430_659_2158 | 492 |
| 485 | 3300046518 | Ga0495631_0020337 | Ga0495631_0020337_1484_2986 | 492 |
| 486 | 3300046519 | Ga0495632_0001647 | Ga0495632_0001647_9308_10801 | 492 |
| 487 | 3300046519 | Ga0495632_0020470 | Ga0495632_0020470_125_1618 | 492 |
| 488 | 3300046519 | Ga0495632_0025914 | Ga0495632_0025914_115_1620 | 492 |
| 489 | 3300046520 | Ga0495637_0000028 | Ga0495637_0000028_76321_77826 | 492 |
| 490 | 3300046522 | Ga0495643_0009285 | Ga0495643_0009285_3590_5083 | 492 |
| 491 | 3300046522 | Ga0495643_0018085 | Ga0495643_0018085_2473_3978 | 492 |
| 492 | 3300046523 | Ga0495644_0000816 | Ga0495644_0000816_6511_8001 | 492 |
| 493 | 3300046523 | Ga0495644_0002483 | Ga0495644_0002483_1983_3473 | 492 |
| 494 | 3300046523 | Ga0495644_0016166 | Ga0495644_0016166_151_1644 | 492 |
| 495 | 3300046524 | Ga0495648_0000959 | Ga0495648_0000959_28032_29522 | 492 |
| 496 | 3300046524 | Ga0495648_0002004 | Ga0495648_0002004_3162_4652 | 492 |
| 497 | 3300046528 | Ga0495642_0004047 | Ga0495642_0004047_4131_5624 | 492 |
| 498 | 3300046538 | Ga0495609_0000637 | Ga0495609_0000637_20863_22353 | 492 |
| 499 | 3300046538 | Ga0495609_0010356 | Ga0495609_0010356_278_1768 | 492 |
| 500 | 3300046538 | Ga0495609_0022949 | Ga0495609_0022949_120_1613 | 492 |
| 501 | 3300046558 | Ga0495633_0005634 | Ga0495633_0005634_179_1678 | 492 |
| 502 | 3300046558 | Ga0495633_0012968 | Ga0495633_0012968_565_2055 | 492 |
| 503 | 3300046558 | Ga0495633_0049565 | Ga0495633_0049565_278_1768 | 492 |
| 504 | 3300046616 | Ga0495668_0000136 | Ga0495668_0000136_69295_70785 | 492 |
| 505 | 3300046616 | Ga0495668_0058272 | Ga0495668_0058272_488_1981 | 492 |
| 506 | 3300046648 | Ga0495611_0001165 | Ga0495611_0001165_12189_13691 | 492 |
| 507 | 3300046648 | Ga0495611_0002506 | Ga0495611_0002506_127_1632 | 492 |
| 508 | 3300046648 | Ga0495611_0003911 | Ga0495611_0003911_4821_6311 | 492 |
| 509 | 3300046648 | Ga0495611_0039831 | Ga0495611_0039831_227_1717 | 492 |
| 510 | 3300046660 | Ga0495625_0002385 | Ga0495625_0002385_9278_10768 | 492 |
| 511 | 3300046660 | Ga0495625_0113768 | Ga0495625_0113768_126_1616 | 492 |
| 512 | 3300046664 | Ga0495659_0002583 | Ga0495659_0002583_1107_2597 | 492 |
| 513 | 3300046664 | Ga0495659_0005015 | Ga0495659_0005015_2422_3912 | 492 |
| 514 | 3300046665 | Ga0495661_0012446 | Ga0495661_0012446_1489_2979 | 492 |
| 515 | 3300046665 | Ga0495661_0012907 | Ga0495661_0012907_84_1589 | 492 |
| 516 | 3300046665 | Ga0495661_0037594 | Ga0495661_0037594_334_1824 | 492 |
| 517 | 3300046665 | Ga0495661_0065189 | Ga0495661_0065189_312_1811 | 492 |
| 518 | 3300046684 | Ga0495669_0011001 | Ga0495669_0011001_1235_2725 | 492 |
| 519 | 3300046684 | Ga0495669_0011379 | Ga0495669_0011379_186_1679 | 492 |
| 520 | 3300046691 | Ga0495670_0004297 | Ga0495670_0004297_2329_3819 | 492 |
| 521 | 3300046691 | Ga0495670_0036782 | Ga0495670_0036782_590_2083 | 492 |
| 522 | 3300046691 | Ga0495670_0055260 | Ga0495670_0055260_278_1768 | 492 |
| 523 | 3300046692 | Ga0495671_0003539 | Ga0495671_0003539_8024_9523 | 492 |
| 524 | 3300046694 | Ga0495649_0007907 | Ga0495649_0007907_4883_6376 | 492 |
| 525 | 3300046794 | Ga0495589_0072146 | Ga0495589_0072146_55_1560 | 492 |
| 526 | 3300046810 | Ga0495660_0081097 | Ga0495660_0081097_53_1543 | 492 |
| 527 | 3300047318 | Ga0495636_0012459 | Ga0495636_0012459_1796_3286 | 492 |
| 528 | 3300047320 | Ga0495672_0001291 | Ga0495672_0001291_18600_20096 | 492 |
| 529 | 3300047320 | Ga0495672_0002747 | Ga0495672_0002747_202_1707 | 492 |
| 530 | 3300047320 | Ga0495672_0008317 | Ga0495672_0008317_4609_6099 | 492 |
| 531 | 3300047320 | Ga0495672_0027727 | Ga0495672_0027727_2042_3535 | 492 |
| 532 | 3300047320 | Ga0495672_0029428 | Ga0495672_0029428_259_1749 | 492 |
| 533 | 3300047321 | Ga0495676_0000135 | Ga0495676_0000135_35061_36569 | 492 |
| 534 | 3300047323 | Ga0495683_0000330 | Ga0495683_0000330_202_1707 | 492 |
| 535 | 3300047323 | Ga0495683_0003371 | Ga0495683_0003371_617_2116 | 492 |
| 536 | 3300047323 | Ga0495683_0004322 | Ga0495683_0004322_227_1717 | 492 |
| 537 | 3300047323 | Ga0495683_0026959 | Ga0495683_0026959_419_1909 | 492 |
| 538 | 3300047443 | Ga0495687_000609 | Ga0495687_000609_25512_27002 | 492 |
| 539 | 3300047443 | Ga0495687_021690 | Ga0495687_021690_1489_2979 | 492 |
| 540 | 3300047445 | Ga0495677_0005109 | Ga0495677_0005109_1459_2949 | 492 |
| 541 | 3300047445 | Ga0495677_0009064 | Ga0495677_0009064_2014_3504 | 492 |
| 542 | 3300047445 | Ga0495677_0019627 | Ga0495677_0019627_190_1680 | 492 |
| 543 | 3300047446 | Ga0495679_007244 | Ga0495679_007244_806_2296 | 492 |
| 544 | 3300047446 | Ga0495679_032214 | Ga0495679_032214_46_1551 | 492 |
| 545 | 3300047447 | Ga0495685_000110 | Ga0495685_000110_9545_11035 | 492 |
| 546 | 3300047447 | Ga0495685_017583 | Ga0495685_017583_464_1954 | 492 |
| 547 | 3300047469 | Ga0495673_0005363 | Ga0495673_0005363_2204_3694 | 492 |
| 548 | 3300047470 | Ga0495681_0006452 | Ga0495681_0006452_3424_4914 | 492 |
| 549 | 3300047470 | Ga0495681_0037378 | Ga0495681_0037378_746_2251 | 492 |
| 550 | 3300047472 | Ga0495686_0003368 | Ga0495686_0003368_194_1684 | 492 |
| 551 | 3300047673 | Ga0495593_0010408 | Ga0495593_0010408_3362_4855 | 492 |
| 552 | 3300048091 | Ga0495626_0029337 | Ga0495626_0029337_968_2464 | 492 |
| 553 | 3300048091 | Ga0495626_0029831 | Ga0495626_0029831_117_1619 | 492 |
| 554 | 3300048091 | Ga0495626_0048822 | Ga0495626_0048822_319_1812 | 492 |
| 555 | 3300048903 | Ga0496100_0059791 | Ga0496100_0059791_724_2223 | 492 |
| 556 | 3300048904 | Ga0496101_0010598 | Ga0496101_0010598_4574_6073 | 492 |
| 557 | 3300048918 | Ga0496115_0142663 | Ga0496115_0142663_428_1915 | 492 |
| 558 | 3300049459 | Ga0495678_002015 | Ga0495678_002015_1157_2647 | 492 |
| 559 | 3300049459 | Ga0495678_004801 | Ga0495678_004801_6133_7638 | 492 |
| 560 | 3300049459 | Ga0495678_021395 | Ga0495678_021395_1206_2699 | 492 |
| 561 | 3300049460 | Ga0495682_0003258 | Ga0495682_0003258_3797_5287 | 492 |
| 562 | 3300050507 | nmdc:mga05p37_6267_c1 | nmdc:mga05p37_6267_c1_7540_9024 | 492 |
| 563 | 3300050510 | nmdc:mga06r32_34139_c1 | nmdc:mga06r32_34139_c1_76_1560 | 492 |
| 564 | 3300002774 | JGI25150J39212_1010346 | JGI25150J39212_10103461 | 493 |
| 565 | 3300003763 | Ga0055529_1000027 | Ga0055529_1000027264 | 493 |
| 566 | 3300003771 | Ga0055526_1005264 | Ga0055526_10052641 | 493 |
| 567 | 3300003771 | Ga0055526_1009279 | Ga0055526_10092791 | 493 |
| 568 | 3300005366 | Ga0070659_100110036 | Ga0070659_1001100362 | 493 |
| 569 | 3300005457 | Ga0070662_100077482 | Ga0070662_1000774822 | 493 |
| 570 | 3300005548 | Ga0070665_100005374 | Ga0070665_1000053742 | 493 |
| 571 | 3300009036 | Ga0105244_10008170 | Ga0105244_100081705 | 493 |
| 572 | 3300015261 | Ga0182006_1000169 | Ga0182006_10001691 | 493 |
| 573 | 3300015265 | Ga0182005_1000003 | Ga0182005_1000003528 | 493 |
| 574 | 3300021361 | Ga0213872_10000622 | Ga0213872_100006224 | 493 |
| 575 | 3300021361 | Ga0213872_10009107 | Ga0213872_100091072 | 493 |
| 576 | 3300021361 | Ga0213872_10038615 | Ga0213872_100386152 | 493 |
| 577 | 3300021361 | Ga0213872_10040523 | Ga0213872_100405231 | 493 |
| 578 | 3300025245 | Ga0207425_1001817 | Ga0207425_10018173 | 493 |
| 579 | 3300025246 | Ga0209646_1000126 | Ga0209646_100012657 | 493 |
| 580 | 3300025272 | Ga0209455_1000033 | Ga0209455_1000033181 | 493 |
| 581 | 3300025294 | Ga0209025_1001104 | Ga0209025_100110428 | 493 |
| 582 | 3300025295 | Ga0209564_1000028 | Ga0209564_1000028223 | 493 |
| 583 | 3300025295 | Ga0209564_1000032 | Ga0209564_1000032373 | 493 |
| 584 | 3300025297 | Ga0209758_1000343 | Ga0209758_100034328 | 493 |
| 585 | 3300025933 | Ga0207706_10112979 | Ga0207706_101129792 | 493 |
| 586 | 3300026067 | Ga0207678_10002725 | Ga0207678_100027255 | 493 |
| 587 | 3300026067 | Ga0207678_10203023 | Ga0207678_102030231 | 493 |
| 588 | 3300026088 | Ga0207641_10042901 | Ga0207641_100429013 | 493 |
| 589 | 3300028379 | Ga0268266_10002274 | Ga0268266_1000227412 | 493 |
| 590 | 3300028379 | Ga0268266_10007538 | Ga0268266_100075386 | 493 |
| 591 | 3300028379 | Ga0268266_10014702 | Ga0268266_100147022 | 493 |
| 592 | 3300031548 | Ga0307408_100001264 | Ga0307408_10000126413 | 493 |
| 593 | 3300033180 | Ga0307510_10168753 | Ga0307510_101687532 | 493 |
| 594 | 3300037853 | Ga0436364_0602549 | Ga0436364_0602549_517_1998 | 493 |
| 595 | 3300039447 | Ga0436361_0059946 | Ga0436361_0059946_648_2132 | 493 |
| 596 | 3300039447 | Ga0436361_0063197 | Ga0436361_0063197_1501_2985 | 493 |
| 597 | 3300039447 | Ga0436361_0174205 | Ga0436361_0174205_744_2228 | 493 |
| 598 | 3300039447 | Ga0436361_0615119 | Ga0436361_0615119_1469_2953 | 493 |
| 599 | 3300039447 | Ga0436361_0701338 | Ga0436361_0701338_15268_16761 | 493 |
| 600 | 3300044901 | Ga0466960_0053673 | Ga0466960_0053673_287_1789 | 493 |
| 601 | 3300046453 | Ga0495627_000016 | Ga0495627_000016_191269_192774 | 493 |
| 602 | 3300046457 | Ga0495590_0000058 | Ga0495590_0000058_25620_27107 | 493 |
| 603 | 3300046459 | Ga0495629_0004226 | Ga0495629_0004226_6190_7695 | 493 |
| 604 | 3300046460 | Ga0495638_0000627 | Ga0495638_0000627_37374_38861 | 493 |
| 605 | 3300046460 | Ga0495638_0007268 | Ga0495638_0007268_6242_7741 | 493 |
| 606 | 3300046463 | Ga0495653_0000014 | Ga0495653_0000014_14670_16154 | 493 |
| 607 | 3300046463 | Ga0495653_0012633 | Ga0495653_0012633_157_1653 | 493 |
| 608 | 3300046471 | Ga0495650_0000146 | Ga0495650_0000146_134767_136257 | 493 |
| 609 | 3300046471 | Ga0495650_0000334 | Ga0495650_0000334_66090_67577 | 493 |
| 610 | 3300046471 | Ga0495650_0000463 | Ga0495650_0000463_41151_42647 | 493 |
| 611 | 3300046471 | Ga0495650_0001265 | Ga0495650_0001265_15558_17042 | 493 |
| 612 | 3300046471 | Ga0495650_0002431 | Ga0495650_0002431_13421_14908 | 493 |
| 613 | 3300046471 | Ga0495650_0019882 | Ga0495650_0019882_167_1654 | 493 |
| 614 | 3300046474 | Ga0495605_0000010 | Ga0495605_0000010_55737_57224 | 493 |
| 615 | 3300046474 | Ga0495605_0042993 | Ga0495605_0042993_131_1633 | 493 |
| 616 | 3300046491 | Ga0495584_0006181 | Ga0495584_0006181_4178_5680 | 493 |
| 617 | 3300046492 | Ga0495585_0005593 | Ga0495585_0005593_854_2359 | 493 |
| 618 | 3300046499 | Ga0495594_0006383 | Ga0495594_0006383_4072_5559 | 493 |
| 619 | 3300046499 | Ga0495594_0023607 | Ga0495594_0023607_1717_3204 | 493 |
| 620 | 3300046500 | Ga0495596_0001100 | Ga0495596_0001100_13601_15103 | 493 |
| 621 | 3300046500 | Ga0495596_0005078 | Ga0495596_0005078_4532_6031 | 493 |
| 622 | 3300046501 | Ga0495607_0002162 | Ga0495607_0002162_713_2200 | 493 |
| 623 | 3300046501 | Ga0495607_0025322 | Ga0495607_0025322_1374_2858 | 493 |
| 624 | 3300046506 | Ga0495583_0000346 | Ga0495583_0000346_54857_56344 | 493 |
| 625 | 3300046507 | Ga0495606_0003214 | Ga0495606_0003214_198_1682 | 493 |
| 626 | 3300046507 | Ga0495606_0006492 | Ga0495606_0006492_155_1645 | 493 |
| 627 | 3300046507 | Ga0495606_0027391 | Ga0495606_0027391_2416_3903 | 493 |
| 628 | 3300046512 | Ga0495610_0021828 | Ga0495610_0021828_188_1672 | 493 |
| 629 | 3300046513 | Ga0495616_0040695 | Ga0495616_0040695_701_2188 | 493 |
| 630 | 3300046517 | Ga0495630_0045119 | Ga0495630_0045119_1553_3046 | 493 |
| 631 | 3300046518 | Ga0495631_0003968 | Ga0495631_0003968_5745_7250 | 493 |
| 632 | 3300046520 | Ga0495637_0049662 | Ga0495637_0049662_93_1577 | 493 |
| 633 | 3300046522 | Ga0495643_0001967 | Ga0495643_0001967_15521_17005 | 493 |
| 634 | 3300046522 | Ga0495643_0001996 | Ga0495643_0001996_15324_16811 | 493 |
| 635 | 3300046524 | Ga0495648_0000004 | Ga0495648_0000004_105659_107146 | 493 |
| 636 | 3300046524 | Ga0495648_0005916 | Ga0495648_0005916_8311_9795 | 493 |
| 637 | 3300046526 | Ga0495666_0009729 | Ga0495666_0009729_3089_4594 | 493 |
| 638 | 3300046528 | Ga0495642_0001389 | Ga0495642_0001389_60_1547 | 493 |
| 639 | 3300046528 | Ga0495642_0003344 | Ga0495642_0003344_366_1868 | 493 |
| 640 | 3300046528 | Ga0495642_0020605 | Ga0495642_0020605_970_2454 | 493 |
| 641 | 3300046528 | Ga0495642_0029962 | Ga0495642_0029962_631_2127 | 493 |
| 642 | 3300046529 | Ga0495652_0101639 | Ga0495652_0101639_99_1604 | 493 |
| 643 | 3300046530 | Ga0495654_0000034 | Ga0495654_0000034_927_2411 | 493 |
| 644 | 3300046530 | Ga0495654_0003671 | Ga0495654_0003671_7674_9185 | 493 |
| 645 | 3300046530 | Ga0495654_0008297 | Ga0495654_0008297_3524_5026 | 493 |
| 646 | 3300046531 | Ga0495665_0017370 | Ga0495665_0017370_376_1884 | 493 |
| 647 | 3300046535 | Ga0495586_0032273 | Ga0495586_0032273_654_2159 | 493 |
| 648 | 3300046535 | Ga0495586_0065506 | Ga0495586_0065506_35_1531 | 493 |
| 649 | 3300046536 | Ga0495587_0012562 | Ga0495587_0012562_211_1716 | 493 |
| 650 | 3300046536 | Ga0495587_0034917 | Ga0495587_0034917_1289_2782 | 493 |
| 651 | 3300046538 | Ga0495609_0014619 | Ga0495609_0014619_1865_3364 | 493 |
| 652 | 3300046542 | Ga0495597_0001037 | Ga0495597_0001037_163_1650 | 493 |
| 653 | 3300046542 | Ga0495597_0003215 | Ga0495597_0003215_1580_3064 | 493 |
| 654 | 3300046542 | Ga0495597_0007545 | Ga0495597_0007545_589_2091 | 493 |
| 655 | 3300046542 | Ga0495597_0053026 | Ga0495597_0053026_134_1633 | 493 |
| 656 | 3300046557 | Ga0495622_0000431 | Ga0495622_0000431_16719_18206 | 493 |
| 657 | 3300046557 | Ga0495622_0007772 | Ga0495622_0007772_1351_2856 | 493 |
| 658 | 3300046558 | Ga0495633_0000068 | Ga0495633_0000068_122732_124219 | 493 |
| 659 | 3300046558 | Ga0495633_0020466 | Ga0495633_0020466_771_2276 | 493 |
| 660 | 3300046615 | Ga0495656_0003394 | Ga0495656_0003394_266_1771 | 493 |
| 661 | 3300046616 | Ga0495668_0001987 | Ga0495668_0001987_16230_17717 | 493 |
| 662 | 3300046616 | Ga0495668_0027644 | Ga0495668_0027644_1553_3037 | 493 |
| 663 | 3300046642 | Ga0495634_0003581 | Ga0495634_0003581_243_1739 | 493 |
| 664 | 3300046660 | Ga0495625_0000046 | Ga0495625_0000046_6098_7603 | 493 |
| 665 | 3300046660 | Ga0495625_0000257 | Ga0495625_0000257_64209_65696 | 493 |
| 666 | 3300046660 | Ga0495625_0007669 | Ga0495625_0007669_192_1679 | 493 |
| 667 | 3300046660 | Ga0495625_0009636 | Ga0495625_0009636_3727_5226 | 493 |
| 668 | 3300046660 | Ga0495625_0016122 | Ga0495625_0016122_4090_5577 | 493 |
| 669 | 3300046660 | Ga0495625_0031109 | Ga0495625_0031109_225_1709 | 493 |
| 670 | 3300046664 | Ga0495659_0000025 | Ga0495659_0000025_58453_59964 | 493 |
| 671 | 3300046665 | Ga0495661_0001306 | Ga0495661_0001306_781_2286 | 493 |
| 672 | 3300046665 | Ga0495661_0098897 | Ga0495661_0098897_123_1607 | 493 |
| 673 | 3300046665 | Ga0495661_0104381 | Ga0495661_0104381_23_1507 | 493 |
| 674 | 3300046674 | Ga0495588_0000050 | Ga0495588_0000050_325627_327117 | 493 |
| 675 | 3300046678 | Ga0495599_0118315 | Ga0495599_0118315_37_1542 | 493 |
| 676 | 3300046679 | Ga0495623_0011122 | Ga0495623_0011122_4154_5647 | 493 |
| 677 | 3300046684 | Ga0495669_0000095 | Ga0495669_0000095_20633_22135 | 493 |
| 678 | 3300046684 | Ga0495669_0002966 | Ga0495669_0002966_1915_3414 | 493 |
| 679 | 3300046689 | Ga0495613_0021326 | Ga0495613_0021326_102_1589 | 493 |
| 680 | 3300046689 | Ga0495613_0040265 | Ga0495613_0040265_1705_3201 | 493 |
| 681 | 3300046689 | Ga0495613_0041728 | Ga0495613_0041728_939_2447 | 493 |
| 682 | 3300046689 | Ga0495613_0130855 | Ga0495613_0130855_210_1715 | 493 |
| 683 | 3300046690 | Ga0495624_0005313 | Ga0495624_0005313_1192_2700 | 493 |
| 684 | 3300046691 | Ga0495670_0001130 | Ga0495670_0001130_10672_12177 | 493 |
| 685 | 3300046692 | Ga0495671_0000701 | Ga0495671_0000701_10740_12251 | 493 |
| 686 | 3300046694 | Ga0495649_0003498 | Ga0495649_0003498_221_1705 | 493 |
| 687 | 3300046794 | Ga0495589_0023884 | Ga0495589_0023884_1019_2521 | 493 |
| 688 | 3300046809 | Ga0495600_0119861 | Ga0495600_0119861_38_1543 | 493 |
| 689 | 3300046810 | Ga0495660_0008483 | Ga0495660_0008483_129_1634 | 493 |
| 690 | 3300047315 | Ga0495581_0006656 | Ga0495581_0006656_760_2268 | 493 |
| 691 | 3300047317 | Ga0495604_0071133 | Ga0495604_0071133_285_1778 | 493 |
| 692 | 3300047318 | Ga0495636_0007204 | Ga0495636_0007204_162_1649 | 493 |
| 693 | 3300047319 | Ga0495674_0007930 | Ga0495674_0007930_5460_6947 | 493 |
| 694 | 3300047320 | Ga0495672_0000099 | Ga0495672_0000099_282_1766 | 493 |
| 695 | 3300047320 | Ga0495672_0000508 | Ga0495672_0000508_24109_25620 | 493 |
| 696 | 3300047443 | Ga0495687_001605 | Ga0495687_001605_13833_15335 | 493 |
| 697 | 3300047443 | Ga0495687_016404 | Ga0495687_016404_486_1988 | 493 |
| 698 | 3300047444 | Ga0495675_0032829 | Ga0495675_0032829_196_1689 | 493 |
| 699 | 3300047445 | Ga0495677_0003116 | Ga0495677_0003116_746_2251 | 493 |
| 700 | 3300047469 | Ga0495673_0000031 | Ga0495673_0000031_156592_158082 | 493 |
| 701 | 3300047470 | Ga0495681_0011831 | Ga0495681_0011831_1928_3433 | 493 |
| 702 | 3300047470 | Ga0495681_0019724 | Ga0495681_0019724_2033_3532 | 493 |
| 703 | 3300047472 | Ga0495686_0004791 | Ga0495686_0004791_281_1786 | 493 |
| 704 | 3300048088 | Ga0495602_0018108 | Ga0495602_0018108_260_1753 | 493 |
| 705 | 3300048091 | Ga0495626_0002032 | Ga0495626_0002032_12490_13992 | 493 |
| 706 | 3300048091 | Ga0495626_0005264 | Ga0495626_0005264_3718_5205 | 493 |
| 707 | 3300048091 | Ga0495626_0006906 | Ga0495626_0006906_4058_5557 | 493 |
| 708 | 3300048091 | Ga0495626_0012465 | Ga0495626_0012465_664_2154 | 493 |
| 709 | 3300048905 | Ga0496102_0000202 | Ga0496102_0000202_25845_27338 | 493 |
| 710 | 3300048905 | Ga0496102_0016243 | Ga0496102_0016243_4449_5939 | 493 |
| 711 | 3300048906 | Ga0496103_0003201 | Ga0496103_0003201_6391_7884 | 493 |
| 712 | 3300048906 | Ga0496103_0003638 | Ga0496103_0003638_4267_5766 | 493 |
| 713 | 3300048906 | Ga0496103_0048237 | Ga0496103_0048237_949_2442 | 493 |
| 714 | 3300048911 | Ga0496108_0180441 | Ga0496108_0180441_126_1610 | 493 |
| 715 | 3300048926 | Ga0496123_0002080 | Ga0496123_0002080_1222_2712 | 493 |
| 716 | 3300048927 | Ga0496124_0053150 | Ga0496124_0053150_574_2079 | 493 |
| 717 | 3300048929 | Ga0496126_0000187 | Ga0496126_0000187_55793_57295 | 493 |
| 718 | 3300049459 | Ga0495678_000001 | Ga0495678_000001_612140_613645 | 493 |
| 719 | 3300049459 | Ga0495678_000189 | Ga0495678_000189_24047_25531 | 493 |
| 720 | 3300049766 | Ga0501269_000408 | Ga0501269_000408_6435_7934 | 493 |
| 721 | 3300053119 | Ga0500595_001478 | Ga0500595_001478_1575_3242 | 493 |
| 722 | 3300005327 | Ga0070658_10000046 | Ga0070658_1000004697 | 494 |
| 723 | 3300005328 | Ga0070676_10006446 | Ga0070676_100064462 | 494 |
| 724 | 3300005329 | Ga0070683_100032958 | Ga0070683_1000329583 | 494 |
| 725 | 3300005339 | Ga0070660_100051141 | Ga0070660_1000511411 | 494 |
| 726 | 3300005343 | Ga0070687_100005339 | Ga0070687_1000053392 | 494 |
| 727 | 3300005347 | Ga0070668_100054943 | Ga0070668_1000549432 | 494 |
| 728 | 3300005353 | Ga0070669_100021945 | Ga0070669_1000219453 | 494 |
| 729 | 3300005366 | Ga0070659_100002179 | Ga0070659_1000021798 | 494 |
| 730 | 3300005436 | Ga0070713_100033721 | Ga0070713_1000337212 | 494 |
| 731 | 3300005441 | Ga0070700_100012722 | Ga0070700_1000127222 | 494 |
| 732 | 3300005455 | Ga0070663_100142610 | Ga0070663_1001426101 | 494 |
| 733 | 3300005457 | Ga0070662_100033559 | Ga0070662_1000335592 | 494 |
| 734 | 3300005530 | Ga0070679_100096336 | Ga0070679_1000963361 | 494 |
| 735 | 3300005539 | Ga0068853_100000021 | Ga0068853_100000021136 | 494 |
| 736 | 3300005539 | Ga0068853_100094885 | Ga0068853_1000948852 | 494 |
| 737 | 3300005563 | Ga0068855_100003678 | Ga0068855_1000036786 | 494 |
| 738 | 3300005578 | Ga0068854_100000075 | Ga0068854_1000000751 | 494 |
| 739 | 3300005719 | Ga0068861_100009161 | Ga0068861_1000091613 | 494 |
| 740 | 3300005840 | Ga0068870_10003915 | Ga0068870_100039153 | 494 |
| 741 | 3300005844 | Ga0068862_100016419 | Ga0068862_1000164194 | 494 |
| 742 | 3300006844 | Ga0075428_100005570 | Ga0075428_1000055709 | 494 |
| 743 | 3300006847 | Ga0075431_100017090 | Ga0075431_1000170903 | 494 |
| 744 | 3300006847 | Ga0075431_100067431 | Ga0075431_1000674312 | 494 |
| 745 | 3300006847 | Ga0075431_100122062 | Ga0075431_1001220622 | 494 |
| 746 | 3300009093 | Ga0105240_10003871 | Ga0105240_1000387117 | 494 |
| 747 | 3300009093 | Ga0105240_10039372 | Ga0105240_100393722 | 494 |
| 748 | 3300009093 | Ga0105240_10055880 | Ga0105240_100558803 | 494 |
| 749 | 3300009094 | Ga0111539_10002412 | Ga0111539_1000241210 | 494 |
| 750 | 3300009094 | Ga0111539_10022661 | Ga0111539_100226612 | 494 |
| 751 | 3300009553 | Ga0105249_10172446 | Ga0105249_101724461 | 494 |
| 752 | 3300013104 | Ga0157370_10025270 | Ga0157370_100252705 | 494 |
| 753 | 3300013104 | Ga0157370_10025427 | Ga0157370_100254273 | 494 |
| 754 | 3300013104 | Ga0157370_10090329 | Ga0157370_100903292 | 494 |
| 755 | 3300013105 | Ga0157369_10056938 | Ga0157369_100569382 | 494 |
| 756 | 3300013307 | Ga0157372_10006882 | Ga0157372_100068822 | 494 |
| 757 | 3300025908 | Ga0207643_10011795 | Ga0207643_100117953 | 494 |
| 758 | 3300025909 | Ga0207705_10000064 | Ga0207705_1000006412 | 494 |
| 759 | 3300025909 | Ga0207705_10000465 | Ga0207705_1000046518 | 494 |
| 760 | 3300025909 | Ga0207705_10032829 | Ga0207705_100328292 | 494 |
| 761 | 3300025913 | Ga0207695_10007257 | Ga0207695_100072579 | 494 |
| 762 | 3300025919 | Ga0207657_10002434 | Ga0207657_100024349 | 494 |
| 763 | 3300025919 | Ga0207657_10039626 | Ga0207657_100396263 | 494 |
| 764 | 3300025921 | Ga0207652_10028868 | Ga0207652_100288682 | 494 |
| 765 | 3300025932 | Ga0207690_10003564 | Ga0207690_100035647 | 494 |
| 766 | 3300025933 | Ga0207706_10000581 | Ga0207706_1000058119 | 494 |
| 767 | 3300025940 | Ga0207691_10000582 | Ga0207691_100005825 | 494 |
| 768 | 3300025944 | Ga0207661_10017562 | Ga0207661_100175622 | 494 |
| 769 | 3300025949 | Ga0207667_10000389 | Ga0207667_1000038913 | 494 |
| 770 | 3300025949 | Ga0207667_10073217 | Ga0207667_100732172 | 494 |
| 771 | 3300025961 | Ga0207712_10089446 | Ga0207712_100894462 | 494 |
| 772 | 3300025981 | Ga0207640_10000034 | Ga0207640_1000003442 | 494 |
| 773 | 3300026041 | Ga0207639_10000035 | Ga0207639_10000035133 | 494 |
| 774 | 3300026067 | Ga0207678_10011837 | Ga0207678_100118375 | 494 |
| 775 | 3300026067 | Ga0207678_10040299 | Ga0207678_100402992 | 494 |
| 776 | 3300026075 | Ga0207708_10016949 | Ga0207708_100169493 | 494 |
| 777 | 3300026089 | Ga0207648_10002956 | Ga0207648_1000295613 | 494 |
| 778 | 3300026116 | Ga0207674_10002393 | Ga0207674_100023937 | 494 |
| 779 | 3300026118 | Ga0207675_100000780 | Ga0207675_10000078019 | 494 |
| 780 | 3300026121 | Ga0207683_10125124 | Ga0207683_101251242 | 494 |
| 781 | 3300027614 | Ga0209970_1002556 | Ga0209970_10025562 | 494 |
| 782 | 3300027617 | Ga0210002_1000808 | Ga0210002_10008082 | 494 |
| 783 | 3300027682 | Ga0209971_1000112 | Ga0209971_100011211 | 494 |
| 784 | 3300027717 | Ga0209998_10000764 | Ga0209998_100007643 | 494 |
| 785 | 3300027876 | Ga0209974_10000147 | Ga0209974_1000014713 | 494 |
| 786 | 3300027907 | Ga0207428_10120500 | Ga0207428_101205002 | 494 |
| 787 | 3300028380 | Ga0268265_10005212 | Ga0268265_100052122 | 494 |
| 788 | 3300031238 | Ga0265332_10029155 | Ga0265332_100291552 | 494 |
| 789 | 3300031239 | Ga0265328_10018909 | Ga0265328_100189092 | 494 |
| 790 | 3300031250 | Ga0265331_10000881 | Ga0265331_1000088110 | 494 |
| 791 | 3300031711 | Ga0265314_10000550 | Ga0265314_100005508 | 494 |
| 792 | 3300035092 | Ga0373952_0002488 | Ga0373952_0002488_1392_2879 | 494 |
| 793 | 3300049581 | Ga0501047_0041763 | Ga0501047_0041763_510_2012 | 494 |
| 794 | 3300049589 | Ga0501073_0030634 | Ga0501073_0030634_846_2348 | 494 |
| 795 | 3300049591 | Ga0501075_0033578 | Ga0501075_0033578_1291_2787 | 494 |
| 796 | 3300049742 | Ga0501080_0146091 | Ga0501080_0146091_606_2108 | 494 |
| 797 | 3300049822 | Ga0501035_0079122 | Ga0501035_0079122_532_2028 | 494 |
| 798 | 3300049824 | Ga0501045_0021073 | Ga0501045_0021073_2326_3822 | 494 |
| 799 | 3300050508 | nmdc:mga09592_81705_c1 | nmdc:mga09592_81705_c1_985_2481 | 494 |
| 800 | 3300050510 | nmdc:mga06r32_25770_c1 | nmdc:mga06r32_25770_c1_1539_3035 | 494 |
| 801 | 3300050510 | nmdc:mga06r32_60012_c1 | nmdc:mga06r32_60012_c1_521_2017 | 494 |
| 802 | 3300050511 | nmdc:mga08y16_224468_c1 | nmdc:mga08y16_224468_c1_265_1761 | 494 |
| 803 | 3300050511 | nmdc:mga08y16_25838_c1 | nmdc:mga08y16_25838_c1_2413_3900 | 494 |
| 804 | 3300050511 | nmdc:mga08y16_30646_c1 | nmdc:mga08y16_30646_c1_1337_2833 | 494 |
| 805 | iso_pu_bacteria | 2582581278 | 2585143572 | 494 |
| 806 | iso_pu_bacteria | 2585428183 | 2588215859 | 494 |
| 807 | iso_pu_bacteria | 2585428187 | 2588234594 | 494 |
| 808 | iso_pu_bacteria | 2739367874 | 2740060416 | 494 |
| 809 | iso_pu_bacteria | 2765235839 | 2765575666 | 494 |
| 810 | iso_pu_bacteria | 2871720351 | 2871723592 | 494 |
| 811 | iso_pu_bacteria | 2945924605 | 2945924813 | 494 |
| 812 | 3300005340 | Ga0070689_100036095 | Ga0070689_1000360952 | 495 |
| 813 | 3300005356 | Ga0070674_100059418 | Ga0070674_1000594182 | 495 |
| 814 | 3300005445 | Ga0070708_100083628 | Ga0070708_1000836282 | 495 |
| 815 | 3300005458 | Ga0070681_10010965 | Ga0070681_100109657 | 495 |
| 816 | 3300005467 | Ga0070706_100011228 | Ga0070706_1000112282 | 495 |
| 817 | 3300005471 | Ga0070698_100083291 | Ga0070698_1000832912 | 495 |
| 818 | 3300005549 | Ga0070704_100006379 | Ga0070704_1000063795 | 495 |
| 819 | 3300005841 | Ga0068863_100212510 | Ga0068863_1002125102 | 495 |
| 820 | 3300005844 | Ga0068862_100000833 | Ga0068862_1000008335 | 495 |
| 821 | 3300006846 | Ga0075430_100009725 | Ga0075430_1000097255 | 495 |
| 822 | 3300006871 | Ga0075434_100001516 | Ga0075434_10000151612 | 495 |
| 823 | 3300009147 | Ga0114129_10037872 | Ga0114129_100378722 | 495 |
| 824 | 3300009147 | Ga0114129_10060493 | Ga0114129_100604932 | 495 |
| 825 | 3300009176 | Ga0105242_10024217 | Ga0105242_100242172 | 495 |
| 826 | 3300009176 | Ga0105242_10121218 | Ga0105242_101212181 | 495 |
| 827 | 3300009177 | Ga0105248_10302373 | Ga0105248_103023731 | 495 |
| 828 | 3300009553 | Ga0105249_10094420 | Ga0105249_100944202 | 495 |
| 829 | 3300013308 | Ga0157375_10050708 | Ga0157375_100507083 | 495 |
| 830 | 3300025910 | Ga0207684_10056818 | Ga0207684_100568184 | 495 |
| 831 | 3300025910 | Ga0207684_10094319 | Ga0207684_100943192 | 495 |
| 832 | 3300025922 | Ga0207646_10135794 | Ga0207646_101357942 | 495 |
| 833 | 3300025934 | Ga0207686_10003047 | Ga0207686_100030476 | 495 |
| 834 | 3300025941 | Ga0207711_10082800 | Ga0207711_100828001 | 495 |
| 835 | 3300026089 | Ga0207648_10162535 | Ga0207648_101625352 | 495 |
| 836 | 3300026118 | Ga0207675_100038441 | Ga0207675_1000384412 | 495 |
| 837 | 3300028380 | Ga0268265_10000564 | Ga0268265_1000056412 | 495 |
| 838 | 3300031691 | Ga0316579_10007937 | Ga0316579_100079373 | 495 |
| 839 | 3300032002 | Ga0307416_100271114 | Ga0307416_1002711141 | 495 |
| 840 | 3300036647 | Ga0316582_0036835 | Ga0316582_0036835_287_1792 | 495 |
| 841 | 3300044712 | Ga0453684_0014990 | Ga0453684_0014990_7464_8957 | 495 |
| 842 | 3300046538 | Ga0495609_0001435 | Ga0495609_0001435_14127_15686 | 495 |
| 843 | 3300046810 | Ga0495660_0008202 | Ga0495660_0008202_4009_5568 | 495 |
| 844 | 3300046810 | Ga0495660_0051564 | Ga0495660_0051564_102_1661 | 495 |
| 845 | 3300047315 | Ga0495581_0075958 | Ga0495581_0075958_93_1586 | 495 |
| 846 | 3300048919 | Ga0496116_0008818 | Ga0496116_0008818_4128_5687 | 495 |
| 847 | 3300049568 | Ga0501031_0001950 | Ga0501031_0001950_2617_4119 | 495 |
| 848 | 3300049568 | Ga0501031_0012585 | Ga0501031_0012585_86_1588 | 495 |
| 849 | 3300049569 | Ga0501032_0004384 | Ga0501032_0004384_1682_3184 | 495 |
| 850 | 3300049569 | Ga0501032_0092269 | Ga0501032_0092269_359_1870 | 495 |
| 851 | 3300049569 | Ga0501032_0103092 | Ga0501032_0103092_54_1556 | 495 |
| 852 | 3300049570 | Ga0501033_0002590 | Ga0501033_0002590_11357_12859 | 495 |
| 853 | 3300049571 | Ga0501034_0015686 | Ga0501034_0015686_5120_6622 | 495 |
| 854 | 3300049572 | Ga0501036_0007597 | Ga0501036_0007597_815_2317 | 495 |
| 855 | 3300049573 | Ga0501037_0001188 | Ga0501037_0001188_2559_4070 | 495 |
| 856 | 3300049573 | Ga0501037_0003642 | Ga0501037_0003642_9590_11092 | 495 |
| 857 | 3300049573 | Ga0501037_0036042 | Ga0501037_0036042_31_1533 | 495 |
| 858 | 3300049573 | Ga0501037_0111887 | Ga0501037_0111887_10_1512 | 495 |
| 859 | 3300049574 | Ga0501038_0009183 | Ga0501038_0009183_1040_2542 | 495 |
| 860 | 3300049574 | Ga0501038_0022293 | Ga0501038_0022293_187_1689 | 495 |
| 861 | 3300049579 | Ga0501043_0001312 | Ga0501043_0001312_13419_14921 | 495 |
| 862 | 3300049579 | Ga0501043_0036562 | Ga0501043_0036562_532_2034 | 495 |
| 863 | 3300049580 | Ga0501046_0004508 | Ga0501046_0004508_6639_8150 | 495 |
| 864 | 3300049580 | Ga0501046_0032465 | Ga0501046_0032465_432_1934 | 495 |
| 865 | 3300049582 | Ga0501048_0001715 | Ga0501048_0001715_196_1698 | 495 |
| 866 | 3300049582 | Ga0501048_0018291 | Ga0501048_0018291_2337_3839 | 495 |
| 867 | 3300049583 | Ga0501067_0000947 | Ga0501067_0000947_5442_6944 | 495 |
| 868 | 3300049583 | Ga0501067_0002401 | Ga0501067_0002401_8170_9672 | 495 |
| 869 | 3300049585 | Ga0501069_0015659 | Ga0501069_0015659_146_1648 | 495 |
| 870 | 3300049585 | Ga0501069_0037108 | Ga0501069_0037108_170_1672 | 495 |
| 871 | 3300049586 | Ga0501070_0002702 | Ga0501070_0002702_10657_12168 | 495 |
| 872 | 3300049586 | Ga0501070_0024937 | Ga0501070_0024937_346_1848 | 495 |
| 873 | 3300049587 | Ga0501071_0003555 | Ga0501071_0003555_6601_8103 | 495 |
| 874 | 3300049590 | Ga0501074_0018785 | Ga0501074_0018785_2453_3955 | 495 |
| 875 | 3300049741 | Ga0501079_0047941 | Ga0501079_0047941_1004_2506 | 495 |
| 876 | 3300049742 | Ga0501080_0017774 | Ga0501080_0017774_4714_6225 | 495 |
| 877 | 3300049744 | Ga0501083_0013877 | Ga0501083_0013877_3396_4898 | 495 |
| 878 | 3300049744 | Ga0501083_0037688 | Ga0501083_0037688_106_1608 | 495 |
| 879 | 3300049822 | Ga0501035_0001569 | Ga0501035_0001569_9249_10751 | 495 |
| 880 | 3300049822 | Ga0501035_0019590 | Ga0501035_0019590_3940_5442 | 495 |
| 881 | 3300049822 | Ga0501035_0169616 | Ga0501035_0169616_71_1582 | 495 |
| 882 | 3300050507 | nmdc:mga05p37_260027_c1 | nmdc:mga05p37_260027_c1_22_1512 | 495 |
| 883 | 3300050512 | nmdc:mga0n895_86581_c1 | nmdc:mga0n895_86581_c1_1609_3102 | 495 |
| 884 | 3300050515 | nmdc:mga0a205_150114_c1 | nmdc:mga0a205_150114_c1_499_2022 | 495 |
| 885 | 3300050515 | nmdc:mga0a205_67743_c1 | nmdc:mga0a205_67743_c1_1609_3099 | 495 |
| 886 | 3300053177 | Ga0500636_0048047 | Ga0500636_0048047_296_1855 | 495 |
| 887 | 3300060353 | Ga0501082_0003408 | Ga0501082_0003408_1146_2648 | 495 |
| 888 | 3300060353 | Ga0501082_0094700 | Ga0501082_0094700_708_2210 | 495 |
| 889 | 3300009093 | Ga0105240_10039928 | Ga0105240_100399282 | 496 |
| 890 | iso_pu_bacteria | 2501025504 | 2501407989 | 496 |
| 891 | iso_pu_bacteria | 2510917014 | 2511095734 | 496 |
| 892 | iso_pu_bacteria | 2510917015 | 2511103513 | 496 |
| 893 | iso_pu_bacteria | 2883087390 | 2883095268 | 496 |
| 894 | 3300049570 | Ga0501033_0047393 | Ga0501033_0047393_895_2460 | 497 |
| 895 | 3300049571 | Ga0501034_0057136 | Ga0501034_0057136_1561_3120 | 497 |
| 896 | 3300049573 | Ga0501037_0038007 | Ga0501037_0038007_1216_2775 | 497 |
| 897 | 3300049823 | Ga0501044_0082984 | Ga0501044_0082984_395_1960 | 497 |
| 898 | 3300001915 | JGI24741J21665_1000554 | JGI24741J21665_10005545 | 498 |
| 899 | 3300003322 | rootL2_10159492 | rootL2_101594923 | 498 |
| 900 | 3300005337 | Ga0070682_100000608 | Ga0070682_10000060810 | 498 |
| 901 | 3300013308 | Ga0157375_10001252 | Ga0157375_1000125218 | 498 |
| 902 | 3300031911 | Ga0307412_10000241 | Ga0307412_100002415 | 498 |
| 903 | 3300041413 | Ga0439465_0000032 | Ga0439465_0000032_16414_17910 | 498 |
| 904 | 3300046453 | Ga0495627_004487 | Ga0495627_004487_2372_3868 | 498 |
| 905 | 3300046519 | Ga0495632_0007170 | Ga0495632_0007170_5041_6537 | 498 |
| 906 | 3300046522 | Ga0495643_0022240 | Ga0495643_0022240_1756_3252 | 498 |
| 907 | 3300046558 | Ga0495633_0002607 | Ga0495633_0002607_7921_9417 | 498 |
| 908 | 3300046660 | Ga0495625_0000096 | Ga0495625_0000096_66764_68260 | 498 |
| 909 | 3300047472 | Ga0495686_0000069 | Ga0495686_0000069_4352_5848 | 498 |
| 910 | 3300048929 | Ga0496126_0004486 | Ga0496126_0004486_13471_14967 | 498 |
| 911 | 3300048929 | Ga0496126_0131763 | Ga0496126_0131763_523_2019 | 498 |
| 912 | iso_pu_bacteria | 2501025501 | 2501074221 | 498 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6k79-assembly2.cif.gz_C | glycerol kinase form thermococcus kodakarensis, complex structure with substrate. | 0.9783 | 3 | 497 |
| 6k76-assembly1.cif.gz_B-2 | glycerol kinase form thermococcus kodakarensis, complex structure with substrate. | 0.9769 | 3 | 498 |
| 6k79-assembly1.cif.gz_B-2 | glycerol kinase form thermococcus kodakarensis, complex structure with substrate. | 0.9767 | 3 | 497 |
| 3ezw-assembly2.cif.gz_F | crystal structure of a hyperactive escherichia coli glycerol kinase mutant gly230 --> asp obtained using microfluidic crystallization devices | 0.9746 | 2 | 495 |
| 3ezw-assembly2.cif.gz_H | crystal structure of a hyperactive escherichia coli glycerol kinase mutant gly230 --> asp obtained using microfluidic crystallization devices | 0.974 | 2 | 495 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4e1jB01 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.9933 | 5 | 251 | 3.30.420.40 |
| 1gleG01 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.989 | 4 | 252 | 3.30.420.40 |
| 4e1jB01 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.9814 | 5 | 251 | 3.30.420.40 |
| af_A4IBJ9_264_511_3.30.420.40 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.9642 | 255 | 493 | 3.30.420.40 |
| af_Q21944_255_502_3.30.420.40 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.9624 | 253 | 495 | 3.30.420.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A352CJM4-F1-model_v4 | Glycerol kinase | 0.9962 | 4 | 140 |
GO:0004370
GO:0005829 GO:0019563 |
| AF-A0A3B9XVS2-F1-model_v4 | Glycerol kinase | 0.9924 | 3 | 286 |
GO:0004370
GO:0005829 GO:0019563 |
| AF-A0A1H8ELL8-F1-model_v4 | Glycerol kinase (EC 2.7.1.30) (ATP:glycerol 3-phosphotransferase) (Glycerokinase) (GK) | 0.9923 | 1 | 495 |
GO:0004370
GO:0005524 GO:0005829 GO:0006072 GO:0019563 |
| AF-A0A4Q3YKV4-F1-model_v4 | Glycerol kinase | 0.992 | 3 | 281 |
GO:0004370
GO:0005829 GO:0019563 |
| AF-A0A3C1X7N3-F1-model_v4 | ATP:glycerol 3-phosphotransferase | 0.9917 | 3 | 215 |
GO:0004370
GO:0005829 GO:0019563 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar