F485523

General Info

Members Datasets Scaffolds Average Seq Length
912 405 876 492

Family's Representative Sequence

Representative Sequence 3300053119|Ga0500595_001478|Ga0500595_001478_1575_3242
Length 555
Sequence MELYRLFAIGGGFLVSFAFMDLLKAFPHKRELNAVKWLVVSATHNIATLLSEGENSLVAKQYILALDQGTTSSRAMVVDETGAVISIAQHPFKQIFPKPGWVEHSPTEIWSSQSGVATEALAKANLTGRNITTIGITNQRETTVVWDRETGEPVYNAIVWQDRRTAEFCDGLRVNVGGTIQQKTGLIPDAYFSGSKVNWILANVDGARAKAEAGRLAFGTVDSWLIWKLTNGARHVTDVTNASRTMLFNIHTMDWDEELLKLLGVPRSMLPEVVASSGVCATTTGLIAGVPIAGIAGDQQAALFGQMCTSPGMAKCTYGTGAFMLLNTGTQPVASKNRLLTTVAWKIGNTVEYALEGSMLMAGAVVQWLRDELQMIRTSAEIEQLAATVTSSNGVVLVPAFAGLGAPHWDPYARGSLLGLTRGTSRAHIARAALEGIALQATDVLEAMQADSGLPLAQLRVDGGAAANNMLMQIQSDVLGIEVVRPKNAEATVLGAAYLAGLAVGYWPDKDTIARQWQMDRVFKPAMDSRDREKVRGTWRRALERASDWAREEEK

Samples

Sample ID Description Type Environment
1 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
2 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
3 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
4 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
5 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
6 2582581278 Chryseobacterium sp. CF365 Isolate Rhizosphere
7 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
8 2585428187 Chryseobacterium sp. YR460 Isolate Rhizosphere
9 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
10 2643221638 Duganella sp. Root336D2 Isolate Unclassified
11 2643221645 Massilia sp. Root351 Isolate Unclassified
12 2643221664 Massilia sp. Root418 Isolate Unclassified
13 2738541280 Massilia sp. GV090 Isolate Unclassified
14 2738541297 Duganella sp. GV083 Isolate Unclassified
15 2738541300 Massilia sp. GV016 Isolate Unclassified
16 2738541357 Duganella sp. GV053 Isolate Unclassified
17 2738543003 Duganella sp. GV066 Isolate Unclassified
18 2738543018 Massilia sp. GV045 Isolate Unclassified
19 2738543026 Duganella sp. GV089 Isolate Unclassified
20 2738543029 Duganella sp. GV039 Isolate Unclassified
21 2738543030 Massilia sp. GV097 Isolate Unclassified
22 2739367874 Chryseobacterium sp. T16E-39 Isolate Unclassified
23 2765235839 Chryseobacterium indologenes AA5 Isolate Unclassified
24 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
25 2821131069 Duganella sp. 1224 Isolate Unclassified
26 2842711865 Duganella sp. R-73148 Isolate Unclassified
27 2857553236 Duganella sp. R-74557 Isolate Unclassified
28 2857558681 Duganella sp. R-74565 Isolate Unclassified
29 2857564685 Duganella sp. R-74599 Isolate Unclassified
30 2871720351 Chryseobacterium sp. KLBC 52 Isolate Nodule
31 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
32 2884215851 Edaphobacter sp. 12200R-103 Isolate Rhizosphere
33 2904424332 Duganella sp. 1411 Isolate Rhizosphere
34 2919476304 Duganella sp. 3397 Isolate Unclassified
35 2945924605 Chryseobacterium ginsenosidimutans W1I9 Isolate Rhizosphere
36 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
37 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
38 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
39 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
40 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
41 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
42 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
43 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
44 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
45 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
46 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
47 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
48 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
49 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
50 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
51 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
52 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
53 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
54 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
55 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
56 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
57 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
58 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
59 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
60 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
61 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
62 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
63 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
64 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
65 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
66 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
67 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
68 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
69 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
70 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
71 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
72 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
73 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
74 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
75 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
76 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
77 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
78 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
79 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
80 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
81 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
82 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
83 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
84 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
85 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
86 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
87 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
88 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
89 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
90 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
91 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
92 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
93 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
94 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
95 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
96 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
97 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
98 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
99 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
100 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
101 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
102 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
103 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
104 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
105 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
106 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
107 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
108 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
109 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
110 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
111 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
112 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
113 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
114 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
115 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
116 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
117 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
118 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
119 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
120 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
121 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
122 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
123 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
124 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
125 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
126 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
127 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
128 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
129 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
130 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
131 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
132 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
133 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
134 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
135 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
136 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
137 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
138 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
139 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
140 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
141 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
142 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
143 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
145 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
146 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
147 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
148 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
149 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
150 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
152 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
153 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
201 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
203 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
204 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
205 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
209 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
210 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
211 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
212 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
213 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
214 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
215 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
216 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
217 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
218 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
219 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
220 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
221 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
222 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
223 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
224 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
225 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
226 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
227 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
228 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
229 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
230 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
231 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
232 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
233 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
234 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
235 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
236 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
237 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
238 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
239 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
240 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
241 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
242 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
243 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
244 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
245 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
246 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
247 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
248 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
249 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
250 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
251 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
252 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
253 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
254 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
255 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
256 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
257 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
258 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
259 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
260 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
261 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
262 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
263 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
264 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
265 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
266 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
267 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
268 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
269 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
270 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
271 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
272 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
273 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
274 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
275 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
276 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
277 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
278 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
279 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
280 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
281 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
282 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
283 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
284 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
285 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
286 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
287 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
288 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
289 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
290 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
291 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
292 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
293 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
294 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
295 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
296 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
297 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
298 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
299 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
300 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
301 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
302 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
303 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
304 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
305 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
306 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
307 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
308 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
309 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
310 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
311 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
312 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
313 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
314 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
315 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
316 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
317 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
318 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
319 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
320 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
321 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
322 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
323 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
324 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
325 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
326 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
327 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
328 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
329 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
330 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
331 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
332 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
333 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
334 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
335 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
336 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
337 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
338 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
339 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
340 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
341 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
342 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
343 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
344 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
345 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
346 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
347 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
348 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
349 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
350 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
351 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
352 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
353 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
354 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
355 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
356 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
357 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
358 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
359 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
360 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
361 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
362 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
363 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
364 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
365 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
366 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
367 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
368 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
369 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
370 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
371 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
372 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
373 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
374 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
375 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
376 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
377 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
378 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
379 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
380 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
381 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
382 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
383 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
384 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
385 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
386 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
387 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
388 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
389 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
390 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
391 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
392 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
393 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
394 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
395 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
396 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
397 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
398 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
399 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
400 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
401 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
402 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
403 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
404 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
405 8057160832 Larsenimonas rhizosphaerae GH2-1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.05
Metatranscriptomes 0
Isolates 3.95

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.88
Nodule 0.22
Rhizoplane 1.54
Rhizosphere 84.98
Stem 0
Stem Tuber 0
Unclassified 4.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1000554 3300001915 Bacteria 11423
2 JGI24748J21848_1002744 3300002074 Bacteria 2000
3 JGI24034J26672_10000147 3300002239 Bacteria 10141
4 JGI25152J39213_1003586 3300002773 Bacteria 5254
5 JGI25150J39212_1002183 3300002774 Bacteria 5003
6 JGI25150J39212_1010346 3300002774 Bacteria 1737
7 JGI25159J45721_1003997 3300002987 Bacteria 5022
8 JGI25159J45721_1004079 3300002987 Bacteria 4957
9 JGI25159J45721_1005468 3300002987 Bacteria 3986
10 JGI25153J46596_10004507 3300003215 Bacteria 7497
11 rootL2_10159492 3300003322 Bacteria 6215
12 JGI25160J50197_1005006 3300003354 Bacteria 5609
13 JGI25161J50226_1002268 3300003374 Bacteria 5034
14 JGI25161J50226_1002280 3300003374 Bacteria 5023
15 Ga0055529_1000027 3300003763 Bacteria 292744
16 Ga0055529_1001421 3300003763 Bacteria 7548
17 Ga0055526_1005264 3300003771 Bacteria 7497
18 Ga0055526_1008101 3300003771 Bacteria 5301
19 Ga0055526_1008548 3300003771 Bacteria 5081
20 Ga0055526_1009279 3300003771 Bacteria 4766
21 Ga0055537_1004396 3300003773 Bacteria 4035
22 Ga0055524_1000022 3300003775 Bacteria 224103
23 Ga0055524_1002028 3300003775 Bacteria 10811
24 Ga0055524_1004397 3300003775 Bacteria 6501
25 Ga0055524_1006458 3300003775 Bacteria 5081
26 Ga0055534_1000254 3300003784 Bacteria 37129
27 Ga0055534_1002808 3300003784 Bacteria 5810
28 Ga0055528_1000031 3300003790 Bacteria 120960
29 Ga0055530_10006375 3300003791 Bacteria 5292
30 Ga0055530_10006633 3300003791 Bacteria 5111
31 Ga0055543_1003018 3300004625 Bacteria 5194
32 Ga0065165_1002165 3300005262 Bacteria 17754
33 Ga0065165_1002884 3300005262 Bacteria 13219
34 Ga0065165_1029943 3300005262 Bacteria 1737
35 Ga0065704_10093677 3300005289 Bacteria 2583
36 Ga0070658_10000046 3300005327 Bacteria 130559
37 Ga0070658_10006014 3300005327 Bacteria 9845
38 Ga0070658_10094151 3300005327 Bacteria 2471
39 Ga0070676_10004005 3300005328 Bacteria 7731
40 Ga0070676_10006446 3300005328 Bacteria 6274
41 Ga0070683_100000958 3300005329 Bacteria 21438
42 Ga0070683_100013428 3300005329 Bacteria 7143
43 Ga0070683_100032958 3300005329 Bacteria 4721
44 Ga0070683_100034891 3300005329 Bacteria 4598
45 Ga0070690_100033253 3300005330 Bacteria 3226
46 Ga0070670_100084892 3300005331 Bacteria 2720
47 Ga0070670_100132312 3300005331 Bacteria 2154
48 Ga0070666_10115908 3300005335 Bacteria 1855
49 Ga0070682_100000608 3300005337 Bacteria 21759
50 Ga0070682_100038141 3300005337 Bacteria 2945
51 Ga0068868_100019452 3300005338 Bacteria 5088
52 Ga0070660_100051141 3300005339 Bacteria 3181
53 Ga0070689_100035150 3300005340 Bacteria 3827
54 Ga0070689_100036095 3300005340 Bacteria 3780
55 Ga0070687_100005339 3300005343 Bacteria 5196
56 Ga0070661_100001276 3300005344 Bacteria 17703
57 Ga0070668_100054943 3300005347 Bacteria 3073
58 Ga0070669_100000002 3300005353 Bacteria 506497
59 Ga0070669_100021945 3300005353 Bacteria 4565
60 Ga0070675_100080968 3300005354 Bacteria 2707
61 Ga0070671_100020237 3300005355 Bacteria 5425
62 Ga0070674_100000075 3300005356 Bacteria 45822
63 Ga0070674_100024912 3300005356 Bacteria 3887
64 Ga0070674_100059418 3300005356 Bacteria 2661
65 Ga0070688_100072385 3300005365 Bacteria 2209
66 Ga0070659_100002179 3300005366 Bacteria 13945
67 Ga0070659_100110036 3300005366 Bacteria 2224
68 Ga0070667_100127410 3300005367 Bacteria 2219
69 Ga0070714_100001328 3300005435 Bacteria 17855
70 Ga0070713_100033721 3300005436 Bacteria 4105
71 Ga0070700_100012722 3300005441 Bacteria 4708
72 Ga0070700_100047855 3300005441 Bacteria 2648
73 Ga0070708_100013120 3300005445 Bacteria 6779
74 Ga0070708_100083628 3300005445 Bacteria 2894
75 Ga0070708_100103496 3300005445 Bacteria 2610
76 Ga0070663_100142610 3300005455 Bacteria 1830
77 Ga0070662_100033559 3300005457 Bacteria 3615
78 Ga0070662_100052580 3300005457 Bacteria 2945
79 Ga0070662_100077482 3300005457 Bacteria 2467
80 Ga0070681_10010965 3300005458 Bacteria 8963
81 Ga0068867_100169349 3300005459 Bacteria 1729
82 Ga0070706_100002511 3300005467 Bacteria 18474
83 Ga0070706_100011228 3300005467 Bacteria 8318
84 Ga0070706_100025573 3300005467 Bacteria 5434
85 Ga0070707_100009163 3300005468 Bacteria 9183
86 Ga0070698_100007507 3300005471 Bacteria 11798
87 Ga0070698_100083291 3300005471 Bacteria 3188
88 Ga0070679_100008498 3300005530 Bacteria 9673
89 Ga0070679_100032747 3300005530 Bacteria 5144
90 Ga0070679_100096336 3300005530 Bacteria 2946
91 Ga0070684_100017640 3300005535 Bacteria 5864
92 Ga0068853_100000021 3300005539 Bacteria 149283
93 Ga0068853_100015247 3300005539 Bacteria 6317
94 Ga0068853_100094885 3300005539 Bacteria 2629
95 Ga0070686_100030529 3300005544 Bacteria 3288
96 Ga0070696_100035528 3300005546 Bacteria 3433
97 Ga0070665_100005374 3300005548 Bacteria 13227
98 Ga0070704_100006379 3300005549 Bacteria 6953
99 Ga0068855_100003678 3300005563 Bacteria 18757
100 Ga0068855_100012820 3300005563 Bacteria 10113
101 Ga0068854_100000075 3300005578 Bacteria 71042
102 Ga0070702_100013695 3300005615 Bacteria 4101
103 Ga0068852_100041861 3300005616 Bacteria 3875
104 Ga0068866_10000469 3300005718 Bacteria 18473
105 Ga0068866_10019822 3300005718 Bacteria 3070
106 Ga0068861_100009161 3300005719 Bacteria 6826
107 Ga0068851_10061200 3300005834 Bacteria 1929
108 Ga0068870_10003915 3300005840 Bacteria 6354
109 Ga0068863_100212510 3300005841 Bacteria 1863
110 Ga0068858_100095987 3300005842 Bacteria 2762
111 Ga0068858_100123830 3300005842 Bacteria 2419
112 Ga0068860_100002743 3300005843 Bacteria 18327
113 Ga0068860_100112638 3300005843 Bacteria 2601
114 Ga0068862_100000833 3300005844 Bacteria 30475
115 Ga0068862_100016419 3300005844 Bacteria 6161
116 Ga0081538_10000086 3300005981 Bacteria 89701
117 Ga0081538_10005107 3300005981 Bacteria 11920
118 Ga0081538_10056630 3300005981 Bacteria 2294
119 Ga0081539_10001052 3300005985 Bacteria 50554
120 Ga0070717_10000138 3300006028 Bacteria 54320
121 Ga0070717_10187262 3300006028 Bacteria 1807
122 Ga0075365_10003408 3300006038 Bacteria 8180
123 Ga0068871_100078589 3300006358 Bacteria 2728
124 Ga0075428_100005570 3300006844 Bacteria 13994
125 Ga0075430_100009725 3300006846 Bacteria 8128
126 Ga0075431_100002603 3300006847 Bacteria 17447
127 Ga0075431_100017090 3300006847 Bacteria 7370
128 Ga0075431_100067431 3300006847 Bacteria 3693
129 Ga0075431_100122062 3300006847 Bacteria 2688
130 Ga0075433_10049441 3300006852 Bacteria 3658
131 Ga0075434_100001516 3300006871 Bacteria 19638
132 Ga0075435_100097095 3300007076 Bacteria 2438
133 Ga0105244_10008170 3300009036 Bacteria 6562
134 Ga0105240_10003871 3300009093 Bacteria 23106
135 Ga0105240_10039372 3300009093 Bacteria 6054
136 Ga0105240_10039928 3300009093 Bacteria 6007
137 Ga0105240_10055880 3300009093 Bacteria 4941
138 Ga0111539_10002412 3300009094 Bacteria 24866
139 Ga0111539_10022661 3300009094 Bacteria 7715
140 Ga0111539_10043978 3300009094 Bacteria 5352
141 Ga0111539_10091770 3300009094 Bacteria 3568
142 Ga0105245_10223916 3300009098 Bacteria 1816
143 Ga0114129_10000276 3300009147 Bacteria 58586
144 Ga0114129_10004035 3300009147 Bacteria 20726
145 Ga0114129_10037872 3300009147 Bacteria 6805
146 Ga0114129_10060493 3300009147 Bacteria 5296
147 Ga0114129_10192762 3300009147 Bacteria 2766
148 Ga0105243_10083102 3300009148 Bacteria 2619
149 Ga0105242_10013245 3300009176 Bacteria 6366
150 Ga0105242_10024217 3300009176 Bacteria 4792
151 Ga0105242_10121218 3300009176 Bacteria 2245
152 Ga0105248_10061547 3300009177 Bacteria 4215
153 Ga0105248_10302373 3300009177 Bacteria 1801
154 Ga0105238_10051950 3300009551 Bacteria 4121
155 Ga0105249_10023904 3300009553 Bacteria 5489
156 Ga0105249_10094420 3300009553 Bacteria 2803
157 Ga0105249_10145546 3300009553 Bacteria 2276
158 Ga0105249_10172446 3300009553 Bacteria 2099
159 Ga0157370_10025270 3300013104 Bacteria 5879
160 Ga0157370_10025427 3300013104 Bacteria 5860
161 Ga0157370_10030691 3300013104 Bacteria 5265
162 Ga0157370_10090329 3300013104 Bacteria 2876
163 Ga0157369_10008375 3300013105 Bacteria 11859
164 Ga0157369_10009230 3300013105 Bacteria 11282
165 Ga0157369_10056938 3300013105 Bacteria 4218
166 Ga0157369_10085370 3300013105 Bacteria 3373
167 Ga0157374_10005308 3300013296 Bacteria 10822
168 Ga0157374_10128532 3300013296 Bacteria 2450
169 Ga0163162_10000370 3300013306 Bacteria 40835
170 Ga0157372_10006882 3300013307 Bacteria 12097
171 Ga0157372_10008860 3300013307 Bacteria 10687
172 Ga0157372_10041737 3300013307 Bacteria 5072
173 Ga0157375_10001252 3300013308 Bacteria 21985
174 Ga0157375_10050708 3300013308 Bacteria 4072
175 Ga0157380_10079004 3300014326 Bacteria 2686
176 Ga0157379_10038997 3300014968 Bacteria 4238
177 Ga0182006_1000169 3300015261 Bacteria 68993
178 Ga0182005_1000003 3300015265 Bacteria 683269
179 Ga0213872_10000622 3300021361 Bacteria 26830
180 Ga0213872_10001135 3300021361 Bacteria 18210
181 Ga0213872_10009107 3300021361 Bacteria 4771
182 Ga0213872_10038615 3300021361 Bacteria 2179
183 Ga0213872_10040523 3300021361 Bacteria 2126
184 Ga0209436_100529 3300025208 Bacteria 16608
185 Ga0209436_102729 3300025208 Bacteria 5085
186 Ga0209436_111418 3300025208 Bacteria 1562
187 Ga0207425_1000013 3300025245 Bacteria 497384
188 Ga0207425_1001817 3300025245 Bacteria 8267
189 Ga0207425_1002536 3300025245 Bacteria 6369
190 Ga0209646_1000126 3300025246 Bacteria 132815
191 Ga0209129_1000106 3300025258 Bacteria 156102
192 Ga0209129_1006180 3300025258 Bacteria 3971
193 Ga0209565_1000035 3300025263 Bacteria 298125
194 Ga0209565_1001529 3300025263 Bacteria 9962
195 Ga0209565_1015177 3300025263 Bacteria 1743
196 Ga0209565_1017862 3300025263 Bacteria 1546
197 Ga0209455_1000033 3300025272 Bacteria 504606
198 Ga0209455_1004973 3300025272 Bacteria 4214
199 Ga0209673_1000006 3300025273 Bacteria 650600
200 Ga0209130_1001743 3300025284 Bacteria 12967
201 Ga0209130_1002565 3300025284 Bacteria 8862
202 Ga0209130_1004648 3300025284 Bacteria 5101
203 Ga0209675_1000005 3300025291 Bacteria 849192
204 Ga0209675_1001499 3300025291 Bacteria 13390
205 Ga0209675_1013774 3300025291 Bacteria 2505
206 Ga0209025_1001104 3300025294 Bacteria 38839
207 Ga0209564_1000028 3300025295 Bacteria 510986
208 Ga0209564_1000032 3300025295 Bacteria 464041
209 Ga0209564_1000083 3300025295 Bacteria 259272
210 Ga0209564_1000088 3300025295 Bacteria 250268
211 Ga0209564_1002997 3300025295 Bacteria 12123
212 Ga0209758_1000031 3300025297 Bacteria 497252
213 Ga0209758_1000343 3300025297 Bacteria 85198
214 Ga0209050_1000078 3300025298 Bacteria 278409
215 Ga0209050_1003291 3300025298 Bacteria 12126
216 Ga0209256_1000035 3300025299 Bacteria 386754
217 Ga0209256_1000141 3300025299 Bacteria 152280
218 Ga0209256_1000305 3300025299 Bacteria 85970
219 Ga0209256_1000712 3300025299 Bacteria 44167
220 Ga0209256_1006321 3300025299 Bacteria 6337
221 Ga0207426_1002410 3300025302 Bacteria 12021
222 Ga0207426_1011253 3300025302 Bacteria 3422
223 Ga0209051_1010576 3300025303 Bacteria 4640
224 Ga0209257_1000097 3300025304 Bacteria 259243
225 Ga0207697_10011578 3300025315 Bacteria 3727
226 Ga0207642_10000181 3300025899 Bacteria 18196
227 Ga0207680_10079907 3300025903 Bacteria 2052
228 Ga0207643_10001923 3300025908 Bacteria 11475
229 Ga0207643_10011795 3300025908 Bacteria 4717
230 Ga0207705_10000064 3300025909 Bacteria 141200
231 Ga0207705_10000465 3300025909 Bacteria 34700
232 Ga0207705_10003727 3300025909 Bacteria 11601
233 Ga0207705_10006639 3300025909 Bacteria 8562
234 Ga0207705_10032829 3300025909 Bacteria 3709
235 Ga0207684_10002504 3300025910 Bacteria 18488
236 Ga0207684_10028522 3300025910 Bacteria 4756
237 Ga0207684_10056818 3300025910 Bacteria 3321
238 Ga0207684_10094319 3300025910 Bacteria 2553
239 Ga0207695_10000001 3300025913 Bacteria 2888630
240 Ga0207695_10007257 3300025913 Bacteria 14150
241 Ga0207662_10008062 3300025918 Bacteria 5749
242 Ga0207657_10002434 3300025919 Bacteria 20096
243 Ga0207657_10039626 3300025919 Bacteria 4185
244 Ga0207652_10022861 3300025921 Bacteria 5179
245 Ga0207652_10028868 3300025921 Bacteria 4631
246 Ga0207652_10084328 3300025921 Bacteria 2783
247 Ga0207646_10005544 3300025922 Bacteria 13258
248 Ga0207646_10032394 3300025922 Bacteria 4731
249 Ga0207646_10135794 3300025922 Bacteria 2214
250 Ga0207681_10000107 3300025923 Bacteria 71564
251 Ga0207694_10018192 3300025924 Bacteria 5313
252 Ga0207650_10060600 3300025925 Bacteria 2824
253 Ga0207659_10047183 3300025926 Bacteria 3046
254 Ga0207687_10124167 3300025927 Bacteria 1935
255 Ga0207664_10005822 3300025929 Bacteria 8430
256 Ga0207690_10003564 3300025932 Bacteria 9262
257 Ga0207706_10000581 3300025933 Bacteria 38892
258 Ga0207706_10112979 3300025933 Bacteria 2389
259 Ga0207686_10003047 3300025934 Bacteria 9019
260 Ga0207709_10016051 3300025935 Bacteria 4157
261 Ga0207670_10019700 3300025936 Bacteria 4127
262 Ga0207669_10000091 3300025937 Bacteria 45833
263 Ga0207704_10026523 3300025938 Bacteria 3181
264 Ga0207691_10000582 3300025940 Bacteria 36439
265 Ga0207711_10082800 3300025941 Bacteria 2805
266 Ga0207661_10017562 3300025944 Bacteria 5298
267 Ga0207661_10023193 3300025944 Bacteria 4687
268 Ga0207661_10085871 3300025944 Bacteria 2610
269 Ga0207667_10000389 3300025949 Bacteria 59220
270 Ga0207667_10051556 3300025949 Bacteria 4338
271 Ga0207667_10073217 3300025949 Bacteria 3560
272 Ga0207712_10042215 3300025961 Bacteria 3139
273 Ga0207712_10089446 3300025961 Bacteria 2263
274 Ga0207640_10000034 3300025981 Bacteria 112705
275 Ga0207658_10041586 3300025986 Bacteria 3329
276 Ga0207677_10000002 3300026023 Bacteria 478921
277 Ga0207703_10030078 3300026035 Bacteria 4290
278 Ga0207703_10164122 3300026035 Bacteria 1947
279 Ga0207639_10000035 3300026041 Bacteria 149309
280 Ga0207639_10014785 3300026041 Bacteria 5497
281 Ga0207678_10002725 3300026067 Bacteria 16015
282 Ga0207678_10011837 3300026067 Bacteria 7661
283 Ga0207678_10040299 3300026067 Bacteria 4052
284 Ga0207678_10203023 3300026067 Bacteria 1695
285 Ga0207708_10009516 3300026075 Bacteria 7203
286 Ga0207708_10016949 3300026075 Bacteria 5485
287 Ga0207641_10042901 3300026088 Bacteria 3797
288 Ga0207641_10046278 3300026088 Bacteria 3666
289 Ga0207641_10102067 3300026088 Bacteria 2528
290 Ga0207648_10002956 3300026089 Bacteria 17970
291 Ga0207648_10162535 3300026089 Bacteria 1972
292 Ga0207676_10000889 3300026095 Bacteria 23205
293 Ga0207676_10074414 3300026095 Bacteria 2736
294 Ga0207674_10002393 3300026116 Bacteria 23705
295 Ga0207675_100000780 3300026118 Bacteria 31801
296 Ga0207675_100022135 3300026118 Bacteria 5917
297 Ga0207675_100038441 3300026118 Bacteria 4466
298 Ga0207683_10012979 3300026121 Bacteria 7113
299 Ga0207683_10016839 3300026121 Bacteria 6219
300 Ga0207683_10125124 3300026121 Bacteria 2310
301 Ga0207698_10016019 3300026142 Bacteria 5042
302 Ga0207698_10062888 3300026142 Bacteria 2901
303 Ga0209970_1002556 3300027614 Bacteria 3081
304 Ga0210002_1000808 3300027617 Bacteria 4278
305 Ga0209282_1000003 3300027666 Bacteria 856377
306 Ga0209971_1000112 3300027682 Bacteria 23513
307 Ga0209998_10000764 3300027717 Bacteria 8414
308 Ga0209974_10000147 3300027876 Bacteria 21336
309 Ga0207428_10120500 3300027907 Bacteria 2012
310 Ga0268266_10002274 3300028379 Bacteria 20865
311 Ga0268266_10007538 3300028379 Bacteria 9800
312 Ga0268266_10014702 3300028379 Bacteria 6723
313 Ga0268265_10000564 3300028380 Bacteria 37658
314 Ga0268265_10005212 3300028380 Bacteria 8904
315 Ga0268264_10001953 3300028381 Bacteria 18519
316 Ga0268264_10092666 3300028381 Bacteria 2608
317 Ga0265332_10029155 3300031238 Bacteria 2414
318 Ga0265328_10018909 3300031239 Bacteria 2651
319 Ga0265320_10003087 3300031240 Bacteria 11303
320 Ga0265331_10000881 3300031250 Bacteria 24365
321 Ga0265316_10048332 3300031344 Bacteria 3359
322 Ga0307408_100001264 3300031548 Bacteria 18976
323 Ga0307408_100002135 3300031548 Bacteria 14188
324 Ga0307408_100002206 3300031548 Bacteria 13910
325 Ga0307408_100067452 3300031548 Bacteria 2631
326 Ga0265313_10006240 3300031595 Bacteria 8508
327 Ga0316579_10007937 3300031691 Bacteria 4403
328 Ga0265314_10000550 3300031711 Bacteria 47939
329 Ga0265314_10026842 3300031711 Bacteria 4321
330 Ga0265342_10008167 3300031712 Bacteria 7549
331 Ga0307406_10001008 3300031901 Bacteria 15659
332 Ga0307412_10000241 3300031911 Bacteria 35462
333 Ga0307409_100000481 3300031995 Bacteria 17077
334 Ga0307409_100128839 3300031995 Bacteria 2158
335 Ga0307416_100054328 3300032002 Bacteria 3219
336 Ga0307416_100271114 3300032002 Bacteria 1666
337 Ga0307414_10024771 3300032004 Bacteria 3832
338 Ga0307510_10168753 3300033180 Bacteria 1771
339 Ga0373929_0000013 3300035085 Bacteria 159542
340 Ga0373952_0002488 3300035092 Bacteria 3321
341 Ga0373947_0089793 3300035725 Bacteria 1914
342 Ga0373937_0068742 3300036401 Bacteria 3266
343 Ga0316582_0036835 3300036647 Bacteria 3029
344 Ga0395899_0048812 3300037312 Bacteria 3148
345 Ga0395900_0044881 3300037418 Bacteria 4552
346 Ga0395898_0004764 3300037466 Bacteria 14768
347 Ga0395905_0028155 3300037471 Bacteria 5296
348 Ga0436364_0602549 3300037853 Bacteria 2379
349 Ga0395901_0192665 3300038443 Bacteria 2138
350 Ga0436361_0059946 3300039447 Bacteria 2220
351 Ga0436361_0063197 3300039447 Bacteria 3198
352 Ga0436361_0174205 3300039447 Bacteria 2449
353 Ga0436361_0182321 3300039447 Bacteria 1886
354 Ga0436361_0596240 3300039447 Bacteria 18495
355 Ga0436361_0615119 3300039447 Bacteria 3218
356 Ga0436361_0701338 3300039447 Bacteria 18562
357 Ga0439465_0000032 3300041413 Bacteria 28481
358 Ga0451577_0000260 3300042876 Bacteria 104156
359 Ga0466972_0047778 3300044658 Bacteria 2069
360 Ga0453683_0011657 3300044673 Bacteria 5789
361 Ga0453683_0113318 3300044673 Bacteria 1706
362 Ga0466961_0001658 3300044693 Bacteria 13844
363 Ga0466961_0034721 3300044693 Bacteria 3238
364 Ga0453684_0000836 3300044712 Bacteria 103922
365 Ga0453684_0000861 3300044712 Bacteria 102147
366 Ga0453684_0001278 3300044712 Bacteria 75250
367 Ga0453684_0014990 3300044712 Bacteria 12309
368 Ga0453684_0020326 3300044712 Bacteria 10024
369 Ga0453684_0027978 3300044712 Bacteria 8062
370 Ga0453684_0043398 3300044712 Bacteria 6043
371 Ga0453684_0052242 3300044712 Bacteria 5346
372 Ga0453684_0163272 3300044712 Bacteria 2632
373 Ga0466957_0038741 3300044842 Bacteria 2873
374 Ga0466960_0000095 3300044901 Bacteria 28923
375 Ga0466960_0053673 3300044901 Bacteria 1954
376 Ga0451576_0003537 3300045051 Bacteria 21306
377 Ga0451576_0047684 3300045051 Bacteria 4503
378 Ga0466958_0056836 3300045836 Bacteria 2378
379 Ga0466967_0013799 3300045976 Bacteria 6262
380 Ga0466967_0105989 3300045976 Bacteria 2576
381 Ga0495617_000011 3300046452 Bacteria 301936
382 Ga0495617_000014 3300046452 Bacteria 286979
383 Ga0495617_000515 3300046452 Bacteria 20231
384 Ga0495627_000016 3300046453 Bacteria 318947
385 Ga0495627_000763 3300046453 Bacteria 23901
386 Ga0495627_004487 3300046453 Bacteria 5835
387 Ga0495627_019607 3300046453 Bacteria 2265
388 Ga0495592_0000424 3300046454 Bacteria 32002
389 Ga0495603_0081010 3300046455 Bacteria 1902
390 Ga0495590_0000058 3300046457 Bacteria 93362
391 Ga0495591_000132 3300046458 Bacteria 81947
392 Ga0495591_018407 3300046458 Bacteria 2370
393 Ga0495629_0004226 3300046459 Bacteria 10774
394 Ga0495629_0015670 3300046459 Bacteria 5443
395 Ga0495638_0000627 3300046460 Bacteria 39046
396 Ga0495638_0003837 3300046460 Bacteria 11669
397 Ga0495638_0007268 3300046460 Bacteria 7962
398 Ga0495653_0000014 3300046463 Bacteria 215253
399 Ga0495653_0012633 3300046463 Bacteria 6896
400 Ga0495650_0000053 3300046471 Bacteria 316684
401 Ga0495650_0000071 3300046471 Bacteria 258374
402 Ga0495650_0000146 3300046471 Bacteria 163598
403 Ga0495650_0000334 3300046471 Bacteria 84144
404 Ga0495650_0000460 3300046471 Bacteria 63424
405 Ga0495650_0000463 3300046471 Bacteria 63012
406 Ga0495650_0001265 3300046471 Bacteria 26082
407 Ga0495650_0002431 3300046471 Bacteria 15100
408 Ga0495650_0002556 3300046471 Bacteria 14449
409 Ga0495650_0008243 3300046471 Bacteria 6117
410 Ga0495650_0019882 3300046471 Bacteria 3289
411 Ga0495580_0050636 3300046472 Bacteria 2936
412 Ga0495605_0000010 3300046474 Bacteria 319487
413 Ga0495605_0000538 3300046474 Bacteria 31464
414 Ga0495605_0017639 3300046474 Bacteria 3839
415 Ga0495605_0026450 3300046474 Bacteria 3017
416 Ga0495605_0042993 3300046474 Bacteria 2243
417 Ga0495639_0024293 3300046475 Bacteria 2668
418 Ga0495662_0018132 3300046476 Bacteria 3405
419 Ga0495664_0001675 3300046477 Bacteria 11778
420 Ga0495584_0000883 3300046491 Bacteria 19287
421 Ga0495584_0001234 3300046491 Bacteria 15595
422 Ga0495584_0001667 3300046491 Bacteria 13051
423 Ga0495584_0006181 3300046491 Bacteria 6292
424 Ga0495584_0006407 3300046491 Bacteria 6163
425 Ga0495584_0009117 3300046491 Bacteria 5124
426 Ga0495585_0000022 3300046492 Bacteria 153475
427 Ga0495585_0000113 3300046492 Bacteria 86842
428 Ga0495585_0001317 3300046492 Bacteria 19761
429 Ga0495585_0003678 3300046492 Bacteria 10254
430 Ga0495585_0005593 3300046492 Bacteria 7897
431 Ga0495585_0009685 3300046492 Bacteria 5769
432 Ga0495585_0024365 3300046492 Bacteria 3469
433 Ga0495585_0052816 3300046492 Bacteria 2249
434 Ga0495585_0089020 3300046492 Bacteria 1664
435 Ga0495594_0000001 3300046499 Bacteria 293051
436 Ga0495594_0002777 3300046499 Bacteria 9083
437 Ga0495594_0006383 3300046499 Bacteria 6066
438 Ga0495594_0010755 3300046499 Bacteria 4749
439 Ga0495594_0023607 3300046499 Bacteria 3297
440 Ga0495594_0042044 3300046499 Bacteria 2502
441 Ga0495596_0001100 3300046500 Bacteria 15989
442 Ga0495596_0002530 3300046500 Bacteria 9789
443 Ga0495596_0005078 3300046500 Bacteria 6277
444 Ga0495596_0016441 3300046500 Bacteria 3073
445 Ga0495596_0018066 3300046500 Bacteria 2910
446 Ga0495607_0002162 3300046501 Bacteria 16375
447 Ga0495607_0005885 3300046501 Bacteria 8708
448 Ga0495607_0021315 3300046501 Bacteria 4079
449 Ga0495607_0025322 3300046501 Bacteria 3692
450 Ga0495607_0043095 3300046501 Bacteria 2671
451 Ga0495607_0050374 3300046501 Bacteria 2424
452 Ga0495607_0056529 3300046501 Bacteria 2252
453 Ga0495583_0000102 3300046506 Bacteria 143105
454 Ga0495583_0000116 3300046506 Bacteria 135355
455 Ga0495583_0000183 3300046506 Bacteria 106663
456 Ga0495583_0000346 3300046506 Bacteria 73089
457 Ga0495583_0001913 3300046506 Bacteria 19244
458 Ga0495583_0005154 3300046506 Bacteria 8999
459 Ga0495606_0000004 3300046507 Bacteria 406209
460 Ga0495606_0003214 3300046507 Bacteria 17599
461 Ga0495606_0006492 3300046507 Bacteria 10760
462 Ga0495606_0027391 3300046507 Bacteria 4042
463 Ga0495606_0072411 3300046507 Bacteria 2165
464 Ga0495610_0000007 3300046512 Bacteria 820919
465 Ga0495610_0003047 3300046512 Bacteria 13412
466 Ga0495610_0006005 3300046512 Bacteria 8483
467 Ga0495610_0021828 3300046512 Bacteria 3513
468 Ga0495610_0032257 3300046512 Bacteria 2724
469 Ga0495616_0000886 3300046513 Bacteria 21668
470 Ga0495616_0001063 3300046513 Bacteria 19605
471 Ga0495616_0004707 3300046513 Bacteria 8549
472 Ga0495616_0005161 3300046513 Bacteria 8097
473 Ga0495616_0013981 3300046513 Bacteria 4510
474 Ga0495616_0033232 3300046513 Bacteria 2689
475 Ga0495616_0033430 3300046513 Bacteria 2679
476 Ga0495616_0040695 3300046513 Bacteria 2373
477 Ga0495616_0075186 3300046513 Bacteria 1626
478 Ga0495618_0000037 3300046514 Bacteria 99735
479 Ga0495628_0078600 3300046516 Bacteria 2566
480 Ga0495630_0000991 3300046517 Bacteria 19745
481 Ga0495630_0045119 3300046517 Bacteria 3293
482 Ga0495630_0057496 3300046517 Bacteria 2915
483 Ga0495631_0003968 3300046518 Bacteria 7987
484 Ga0495631_0015171 3300046518 Bacteria 3700
485 Ga0495631_0020337 3300046518 Bacteria 3102
486 Ga0495631_0059754 3300046518 Bacteria 1655
487 Ga0495632_0000264 3300046519 Bacteria 52194
488 Ga0495632_0001647 3300046519 Bacteria 18288
489 Ga0495632_0003427 3300046519 Bacteria 11265
490 Ga0495632_0007170 3300046519 Bacteria 7047
491 Ga0495632_0020470 3300046519 Bacteria 3581
492 Ga0495632_0025914 3300046519 Bacteria 3094
493 Ga0495637_0000028 3300046520 Bacteria 144203
494 Ga0495637_0049662 3300046520 Bacteria 1761
495 Ga0495643_0001511 3300046522 Bacteria 21024
496 Ga0495643_0001967 3300046522 Bacteria 17235
497 Ga0495643_0001996 3300046522 Bacteria 17039
498 Ga0495643_0009285 3300046522 Bacteria 6124
499 Ga0495643_0012521 3300046522 Bacteria 5114
500 Ga0495643_0018085 3300046522 Bacteria 4104
501 Ga0495643_0022240 3300046522 Bacteria 3621
502 Ga0495643_0062760 3300046522 Bacteria 1966
503 Ga0495644_0000227 3300046523 Bacteria 26614
504 Ga0495644_0000816 3300046523 Bacteria 12821
505 Ga0495644_0002483 3300046523 Bacteria 7353
506 Ga0495644_0016166 3300046523 Bacteria 2858
507 Ga0495648_0000004 3300046524 Bacteria 373639
508 Ga0495648_0000959 3300046524 Bacteria 29756
509 Ga0495648_0002004 3300046524 Bacteria 19288
510 Ga0495648_0004787 3300046524 Bacteria 11444
511 Ga0495648_0005916 3300046524 Bacteria 10066
512 Ga0495648_0021974 3300046524 Bacteria 4404
513 Ga0495648_0028330 3300046524 Bacteria 3733
514 Ga0495648_0044367 3300046524 Bacteria 2776
515 Ga0495663_0004004 3300046525 Bacteria 4184
516 Ga0495666_0009729 3300046526 Bacteria 4804
517 Ga0495642_0000192 3300046528 Bacteria 36285
518 Ga0495642_0001389 3300046528 Bacteria 10833
519 Ga0495642_0003344 3300046528 Bacteria 6335
520 Ga0495642_0004047 3300046528 Bacteria 5721
521 Ga0495642_0020605 3300046528 Bacteria 2591
522 Ga0495642_0029962 3300046528 Bacteria 2175
523 Ga0495652_0072445 3300046529 Bacteria 2872
524 Ga0495652_0101639 3300046529 Bacteria 2330
525 Ga0495654_0000034 3300046530 Bacteria 196519
526 Ga0495654_0003671 3300046530 Bacteria 9315
527 Ga0495654_0008297 3300046530 Bacteria 5746
528 Ga0495665_0017370 3300046531 Bacteria 3870
529 Ga0495665_0062538 3300046531 Bacteria 1965
530 Ga0495640_0001641 3300046533 Bacteria 17695
531 Ga0495640_0003678 3300046533 Bacteria 12324
532 Ga0495586_0032273 3300046535 Bacteria 2807
533 Ga0495586_0065506 3300046535 Bacteria 1980
534 Ga0495587_0012562 3300046536 Bacteria 5325
535 Ga0495587_0034917 3300046536 Bacteria 3031
536 Ga0495609_0000637 3300046538 Bacteria 27304
537 Ga0495609_0001435 3300046538 Bacteria 15872
538 Ga0495609_0002279 3300046538 Bacteria 11960
539 Ga0495609_0003851 3300046538 Bacteria 8438
540 Ga0495609_0010356 3300046538 Bacteria 4475
541 Ga0495609_0014619 3300046538 Bacteria 3686
542 Ga0495609_0019238 3300046538 Bacteria 3162
543 Ga0495609_0022949 3300046538 Bacteria 2872
544 Ga0495597_0001037 3300046542 Bacteria 21229
545 Ga0495597_0003215 3300046542 Bacteria 9720
546 Ga0495597_0007545 3300046542 Bacteria 5515
547 Ga0495597_0015409 3300046542 Bacteria 3620
548 Ga0495597_0022301 3300046542 Bacteria 2937
549 Ga0495597_0053026 3300046542 Bacteria 1784
550 Ga0495645_0011816 3300046543 Bacteria 6152
551 Ga0495645_0122311 3300046543 Bacteria 1831
552 Ga0495622_0000090 3300046557 Bacteria 81752
553 Ga0495622_0000431 3300046557 Bacteria 27552
554 Ga0495622_0007772 3300046557 Bacteria 4980
555 Ga0495633_0000068 3300046558 Bacteria 136733
556 Ga0495633_0000094 3300046558 Bacteria 120459
557 Ga0495633_0001323 3300046558 Bacteria 19469
558 Ga0495633_0002607 3300046558 Bacteria 12618
559 Ga0495633_0005634 3300046558 Bacteria 7592
560 Ga0495633_0012968 3300046558 Bacteria 4409
561 Ga0495633_0015673 3300046558 Bacteria 3928
562 Ga0495633_0016756 3300046558 Bacteria 3768
563 Ga0495633_0019961 3300046558 Bacteria 3379
564 Ga0495633_0020466 3300046558 Bacteria 3328
565 Ga0495633_0028646 3300046558 Bacteria 2712
566 Ga0495633_0049565 3300046558 Bacteria 1981
567 Ga0495633_0064098 3300046558 Bacteria 1718
568 Ga0495656_0003394 3300046615 Bacteria 5387
569 Ga0495656_0020201 3300046615 Bacteria 2581
570 Ga0495656_0026412 3300046615 Bacteria 2311
571 Ga0495668_0000136 3300046616 Bacteria 111262
572 Ga0495668_0000714 3300046616 Bacteria 40056
573 Ga0495668_0001987 3300046616 Bacteria 17898
574 Ga0495668_0005938 3300046616 Bacteria 8109
575 Ga0495668_0007992 3300046616 Bacteria 6666
576 Ga0495668_0012545 3300046616 Bacteria 5026
577 Ga0495668_0027644 3300046616 Bacteria 3214
578 Ga0495668_0058272 3300046616 Bacteria 2131
579 Ga0495634_0003581 3300046642 Bacteria 12418
580 Ga0495634_0035273 3300046642 Bacteria 3427
581 Ga0495634_0039116 3300046642 Bacteria 3231
582 Ga0495611_0001165 3300046648 Bacteria 13719
583 Ga0495611_0002506 3300046648 Bacteria 8358
584 Ga0495611_0003911 3300046648 Bacteria 6486
585 Ga0495611_0039831 3300046648 Bacteria 2093
586 Ga0495625_0000046 3300046660 Bacteria 202299
587 Ga0495625_0000096 3300046660 Bacteria 142609
588 Ga0495625_0000109 3300046660 Bacteria 125064
589 Ga0495625_0000257 3300046660 Bacteria 82608
590 Ga0495625_0002385 3300046660 Bacteria 20412
591 Ga0495625_0007669 3300046660 Bacteria 9355
592 Ga0495625_0009636 3300046660 Bacteria 8053
593 Ga0495625_0016122 3300046660 Bacteria 5887
594 Ga0495625_0031109 3300046660 Bacteria 3973
595 Ga0495625_0031228 3300046660 Bacteria 3964
596 Ga0495625_0044535 3300046660 Bacteria 3212
597 Ga0495625_0113768 3300046660 Bacteria 1847
598 Ga0495635_0003838 3300046663 Bacteria 10439
599 Ga0495659_0000025 3300046664 Bacteria 69322
600 Ga0495659_0002583 3300046664 Bacteria 5838
601 Ga0495659_0005015 3300046664 Bacteria 4163
602 Ga0495661_0001306 3300046665 Bacteria 21236
603 Ga0495661_0012446 3300046665 Bacteria 5743
604 Ga0495661_0012907 3300046665 Bacteria 5628
605 Ga0495661_0020929 3300046665 Bacteria 4266
606 Ga0495661_0037594 3300046665 Bacteria 3021
607 Ga0495661_0065189 3300046665 Bacteria 2146
608 Ga0495661_0098897 3300046665 Bacteria 1646
609 Ga0495661_0104381 3300046665 Bacteria 1589
610 Ga0495588_0000050 3300046674 Bacteria 335314
611 Ga0495657_0003478 3300046675 Bacteria 12843
612 Ga0495599_0118315 3300046678 Bacteria 1648
613 Ga0495623_0011122 3300046679 Bacteria 5825
614 Ga0495623_0075853 3300046679 Bacteria 2087
615 Ga0495646_0021012 3300046680 Bacteria 4127
616 Ga0495646_0062057 3300046680 Bacteria 2223
617 Ga0495647_0000002 3300046681 Bacteria 174959
618 Ga0495647_0002786 3300046681 Bacteria 5539
619 Ga0495669_0000095 3300046684 Bacteria 57161
620 Ga0495669_0002966 3300046684 Bacteria 6970
621 Ga0495669_0003029 3300046684 Bacteria 6909
622 Ga0495669_0011001 3300046684 Bacteria 3831
623 Ga0495669_0011379 3300046684 Bacteria 3777
624 Ga0495669_0013473 3300046684 Bacteria 3484
625 Ga0495669_0034632 3300046684 Bacteria 2226
626 Ga0495613_0000190 3300046689 Bacteria 60696
627 Ga0495613_0021326 3300046689 Bacteria 4832
628 Ga0495613_0040265 3300046689 Bacteria 3463
629 Ga0495613_0041728 3300046689 Bacteria 3397
630 Ga0495613_0097478 3300046689 Bacteria 2125
631 Ga0495613_0130855 3300046689 Bacteria 1797
632 Ga0495624_0005313 3300046690 Bacteria 9303
633 Ga0495624_0051197 3300046690 Bacteria 2614
634 Ga0495670_0001130 3300046691 Bacteria 12953
635 Ga0495670_0004297 3300046691 Bacteria 6976
636 Ga0495670_0036782 3300046691 Bacteria 2439
637 Ga0495670_0055260 3300046691 Bacteria 1990
638 Ga0495671_0000033 3300046692 Bacteria 197509
639 Ga0495671_0000701 3300046692 Bacteria 24303
640 Ga0495671_0000718 3300046692 Bacteria 23936
641 Ga0495671_0003539 3300046692 Bacteria 9547
642 Ga0495649_0000648 3300046694 Bacteria 28291
643 Ga0495649_0003498 3300046694 Bacteria 10572
644 Ga0495649_0007907 3300046694 Bacteria 6434
645 Ga0495589_0023884 3300046794 Bacteria 3110
646 Ga0495589_0025252 3300046794 Bacteria 3016
647 Ga0495589_0072146 3300046794 Bacteria 1686
648 Ga0495600_0119861 3300046809 Bacteria 1711
649 Ga0495660_0008202 3300046810 Bacteria 6123
650 Ga0495660_0008483 3300046810 Bacteria 6019
651 Ga0495660_0013849 3300046810 Bacteria 4675
652 Ga0495660_0051564 3300046810 Bacteria 2238
653 Ga0495660_0081097 3300046810 Bacteria 1701
654 Ga0495581_0006656 3300047315 Bacteria 6696
655 Ga0495581_0013387 3300047315 Bacteria 4755
656 Ga0495581_0075958 3300047315 Bacteria 1944
657 Ga0495604_0022053 3300047317 Bacteria 5083
658 Ga0495604_0032267 3300047317 Bacteria 4153
659 Ga0495604_0071133 3300047317 Bacteria 2632
660 Ga0495636_0004699 3300047318 Bacteria 5356
661 Ga0495636_0007204 3300047318 Bacteria 4378
662 Ga0495636_0012459 3300047318 Bacteria 3367
663 Ga0495636_0022754 3300047318 Bacteria 2536
664 Ga0495674_0007930 3300047319 Bacteria 10133
665 Ga0495674_0013486 3300047319 Bacteria 7685
666 Ga0495674_0016977 3300047319 Bacteria 6784
667 Ga0495672_0000099 3300047320 Bacteria 140634
668 Ga0495672_0000508 3300047320 Bacteria 44840
669 Ga0495672_0001116 3300047320 Bacteria 27207
670 Ga0495672_0001291 3300047320 Bacteria 24984
671 Ga0495672_0002747 3300047320 Bacteria 15771
672 Ga0495672_0008317 3300047320 Bacteria 7680
673 Ga0495672_0013539 3300047320 Bacteria 5624
674 Ga0495672_0027727 3300047320 Bacteria 3594
675 Ga0495672_0029428 3300047320 Bacteria 3459
676 Ga0495676_0000135 3300047321 Bacteria 55966
677 Ga0495676_0006827 3300047321 Bacteria 10494
678 Ga0495680_0000094 3300047322 Bacteria 80355
679 Ga0495683_0000330 3300047323 Bacteria 39863
680 Ga0495683_0003371 3300047323 Bacteria 9331
681 Ga0495683_0004322 3300047323 Bacteria 8095
682 Ga0495683_0019907 3300047323 Bacteria 3462
683 Ga0495683_0026959 3300047323 Bacteria 2939
684 Ga0495687_000442 3300047443 Bacteria 51118
685 Ga0495687_000609 3300047443 Bacteria 41802
686 Ga0495687_001605 3300047443 Bacteria 20392
687 Ga0495687_016404 3300047443 Bacteria 3726
688 Ga0495687_021690 3300047443 Bacteria 3100
689 Ga0495675_0032829 3300047444 Bacteria 3311
690 Ga0495677_0000445 3300047445 Bacteria 17692
691 Ga0495677_0003116 3300047445 Bacteria 6459
692 Ga0495677_0005109 3300047445 Bacteria 4997
693 Ga0495677_0009064 3300047445 Bacteria 3679
694 Ga0495677_0019627 3300047445 Bacteria 2450
695 Ga0495679_007244 3300047446 Bacteria 4653
696 Ga0495679_032214 3300047446 Bacteria 1683
697 Ga0495685_000110 3300047447 Bacteria 29273
698 Ga0495685_003105 3300047447 Bacteria 5269
699 Ga0495685_017583 3300047447 Bacteria 2449
700 Ga0495673_0000031 3300047469 Bacteria 447868
701 Ga0495673_0000032 3300047469 Bacteria 375856
702 Ga0495673_0005363 3300047469 Bacteria 7768
703 Ga0495673_0009705 3300047469 Bacteria 5302
704 Ga0495681_0001145 3300047470 Bacteria 20136
705 Ga0495681_0006452 3300047470 Bacteria 7708
706 Ga0495681_0011831 3300047470 Bacteria 5165
707 Ga0495681_0019724 3300047470 Bacteria 3672
708 Ga0495681_0037378 3300047470 Bacteria 2391
709 Ga0495686_0000069 3300047472 Bacteria 217778
710 Ga0495686_0002300 3300047472 Bacteria 18278
711 Ga0495686_0003368 3300047472 Bacteria 13922
712 Ga0495686_0004791 3300047472 Bacteria 10920
713 Ga0495686_0006443 3300047472 Bacteria 8986
714 Ga0495686_0075644 3300047472 Bacteria 2064
715 Ga0495593_0010408 3300047673 Bacteria 5377
716 Ga0495602_0018108 3300048088 Bacteria 7047
717 Ga0495614_0027231 3300048089 Bacteria 2465
718 Ga0495626_0002032 3300048091 Bacteria 14850
719 Ga0495626_0005264 3300048091 Bacteria 7645
720 Ga0495626_0006906 3300048091 Bacteria 6394
721 Ga0495626_0012465 3300048091 Bacteria 4455
722 Ga0495626_0018406 3300048091 Bacteria 3507
723 Ga0495626_0029337 3300048091 Bacteria 2663
724 Ga0495626_0029831 3300048091 Bacteria 2635
725 Ga0495626_0048822 3300048091 Bacteria 1962
726 Ga0496100_0059791 3300048903 Bacteria 2505
727 Ga0496101_0010598 3300048904 Bacteria 6088
728 Ga0496101_0017184 3300048904 Bacteria 4903
729 Ga0496102_0000202 3300048905 Bacteria 80040
730 Ga0496102_0016243 3300048905 Bacteria 6504
731 Ga0496102_0157146 3300048905 Bacteria 2138
732 Ga0496103_0003201 3300048906 Bacteria 10048
733 Ga0496103_0003638 3300048906 Bacteria 9384
734 Ga0496103_0048237 3300048906 Bacteria 2631
735 Ga0496106_0002899 3300048909 Bacteria 12755
736 Ga0496108_0180441 3300048911 Bacteria 1828
737 Ga0496109_0005497 3300048912 Bacteria 10609
738 Ga0496113_0012454 3300048916 Bacteria 5716
739 Ga0496115_0142663 3300048918 Bacteria 1976
740 Ga0496116_0008818 3300048919 Bacteria 8690
741 Ga0496119_0060505 3300048922 Bacteria 2267
742 Ga0496120_0029328 3300048923 Bacteria 3360
743 Ga0496121_0012095 3300048924 Bacteria 9483
744 Ga0496123_0002080 3300048926 Bacteria 25773
745 Ga0496123_0009431 3300048926 Bacteria 8792
746 Ga0496124_0053150 3300048927 Bacteria 3436
747 Ga0496126_0000187 3300048929 Bacteria 139670
748 Ga0496126_0004486 3300048929 Bacteria 16654
749 Ga0496126_0131763 3300048929 Bacteria 2160
750 Ga0495678_000001 3300049459 Bacteria 1060340
751 Ga0495678_000189 3300049459 Bacteria 72122
752 Ga0495678_002015 3300049459 Bacteria 14567
753 Ga0495678_004801 3300049459 Bacteria 7691
754 Ga0495678_021395 3300049459 Bacteria 2849
755 Ga0495682_0003258 3300049460 Bacteria 7268
756 Ga0495682_0003425 3300049460 Bacteria 7054
757 Ga0495682_0024853 3300049460 Bacteria 2231
758 Ga0501031_0001950 3300049568 Bacteria 13011
759 Ga0501031_0012585 3300049568 Bacteria 5526
760 Ga0501031_0027934 3300049568 Bacteria 3677
761 Ga0501031_0045196 3300049568 Bacteria 2873
762 Ga0501032_0004384 3300049569 Bacteria 10650
763 Ga0501032_0028519 3300049569 Bacteria 3836
764 Ga0501032_0092269 3300049569 Unclassified 2009
765 Ga0501032_0103092 3300049569 Bacteria 1890
766 Ga0501033_0002590 3300049570 Bacteria 15242
767 Ga0501033_0039477 3300049570 Bacteria 3525
768 Ga0501033_0047393 3300049570 Bacteria 3195
769 Ga0501034_0009548 3300049571 Bacteria 10156
770 Ga0501034_0009621 3300049571 Bacteria 10111
771 Ga0501034_0015686 3300049571 Bacteria 7780
772 Ga0501034_0057136 3300049571 Bacteria 3923
773 Ga0501034_0071738 3300049571 Bacteria 3472
774 Ga0501036_0001005 3300049572 Bacteria 21286
775 Ga0501036_0007597 3300049572 Bacteria 8847
776 Ga0501036_0089364 3300049572 Bacteria 2603
777 Ga0501036_0155760 3300049572 Bacteria 1927
778 Ga0501037_0001188 3300049573 Bacteria 19235
779 Ga0501037_0003642 3300049573 Bacteria 11179
780 Ga0501037_0007930 3300049573 Bacteria 7780
781 Ga0501037_0036042 3300049573 Bacteria 3646
782 Ga0501037_0038007 3300049573 Bacteria 3549
783 Ga0501037_0111887 3300049573 Bacteria 1966
784 Ga0501038_0001420 3300049574 Bacteria 21939
785 Ga0501038_0009183 3300049574 Bacteria 9074
786 Ga0501038_0022293 3300049574 Bacteria 5677
787 Ga0501038_0097457 3300049574 Bacteria 2453
788 Ga0501039_0033825 3300049575 Bacteria 3944
789 Ga0501040_0119531 3300049576 Bacteria 1848
790 Ga0501042_0200488 3300049578 Bacteria 1439
791 Ga0501043_0001312 3300049579 Bacteria 21759
792 Ga0501043_0002199 3300049579 Bacteria 16623
793 Ga0501043_0036562 3300049579 Bacteria 3863
794 Ga0501043_0076784 3300049579 Bacteria 2624
795 Ga0501046_0000091 3300049580 Bacteria 98095
796 Ga0501046_0004508 3300049580 Bacteria 12624
797 Ga0501046_0010400 3300049580 Bacteria 7994
798 Ga0501046_0032465 3300049580 Bacteria 4227
799 Ga0501047_0041763 3300049581 Bacteria 4431
800 Ga0501048_0001715 3300049582 Bacteria 16710
801 Ga0501048_0018291 3300049582 Bacteria 5155
802 Ga0501048_0042549 3300049582 Bacteria 3252
803 Ga0501067_0000947 3300049583 Bacteria 15527
804 Ga0501067_0002401 3300049583 Bacteria 10347
805 Ga0501068_0038203 3300049584 Bacteria 2875
806 Ga0501069_0004044 3300049585 Bacteria 7573
807 Ga0501069_0015659 3300049585 Bacteria 4065
808 Ga0501069_0037108 3300049585 Bacteria 2689
809 Ga0501070_0002702 3300049586 Bacteria 15486
810 Ga0501070_0024937 3300049586 Bacteria 5015
811 Ga0501071_0003555 3300049587 Bacteria 9759
812 Ga0501072_0036737 3300049588 Bacteria 3841
813 Ga0501073_0000994 3300049589 Bacteria 20456
814 Ga0501073_0013712 3300049589 Bacteria 5895
815 Ga0501073_0030634 3300049589 Bacteria 3840
816 Ga0501074_0018785 3300049590 Bacteria 5022
817 Ga0501074_0049217 3300049590 Bacteria 3043
818 Ga0501075_0028843 3300049591 Bacteria 4100
819 Ga0501075_0033578 3300049591 Bacteria 3818
820 Ga0501249_001861 3300049679 Bacteria 4302
821 Ga0501079_0047941 3300049741 Bacteria 3296
822 Ga0501079_0137887 3300049741 Bacteria 1900
823 Ga0501080_0017774 3300049742 Bacteria 6581
824 Ga0501080_0050935 3300049742 Bacteria 3853
825 Ga0501080_0061557 3300049742 Bacteria 3494
826 Ga0501080_0146091 3300049742 Bacteria 2186
827 Ga0501083_0001847 3300049744 Bacteria 14533
828 Ga0501083_0002059 3300049744 Bacteria 13834
829 Ga0501083_0008667 3300049744 Bacteria 7174
830 Ga0501083_0013877 3300049744 Bacteria 5632
831 Ga0501083_0037688 3300049744 Bacteria 3291
832 Ga0501269_000408 3300049766 Bacteria 9926
833 Ga0501035_0001569 3300049822 Bacteria 23249
834 Ga0501035_0019590 3300049822 Bacteria 6216
835 Ga0501035_0079122 3300049822 Bacteria 2904
836 Ga0501035_0169616 3300049822 Unclassified 1886
837 Ga0501044_0000231 3300049823 Bacteria 70134
838 Ga0501044_0082984 3300049823 Bacteria 3241
839 Ga0501044_0117528 3300049823 Bacteria 2663
840 Ga0501045_0021073 3300049824 Bacteria 4660
841 nmdc:mga0yw44_1651_c1 3300050492 Bacteria 8992
842 nmdc:mga05p37_260027_c1 3300050507 Bacteria 2078
843 nmdc:mga05p37_37999_c1 3300050507 Bacteria 5905
844 nmdc:mga05p37_46325_c1 3300050507 Bacteria 5347
845 nmdc:mga05p37_6267_c1 3300050507 Bacteria 14010
846 nmdc:mga09592_81705_c1 3300050508 Bacteria 2754
847 nmdc:mga06r32_25770_c1 3300050510 Bacteria 5474
848 nmdc:mga06r32_34139_c1 3300050510 Bacteria 4795
849 nmdc:mga06r32_60012_c1 3300050510 Bacteria 3659
850 nmdc:mga08y16_152635_c1 3300050511 Bacteria 2401
851 nmdc:mga08y16_224468_c1 3300050511 Bacteria 1944
852 nmdc:mga08y16_25838_c1 3300050511 Bacteria 6196
853 nmdc:mga08y16_30646_c1 3300050511 Bacteria 5659
854 nmdc:mga0n895_86581_c1 3300050512 Bacteria 3129
855 nmdc:mga0rr50_39828_c1 3300050513 Bacteria 3411
856 nmdc:mga0rr50_80450_c1 3300050513 Bacteria 2512
857 nmdc:mga08x19_149369_c1 3300050514 Bacteria 1581
858 nmdc:mga0a205_150114_c1 3300050515 Bacteria 2230
859 nmdc:mga0a205_67743_c1 3300050515 Bacteria 3448
860 Ga0495601_0019403 3300053077 Bacteria 4146
861 Ga0495619_0000347 3300053085 Bacteria 32351
862 Ga0495619_0002573 3300053085 Bacteria 11856
863 Ga0500556_0001367 3300053104 Bacteria 10718
864 Ga0500595_000023 3300053119 Bacteria 147097
865 Ga0500595_001478 3300053119 Bacteria 12489
866 Ga0500618_000613 3300053125 Bacteria 21774
867 Ga0500618_001514 3300053125 Bacteria 10236
868 Ga0500586_001393 3300053145 Bacteria 5085
869 Ga0500616_0002423 3300053153 Bacteria 15529
870 Ga0500616_0006321 3300053153 Bacteria 7781
871 Ga0500636_0048047 3300053177 Bacteria 2513
872 Ga0501084_0104748 3300054114 Bacteria 2376
873 Ga0501084_0120763 3300054114 Bacteria 2203
874 Ga0501084_0128855 3300054114 Bacteria 2130
875 Ga0501082_0003408 3300060353 Bacteria 13875
876 Ga0501082_0094700 3300060353 Bacteria 2580

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044712 Ga0453684_0027978 Ga0453684_0027978_27_1340 413
2 3300036401 Ga0373937_0068742 Ga0373937_0068742_1616_2920 425
3 3300046516 Ga0495628_0078600 Ga0495628_0078600_1250_2554 427
4 3300013296 Ga0157374_10005308 Ga0157374_100053086 431
5 3300046558 Ga0495633_0016756 Ga0495633_0016756_45_1388 439
6 3300049679 Ga0501249_001861 Ga0501249_001861_998_2332 439
7 3300046681 Ga0495647_0000002 Ga0495647_0000002_41244_42590 441
8 3300049741 Ga0501079_0137887 Ga0501079_0137887_543_1874 441
9 3300046519 Ga0495632_0003427 Ga0495632_0003427_9522_11018 444
10 3300049578 Ga0501042_0200488 Ga0501042_0200488_82_1419 444
11 3300031344 Ga0265316_10048332 Ga0265316_100483323 447
12 3300031595 Ga0265313_10006240 Ga0265313_100062405 447
13 3300031712 Ga0265342_10008167 Ga0265342_100081673 447
14 3300046455 Ga0495603_0081010 Ga0495603_0081010_19_1389 450
15 3300046475 Ga0495639_0024293 Ga0495639_0024293_12_1382 450
16 3300046642 Ga0495634_0035273 Ga0495634_0035273_2043_3413 450
17 3300050513 nmdc:mga0rr50_39828_c1 nmdc:mga0rr50_39828_c1_1064_2539 450
18 3300047472 Ga0495686_0002300 Ga0495686_0002300_16257_17759 456
19 3300049460 Ga0495682_0003425 Ga0495682_0003425_5045_6547 456
20 3300046513 Ga0495616_0001063 Ga0495616_0001063_165_1664 457
21 3300046522 Ga0495643_0012521 Ga0495643_0012521_1855_3348 457
22 3300046542 Ga0495597_0022301 Ga0495597_0022301_220_1707 457
23 3300046500 Ga0495596_0016441 Ga0495596_0016441_492_1994 458
24 3300005546 Ga0070696_100035528 Ga0070696_1000355283 462
25 3300047445 Ga0495677_0000445 Ga0495677_0000445_7474_8967 462
26 3300049460 Ga0495682_0024853 Ga0495682_0024853_709_2208 462
27 3300046533 Ga0495640_0003678 Ga0495640_0003678_5913_7385 463
28 3300046684 Ga0495669_0013473 Ga0495669_0013473_16_1437 463
29 3300005337 Ga0070682_100038141 Ga0070682_1000381411 464
30 3300005544 Ga0070686_100030529 Ga0070686_1000305294 464
31 3300005843 Ga0068860_100002743 Ga0068860_1000027431 464
32 3300026121 Ga0207683_10012979 Ga0207683_100129791 464
33 3300028381 Ga0268264_10001953 Ga0268264_100019532 464
34 3300048904 Ga0496101_0017184 Ga0496101_0017184_1375_2829 464
35 3300048909 Ga0496106_0002899 Ga0496106_0002899_5024_6478 464
36 3300048912 Ga0496109_0005497 Ga0496109_0005497_7782_9236 464
37 3300005356 Ga0070674_100000075 Ga0070674_10000007517 465
38 3300005718 Ga0068866_10000469 Ga0068866_1000046919 465
39 3300009176 Ga0105242_10013245 Ga0105242_100132454 465
40 3300025899 Ga0207642_10000181 Ga0207642_1000018118 465
41 3300025935 Ga0207709_10016051 Ga0207709_100160513 465
42 3300025937 Ga0207669_10000091 Ga0207669_1000009138 465
43 3300002074 JGI24748J21848_1002744 JGI24748J21848_10027441 466
44 3300002239 JGI24034J26672_10000147 JGI24034J26672_1000014710 466
45 3300046506 Ga0495583_0000102 Ga0495583_0000102_109184_110677 466
46 3300046660 Ga0495625_0031228 Ga0495625_0031228_134_1624 466
47 3300005467 Ga0070706_100002511 Ga0070706_10000251111 468
48 3300025910 Ga0207684_10002504 Ga0207684_1000250412 468
49 3300049744 Ga0501083_0001847 Ga0501083_0001847_11175_12662 468
50 3300053125 Ga0500618_000613 Ga0500618_000613_14318_15823 468
51 3300046472 Ga0495580_0050636 Ga0495580_0050636_11_1429 469
52 3300046558 Ga0495633_0028646 Ga0495633_0028646_10_1434 469
53 3300006847 Ga0075431_100002603 Ga0075431_10000260311 470
54 3300042876 Ga0451577_0000260 Ga0451577_0000260_28954_30456 470
55 3300044712 Ga0453684_0000836 Ga0453684_0000836_41285_42787 470
56 3300044712 Ga0453684_0043398 Ga0453684_0043398_1041_2528 470
57 3300045051 Ga0451576_0047684 Ga0451576_0047684_1241_2743 470
58 3300046679 Ga0495623_0075853 Ga0495623_0075853_662_2074 470
59 3300005981 Ga0081538_10005107 Ga0081538_100051077 471
60 3300044712 Ga0453684_0000861 Ga0453684_0000861_39025_40512 471
61 3300046492 Ga0495585_0089020 Ga0495585_0089020_120_1613 471
62 3300046538 Ga0495609_0019238 Ga0495609_0019238_710_2206 471
63 3300046557 Ga0495622_0000090 Ga0495622_0000090_61814_63307 471
64 3300047443 Ga0495687_000442 Ga0495687_000442_36107_37600 471
65 3300005842 Ga0068858_100123830 Ga0068858_1001238301 472
66 3300009553 Ga0105249_10023904 Ga0105249_100239045 472
67 3300025961 Ga0207712_10042215 Ga0207712_100422152 472
68 3300037312 Ga0395899_0048812 Ga0395899_0048812_672_2126 472
69 3300037418 Ga0395900_0044881 Ga0395900_0044881_352_1806 472
70 3300037466 Ga0395898_0004764 Ga0395898_0004764_8023_9477 472
71 3300037471 Ga0395905_0028155 Ga0395905_0028155_101_1555 472
72 3300044712 Ga0453684_0163272 Ga0453684_0163272_127_1617 473
73 3300005327 Ga0070658_10094151 Ga0070658_100941512 474
74 3300005329 Ga0070683_100034891 Ga0070683_1000348913 474
75 3300005344 Ga0070661_100001276 Ga0070661_1000012762 474
76 3300005530 Ga0070679_100008498 Ga0070679_1000084982 474
77 3300005539 Ga0068853_100015247 Ga0068853_1000152473 474
78 3300005563 Ga0068855_100012820 Ga0068855_1000128204 474
79 3300005616 Ga0068852_100041861 Ga0068852_1000418612 474
80 3300005834 Ga0068851_10061200 Ga0068851_100612001 474
81 3300009551 Ga0105238_10051950 Ga0105238_100519501 474
82 3300013105 Ga0157369_10008375 Ga0157369_100083756 474
83 3300013307 Ga0157372_10008860 Ga0157372_100088604 474
84 3300025909 Ga0207705_10003727 Ga0207705_100037273 474
85 3300025921 Ga0207652_10084328 Ga0207652_100843282 474
86 3300025924 Ga0207694_10018192 Ga0207694_100181921 474
87 3300025944 Ga0207661_10085871 Ga0207661_100858711 474
88 3300025949 Ga0207667_10051556 Ga0207667_100515563 474
89 3300026041 Ga0207639_10014785 Ga0207639_100147854 474
90 3300026142 Ga0207698_10062888 Ga0207698_100628881 474
91 3300039447 Ga0436361_0596240 Ga0436361_0596240_11730_13163 474
92 3300035085 Ga0373929_0000013 Ga0373929_0000013_155518_157005 475
93 3300005471 Ga0070698_100007507 Ga0070698_1000075074 476
94 3300009177 Ga0105248_10061547 Ga0105248_100615473 476
95 3300013306 Ga0163162_10000370 Ga0163162_1000037017 476
96 3300039447 Ga0436361_0182321 Ga0436361_0182321_43_1473 476
97 3300046459 Ga0495629_0015670 Ga0495629_0015670_826_2274 476
98 3300046471 Ga0495650_0000071 Ga0495650_0000071_115097_116545 476
99 3300046471 Ga0495650_0002556 Ga0495650_0002556_6235_7683 476
100 3300046476 Ga0495662_0018132 Ga0495662_0018132_1392_2840 476
101 3300046477 Ga0495664_0001675 Ga0495664_0001675_1805_3253 476
102 3300046499 Ga0495594_0002777 Ga0495594_0002777_6507_7955 476
103 3300046499 Ga0495594_0010755 Ga0495594_0010755_879_2327 476
104 3300046513 Ga0495616_0075186 Ga0495616_0075186_148_1596 476
105 3300046518 Ga0495631_0059754 Ga0495631_0059754_33_1481 476
106 3300046523 Ga0495644_0000227 Ga0495644_0000227_15329_16777 476
107 3300046529 Ga0495652_0072445 Ga0495652_0072445_155_1603 476
108 3300046531 Ga0495665_0062538 Ga0495665_0062538_47_1495 476
109 3300046533 Ga0495640_0001641 Ga0495640_0001641_810_2258 476
110 3300046538 Ga0495609_0003851 Ga0495609_0003851_1593_3041 476
111 3300046543 Ga0495645_0122311 Ga0495645_0122311_120_1568 476
112 3300046558 Ga0495633_0019961 Ga0495633_0019961_1541_2989 476
113 3300046642 Ga0495634_0039116 Ga0495634_0039116_1713_3161 476
114 3300046660 Ga0495625_0044535 Ga0495625_0044535_205_1647 476
115 3300046663 Ga0495635_0003838 Ga0495635_0003838_8653_10101 476
116 3300046680 Ga0495646_0021012 Ga0495646_0021012_282_1730 476
117 3300046680 Ga0495646_0062057 Ga0495646_0062057_114_1562 476
118 3300046684 Ga0495669_0003029 Ga0495669_0003029_2074_3522 476
119 3300046690 Ga0495624_0051197 Ga0495624_0051197_850_2298 476
120 3300047315 Ga0495581_0013387 Ga0495581_0013387_206_1654 476
121 3300047317 Ga0495604_0022053 Ga0495604_0022053_858_2306 476
122 3300047317 Ga0495604_0032267 Ga0495604_0032267_1530_2978 476
123 3300047318 Ga0495636_0022754 Ga0495636_0022754_772_2220 476
124 3300047319 Ga0495674_0013486 Ga0495674_0013486_4151_5599 476
125 3300047319 Ga0495674_0016977 Ga0495674_0016977_2590_4038 476
126 3300047321 Ga0495676_0006827 Ga0495676_0006827_114_1562 476
127 3300048089 Ga0495614_0027231 Ga0495614_0027231_904_2352 476
128 3300049568 Ga0501031_0027934 Ga0501031_0027934_1308_2756 476
129 3300049570 Ga0501033_0039477 Ga0501033_0039477_897_2345 476
130 3300049571 Ga0501034_0009621 Ga0501034_0009621_6142_7590 476
131 3300049572 Ga0501036_0001005 Ga0501036_0001005_2021_3469 476
132 3300049573 Ga0501037_0007930 Ga0501037_0007930_5315_6763 476
133 3300049574 Ga0501038_0001420 Ga0501038_0001420_13714_15162 476
134 3300049575 Ga0501039_0033825 Ga0501039_0033825_1913_3361 476
135 3300049579 Ga0501043_0002199 Ga0501043_0002199_408_1856 476
136 3300049580 Ga0501046_0000091 Ga0501046_0000091_66482_67930 476
137 3300049582 Ga0501048_0042549 Ga0501048_0042549_1712_3160 476
138 3300049584 Ga0501068_0038203 Ga0501068_0038203_640_2088 476
139 3300049589 Ga0501073_0000994 Ga0501073_0000994_12715_14163 476
140 3300049590 Ga0501074_0049217 Ga0501074_0049217_1292_2740 476
141 3300049823 Ga0501044_0000231 Ga0501044_0000231_24685_26196 476
142 3300053119 Ga0500595_000023 Ga0500595_000023_95123_96571 476
143 3300005327 Ga0070658_10006014 Ga0070658_100060143 477
144 3300005981 Ga0081538_10000086 Ga0081538_1000008625 477
145 3300013104 Ga0157370_10030691 Ga0157370_100306914 477
146 3300025909 Ga0207705_10006639 Ga0207705_100066394 477
147 3300044673 Ga0453683_0113318 Ga0453683_0113318_66_1556 477
148 3300046558 Ga0495633_0001323 Ga0495633_0001323_17807_19294 477
149 3300047320 Ga0495672_0001116 Ga0495672_0001116_15306_16769 477
150 3300049823 Ga0501044_0117528 Ga0501044_0117528_1176_2624 477
151 3300003763 Ga0055529_1001421 Ga0055529_10014217 478
152 3300025272 Ga0209455_1004973 Ga0209455_10049731 478
153 3300049572 Ga0501036_0155760 Ga0501036_0155760_32_1477 478
154 3300053125 Ga0500618_001514 Ga0500618_001514_1492_3006 478
155 3300054114 Ga0501084_0128855 Ga0501084_0128855_58_1503 478
156 3300005331 Ga0070670_100132312 Ga0070670_1001323122 479
157 3300005459 Ga0068867_100169349 Ga0068867_1001693491 479
158 3300009147 Ga0114129_10000276 Ga0114129_1000027617 479
159 3300026035 Ga0207703_10164122 Ga0207703_101641221 479
160 3300050507 nmdc:mga05p37_37999_c1 nmdc:mga05p37_37999_c1_4007_5497 479
161 3300006038 Ga0075365_10003408 Ga0075365_100034084 480
162 3300046499 Ga0495594_0000001 Ga0495594_0000001_81553_82998 480
163 3300050492 nmdc:mga0yw44_1651_c1 nmdc:mga0yw44_1651_c1_5193_6656 480
164 3300005328 Ga0070676_10004005 Ga0070676_100040055 481
165 3300005329 Ga0070683_100013428 Ga0070683_1000134285 481
166 3300005340 Ga0070689_100035150 Ga0070689_1000351502 481
167 3300005354 Ga0070675_100080968 Ga0070675_1000809682 481
168 3300005355 Ga0070671_100020237 Ga0070671_1000202376 481
169 3300005356 Ga0070674_100024912 Ga0070674_1000249122 481
170 3300005365 Ga0070688_100072385 Ga0070688_1000723851 481
171 3300005367 Ga0070667_100127410 Ga0070667_1001274102 481
172 3300005441 Ga0070700_100047855 Ga0070700_1000478553 481
173 3300005457 Ga0070662_100052580 Ga0070662_1000525803 481
174 3300005535 Ga0070684_100017640 Ga0070684_1000176407 481
175 3300005615 Ga0070702_100013695 Ga0070702_1000136953 481
176 3300005718 Ga0068866_10019822 Ga0068866_100198223 481
177 3300005842 Ga0068858_100095987 Ga0068858_1000959873 481
178 3300005843 Ga0068860_100112638 Ga0068860_1001126382 481
179 3300005985 Ga0081539_10001052 Ga0081539_1000105222 481
180 3300006358 Ga0068871_100078589 Ga0068871_1000785893 481
181 3300007076 Ga0075435_100097095 Ga0075435_1000970952 481
182 3300009148 Ga0105243_10083102 Ga0105243_100831023 481
183 3300009553 Ga0105249_10145546 Ga0105249_101455462 481
184 3300014326 Ga0157380_10079004 Ga0157380_100790043 481
185 3300025903 Ga0207680_10079907 Ga0207680_100799072 481
186 3300025918 Ga0207662_10008062 Ga0207662_100080623 481
187 3300025926 Ga0207659_10047183 Ga0207659_100471833 481
188 3300025936 Ga0207670_10019700 Ga0207670_100197002 481
189 3300025944 Ga0207661_10023193 Ga0207661_100231933 481
190 3300025986 Ga0207658_10041586 Ga0207658_100415862 481
191 3300026035 Ga0207703_10030078 Ga0207703_100300783 481
192 3300026075 Ga0207708_10009516 Ga0207708_100095164 481
193 3300026088 Ga0207641_10046278 Ga0207641_100462782 481
194 3300026095 Ga0207676_10000889 Ga0207676_100008892 481
195 3300028381 Ga0268264_10092666 Ga0268264_100926662 481
196 3300031995 Ga0307409_100128839 Ga0307409_1001288393 481
197 3300032002 Ga0307416_100054328 Ga0307416_1000543282 481
198 3300038443 Ga0395901_0192665 Ga0395901_0192665_315_1775 481
199 3300045976 Ga0466967_0105989 Ga0466967_0105989_1106_2560 481
200 3300046454 Ga0495592_0000424 Ga0495592_0000424_20599_22122 481
201 3300046499 Ga0495594_0042044 Ga0495594_0042044_156_1649 481
202 3300046514 Ga0495618_0000037 Ga0495618_0000037_78445_79908 481
203 3300046517 Ga0495630_0000991 Ga0495630_0000991_2488_3960 481
204 3300046517 Ga0495630_0057496 Ga0495630_0057496_110_1582 481
205 3300046543 Ga0495645_0011816 Ga0495645_0011816_2861_4327 481
206 3300046660 Ga0495625_0000109 Ga0495625_0000109_31530_32987 481
207 3300046675 Ga0495657_0003478 Ga0495657_0003478_8863_10335 481
208 3300046681 Ga0495647_0002786 Ga0495647_0002786_2635_4164 481
209 3300046689 Ga0495613_0000190 Ga0495613_0000190_20525_22039 481
210 3300046689 Ga0495613_0097478 Ga0495613_0097478_212_1684 481
211 3300047322 Ga0495680_0000094 Ga0495680_0000094_71362_72885 481
212 3300048916 Ga0496113_0012454 Ga0496113_0012454_3149_4606 481
213 3300050513 nmdc:mga0rr50_80450_c1 nmdc:mga0rr50_80450_c1_670_2178 481
214 3300053077 Ga0495601_0019403 Ga0495601_0019403_972_2444 481
215 3300053085 Ga0495619_0000347 Ga0495619_0000347_13936_15405 481
216 3300053085 Ga0495619_0002573 Ga0495619_0002573_6587_8059 481
217 3300005262 Ga0065165_1002884 Ga0065165_10028848 482
218 3300005329 Ga0070683_100000958 Ga0070683_10000095823 482
219 3300009147 Ga0114129_10192762 Ga0114129_101927623 482
220 3300013296 Ga0157374_10128532 Ga0157374_101285323 482
221 3300014968 Ga0157379_10038997 Ga0157379_100389972 482
222 3300044901 Ga0466960_0000095 Ga0466960_0000095_16291_17745 482
223 3300046452 Ga0495617_000014 Ga0495617_000014_285123_286622 482
224 3300046453 Ga0495627_000763 Ga0495627_000763_309_1808 482
225 3300046471 Ga0495650_0000053 Ga0495650_0000053_100335_101789 482
226 3300046474 Ga0495605_0000538 Ga0495605_0000538_29612_31111 482
227 3300046501 Ga0495607_0043095 Ga0495607_0043095_967_2466 482
228 3300046513 Ga0495616_0004707 Ga0495616_0004707_6944_8443 482
229 3300046518 Ga0495631_0015171 Ga0495631_0015171_1865_3364 482
230 3300046524 Ga0495648_0004787 Ga0495648_0004787_337_1836 482
231 3300046528 Ga0495642_0000192 Ga0495642_0000192_34450_35949 482
232 3300046615 Ga0495656_0020201 Ga0495656_0020201_903_2402 482
233 3300046616 Ga0495668_0005938 Ga0495668_0005938_6361_7860 482
234 3300046684 Ga0495669_0034632 Ga0495669_0034632_250_1749 482
235 3300046692 Ga0495671_0000718 Ga0495671_0000718_22101_23600 482
236 3300046794 Ga0495589_0025252 Ga0495589_0025252_333_1832 482
237 3300047472 Ga0495686_0075644 Ga0495686_0075644_374_1873 482
238 3300048922 Ga0496119_0060505 Ga0496119_0060505_159_1613 482
239 3300049571 Ga0501034_0009548 Ga0501034_0009548_7985_9433 482
240 3300050507 nmdc:mga05p37_46325_c1 nmdc:mga05p37_46325_c1_3235_4722 482
241 3300053153 Ga0500616_0002423 Ga0500616_0002423_4407_5861 482
242 3300005330 Ga0070690_100033253 Ga0070690_1000332532 483
243 3300005331 Ga0070670_100084892 Ga0070670_1000848923 483
244 3300005335 Ga0070666_10115908 Ga0070666_101159082 483
245 3300005338 Ga0068868_100019452 Ga0068868_1000194522 483
246 3300005445 Ga0070708_100103496 Ga0070708_1001034962 483
247 3300009094 Ga0111539_10043978 Ga0111539_100439785 483
248 3300009098 Ga0105245_10223916 Ga0105245_102239161 483
249 3300025315 Ga0207697_10011578 Ga0207697_100115782 483
250 3300025908 Ga0207643_10001923 Ga0207643_100019238 483
251 3300025925 Ga0207650_10060600 Ga0207650_100606002 483
252 3300025927 Ga0207687_10124167 Ga0207687_101241671 483
253 3300025938 Ga0207704_10026523 Ga0207704_100265232 483
254 3300026023 Ga0207677_10000002 Ga0207677_10000002396 483
255 3300026088 Ga0207641_10102067 Ga0207641_101020672 483
256 3300026095 Ga0207676_10074414 Ga0207676_100744143 483
257 3300026118 Ga0207675_100022135 Ga0207675_1000221352 483
258 3300026121 Ga0207683_10016839 Ga0207683_100168395 483
259 3300046522 Ga0495643_0001511 Ga0495643_0001511_19378_20877 483
260 3300048923 Ga0496120_0029328 Ga0496120_0029328_1512_2996 483
261 3300048926 Ga0496123_0009431 Ga0496123_0009431_305_1789 483
262 3300053104 Ga0500556_0001367 Ga0500556_0001367_7201_8658 483
263 3300053153 Ga0500616_0006321 Ga0500616_0006321_1871_3328 483
264 3300005353 Ga0070669_100000002 Ga0070669_100000002400 484
265 3300005981 Ga0081538_10056630 Ga0081538_100566302 484
266 3300025923 Ga0207681_10000107 Ga0207681_1000010746 484
267 3300031711 Ga0265314_10026842 Ga0265314_100268423 484
268 3300049572 Ga0501036_0089364 Ga0501036_0089364_1111_2568 484
269 3300049574 Ga0501038_0097457 Ga0501038_0097457_757_2214 484
270 3300049576 Ga0501040_0119531 Ga0501040_0119531_344_1801 484
271 3300049588 Ga0501072_0036737 Ga0501072_0036737_2359_3816 484
272 3300049591 Ga0501075_0028843 Ga0501075_0028843_2317_3774 484
273 3300054114 Ga0501084_0120763 Ga0501084_0120763_239_1696 484
274 3300009094 Ga0111539_10091770 Ga0111539_100917704 485
275 3300025929 Ga0207664_10005822 Ga0207664_100058225 485
276 3300048905 Ga0496102_0157146 Ga0496102_0157146_80_1555 485
277 3300049568 Ga0501031_0045196 Ga0501031_0045196_113_1570 485
278 3300049569 Ga0501032_0028519 Ga0501032_0028519_325_1782 485
279 3300049571 Ga0501034_0071738 Ga0501034_0071738_1866_3323 485
280 3300049579 Ga0501043_0076784 Ga0501043_0076784_1018_2475 485
281 3300049580 Ga0501046_0010400 Ga0501046_0010400_5627_7084 485
282 3300049585 Ga0501069_0004044 Ga0501069_0004044_3423_4880 485
283 3300049589 Ga0501073_0013712 Ga0501073_0013712_1786_3243 485
284 3300049742 Ga0501080_0050935 Ga0501080_0050935_889_2349 485
285 3300049742 Ga0501080_0061557 Ga0501080_0061557_172_1629 485
286 3300049744 Ga0501083_0008667 Ga0501083_0008667_2561_4018 485
287 3300050511 nmdc:mga08y16_152635_c1 nmdc:mga08y16_152635_c1_445_1920 485
288 3300054114 Ga0501084_0104748 Ga0501084_0104748_574_2031 485
289 3300045836 Ga0466958_0056836 Ga0466958_0056836_697_2163 486
290 3300046452 Ga0495617_000011 Ga0495617_000011_25893_27377 486
291 3300046458 Ga0495591_018407 Ga0495591_018407_132_1625 486
292 3300046471 Ga0495650_0000460 Ga0495650_0000460_8790_10274 486
293 3300046474 Ga0495605_0017639 Ga0495605_0017639_2217_3710 486
294 3300046492 Ga0495585_0024365 Ga0495585_0024365_133_1626 486
295 3300046501 Ga0495607_0021315 Ga0495607_0021315_47_1540 486
296 3300046507 Ga0495606_0000004 Ga0495606_0000004_128149_129636 486
297 3300046512 Ga0495610_0000007 Ga0495610_0000007_530827_532311 486
298 3300046512 Ga0495610_0032257 Ga0495610_0032257_1099_2592 486
299 3300046519 Ga0495632_0000264 Ga0495632_0000264_49291_50784 486
300 3300046524 Ga0495648_0021974 Ga0495648_0021974_116_1600 486
301 3300046524 Ga0495648_0028330 Ga0495648_0028330_135_1619 486
302 3300046524 Ga0495648_0044367 Ga0495648_0044367_1151_2644 486
303 3300046558 Ga0495633_0064098 Ga0495633_0064098_115_1599 486
304 3300046616 Ga0495668_0000714 Ga0495668_0000714_177_1664 486
305 3300046616 Ga0495668_0007992 Ga0495668_0007992_5127_6620 486
306 3300046616 Ga0495668_0012545 Ga0495668_0012545_3300_4784 486
307 3300046665 Ga0495661_0020929 Ga0495661_0020929_563_2047 486
308 3300046692 Ga0495671_0000033 Ga0495671_0000033_178933_180417 486
309 3300046810 Ga0495660_0013849 Ga0495660_0013849_135_1619 486
310 3300047320 Ga0495672_0013539 Ga0495672_0013539_4032_5525 486
311 3300047323 Ga0495683_0019907 Ga0495683_0019907_1112_2596 486
312 3300047447 Ga0495685_003105 Ga0495685_003105_2057_3550 486
313 3300047469 Ga0495673_0000032 Ga0495673_0000032_317034_318518 486
314 3300047472 Ga0495686_0006443 Ga0495686_0006443_4239_5726 486
315 3300048091 Ga0495626_0018406 Ga0495626_0018406_133_1626 486
316 3300053145 Ga0500586_001393 Ga0500586_001393_226_1710 486
317 3300035725 Ga0373947_0089793 Ga0373947_0089793_39_1529 487
318 3300044693 Ga0466961_0001658 Ga0466961_0001658_6181_7653 487
319 3300046615 Ga0495656_0026412 Ga0495656_0026412_54_1553 487
320 iso_pu_bacteria 2643221554 2643789810 487
321 iso_pu_bacteria 2643221638 2644214468 487
322 iso_pu_bacteria 2842711865 2842713102 487
323 3300005435 Ga0070714_100001328 Ga0070714_1000013285 488
324 3300005445 Ga0070708_100013120 Ga0070708_1000131203 488
325 3300005467 Ga0070706_100025573 Ga0070706_1000255735 488
326 3300005468 Ga0070707_100009163 Ga0070707_1000091639 488
327 3300006028 Ga0070717_10000138 Ga0070717_100001389 488
328 3300006028 Ga0070717_10187262 Ga0070717_101872622 488
329 3300025910 Ga0207684_10028522 Ga0207684_100285222 488
330 3300025922 Ga0207646_10005544 Ga0207646_100055445 488
331 3300025922 Ga0207646_10032394 Ga0207646_100323944 488
332 3300046492 Ga0495585_0009685 Ga0495585_0009685_2697_4196 488
333 3300046513 Ga0495616_0013981 Ga0495616_0013981_17_1516 488
334 3300046525 Ga0495663_0004004 Ga0495663_0004004_1925_3424 488
335 3300046542 Ga0495597_0015409 Ga0495597_0015409_1361_2860 488
336 3300046558 Ga0495633_0015673 Ga0495633_0015673_16_1515 488
337 3300047318 Ga0495636_0004699 Ga0495636_0004699_3580_5076 488
338 3300002773 JGI25152J39213_1003586 JGI25152J39213_10035863 490
339 3300002774 JGI25150J39212_1002183 JGI25150J39212_10021831 490
340 3300002987 JGI25159J45721_1003997 JGI25159J45721_10039974 490
341 3300002987 JGI25159J45721_1004079 JGI25159J45721_10040793 490
342 3300003215 JGI25153J46596_10004507 JGI25153J46596_100045076 490
343 3300003354 JGI25160J50197_1005006 JGI25160J50197_10050064 490
344 3300003374 JGI25161J50226_1002268 JGI25161J50226_10022684 490
345 3300003374 JGI25161J50226_1002280 JGI25161J50226_10022803 490
346 3300003771 Ga0055526_1008101 Ga0055526_10081011 490
347 3300003771 Ga0055526_1008548 Ga0055526_10085483 490
348 3300003773 Ga0055537_1004396 Ga0055537_10043961 490
349 3300003775 Ga0055524_1002028 Ga0055524_10020289 490
350 3300003775 Ga0055524_1004397 Ga0055524_10043972 490
351 3300003775 Ga0055524_1006458 Ga0055524_10064583 490
352 3300003784 Ga0055534_1002808 Ga0055534_10028081 490
353 3300003791 Ga0055530_10006633 Ga0055530_100066334 490
354 3300004625 Ga0055543_1003018 Ga0055543_10030181 490
355 3300005262 Ga0065165_1029943 Ga0065165_10299431 490
356 3300013105 Ga0157369_10085370 Ga0157369_100853702 490
357 3300025208 Ga0209436_100529 Ga0209436_1005291 490
358 3300025208 Ga0209436_102729 Ga0209436_1027294 490
359 3300025245 Ga0207425_1000013 Ga0207425_1000013270 490
360 3300025245 Ga0207425_1002536 Ga0207425_10025365 490
361 3300025258 Ga0209129_1000106 Ga0209129_10001061 490
362 3300025258 Ga0209129_1006180 Ga0209129_10061801 490
363 3300025263 Ga0209565_1001529 Ga0209565_10015295 490
364 3300025263 Ga0209565_1015177 Ga0209565_10151771 490
365 3300025263 Ga0209565_1017862 Ga0209565_10178621 490
366 3300025284 Ga0209130_1001743 Ga0209130_10017431 490
367 3300025284 Ga0209130_1004648 Ga0209130_10046481 490
368 3300025291 Ga0209675_1001499 Ga0209675_10014996 490
369 3300025291 Ga0209675_1013774 Ga0209675_10137741 490
370 3300025295 Ga0209564_1000088 Ga0209564_1000088183 490
371 3300025295 Ga0209564_1002997 Ga0209564_10029979 490
372 3300025297 Ga0209758_1000031 Ga0209758_1000031194 490
373 3300025298 Ga0209050_1000078 Ga0209050_100007898 490
374 3300025298 Ga0209050_1003291 Ga0209050_10032919 490
375 3300025299 Ga0209256_1000305 Ga0209256_10003056 490
376 3300025299 Ga0209256_1000712 Ga0209256_100071234 490
377 3300025299 Ga0209256_1006321 Ga0209256_10063211 490
378 3300025302 Ga0207426_1002410 Ga0207426_10024107 490
379 3300025303 Ga0209051_1010576 Ga0209051_10105763 490
380 3300025304 Ga0209257_1000097 Ga0209257_100009776 490
381 3300031548 Ga0307408_100002206 Ga0307408_1000022068 490
382 3300031548 Ga0307408_100067452 Ga0307408_1000674521 490
383 3300044658 Ga0466972_0047778 Ga0466972_0047778_548_2032 490
384 3300044842 Ga0466957_0038741 Ga0466957_0038741_592_2076 490
385 3300045976 Ga0466967_0013799 Ga0466967_0013799_1080_2558 490
386 3300046491 Ga0495584_0006407 Ga0495584_0006407_291_1766 490
387 3300046492 Ga0495585_0003678 Ga0495585_0003678_8587_10062 490
388 3300046507 Ga0495606_0072411 Ga0495606_0072411_188_1663 490
389 3300046512 Ga0495610_0003047 Ga0495610_0003047_11085_12560 490
390 3300046522 Ga0495643_0062760 Ga0495643_0062760_252_1727 490
391 3300046538 Ga0495609_0002279 Ga0495609_0002279_10337_11815 490
392 3300046558 Ga0495633_0000094 Ga0495633_0000094_118813_120288 490
393 3300047469 Ga0495673_0009705 Ga0495673_0009705_1115_2590 490
394 3300049744 Ga0501083_0002059 Ga0501083_0002059_10589_12064 490
395 3300050514 nmdc:mga08x19_149369_c1 nmdc:mga08x19_149369_c1_47_1555 490
396 iso_pu_bacteria 2511231026 2511386024 490
397 iso_pu_bacteria 2643221645 2644249827 490
398 iso_pu_bacteria 2643221664 2644358497 490
399 iso_pu_bacteria 2738541280 2738739434 490
400 iso_pu_bacteria 2738541297 2738827688 490
401 iso_pu_bacteria 2738541300 2738846007 490
402 iso_pu_bacteria 2738541357 2739151484 490
403 iso_pu_bacteria 2738543003 2739193404 490
404 iso_pu_bacteria 2738543018 2739275840 490
405 iso_pu_bacteria 2738543026 2739319880 490
406 iso_pu_bacteria 2738543029 2739338121 490
407 iso_pu_bacteria 2738543030 2739344884 490
408 iso_pu_bacteria 2808606418 2809147249 490
409 iso_pu_bacteria 2821131069 2821135946 490
410 iso_pu_bacteria 2857553236 2857555657 490
411 iso_pu_bacteria 2857558681 2857561846 490
412 iso_pu_bacteria 2857564685 2857569315 490
413 iso_pu_bacteria 2904424332 2904429473 490
414 iso_pu_bacteria 2919476304 2919479297 490
415 3300005289 Ga0065704_10093677 Ga0065704_100936771 491
416 3300021361 Ga0213872_10001135 Ga0213872_1000113512 491
417 3300031548 Ga0307408_100002135 Ga0307408_1000021355 491
418 3300031901 Ga0307406_10001008 Ga0307406_1000100810 491
419 3300031995 Ga0307409_100000481 Ga0307409_1000004813 491
420 3300032004 Ga0307414_10024771 Ga0307414_100247713 491
421 3300044693 Ga0466961_0034721 Ga0466961_0034721_795_2279 491
422 3300046471 Ga0495650_0008243 Ga0495650_0008243_4231_5709 491
423 3300046694 Ga0495649_0000648 Ga0495649_0000648_134_1618 491
424 3300047470 Ga0495681_0001145 Ga0495681_0001145_18532_20010 491
425 3300048924 Ga0496121_0012095 Ga0496121_0012095_158_1654 491
426 iso_pu_bacteria 2884215851 2884219335 491
427 iso_pu_bacteria 8057160832 8057161380 491
428 3300002987 JGI25159J45721_1005468 JGI25159J45721_10054684 492
429 3300003775 Ga0055524_1000022 Ga0055524_1000022223 492
430 3300003784 Ga0055534_1000254 Ga0055534_100025413 492
431 3300003790 Ga0055528_1000031 Ga0055528_100003136 492
432 3300003791 Ga0055530_10006375 Ga0055530_100063751 492
433 3300005262 Ga0065165_1002165 Ga0065165_10021651 492
434 3300005530 Ga0070679_100032747 Ga0070679_1000327472 492
435 3300006852 Ga0075433_10049441 Ga0075433_100494412 492
436 3300009147 Ga0114129_10004035 Ga0114129_1000403511 492
437 3300013105 Ga0157369_10009230 Ga0157369_100092302 492
438 3300013307 Ga0157372_10041737 Ga0157372_100417373 492
439 3300025208 Ga0209436_111418 Ga0209436_1114181 492
440 3300025263 Ga0209565_1000035 Ga0209565_1000035145 492
441 3300025273 Ga0209673_1000006 Ga0209673_1000006235 492
442 3300025284 Ga0209130_1002565 Ga0209130_10025651 492
443 3300025291 Ga0209675_1000005 Ga0209675_1000005537 492
444 3300025295 Ga0209564_1000083 Ga0209564_100008399 492
445 3300025299 Ga0209256_1000035 Ga0209256_1000035223 492
446 3300025299 Ga0209256_1000141 Ga0209256_100014113 492
447 3300025302 Ga0207426_1011253 Ga0207426_10112531 492
448 3300025913 Ga0207695_10000001 Ga0207695_100000012291 492
449 3300025921 Ga0207652_10022861 Ga0207652_100228614 492
450 3300026142 Ga0207698_10016019 Ga0207698_100160194 492
451 3300027666 Ga0209282_1000003 Ga0209282_1000003189 492
452 3300031240 Ga0265320_10003087 Ga0265320_100030877 492
453 3300044673 Ga0453683_0011657 Ga0453683_0011657_4261_5748 492
454 3300044712 Ga0453684_0001278 Ga0453684_0001278_67869_69356 492
455 3300044712 Ga0453684_0020326 Ga0453684_0020326_7866_9353 492
456 3300044712 Ga0453684_0052242 Ga0453684_0052242_679_2166 492
457 3300045051 Ga0451576_0003537 Ga0451576_0003537_10560_12047 492
458 3300046452 Ga0495617_000515 Ga0495617_000515_18507_19997 492
459 3300046453 Ga0495627_019607 Ga0495627_019607_75_1577 492
460 3300046458 Ga0495591_000132 Ga0495591_000132_66378_67883 492
461 3300046460 Ga0495638_0003837 Ga0495638_0003837_10160_11650 492
462 3300046474 Ga0495605_0026450 Ga0495605_0026450_282_1772 492
463 3300046491 Ga0495584_0000883 Ga0495584_0000883_127_1632 492
464 3300046491 Ga0495584_0001234 Ga0495584_0001234_566_2065 492
465 3300046491 Ga0495584_0001667 Ga0495584_0001667_6074_7564 492
466 3300046491 Ga0495584_0009117 Ga0495584_0009117_55_1548 492
467 3300046492 Ga0495585_0000022 Ga0495585_0000022_20195_21685 492
468 3300046492 Ga0495585_0000113 Ga0495585_0000113_19325_20815 492
469 3300046492 Ga0495585_0001317 Ga0495585_0001317_4993_6492 492
470 3300046492 Ga0495585_0052816 Ga0495585_0052816_133_1638 492
471 3300046500 Ga0495596_0002530 Ga0495596_0002530_8199_9701 492
472 3300046500 Ga0495596_0018066 Ga0495596_0018066_553_2052 492
473 3300046501 Ga0495607_0005885 Ga0495607_0005885_2718_4208 492
474 3300046501 Ga0495607_0050374 Ga0495607_0050374_174_1679 492
475 3300046501 Ga0495607_0056529 Ga0495607_0056529_696_2186 492
476 3300046506 Ga0495583_0000116 Ga0495583_0000116_17520_19013 492
477 3300046506 Ga0495583_0000183 Ga0495583_0000183_12092_13582 492
478 3300046506 Ga0495583_0001913 Ga0495583_0001913_126_1619 492
479 3300046506 Ga0495583_0005154 Ga0495583_0005154_7354_8859 492
480 3300046512 Ga0495610_0006005 Ga0495610_0006005_6144_7649 492
481 3300046513 Ga0495616_0000886 Ga0495616_0000886_19990_21489 492
482 3300046513 Ga0495616_0005161 Ga0495616_0005161_226_1716 492
483 3300046513 Ga0495616_0033232 Ga0495616_0033232_922_2412 492
484 3300046513 Ga0495616_0033430 Ga0495616_0033430_659_2158 492
485 3300046518 Ga0495631_0020337 Ga0495631_0020337_1484_2986 492
486 3300046519 Ga0495632_0001647 Ga0495632_0001647_9308_10801 492
487 3300046519 Ga0495632_0020470 Ga0495632_0020470_125_1618 492
488 3300046519 Ga0495632_0025914 Ga0495632_0025914_115_1620 492
489 3300046520 Ga0495637_0000028 Ga0495637_0000028_76321_77826 492
490 3300046522 Ga0495643_0009285 Ga0495643_0009285_3590_5083 492
491 3300046522 Ga0495643_0018085 Ga0495643_0018085_2473_3978 492
492 3300046523 Ga0495644_0000816 Ga0495644_0000816_6511_8001 492
493 3300046523 Ga0495644_0002483 Ga0495644_0002483_1983_3473 492
494 3300046523 Ga0495644_0016166 Ga0495644_0016166_151_1644 492
495 3300046524 Ga0495648_0000959 Ga0495648_0000959_28032_29522 492
496 3300046524 Ga0495648_0002004 Ga0495648_0002004_3162_4652 492
497 3300046528 Ga0495642_0004047 Ga0495642_0004047_4131_5624 492
498 3300046538 Ga0495609_0000637 Ga0495609_0000637_20863_22353 492
499 3300046538 Ga0495609_0010356 Ga0495609_0010356_278_1768 492
500 3300046538 Ga0495609_0022949 Ga0495609_0022949_120_1613 492
501 3300046558 Ga0495633_0005634 Ga0495633_0005634_179_1678 492
502 3300046558 Ga0495633_0012968 Ga0495633_0012968_565_2055 492
503 3300046558 Ga0495633_0049565 Ga0495633_0049565_278_1768 492
504 3300046616 Ga0495668_0000136 Ga0495668_0000136_69295_70785 492
505 3300046616 Ga0495668_0058272 Ga0495668_0058272_488_1981 492
506 3300046648 Ga0495611_0001165 Ga0495611_0001165_12189_13691 492
507 3300046648 Ga0495611_0002506 Ga0495611_0002506_127_1632 492
508 3300046648 Ga0495611_0003911 Ga0495611_0003911_4821_6311 492
509 3300046648 Ga0495611_0039831 Ga0495611_0039831_227_1717 492
510 3300046660 Ga0495625_0002385 Ga0495625_0002385_9278_10768 492
511 3300046660 Ga0495625_0113768 Ga0495625_0113768_126_1616 492
512 3300046664 Ga0495659_0002583 Ga0495659_0002583_1107_2597 492
513 3300046664 Ga0495659_0005015 Ga0495659_0005015_2422_3912 492
514 3300046665 Ga0495661_0012446 Ga0495661_0012446_1489_2979 492
515 3300046665 Ga0495661_0012907 Ga0495661_0012907_84_1589 492
516 3300046665 Ga0495661_0037594 Ga0495661_0037594_334_1824 492
517 3300046665 Ga0495661_0065189 Ga0495661_0065189_312_1811 492
518 3300046684 Ga0495669_0011001 Ga0495669_0011001_1235_2725 492
519 3300046684 Ga0495669_0011379 Ga0495669_0011379_186_1679 492
520 3300046691 Ga0495670_0004297 Ga0495670_0004297_2329_3819 492
521 3300046691 Ga0495670_0036782 Ga0495670_0036782_590_2083 492
522 3300046691 Ga0495670_0055260 Ga0495670_0055260_278_1768 492
523 3300046692 Ga0495671_0003539 Ga0495671_0003539_8024_9523 492
524 3300046694 Ga0495649_0007907 Ga0495649_0007907_4883_6376 492
525 3300046794 Ga0495589_0072146 Ga0495589_0072146_55_1560 492
526 3300046810 Ga0495660_0081097 Ga0495660_0081097_53_1543 492
527 3300047318 Ga0495636_0012459 Ga0495636_0012459_1796_3286 492
528 3300047320 Ga0495672_0001291 Ga0495672_0001291_18600_20096 492
529 3300047320 Ga0495672_0002747 Ga0495672_0002747_202_1707 492
530 3300047320 Ga0495672_0008317 Ga0495672_0008317_4609_6099 492
531 3300047320 Ga0495672_0027727 Ga0495672_0027727_2042_3535 492
532 3300047320 Ga0495672_0029428 Ga0495672_0029428_259_1749 492
533 3300047321 Ga0495676_0000135 Ga0495676_0000135_35061_36569 492
534 3300047323 Ga0495683_0000330 Ga0495683_0000330_202_1707 492
535 3300047323 Ga0495683_0003371 Ga0495683_0003371_617_2116 492
536 3300047323 Ga0495683_0004322 Ga0495683_0004322_227_1717 492
537 3300047323 Ga0495683_0026959 Ga0495683_0026959_419_1909 492
538 3300047443 Ga0495687_000609 Ga0495687_000609_25512_27002 492
539 3300047443 Ga0495687_021690 Ga0495687_021690_1489_2979 492
540 3300047445 Ga0495677_0005109 Ga0495677_0005109_1459_2949 492
541 3300047445 Ga0495677_0009064 Ga0495677_0009064_2014_3504 492
542 3300047445 Ga0495677_0019627 Ga0495677_0019627_190_1680 492
543 3300047446 Ga0495679_007244 Ga0495679_007244_806_2296 492
544 3300047446 Ga0495679_032214 Ga0495679_032214_46_1551 492
545 3300047447 Ga0495685_000110 Ga0495685_000110_9545_11035 492
546 3300047447 Ga0495685_017583 Ga0495685_017583_464_1954 492
547 3300047469 Ga0495673_0005363 Ga0495673_0005363_2204_3694 492
548 3300047470 Ga0495681_0006452 Ga0495681_0006452_3424_4914 492
549 3300047470 Ga0495681_0037378 Ga0495681_0037378_746_2251 492
550 3300047472 Ga0495686_0003368 Ga0495686_0003368_194_1684 492
551 3300047673 Ga0495593_0010408 Ga0495593_0010408_3362_4855 492
552 3300048091 Ga0495626_0029337 Ga0495626_0029337_968_2464 492
553 3300048091 Ga0495626_0029831 Ga0495626_0029831_117_1619 492
554 3300048091 Ga0495626_0048822 Ga0495626_0048822_319_1812 492
555 3300048903 Ga0496100_0059791 Ga0496100_0059791_724_2223 492
556 3300048904 Ga0496101_0010598 Ga0496101_0010598_4574_6073 492
557 3300048918 Ga0496115_0142663 Ga0496115_0142663_428_1915 492
558 3300049459 Ga0495678_002015 Ga0495678_002015_1157_2647 492
559 3300049459 Ga0495678_004801 Ga0495678_004801_6133_7638 492
560 3300049459 Ga0495678_021395 Ga0495678_021395_1206_2699 492
561 3300049460 Ga0495682_0003258 Ga0495682_0003258_3797_5287 492
562 3300050507 nmdc:mga05p37_6267_c1 nmdc:mga05p37_6267_c1_7540_9024 492
563 3300050510 nmdc:mga06r32_34139_c1 nmdc:mga06r32_34139_c1_76_1560 492
564 3300002774 JGI25150J39212_1010346 JGI25150J39212_10103461 493
565 3300003763 Ga0055529_1000027 Ga0055529_1000027264 493
566 3300003771 Ga0055526_1005264 Ga0055526_10052641 493
567 3300003771 Ga0055526_1009279 Ga0055526_10092791 493
568 3300005366 Ga0070659_100110036 Ga0070659_1001100362 493
569 3300005457 Ga0070662_100077482 Ga0070662_1000774822 493
570 3300005548 Ga0070665_100005374 Ga0070665_1000053742 493
571 3300009036 Ga0105244_10008170 Ga0105244_100081705 493
572 3300015261 Ga0182006_1000169 Ga0182006_10001691 493
573 3300015265 Ga0182005_1000003 Ga0182005_1000003528 493
574 3300021361 Ga0213872_10000622 Ga0213872_100006224 493
575 3300021361 Ga0213872_10009107 Ga0213872_100091072 493
576 3300021361 Ga0213872_10038615 Ga0213872_100386152 493
577 3300021361 Ga0213872_10040523 Ga0213872_100405231 493
578 3300025245 Ga0207425_1001817 Ga0207425_10018173 493
579 3300025246 Ga0209646_1000126 Ga0209646_100012657 493
580 3300025272 Ga0209455_1000033 Ga0209455_1000033181 493
581 3300025294 Ga0209025_1001104 Ga0209025_100110428 493
582 3300025295 Ga0209564_1000028 Ga0209564_1000028223 493
583 3300025295 Ga0209564_1000032 Ga0209564_1000032373 493
584 3300025297 Ga0209758_1000343 Ga0209758_100034328 493
585 3300025933 Ga0207706_10112979 Ga0207706_101129792 493
586 3300026067 Ga0207678_10002725 Ga0207678_100027255 493
587 3300026067 Ga0207678_10203023 Ga0207678_102030231 493
588 3300026088 Ga0207641_10042901 Ga0207641_100429013 493
589 3300028379 Ga0268266_10002274 Ga0268266_1000227412 493
590 3300028379 Ga0268266_10007538 Ga0268266_100075386 493
591 3300028379 Ga0268266_10014702 Ga0268266_100147022 493
592 3300031548 Ga0307408_100001264 Ga0307408_10000126413 493
593 3300033180 Ga0307510_10168753 Ga0307510_101687532 493
594 3300037853 Ga0436364_0602549 Ga0436364_0602549_517_1998 493
595 3300039447 Ga0436361_0059946 Ga0436361_0059946_648_2132 493
596 3300039447 Ga0436361_0063197 Ga0436361_0063197_1501_2985 493
597 3300039447 Ga0436361_0174205 Ga0436361_0174205_744_2228 493
598 3300039447 Ga0436361_0615119 Ga0436361_0615119_1469_2953 493
599 3300039447 Ga0436361_0701338 Ga0436361_0701338_15268_16761 493
600 3300044901 Ga0466960_0053673 Ga0466960_0053673_287_1789 493
601 3300046453 Ga0495627_000016 Ga0495627_000016_191269_192774 493
602 3300046457 Ga0495590_0000058 Ga0495590_0000058_25620_27107 493
603 3300046459 Ga0495629_0004226 Ga0495629_0004226_6190_7695 493
604 3300046460 Ga0495638_0000627 Ga0495638_0000627_37374_38861 493
605 3300046460 Ga0495638_0007268 Ga0495638_0007268_6242_7741 493
606 3300046463 Ga0495653_0000014 Ga0495653_0000014_14670_16154 493
607 3300046463 Ga0495653_0012633 Ga0495653_0012633_157_1653 493
608 3300046471 Ga0495650_0000146 Ga0495650_0000146_134767_136257 493
609 3300046471 Ga0495650_0000334 Ga0495650_0000334_66090_67577 493
610 3300046471 Ga0495650_0000463 Ga0495650_0000463_41151_42647 493
611 3300046471 Ga0495650_0001265 Ga0495650_0001265_15558_17042 493
612 3300046471 Ga0495650_0002431 Ga0495650_0002431_13421_14908 493
613 3300046471 Ga0495650_0019882 Ga0495650_0019882_167_1654 493
614 3300046474 Ga0495605_0000010 Ga0495605_0000010_55737_57224 493
615 3300046474 Ga0495605_0042993 Ga0495605_0042993_131_1633 493
616 3300046491 Ga0495584_0006181 Ga0495584_0006181_4178_5680 493
617 3300046492 Ga0495585_0005593 Ga0495585_0005593_854_2359 493
618 3300046499 Ga0495594_0006383 Ga0495594_0006383_4072_5559 493
619 3300046499 Ga0495594_0023607 Ga0495594_0023607_1717_3204 493
620 3300046500 Ga0495596_0001100 Ga0495596_0001100_13601_15103 493
621 3300046500 Ga0495596_0005078 Ga0495596_0005078_4532_6031 493
622 3300046501 Ga0495607_0002162 Ga0495607_0002162_713_2200 493
623 3300046501 Ga0495607_0025322 Ga0495607_0025322_1374_2858 493
624 3300046506 Ga0495583_0000346 Ga0495583_0000346_54857_56344 493
625 3300046507 Ga0495606_0003214 Ga0495606_0003214_198_1682 493
626 3300046507 Ga0495606_0006492 Ga0495606_0006492_155_1645 493
627 3300046507 Ga0495606_0027391 Ga0495606_0027391_2416_3903 493
628 3300046512 Ga0495610_0021828 Ga0495610_0021828_188_1672 493
629 3300046513 Ga0495616_0040695 Ga0495616_0040695_701_2188 493
630 3300046517 Ga0495630_0045119 Ga0495630_0045119_1553_3046 493
631 3300046518 Ga0495631_0003968 Ga0495631_0003968_5745_7250 493
632 3300046520 Ga0495637_0049662 Ga0495637_0049662_93_1577 493
633 3300046522 Ga0495643_0001967 Ga0495643_0001967_15521_17005 493
634 3300046522 Ga0495643_0001996 Ga0495643_0001996_15324_16811 493
635 3300046524 Ga0495648_0000004 Ga0495648_0000004_105659_107146 493
636 3300046524 Ga0495648_0005916 Ga0495648_0005916_8311_9795 493
637 3300046526 Ga0495666_0009729 Ga0495666_0009729_3089_4594 493
638 3300046528 Ga0495642_0001389 Ga0495642_0001389_60_1547 493
639 3300046528 Ga0495642_0003344 Ga0495642_0003344_366_1868 493
640 3300046528 Ga0495642_0020605 Ga0495642_0020605_970_2454 493
641 3300046528 Ga0495642_0029962 Ga0495642_0029962_631_2127 493
642 3300046529 Ga0495652_0101639 Ga0495652_0101639_99_1604 493
643 3300046530 Ga0495654_0000034 Ga0495654_0000034_927_2411 493
644 3300046530 Ga0495654_0003671 Ga0495654_0003671_7674_9185 493
645 3300046530 Ga0495654_0008297 Ga0495654_0008297_3524_5026 493
646 3300046531 Ga0495665_0017370 Ga0495665_0017370_376_1884 493
647 3300046535 Ga0495586_0032273 Ga0495586_0032273_654_2159 493
648 3300046535 Ga0495586_0065506 Ga0495586_0065506_35_1531 493
649 3300046536 Ga0495587_0012562 Ga0495587_0012562_211_1716 493
650 3300046536 Ga0495587_0034917 Ga0495587_0034917_1289_2782 493
651 3300046538 Ga0495609_0014619 Ga0495609_0014619_1865_3364 493
652 3300046542 Ga0495597_0001037 Ga0495597_0001037_163_1650 493
653 3300046542 Ga0495597_0003215 Ga0495597_0003215_1580_3064 493
654 3300046542 Ga0495597_0007545 Ga0495597_0007545_589_2091 493
655 3300046542 Ga0495597_0053026 Ga0495597_0053026_134_1633 493
656 3300046557 Ga0495622_0000431 Ga0495622_0000431_16719_18206 493
657 3300046557 Ga0495622_0007772 Ga0495622_0007772_1351_2856 493
658 3300046558 Ga0495633_0000068 Ga0495633_0000068_122732_124219 493
659 3300046558 Ga0495633_0020466 Ga0495633_0020466_771_2276 493
660 3300046615 Ga0495656_0003394 Ga0495656_0003394_266_1771 493
661 3300046616 Ga0495668_0001987 Ga0495668_0001987_16230_17717 493
662 3300046616 Ga0495668_0027644 Ga0495668_0027644_1553_3037 493
663 3300046642 Ga0495634_0003581 Ga0495634_0003581_243_1739 493
664 3300046660 Ga0495625_0000046 Ga0495625_0000046_6098_7603 493
665 3300046660 Ga0495625_0000257 Ga0495625_0000257_64209_65696 493
666 3300046660 Ga0495625_0007669 Ga0495625_0007669_192_1679 493
667 3300046660 Ga0495625_0009636 Ga0495625_0009636_3727_5226 493
668 3300046660 Ga0495625_0016122 Ga0495625_0016122_4090_5577 493
669 3300046660 Ga0495625_0031109 Ga0495625_0031109_225_1709 493
670 3300046664 Ga0495659_0000025 Ga0495659_0000025_58453_59964 493
671 3300046665 Ga0495661_0001306 Ga0495661_0001306_781_2286 493
672 3300046665 Ga0495661_0098897 Ga0495661_0098897_123_1607 493
673 3300046665 Ga0495661_0104381 Ga0495661_0104381_23_1507 493
674 3300046674 Ga0495588_0000050 Ga0495588_0000050_325627_327117 493
675 3300046678 Ga0495599_0118315 Ga0495599_0118315_37_1542 493
676 3300046679 Ga0495623_0011122 Ga0495623_0011122_4154_5647 493
677 3300046684 Ga0495669_0000095 Ga0495669_0000095_20633_22135 493
678 3300046684 Ga0495669_0002966 Ga0495669_0002966_1915_3414 493
679 3300046689 Ga0495613_0021326 Ga0495613_0021326_102_1589 493
680 3300046689 Ga0495613_0040265 Ga0495613_0040265_1705_3201 493
681 3300046689 Ga0495613_0041728 Ga0495613_0041728_939_2447 493
682 3300046689 Ga0495613_0130855 Ga0495613_0130855_210_1715 493
683 3300046690 Ga0495624_0005313 Ga0495624_0005313_1192_2700 493
684 3300046691 Ga0495670_0001130 Ga0495670_0001130_10672_12177 493
685 3300046692 Ga0495671_0000701 Ga0495671_0000701_10740_12251 493
686 3300046694 Ga0495649_0003498 Ga0495649_0003498_221_1705 493
687 3300046794 Ga0495589_0023884 Ga0495589_0023884_1019_2521 493
688 3300046809 Ga0495600_0119861 Ga0495600_0119861_38_1543 493
689 3300046810 Ga0495660_0008483 Ga0495660_0008483_129_1634 493
690 3300047315 Ga0495581_0006656 Ga0495581_0006656_760_2268 493
691 3300047317 Ga0495604_0071133 Ga0495604_0071133_285_1778 493
692 3300047318 Ga0495636_0007204 Ga0495636_0007204_162_1649 493
693 3300047319 Ga0495674_0007930 Ga0495674_0007930_5460_6947 493
694 3300047320 Ga0495672_0000099 Ga0495672_0000099_282_1766 493
695 3300047320 Ga0495672_0000508 Ga0495672_0000508_24109_25620 493
696 3300047443 Ga0495687_001605 Ga0495687_001605_13833_15335 493
697 3300047443 Ga0495687_016404 Ga0495687_016404_486_1988 493
698 3300047444 Ga0495675_0032829 Ga0495675_0032829_196_1689 493
699 3300047445 Ga0495677_0003116 Ga0495677_0003116_746_2251 493
700 3300047469 Ga0495673_0000031 Ga0495673_0000031_156592_158082 493
701 3300047470 Ga0495681_0011831 Ga0495681_0011831_1928_3433 493
702 3300047470 Ga0495681_0019724 Ga0495681_0019724_2033_3532 493
703 3300047472 Ga0495686_0004791 Ga0495686_0004791_281_1786 493
704 3300048088 Ga0495602_0018108 Ga0495602_0018108_260_1753 493
705 3300048091 Ga0495626_0002032 Ga0495626_0002032_12490_13992 493
706 3300048091 Ga0495626_0005264 Ga0495626_0005264_3718_5205 493
707 3300048091 Ga0495626_0006906 Ga0495626_0006906_4058_5557 493
708 3300048091 Ga0495626_0012465 Ga0495626_0012465_664_2154 493
709 3300048905 Ga0496102_0000202 Ga0496102_0000202_25845_27338 493
710 3300048905 Ga0496102_0016243 Ga0496102_0016243_4449_5939 493
711 3300048906 Ga0496103_0003201 Ga0496103_0003201_6391_7884 493
712 3300048906 Ga0496103_0003638 Ga0496103_0003638_4267_5766 493
713 3300048906 Ga0496103_0048237 Ga0496103_0048237_949_2442 493
714 3300048911 Ga0496108_0180441 Ga0496108_0180441_126_1610 493
715 3300048926 Ga0496123_0002080 Ga0496123_0002080_1222_2712 493
716 3300048927 Ga0496124_0053150 Ga0496124_0053150_574_2079 493
717 3300048929 Ga0496126_0000187 Ga0496126_0000187_55793_57295 493
718 3300049459 Ga0495678_000001 Ga0495678_000001_612140_613645 493
719 3300049459 Ga0495678_000189 Ga0495678_000189_24047_25531 493
720 3300049766 Ga0501269_000408 Ga0501269_000408_6435_7934 493
721 3300053119 Ga0500595_001478 Ga0500595_001478_1575_3242 493
722 3300005327 Ga0070658_10000046 Ga0070658_1000004697 494
723 3300005328 Ga0070676_10006446 Ga0070676_100064462 494
724 3300005329 Ga0070683_100032958 Ga0070683_1000329583 494
725 3300005339 Ga0070660_100051141 Ga0070660_1000511411 494
726 3300005343 Ga0070687_100005339 Ga0070687_1000053392 494
727 3300005347 Ga0070668_100054943 Ga0070668_1000549432 494
728 3300005353 Ga0070669_100021945 Ga0070669_1000219453 494
729 3300005366 Ga0070659_100002179 Ga0070659_1000021798 494
730 3300005436 Ga0070713_100033721 Ga0070713_1000337212 494
731 3300005441 Ga0070700_100012722 Ga0070700_1000127222 494
732 3300005455 Ga0070663_100142610 Ga0070663_1001426101 494
733 3300005457 Ga0070662_100033559 Ga0070662_1000335592 494
734 3300005530 Ga0070679_100096336 Ga0070679_1000963361 494
735 3300005539 Ga0068853_100000021 Ga0068853_100000021136 494
736 3300005539 Ga0068853_100094885 Ga0068853_1000948852 494
737 3300005563 Ga0068855_100003678 Ga0068855_1000036786 494
738 3300005578 Ga0068854_100000075 Ga0068854_1000000751 494
739 3300005719 Ga0068861_100009161 Ga0068861_1000091613 494
740 3300005840 Ga0068870_10003915 Ga0068870_100039153 494
741 3300005844 Ga0068862_100016419 Ga0068862_1000164194 494
742 3300006844 Ga0075428_100005570 Ga0075428_1000055709 494
743 3300006847 Ga0075431_100017090 Ga0075431_1000170903 494
744 3300006847 Ga0075431_100067431 Ga0075431_1000674312 494
745 3300006847 Ga0075431_100122062 Ga0075431_1001220622 494
746 3300009093 Ga0105240_10003871 Ga0105240_1000387117 494
747 3300009093 Ga0105240_10039372 Ga0105240_100393722 494
748 3300009093 Ga0105240_10055880 Ga0105240_100558803 494
749 3300009094 Ga0111539_10002412 Ga0111539_1000241210 494
750 3300009094 Ga0111539_10022661 Ga0111539_100226612 494
751 3300009553 Ga0105249_10172446 Ga0105249_101724461 494
752 3300013104 Ga0157370_10025270 Ga0157370_100252705 494
753 3300013104 Ga0157370_10025427 Ga0157370_100254273 494
754 3300013104 Ga0157370_10090329 Ga0157370_100903292 494
755 3300013105 Ga0157369_10056938 Ga0157369_100569382 494
756 3300013307 Ga0157372_10006882 Ga0157372_100068822 494
757 3300025908 Ga0207643_10011795 Ga0207643_100117953 494
758 3300025909 Ga0207705_10000064 Ga0207705_1000006412 494
759 3300025909 Ga0207705_10000465 Ga0207705_1000046518 494
760 3300025909 Ga0207705_10032829 Ga0207705_100328292 494
761 3300025913 Ga0207695_10007257 Ga0207695_100072579 494
762 3300025919 Ga0207657_10002434 Ga0207657_100024349 494
763 3300025919 Ga0207657_10039626 Ga0207657_100396263 494
764 3300025921 Ga0207652_10028868 Ga0207652_100288682 494
765 3300025932 Ga0207690_10003564 Ga0207690_100035647 494
766 3300025933 Ga0207706_10000581 Ga0207706_1000058119 494
767 3300025940 Ga0207691_10000582 Ga0207691_100005825 494
768 3300025944 Ga0207661_10017562 Ga0207661_100175622 494
769 3300025949 Ga0207667_10000389 Ga0207667_1000038913 494
770 3300025949 Ga0207667_10073217 Ga0207667_100732172 494
771 3300025961 Ga0207712_10089446 Ga0207712_100894462 494
772 3300025981 Ga0207640_10000034 Ga0207640_1000003442 494
773 3300026041 Ga0207639_10000035 Ga0207639_10000035133 494
774 3300026067 Ga0207678_10011837 Ga0207678_100118375 494
775 3300026067 Ga0207678_10040299 Ga0207678_100402992 494
776 3300026075 Ga0207708_10016949 Ga0207708_100169493 494
777 3300026089 Ga0207648_10002956 Ga0207648_1000295613 494
778 3300026116 Ga0207674_10002393 Ga0207674_100023937 494
779 3300026118 Ga0207675_100000780 Ga0207675_10000078019 494
780 3300026121 Ga0207683_10125124 Ga0207683_101251242 494
781 3300027614 Ga0209970_1002556 Ga0209970_10025562 494
782 3300027617 Ga0210002_1000808 Ga0210002_10008082 494
783 3300027682 Ga0209971_1000112 Ga0209971_100011211 494
784 3300027717 Ga0209998_10000764 Ga0209998_100007643 494
785 3300027876 Ga0209974_10000147 Ga0209974_1000014713 494
786 3300027907 Ga0207428_10120500 Ga0207428_101205002 494
787 3300028380 Ga0268265_10005212 Ga0268265_100052122 494
788 3300031238 Ga0265332_10029155 Ga0265332_100291552 494
789 3300031239 Ga0265328_10018909 Ga0265328_100189092 494
790 3300031250 Ga0265331_10000881 Ga0265331_1000088110 494
791 3300031711 Ga0265314_10000550 Ga0265314_100005508 494
792 3300035092 Ga0373952_0002488 Ga0373952_0002488_1392_2879 494
793 3300049581 Ga0501047_0041763 Ga0501047_0041763_510_2012 494
794 3300049589 Ga0501073_0030634 Ga0501073_0030634_846_2348 494
795 3300049591 Ga0501075_0033578 Ga0501075_0033578_1291_2787 494
796 3300049742 Ga0501080_0146091 Ga0501080_0146091_606_2108 494
797 3300049822 Ga0501035_0079122 Ga0501035_0079122_532_2028 494
798 3300049824 Ga0501045_0021073 Ga0501045_0021073_2326_3822 494
799 3300050508 nmdc:mga09592_81705_c1 nmdc:mga09592_81705_c1_985_2481 494
800 3300050510 nmdc:mga06r32_25770_c1 nmdc:mga06r32_25770_c1_1539_3035 494
801 3300050510 nmdc:mga06r32_60012_c1 nmdc:mga06r32_60012_c1_521_2017 494
802 3300050511 nmdc:mga08y16_224468_c1 nmdc:mga08y16_224468_c1_265_1761 494
803 3300050511 nmdc:mga08y16_25838_c1 nmdc:mga08y16_25838_c1_2413_3900 494
804 3300050511 nmdc:mga08y16_30646_c1 nmdc:mga08y16_30646_c1_1337_2833 494
805 iso_pu_bacteria 2582581278 2585143572 494
806 iso_pu_bacteria 2585428183 2588215859 494
807 iso_pu_bacteria 2585428187 2588234594 494
808 iso_pu_bacteria 2739367874 2740060416 494
809 iso_pu_bacteria 2765235839 2765575666 494
810 iso_pu_bacteria 2871720351 2871723592 494
811 iso_pu_bacteria 2945924605 2945924813 494
812 3300005340 Ga0070689_100036095 Ga0070689_1000360952 495
813 3300005356 Ga0070674_100059418 Ga0070674_1000594182 495
814 3300005445 Ga0070708_100083628 Ga0070708_1000836282 495
815 3300005458 Ga0070681_10010965 Ga0070681_100109657 495
816 3300005467 Ga0070706_100011228 Ga0070706_1000112282 495
817 3300005471 Ga0070698_100083291 Ga0070698_1000832912 495
818 3300005549 Ga0070704_100006379 Ga0070704_1000063795 495
819 3300005841 Ga0068863_100212510 Ga0068863_1002125102 495
820 3300005844 Ga0068862_100000833 Ga0068862_1000008335 495
821 3300006846 Ga0075430_100009725 Ga0075430_1000097255 495
822 3300006871 Ga0075434_100001516 Ga0075434_10000151612 495
823 3300009147 Ga0114129_10037872 Ga0114129_100378722 495
824 3300009147 Ga0114129_10060493 Ga0114129_100604932 495
825 3300009176 Ga0105242_10024217 Ga0105242_100242172 495
826 3300009176 Ga0105242_10121218 Ga0105242_101212181 495
827 3300009177 Ga0105248_10302373 Ga0105248_103023731 495
828 3300009553 Ga0105249_10094420 Ga0105249_100944202 495
829 3300013308 Ga0157375_10050708 Ga0157375_100507083 495
830 3300025910 Ga0207684_10056818 Ga0207684_100568184 495
831 3300025910 Ga0207684_10094319 Ga0207684_100943192 495
832 3300025922 Ga0207646_10135794 Ga0207646_101357942 495
833 3300025934 Ga0207686_10003047 Ga0207686_100030476 495
834 3300025941 Ga0207711_10082800 Ga0207711_100828001 495
835 3300026089 Ga0207648_10162535 Ga0207648_101625352 495
836 3300026118 Ga0207675_100038441 Ga0207675_1000384412 495
837 3300028380 Ga0268265_10000564 Ga0268265_1000056412 495
838 3300031691 Ga0316579_10007937 Ga0316579_100079373 495
839 3300032002 Ga0307416_100271114 Ga0307416_1002711141 495
840 3300036647 Ga0316582_0036835 Ga0316582_0036835_287_1792 495
841 3300044712 Ga0453684_0014990 Ga0453684_0014990_7464_8957 495
842 3300046538 Ga0495609_0001435 Ga0495609_0001435_14127_15686 495
843 3300046810 Ga0495660_0008202 Ga0495660_0008202_4009_5568 495
844 3300046810 Ga0495660_0051564 Ga0495660_0051564_102_1661 495
845 3300047315 Ga0495581_0075958 Ga0495581_0075958_93_1586 495
846 3300048919 Ga0496116_0008818 Ga0496116_0008818_4128_5687 495
847 3300049568 Ga0501031_0001950 Ga0501031_0001950_2617_4119 495
848 3300049568 Ga0501031_0012585 Ga0501031_0012585_86_1588 495
849 3300049569 Ga0501032_0004384 Ga0501032_0004384_1682_3184 495
850 3300049569 Ga0501032_0092269 Ga0501032_0092269_359_1870 495
851 3300049569 Ga0501032_0103092 Ga0501032_0103092_54_1556 495
852 3300049570 Ga0501033_0002590 Ga0501033_0002590_11357_12859 495
853 3300049571 Ga0501034_0015686 Ga0501034_0015686_5120_6622 495
854 3300049572 Ga0501036_0007597 Ga0501036_0007597_815_2317 495
855 3300049573 Ga0501037_0001188 Ga0501037_0001188_2559_4070 495
856 3300049573 Ga0501037_0003642 Ga0501037_0003642_9590_11092 495
857 3300049573 Ga0501037_0036042 Ga0501037_0036042_31_1533 495
858 3300049573 Ga0501037_0111887 Ga0501037_0111887_10_1512 495
859 3300049574 Ga0501038_0009183 Ga0501038_0009183_1040_2542 495
860 3300049574 Ga0501038_0022293 Ga0501038_0022293_187_1689 495
861 3300049579 Ga0501043_0001312 Ga0501043_0001312_13419_14921 495
862 3300049579 Ga0501043_0036562 Ga0501043_0036562_532_2034 495
863 3300049580 Ga0501046_0004508 Ga0501046_0004508_6639_8150 495
864 3300049580 Ga0501046_0032465 Ga0501046_0032465_432_1934 495
865 3300049582 Ga0501048_0001715 Ga0501048_0001715_196_1698 495
866 3300049582 Ga0501048_0018291 Ga0501048_0018291_2337_3839 495
867 3300049583 Ga0501067_0000947 Ga0501067_0000947_5442_6944 495
868 3300049583 Ga0501067_0002401 Ga0501067_0002401_8170_9672 495
869 3300049585 Ga0501069_0015659 Ga0501069_0015659_146_1648 495
870 3300049585 Ga0501069_0037108 Ga0501069_0037108_170_1672 495
871 3300049586 Ga0501070_0002702 Ga0501070_0002702_10657_12168 495
872 3300049586 Ga0501070_0024937 Ga0501070_0024937_346_1848 495
873 3300049587 Ga0501071_0003555 Ga0501071_0003555_6601_8103 495
874 3300049590 Ga0501074_0018785 Ga0501074_0018785_2453_3955 495
875 3300049741 Ga0501079_0047941 Ga0501079_0047941_1004_2506 495
876 3300049742 Ga0501080_0017774 Ga0501080_0017774_4714_6225 495
877 3300049744 Ga0501083_0013877 Ga0501083_0013877_3396_4898 495
878 3300049744 Ga0501083_0037688 Ga0501083_0037688_106_1608 495
879 3300049822 Ga0501035_0001569 Ga0501035_0001569_9249_10751 495
880 3300049822 Ga0501035_0019590 Ga0501035_0019590_3940_5442 495
881 3300049822 Ga0501035_0169616 Ga0501035_0169616_71_1582 495
882 3300050507 nmdc:mga05p37_260027_c1 nmdc:mga05p37_260027_c1_22_1512 495
883 3300050512 nmdc:mga0n895_86581_c1 nmdc:mga0n895_86581_c1_1609_3102 495
884 3300050515 nmdc:mga0a205_150114_c1 nmdc:mga0a205_150114_c1_499_2022 495
885 3300050515 nmdc:mga0a205_67743_c1 nmdc:mga0a205_67743_c1_1609_3099 495
886 3300053177 Ga0500636_0048047 Ga0500636_0048047_296_1855 495
887 3300060353 Ga0501082_0003408 Ga0501082_0003408_1146_2648 495
888 3300060353 Ga0501082_0094700 Ga0501082_0094700_708_2210 495
889 3300009093 Ga0105240_10039928 Ga0105240_100399282 496
890 iso_pu_bacteria 2501025504 2501407989 496
891 iso_pu_bacteria 2510917014 2511095734 496
892 iso_pu_bacteria 2510917015 2511103513 496
893 iso_pu_bacteria 2883087390 2883095268 496
894 3300049570 Ga0501033_0047393 Ga0501033_0047393_895_2460 497
895 3300049571 Ga0501034_0057136 Ga0501034_0057136_1561_3120 497
896 3300049573 Ga0501037_0038007 Ga0501037_0038007_1216_2775 497
897 3300049823 Ga0501044_0082984 Ga0501044_0082984_395_1960 497
898 3300001915 JGI24741J21665_1000554 JGI24741J21665_10005545 498
899 3300003322 rootL2_10159492 rootL2_101594923 498
900 3300005337 Ga0070682_100000608 Ga0070682_10000060810 498
901 3300013308 Ga0157375_10001252 Ga0157375_1000125218 498
902 3300031911 Ga0307412_10000241 Ga0307412_100002415 498
903 3300041413 Ga0439465_0000032 Ga0439465_0000032_16414_17910 498
904 3300046453 Ga0495627_004487 Ga0495627_004487_2372_3868 498
905 3300046519 Ga0495632_0007170 Ga0495632_0007170_5041_6537 498
906 3300046522 Ga0495643_0022240 Ga0495643_0022240_1756_3252 498
907 3300046558 Ga0495633_0002607 Ga0495633_0002607_7921_9417 498
908 3300046660 Ga0495625_0000096 Ga0495625_0000096_66764_68260 498
909 3300047472 Ga0495686_0000069 Ga0495686_0000069_4352_5848 498
910 3300048929 Ga0496126_0004486 Ga0496126_0004486_13471_14967 498
911 3300048929 Ga0496126_0131763 Ga0496126_0131763_523_2019 498
912 iso_pu_bacteria 2501025501 2501074221 498

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00370

FGGY_N

FGGY family of carbohydrate kinases, N-terminal domain

62

305

0.98

PF02782

FGGY_C

FGGY family of carbohydrate kinases, C-terminal domain

314

504

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
6k79-assembly2.cif.gz_C glycerol kinase form thermococcus kodakarensis, complex structure with substrate. 0.9783 3 497
6k76-assembly1.cif.gz_B-2 glycerol kinase form thermococcus kodakarensis, complex structure with substrate. 0.9769 3 498
6k79-assembly1.cif.gz_B-2 glycerol kinase form thermococcus kodakarensis, complex structure with substrate. 0.9767 3 497
3ezw-assembly2.cif.gz_F crystal structure of a hyperactive escherichia coli glycerol kinase mutant gly230 --> asp obtained using microfluidic crystallization devices 0.9746 2 495
3ezw-assembly2.cif.gz_H crystal structure of a hyperactive escherichia coli glycerol kinase mutant gly230 --> asp obtained using microfluidic crystallization devices 0.974 2 495
ID Description Score Start End Superfamily
4e1jB01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9933 5 251 3.30.420.40
1gleG01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.989 4 252 3.30.420.40
4e1jB01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9814 5 251 3.30.420.40
af_A4IBJ9_264_511_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9642 255 493 3.30.420.40
af_Q21944_255_502_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9624 253 495 3.30.420.40
ID Description Score Start End GO Terms
AF-A0A352CJM4-F1-model_v4 Glycerol kinase 0.9962 4 140 GO:0004370
GO:0005829
GO:0019563
AF-A0A3B9XVS2-F1-model_v4 Glycerol kinase 0.9924 3 286 GO:0004370
GO:0005829
GO:0019563
AF-A0A1H8ELL8-F1-model_v4 Glycerol kinase (EC 2.7.1.30) (ATP:glycerol 3-phosphotransferase) (Glycerokinase) (GK) 0.9923 1 495 GO:0004370
GO:0005524
GO:0005829
GO:0006072
GO:0019563
AF-A0A4Q3YKV4-F1-model_v4 Glycerol kinase 0.992 3 281 GO:0004370
GO:0005829
GO:0019563
AF-A0A3C1X7N3-F1-model_v4 ATP:glycerol 3-phosphotransferase 0.9917 3 215 GO:0004370
GO:0005829
GO:0019563

Feature Viewer

pLDDT pTM Quality
94.76 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map