F485500

General Info

Members Datasets Scaffolds Average Seq Length
912 322 905 302

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100038506|Ga0070708_1000385063
Length 273
Sequence MSVRPAPLARXXXXAGGPLSLRGLLEREGAFSWVMLAPGVLFLLAFVAYPFFYGIYLSLQDRPVARAGAFVGLANFATLLGEGVFWQVTRNTFVYTLVTTVLKLLGGLAMALVINQSFRARNLVRAVLLLPFIVPTILSTIAWMWIFDPTFSVINWTLVKTGAMVSIIVVNTWRGIPFYGITLLAGLQTISPDLYEAAAIDGASATQRFWHVTLPIIKPILIIVTMFSVIFTFADFQIVYALTHGGPANATQVFVTYAFDLGMSGGQLGLRRE

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300003349 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM Metagenome Rhizosphere
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
66 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
67 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
68 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
69 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
75 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
76 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
79 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
98 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
99 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
100 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
101 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
102 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
109 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
110 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
111 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
113 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
114 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
115 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
179 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
182 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
183 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
184 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
185 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
186 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
187 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
188 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
189 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
190 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
191 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
192 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
193 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
194 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
195 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
196 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
197 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
198 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
199 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
200 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
201 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
202 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
203 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
204 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
205 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
206 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
207 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
208 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
209 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
210 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
211 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
212 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
213 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
214 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
215 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
216 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
217 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
218 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
219 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
220 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
221 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
222 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
223 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
224 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
225 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
226 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
227 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
228 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
229 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
230 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
231 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
232 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
233 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
234 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
235 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
236 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
237 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
238 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
239 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
240 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
241 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
242 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
243 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
244 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
245 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
246 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
247 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
248 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
249 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
250 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
251 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
252 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
253 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
254 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
255 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
256 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
257 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
258 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
259 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
260 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
261 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
262 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
263 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
264 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
265 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
266 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
267 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
268 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
269 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
270 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
271 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
272 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
273 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
274 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
275 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
276 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
277 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
278 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
279 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
280 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
281 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
282 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
283 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
285 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
286 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
289 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
291 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
292 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
293 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
294 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
295 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
296 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
297 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
298 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
299 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
300 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
301 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
302 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
303 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
304 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
305 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
306 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
307 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
308 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
309 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
310 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
311 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
312 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
313 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
314 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
315 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
316 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
317 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
318 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
319 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
320 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
321 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
322 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.89
Metatranscriptomes 0.11
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.33
Nodule 0
Rhizoplane 1.64
Rhizosphere 95.83
Stem 0
Stem Tuber 0
Unclassified 2.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10007226 3300003203 Bacteria 5081
2 rootH1_10091158 3300003323 Bacteria 1843
3 JGI26129J50193_1001876 3300003349 Bacteria 1458
4 JGI25404J52841_10004850 3300003659 Bacteria 2757
5 Ga0065715_10096737 3300005293 Bacteria 3830
6 Ga0065707_10102712 3300005295 Bacteria 2789
7 Ga0065707_10252752 3300005295 Bacteria 1120
8 Ga0070676_10024086 3300005328 Bacteria 3425
9 Ga0070683_100025536 3300005329 Bacteria 5307
10 Ga0070670_100000678 3300005331 Bacteria 26436
11 Ga0068869_100012374 3300005334 Bacteria 5639
12 Ga0068869_100143220 3300005334 Bacteria 1848
13 Ga0068869_100386091 3300005334 Bacteria 1149
14 Ga0070680_100001152 3300005336 Bacteria 18981
15 Ga0070680_100032601 3300005336 Bacteria 4194
16 Ga0070680_100160103 3300005336 Bacteria 1892
17 Ga0070680_100318626 3300005336 Bacteria 1320
18 Ga0070682_100002090 3300005337 Bacteria 11117
19 Ga0070682_100250887 3300005337 Bacteria 1276
20 Ga0070660_100001587 3300005339 Bacteria 15632
21 Ga0070660_100028160 3300005339 Bacteria 4201
22 Ga0070689_100106356 3300005340 Bacteria 2226
23 Ga0070689_100118493 3300005340 Bacteria 2112
24 Ga0070691_10008450 3300005341 Bacteria 4711
25 Ga0070691_10081892 3300005341 Bacteria 1582
26 Ga0070661_100002632 3300005344 Bacteria 12276
27 Ga0070661_100320984 3300005344 Bacteria 1210
28 Ga0070692_10192900 3300005345 Bacteria 1188
29 Ga0070673_100356231 3300005364 Unclassified 1300
30 Ga0070688_100025917 3300005365 Bacteria 3477
31 Ga0070659_100003091 3300005366 Bacteria 11834
32 Ga0070703_10020720 3300005406 Unclassified 1916
33 Ga0070703_10075326 3300005406 Bacteria 1137
34 Ga0070709_10003361 3300005434 Bacteria 8601
35 Ga0070709_10014136 3300005434 Bacteria 4509
36 Ga0070709_10108701 3300005434 Bacteria 1860
37 Ga0070714_100005721 3300005435 Bacteria 9527
38 Ga0070714_100023397 3300005435 Bacteria 5075
39 Ga0070714_100033768 3300005435 Bacteria 4280
40 Ga0070714_100041668 3300005435 Bacteria 3876
41 Ga0070714_100148132 3300005435 Bacteria 2113
42 Ga0070713_100008252 3300005436 Bacteria 7383
43 Ga0070713_100029448 3300005436 Bacteria 4350
44 Ga0070713_100038058 3300005436 Bacteria 3894
45 Ga0070713_100180134 3300005436 Bacteria 1898
46 Ga0070713_100205911 3300005436 Bacteria 1779
47 Ga0070713_100224175 3300005436 Bacteria 1706
48 Ga0070710_10000739 3300005437 Bacteria 15565
49 Ga0070710_10003900 3300005437 Bacteria 7065
50 Ga0070710_10005213 3300005437 Bacteria 6160
51 Ga0070710_10242321 3300005437 Bacteria 1156
52 Ga0070701_10007287 3300005438 Bacteria 4712
53 Ga0070711_100001284 3300005439 Bacteria 13635
54 Ga0070711_100002104 3300005439 Bacteria 11259
55 Ga0070711_100121044 3300005439 Bacteria 1936
56 Ga0070705_100002566 3300005440 Bacteria 9122
57 Ga0070705_100144254 3300005440 Bacteria 1571
58 Ga0070705_100145868 3300005440 Bacteria 1563
59 Ga0070700_100013535 3300005441 Bacteria 4583
60 Ga0070700_100028698 3300005441 Bacteria 3312
61 Ga0070694_100001010 3300005444 Bacteria 16001
62 Ga0070694_100024660 3300005444 Bacteria 3883
63 Ga0070694_100026288 3300005444 Bacteria 3771
64 Ga0070694_100051125 3300005444 Bacteria 2788
65 Ga0070694_100074285 3300005444 Bacteria 2349
66 Ga0070694_100075110 3300005444 Bacteria 2337
67 Ga0070694_100086335 3300005444 Bacteria 2192
68 Ga0070694_100103267 3300005444 Bacteria 2019
69 Ga0070694_100213079 3300005444 Bacteria 1446
70 Ga0070708_100011602 3300005445 Bacteria 7173
71 Ga0070708_100038506 3300005445 Bacteria 4177
72 Ga0070708_100057912 3300005445 Bacteria 3452
73 Ga0070708_100064817 3300005445 Bacteria 3274
74 Ga0070708_100106276 3300005445 Bacteria 2576
75 Ga0070708_100216182 3300005445 Bacteria 1797
76 Ga0070708_100230410 3300005445 Unclassified 1738
77 Ga0070708_100329456 3300005445 Bacteria 1439
78 Ga0070663_100001727 3300005455 Bacteria 12124
79 Ga0070663_100250792 3300005455 Bacteria 1401
80 Ga0070663_100346372 3300005455 Bacteria 1202
81 Ga0070662_100012116 3300005457 Bacteria 5709
82 Ga0070662_100014904 3300005457 Bacteria 5199
83 Ga0070662_100045195 3300005457 Bacteria 3158
84 Ga0070662_100055559 3300005457 Bacteria 2873
85 Ga0070681_10030359 3300005458 Bacteria 5423
86 Ga0070681_10049537 3300005458 Bacteria 4194
87 Ga0070681_10060246 3300005458 Bacteria 3773
88 Ga0070681_10079163 3300005458 Bacteria 3243
89 Ga0070681_10323844 3300005458 Bacteria 1451
90 Ga0068867_100020324 3300005459 Bacteria 4732
91 Ga0068867_100064865 3300005459 Bacteria 2716
92 Ga0068867_100424535 3300005459 Bacteria 1127
93 Ga0070706_100004042 3300005467 Bacteria 14246
94 Ga0070706_100082686 3300005467 Bacteria 2974
95 Ga0070706_100191269 3300005467 Bacteria 1912
96 Ga0070706_100277066 3300005467 Bacteria 1565
97 Ga0070706_100364414 3300005467 Bacteria 1346
98 Ga0070707_100024463 3300005468 Bacteria 5720
99 Ga0070707_100092901 3300005468 Bacteria 2921
100 Ga0070707_100162857 3300005468 Bacteria 2173
101 Ga0070698_100003260 3300005471 Bacteria 17827
102 Ga0070698_100009511 3300005471 Bacteria 10410
103 Ga0070698_100080100 3300005471 Bacteria 3261
104 Ga0070698_100140456 3300005471 Bacteria 2367
105 Ga0070698_100640889 3300005471 Bacteria 1003
106 Ga0070699_100034226 3300005518 Bacteria 4391
107 Ga0070699_100093065 3300005518 Bacteria 2637
108 Ga0070699_100135005 3300005518 Unclassified 2177
109 Ga0070699_100190973 3300005518 Bacteria 1819
110 Ga0070699_100306814 3300005518 Bacteria 1424
111 Ga0070679_100010038 3300005530 Bacteria 8968
112 Ga0070679_100021604 3300005530 Bacteria 6285
113 Ga0070679_100029692 3300005530 Bacteria 5394
114 Ga0070679_100043082 3300005530 Bacteria 4496
115 Ga0070679_100128297 3300005530 Bacteria 2518
116 Ga0070679_100159783 3300005530 Bacteria 2228
117 Ga0070684_100007445 3300005535 Bacteria 8512
118 Ga0070684_100024412 3300005535 Bacteria 5072
119 Ga0070684_100024429 3300005535 Bacteria 5070
120 Ga0070684_100042164 3300005535 Bacteria 3938
121 Ga0070697_100012030 3300005536 Bacteria 6773
122 Ga0070697_100046177 3300005536 Bacteria 3530
123 Ga0070697_100068040 3300005536 Bacteria 2914
124 Ga0070697_100094201 3300005536 Unclassified 2481
125 Ga0070697_100134407 3300005536 Bacteria 2076
126 Ga0070697_100218558 3300005536 Bacteria 1624
127 Ga0068853_100327176 3300005539 Bacteria 1422
128 Ga0070672_100130019 3300005543 Bacteria 2068
129 Ga0070686_100011978 3300005544 Bacteria 4931
130 Ga0070686_100175496 3300005544 Bacteria 1519
131 Ga0070695_100001392 3300005545 Bacteria 13407
132 Ga0070695_100006099 3300005545 Bacteria 7122
133 Ga0070695_100009327 3300005545 Bacteria 5835
134 Ga0070695_100011421 3300005545 Bacteria 5313
135 Ga0070695_100016804 3300005545 Bacteria 4434
136 Ga0070695_100017320 3300005545 Bacteria 4368
137 Ga0070695_100115640 3300005545 Bacteria 1828
138 Ga0070696_100003863 3300005546 Bacteria 10005
139 Ga0070696_100065476 3300005546 Bacteria 2548
140 Ga0070696_100148166 3300005546 Bacteria 1720
141 Ga0070693_100002188 3300005547 Bacteria 8958
142 Ga0070693_100017613 3300005547 Bacteria 3717
143 Ga0070693_100301730 3300005547 Bacteria 1080
144 Ga0070704_100045070 3300005549 Bacteria 3067
145 Ga0070704_100195380 3300005549 Bacteria 1629
146 Ga0070704_100270541 3300005549 Bacteria 1404
147 Ga0070704_100463344 3300005549 Bacteria 1094
148 Ga0068855_100001585 3300005563 Bacteria 28565
149 Ga0068855_100213130 3300005563 Bacteria 2169
150 Ga0070664_100417264 3300005564 Bacteria 1229
151 Ga0068857_100032819 3300005577 Bacteria 4589
152 Ga0068857_100133693 3300005577 Bacteria 2239
153 Ga0068857_100140670 3300005577 Bacteria 2181
154 Ga0068854_100003455 3300005578 Bacteria 9861
155 Ga0068856_100004059 3300005614 Bacteria 14651
156 Ga0070702_100309864 3300005615 Unclassified 1096
157 Ga0068859_100009042 3300005617 Bacteria 10063
158 Ga0068859_100026660 3300005617 Bacteria 5795
159 Ga0068864_100001941 3300005618 Bacteria 16979
160 Ga0068866_10016349 3300005718 Bacteria 3316
161 Ga0068861_100181558 3300005719 Bacteria 1752
162 Ga0068870_10005871 3300005840 Bacteria 5391
163 Ga0068863_100004989 3300005841 Bacteria 13081
164 Ga0068858_100052941 3300005842 Bacteria 3756
165 Ga0068858_100147848 3300005842 Bacteria 2208
166 Ga0068858_100322395 3300005842 Bacteria 1477
167 Ga0068860_100008117 3300005843 Bacteria 10455
168 Ga0068860_100018586 3300005843 Bacteria 6760
169 Ga0068860_100082542 3300005843 Bacteria 3057
170 Ga0068860_100286546 3300005843 Bacteria 1611
171 Ga0068862_100005118 3300005844 Bacteria 11020
172 Ga0068862_100006591 3300005844 Bacteria 9627
173 Ga0068862_100008683 3300005844 Bacteria 8407
174 Ga0068862_100009075 3300005844 Bacteria 8230
175 Ga0068862_100057949 3300005844 Bacteria 3323
176 Ga0068862_100096600 3300005844 Bacteria 2579
177 Ga0068862_100196793 3300005844 Bacteria 1816
178 Ga0081455_10000654 3300005937 Bacteria 44913
179 Ga0081540_1001040 3300005983 Bacteria 24821
180 Ga0081540_1018677 3300005983 Bacteria 4244
181 Ga0081540_1034102 3300005983 Bacteria 2751
182 Ga0081540_1061808 3300005983 Bacteria 1783
183 Ga0081540_1100530 3300005983 Bacteria 1247
184 Ga0081539_10000050 3300005985 Bacteria 269342
185 Ga0081539_10004618 3300005985 Bacteria 15001
186 Ga0070717_10000240 3300006028 Bacteria 37664
187 Ga0070717_10104818 3300006028 Bacteria 2406
188 Ga0070717_10318894 3300006028 Bacteria 1384
189 Ga0070715_10008833 3300006163 Bacteria 3527
190 Ga0070715_10051610 3300006163 Unclassified 1771
191 Ga0070716_100030323 3300006173 Bacteria 2932
192 Ga0070716_100056844 3300006173 Bacteria 2246
193 Ga0070712_100002037 3300006175 Bacteria 12385
194 Ga0070712_100006939 3300006175 Bacteria 7060
195 Ga0070712_100021018 3300006175 Bacteria 4279
196 Ga0070712_100036963 3300006175 Bacteria 3325
197 Ga0068871_100070800 3300006358 Bacteria 2867
198 Ga0075428_100001512 3300006844 Bacteria 24887
199 Ga0075428_100010565 3300006844 Bacteria 10262
200 Ga0075428_100010747 3300006844 Bacteria 10175
201 Ga0075428_100012236 3300006844 Bacteria 9542
202 Ga0075428_100017963 3300006844 Bacteria 7816
203 Ga0075428_100048174 3300006844 Bacteria 4678
204 Ga0075428_100063494 3300006844 Bacteria 4043
205 Ga0075428_100126678 3300006844 Bacteria 2779
206 Ga0075428_100143473 3300006844 Bacteria 2596
207 Ga0075428_100565033 3300006844 Bacteria 1216
208 Ga0075430_100000343 3300006846 Bacteria 33706
209 Ga0075430_100003797 3300006846 Bacteria 12711
210 Ga0075430_100050849 3300006846 Bacteria 3493
211 Ga0075430_100070760 3300006846 Bacteria 2926
212 Ga0075430_100076281 3300006846 Bacteria 2810
213 Ga0075430_100088391 3300006846 Bacteria 2593
214 Ga0075430_100122494 3300006846 Bacteria 2168
215 Ga0075431_100000589 3300006847 Bacteria 30672
216 Ga0075431_100001751 3300006847 Bacteria 20407
217 Ga0075431_100008413 3300006847 Bacteria 10331
218 Ga0075431_100009950 3300006847 Bacteria 9552
219 Ga0075431_100012318 3300006847 Bacteria 8628
220 Ga0075431_100016199 3300006847 Bacteria 7561
221 Ga0075431_100025473 3300006847 Bacteria 6063
222 Ga0075431_100029013 3300006847 Bacteria 5691
223 Ga0075431_100031288 3300006847 Bacteria 5481
224 Ga0075431_100037966 3300006847 Bacteria 4959
225 Ga0075431_100058943 3300006847 Bacteria 3962
226 Ga0075431_100078855 3300006847 Bacteria 3400
227 Ga0075431_100100049 3300006847 Bacteria 2991
228 Ga0075431_100263653 3300006847 Bacteria 1748
229 Ga0075431_100273383 3300006847 Bacteria 1712
230 Ga0075431_100576075 3300006847 Bacteria 1111
231 Ga0075433_10000065 3300006852 Bacteria 46718
232 Ga0075433_10000967 3300006852 Bacteria 20371
233 Ga0075433_10002763 3300006852 Bacteria 13428
234 Ga0075433_10004058 3300006852 Bacteria 11341
235 Ga0075433_10004066 3300006852 Bacteria 11332
236 Ga0075433_10007957 3300006852 Bacteria 8439
237 Ga0075433_10017132 3300006852 Bacteria 5993
238 Ga0075433_10025834 3300006852 Bacteria 4966
239 Ga0075433_10026832 3300006852 Bacteria 4881
240 Ga0075433_10082758 3300006852 Bacteria 2831
241 Ga0075433_10192730 3300006852 Bacteria 1813
242 Ga0075433_10266316 3300006852 Bacteria 1519
243 Ga0075433_10387788 3300006852 Bacteria 1233
244 Ga0075434_100001212 3300006871 Bacteria 21423
245 Ga0075434_100001353 3300006871 Bacteria 20574
246 Ga0075434_100002288 3300006871 Bacteria 16750
247 Ga0075434_100003549 3300006871 Bacteria 13930
248 Ga0075434_100040122 3300006871 Bacteria 4637
249 Ga0075434_100064872 3300006871 Bacteria 3637
250 Ga0075434_100121403 3300006871 Bacteria 2628
251 Ga0075434_100166986 3300006871 Bacteria 2221
252 Ga0075434_100285706 3300006871 Unclassified 1669
253 Ga0075429_100000014 3300006880 Bacteria 79603
254 Ga0075429_100000710 3300006880 Bacteria 26042
255 Ga0075429_100000807 3300006880 Bacteria 24634
256 Ga0075429_100005652 3300006880 Bacteria 10783
257 Ga0075429_100014342 3300006880 Bacteria 6872
258 Ga0075429_100039288 3300006880 Bacteria 4119
259 Ga0075429_100041783 3300006880 Bacteria 3993
260 Ga0075429_100188441 3300006880 Bacteria 1808
261 Ga0075429_100202118 3300006880 Bacteria 1741
262 Ga0075429_100259612 3300006880 Bacteria 1521
263 Ga0075429_100306443 3300006880 Bacteria 1390
264 Ga0075436_100002041 3300006914 Bacteria 13918
265 Ga0075436_100053692 3300006914 Bacteria 2782
266 Ga0097620_100009043 3300006931 Bacteria 10063
267 Ga0097620_100026660 3300006931 Bacteria 5795
268 Ga0097620_100391329 3300006931 Bacteria 1486
269 Ga0075435_100001556 3300007076 Bacteria 14805
270 Ga0075435_100012879 3300007076 Bacteria 6202
271 Ga0075435_100047753 3300007076 Bacteria 3438
272 Ga0075435_100091710 3300007076 Bacteria 2508
273 Ga0075435_100215257 3300007076 Unclassified 1630
274 Ga0075435_100242739 3300007076 Bacteria 1532
275 Ga0075435_100347176 3300007076 Bacteria 1272
276 Ga0099795_10008622 3300007788 Bacteria 2917
277 Ga0105240_10067558 3300009093 Bacteria 4431
278 Ga0105240_10282127 3300009093 Bacteria 1908
279 Ga0105240_10474560 3300009093 Bacteria 1395
280 Ga0111539_10001266 3300009094 Bacteria 33726
281 Ga0111539_10002621 3300009094 Bacteria 23856
282 Ga0111539_10011657 3300009094 Bacteria 11027
283 Ga0111539_10016847 3300009094 Bacteria 9050
284 Ga0111539_10057849 3300009094 Bacteria 4602
285 Ga0111539_10120428 3300009094 Bacteria 3075
286 Ga0111539_10193423 3300009094 Bacteria 2373
287 Ga0111539_10344964 3300009094 Bacteria 1733
288 Ga0111539_10412847 3300009094 Bacteria 1572
289 Ga0111539_10438239 3300009094 Bacteria 1521
290 Ga0105247_10043972 3300009101 Bacteria 2738
291 Ga0114129_10003240 3300009147 Bacteria 22849
292 Ga0114129_10010224 3300009147 Bacteria 13384
293 Ga0114129_10012541 3300009147 Bacteria 12070
294 Ga0114129_10019542 3300009147 Bacteria 9646
295 Ga0114129_10028618 3300009147 Bacteria 7895
296 Ga0114129_10029401 3300009147 Bacteria 7784
297 Ga0114129_10040648 3300009147 Bacteria 6554
298 Ga0114129_10047361 3300009147 Bacteria 6041
299 Ga0114129_10068567 3300009147 Bacteria 4945
300 Ga0114129_10124874 3300009147 Bacteria 3539
301 Ga0114129_10190951 3300009147 Bacteria 2781
302 Ga0114129_10198809 3300009147 Bacteria 2716
303 Ga0114129_10372182 3300009147 Bacteria 1888
304 Ga0114129_10409785 3300009147 Bacteria 1785
305 Ga0114129_10505019 3300009147 Bacteria 1579
306 Ga0114129_10794236 3300009147 Bacteria 1208
307 Ga0114129_10861665 3300009147 Bacteria 1151
308 Ga0105243_10138448 3300009148 Bacteria 2074
309 Ga0105243_10220896 3300009148 Bacteria 1675
310 Ga0105241_10002609 3300009174 Bacteria 13517
311 Ga0105241_10068576 3300009174 Bacteria 2748
312 Ga0105241_10179783 3300009174 Bacteria 1754
313 Ga0105241_10359719 3300009174 Bacteria 1266
314 Ga0105242_10048005 3300009176 Bacteria 3468
315 Ga0105242_10154162 3300009176 Bacteria 2005
316 Ga0105242_10213692 3300009176 Bacteria 1720
317 Ga0105248_10101693 3300009177 Bacteria 3239
318 Ga0105248_10122207 3300009177 Bacteria 2937
319 Ga0105248_10134069 3300009177 Bacteria 2794
320 Ga0105237_10043407 3300009545 Bacteria 4528
321 Ga0105238_10058109 3300009551 Bacteria 3878
322 Ga0105238_10377872 3300009551 Bacteria 1408
323 Ga0105238_10496295 3300009551 Unclassified 1221
324 Ga0105238_10582665 3300009551 Bacteria 1125
325 Ga0105249_10027079 3300009553 Bacteria 5171
326 Ga0105249_10055271 3300009553 Bacteria 3631
327 Ga0105249_10097034 3300009553 Bacteria 2766
328 Ga0105249_10102256 3300009553 Bacteria 2697
329 Ga0105249_10168434 3300009553 Bacteria 2122
330 Ga0105249_10212794 3300009553 Bacteria 1898
331 Ga0105249_10275699 3300009553 Bacteria 1677
332 Ga0105249_10570728 3300009553 Bacteria 1184
333 Ga0099796_10000792 3300010159 Bacteria 5709
334 Ga0105239_10047530 3300010375 Bacteria 4703
335 Ga0105239_10129225 3300010375 Bacteria 2809
336 Ga0105239_10711132 3300010375 Unclassified 1149
337 Ga0105246_10509144 3300011119 Bacteria 1024
338 Ga0157373_10007390 3300013100 Bacteria 8175
339 Ga0157371_10036655 3300013102 Bacteria 3512
340 Ga0157370_10016104 3300013104 Bacteria 7578
341 Ga0157370_10036360 3300013104 Bacteria 4778
342 Ga0157369_10008310 3300013105 Bacteria 11898
343 Ga0157369_10023551 3300013105 Bacteria 6858
344 Ga0157369_10238188 3300013105 Bacteria 1901
345 Ga0157374_10143214 3300013296 Bacteria 2321
346 Ga0157378_10107437 3300013297 Bacteria 2554
347 Ga0157378_10315604 3300013297 Unclassified 1517
348 Ga0163162_10524533 3300013306 Bacteria 1314
349 Ga0157372_10000347 3300013307 Bacteria 51034
350 Ga0157372_10076210 3300013307 Bacteria 3786
351 Ga0157372_10199731 3300013307 Bacteria 2316
352 Ga0163163_10025815 3300014325 Bacteria 5604
353 Ga0163163_10211291 3300014325 Bacteria 1990
354 Ga0163163_10442207 3300014325 Bacteria 1360
355 Ga0157380_10450497 3300014326 Bacteria 1236
356 Ga0157379_10163408 3300014968 Bacteria 2010
357 Ga0157379_10259059 3300014968 Bacteria 1580
358 Ga0157379_10297994 3300014968 Bacteria 1469
359 Ga0157379_10416197 3300014968 Bacteria 1237
360 Ga0157376_10293581 3300014969 Bacteria 1536
361 Ga0182007_10020576 3300015262 Bacteria 2357
362 Ga0163161_10305754 3300017792 Bacteria 1253
363 Ga0206356_11047833 3300020070 Bacteria 1424
364 Ga0213874_10011593 3300021377 Bacteria 2238
365 Ga0213874_10022030 3300021377 Bacteria 1764
366 Ga0213876_10087546 3300021384 Bacteria 1649
367 Ga0213875_10000003 3300021388 Bacteria 719367
368 Ga0207653_10010824 3300025885 Bacteria 2847
369 Ga0207653_10075959 3300025885 Unclassified 1155
370 Ga0207692_10002939 3300025898 Bacteria 6600
371 Ga0207692_10007559 3300025898 Bacteria 4456
372 Ga0207692_10010611 3300025898 Bacteria 3889
373 Ga0207692_10028454 3300025898 Bacteria 2644
374 Ga0207692_10107528 3300025898 Bacteria 1542
375 Ga0207688_10007589 3300025901 Bacteria 5903
376 Ga0207685_10005228 3300025905 Bacteria 3402
377 Ga0207699_10000184 3300025906 Bacteria 37990
378 Ga0207699_10005400 3300025906 Bacteria 6123
379 Ga0207699_10007536 3300025906 Bacteria 5325
380 Ga0207645_10017408 3300025907 Bacteria 4744
381 Ga0207645_10071122 3300025907 Bacteria 2226
382 Ga0207643_10001080 3300025908 Bacteria 16124
383 Ga0207684_10004601 3300025910 Bacteria 12957
384 Ga0207684_10004627 3300025910 Bacteria 12921
385 Ga0207684_10012156 3300025910 Bacteria 7492
386 Ga0207684_10092188 3300025910 Bacteria 2582
387 Ga0207684_10127396 3300025910 Bacteria 2185
388 Ga0207684_10290272 3300025910 Unclassified 1410
389 Ga0207684_10386659 3300025910 Bacteria 1203
390 Ga0207654_10004145 3300025911 Bacteria 7306
391 Ga0207707_10000381 3300025912 Bacteria 46274
392 Ga0207707_10004363 3300025912 Bacteria 12505
393 Ga0207707_10005225 3300025912 Bacteria 11379
394 Ga0207707_10022196 3300025912 Bacteria 5548
395 Ga0207707_10084269 3300025912 Bacteria 2776
396 Ga0207707_10179742 3300025912 Bacteria 1847
397 Ga0207695_10055385 3300025913 Bacteria 4133
398 Ga0207695_10159114 3300025913 Bacteria 2191
399 Ga0207695_10287550 3300025913 Bacteria 1537
400 Ga0207671_10056234 3300025914 Bacteria 2915
401 Ga0207671_10069776 3300025914 Bacteria 2619
402 Ga0207671_10150427 3300025914 Bacteria 1798
403 Ga0207693_10002453 3300025915 Bacteria 16107
404 Ga0207693_10007608 3300025915 Bacteria 8900
405 Ga0207693_10008194 3300025915 Bacteria 8564
406 Ga0207693_10021040 3300025915 Bacteria 5184
407 Ga0207693_10033392 3300025915 Bacteria 4061
408 Ga0207693_10140716 3300025915 Bacteria 1897
409 Ga0207693_10150639 3300025915 Unclassified 1829
410 Ga0207663_10006005 3300025916 Bacteria 6175
411 Ga0207663_10125523 3300025916 Bacteria 1765
412 Ga0207660_10005541 3300025917 Bacteria 8199
413 Ga0207660_10022679 3300025917 Bacteria 4231
414 Ga0207660_10104627 3300025917 Bacteria 2120
415 Ga0207662_10038478 3300025918 Bacteria 2803
416 Ga0207657_10000925 3300025919 Bacteria 31095
417 Ga0207652_10001534 3300025921 Bacteria 20361
418 Ga0207652_10003752 3300025921 Bacteria 12460
419 Ga0207652_10024807 3300025921 Bacteria 4977
420 Ga0207652_10079842 3300025921 Bacteria 2859
421 Ga0207652_10201467 3300025921 Bacteria 1791
422 Ga0207646_10007164 3300025922 Bacteria 11395
423 Ga0207646_10014019 3300025922 Bacteria 7629
424 Ga0207646_10016781 3300025922 Bacteria 6869
425 Ga0207646_10045568 3300025922 Bacteria 3937
426 Ga0207646_10048272 3300025922 Bacteria 3816
427 Ga0207646_10092888 3300025922 Bacteria 2701
428 Ga0207646_10166782 3300025922 Bacteria 1988
429 Ga0207646_10207485 3300025922 Bacteria 1770
430 Ga0207646_10227702 3300025922 Unclassified 1684
431 Ga0207694_10093774 3300025924 Bacteria 2372
432 Ga0207650_10006688 3300025925 Bacteria 7862
433 Ga0207687_10454049 3300025927 Bacteria 1063
434 Ga0207700_10011666 3300025928 Bacteria 5617
435 Ga0207700_10018539 3300025928 Bacteria 4680
436 Ga0207700_10028000 3300025928 Bacteria 3954
437 Ga0207700_10048004 3300025928 Bacteria 3168
438 Ga0207700_10153850 3300025928 Bacteria 1903
439 Ga0207700_10166466 3300025928 Bacteria 1835
440 Ga0207664_10004648 3300025929 Bacteria 9314
441 Ga0207664_10006892 3300025929 Bacteria 7855
442 Ga0207664_10016165 3300025929 Bacteria 5437
443 Ga0207664_10036921 3300025929 Bacteria 3778
444 Ga0207664_10042184 3300025929 Bacteria 3560
445 Ga0207664_10260823 3300025929 Bacteria 1515
446 Ga0207690_10003419 3300025932 Bacteria 9475
447 Ga0207706_10022010 3300025933 Bacteria 5722
448 Ga0207706_10045887 3300025933 Bacteria 3870
449 Ga0207706_10050917 3300025933 Bacteria 3658
450 Ga0207706_10051466 3300025933 Bacteria 3637
451 Ga0207686_10090369 3300025934 Bacteria 2020
452 Ga0207709_10115734 3300025935 Bacteria 1801
453 Ga0207670_10103072 3300025936 Bacteria 2041
454 Ga0207670_10163615 3300025936 Unclassified 1663
455 Ga0207665_10003072 3300025939 Bacteria 11204
456 Ga0207665_10135072 3300025939 Bacteria 1755
457 Ga0207665_10289465 3300025939 Bacteria 1221
458 Ga0207691_10060852 3300025940 Bacteria 3431
459 Ga0207691_10110671 3300025940 Bacteria 2443
460 Ga0207691_10120801 3300025940 Bacteria 2322
461 Ga0207711_10019107 3300025941 Bacteria 5702
462 Ga0207711_10061833 3300025941 Bacteria 3229
463 Ga0207689_10000250 3300025942 Bacteria 48225
464 Ga0207689_10012034 3300025942 Bacteria 7414
465 Ga0207689_10023888 3300025942 Bacteria 5128
466 Ga0207689_10074152 3300025942 Bacteria 2796
467 Ga0207689_10086631 3300025942 Bacteria 2574
468 Ga0207661_10009379 3300025944 Bacteria 7016
469 Ga0207679_10003431 3300025945 Bacteria 9779
470 Ga0207667_10001657 3300025949 Bacteria 28057
471 Ga0207667_10002990 3300025949 Bacteria 20997
472 Ga0207712_10013516 3300025961 Bacteria 5235
473 Ga0207712_10066220 3300025961 Bacteria 2582
474 Ga0207712_10094433 3300025961 Bacteria 2209
475 Ga0207712_10165793 3300025961 Bacteria 1722
476 Ga0207640_10000925 3300025981 Bacteria 16459
477 Ga0207703_10029463 3300026035 Bacteria 4331
478 Ga0207703_10522627 3300026035 Bacteria 1116
479 Ga0207639_10005303 3300026041 Bacteria 8701
480 Ga0207639_10230617 3300026041 Bacteria 1604
481 Ga0207639_10515274 3300026041 Bacteria 1095
482 Ga0207678_10002573 3300026067 Bacteria 16535
483 Ga0207708_10038721 3300026075 Bacteria 3632
484 Ga0207708_10054625 3300026075 Bacteria 3045
485 Ga0207708_10091112 3300026075 Bacteria 2351
486 Ga0207708_10145818 3300026075 Bacteria 1860
487 Ga0207702_10000979 3300026078 Bacteria 29227
488 Ga0207702_10037160 3300026078 Bacteria 4075
489 Ga0207641_10038507 3300026088 Bacteria 3998
490 Ga0207648_10005180 3300026089 Bacteria 13198
491 Ga0207648_10030847 3300026089 Bacteria 4743
492 Ga0207648_10049757 3300026089 Bacteria 3666
493 Ga0207648_10155324 3300026089 Bacteria 2020
494 Ga0207676_10364016 3300026095 Bacteria 1341
495 Ga0207674_10004434 3300026116 Bacteria 16875
496 Ga0207674_10012224 3300026116 Bacteria 9602
497 Ga0207674_10036172 3300026116 Bacteria 5148
498 Ga0207674_10136440 3300026116 Bacteria 2415
499 Ga0207674_10209161 3300026116 Bacteria 1900
500 Ga0207674_10256786 3300026116 Bacteria 1695
501 Ga0207675_100087937 3300026118 Bacteria 2919
502 Ga0207683_10118271 3300026121 Bacteria 2377
503 Ga0207698_10123762 3300026142 Bacteria 2195
504 Ga0209981_1001702 3300027378 Bacteria 2784
505 Ga0209981_1004630 3300027378 Bacteria 1809
506 Ga0209996_1000427 3300027395 Bacteria 5083
507 Ga0209995_1002081 3300027471 Bacteria 3144
508 Ga0209999_1000272 3300027543 Bacteria 7611
509 Ga0209982_1001858 3300027552 Bacteria 2916
510 Ga0209970_1001273 3300027614 Bacteria 4451
511 Ga0210002_1000887 3300027617 Bacteria 4107
512 Ga0209983_1000101 3300027665 Bacteria 14499
513 Ga0209983_1000711 3300027665 Bacteria 7190
514 Ga0209588_1005624 3300027671 Bacteria 3600
515 Ga0209588_1015545 3300027671 Bacteria 2341
516 Ga0209971_1000003 3300027682 Bacteria 110664
517 Ga0209971_1000008 3300027682 Bacteria 102612
518 Ga0209971_1007671 3300027682 Bacteria 2561
519 Ga0209966_1000045 3300027695 Bacteria 52459
520 Ga0209998_10000016 3300027717 Bacteria 85166
521 Ga0209998_10006972 3300027717 Bacteria 2344
522 Ga0209974_10000022 3300027876 Bacteria 36601
523 Ga0209974_10000073 3300027876 Bacteria 26904
524 Ga0209974_10022881 3300027876 Bacteria 2068
525 Ga0207428_10000063 3300027907 Bacteria 151868
526 Ga0207428_10000091 3300027907 Bacteria 125388
527 Ga0207428_10000253 3300027907 Bacteria 73122
528 Ga0207428_10001363 3300027907 Bacteria 25962
529 Ga0207428_10008093 3300027907 Bacteria 9533
530 Ga0207428_10021082 3300027907 Bacteria 5522
531 Ga0207428_10116258 3300027907 Bacteria 2054
532 Ga0268265_10006724 3300028380 Bacteria 7782
533 Ga0268265_10006929 3300028380 Bacteria 7666
534 Ga0268265_10019399 3300028380 Bacteria 4726
535 Ga0268265_10023027 3300028380 Bacteria 4386
536 Ga0268265_10070909 3300028380 Bacteria 2712
537 Ga0268265_10074090 3300028380 Bacteria 2661
538 Ga0268265_10079504 3300028380 Bacteria 2582
539 Ga0268265_10091524 3300028380 Bacteria 2432
540 Ga0268264_10040497 3300028381 Bacteria 3849
541 Ga0268264_10278143 3300028381 Unclassified 1566
542 Ga0268264_10530784 3300028381 Bacteria 1152
543 Ga0265334_10040586 3300028573 Bacteria 1822
544 Ga0307408_100324329 3300031548 Bacteria 1298
545 Ga0307508_10000005 3300031616 Bacteria 286511
546 Ga0307508_10021355 3300031616 Bacteria 5886
547 Ga0265314_10001303 3300031711 Bacteria 28283
548 Ga0307410_10038103 3300031852 Bacteria 3146
549 Ga0307407_10213031 3300031903 Bacteria 1302
550 Ga0307409_100442934 3300031995 Bacteria 1252
551 Ga0373926_0029604 3300035083 Bacteria 1925
552 Ga0373928_0013917 3300035084 Bacteria 1620
553 Ga0373934_0012646 3300035086 Bacteria 3185
554 Ga0373940_0045048 3300035088 Bacteria 1224
555 Ga0373944_0078274 3300035089 Bacteria 1088
556 Ga0373949_0004095 3300035090 Bacteria 3373
557 Ga0373923_0006598 3300035111 Bacteria 4022
558 Ga0373923_0026956 3300035111 Bacteria 2289
559 Ga0373936_0007064 3300035113 Bacteria 4224
560 Ga0373939_0011648 3300035114 Bacteria 2225
561 Ga0373941_0006452 3300035115 Bacteria 2827
562 Ga0373945_0034530 3300035116 Bacteria 1803
563 Ga0373953_0010488 3300035117 Bacteria 3226
564 Ga0373953_0044992 3300035117 Bacteria 1767
565 Ga0373954_0035689 3300035118 Bacteria 2307
566 Ga0373954_0054864 3300035118 Bacteria 1874
567 Ga0373956_0004587 3300035119 Bacteria 5519
568 Ga0373956_0030187 3300035119 Bacteria 2368
569 Ga0373960_0008679 3300035121 Bacteria 2442
570 Ga0373960_0032362 3300035121 Unclassified 1468
571 Ga0373943_0199547 3300035170 Bacteria 1107
572 Ga0373955_0010599 3300035172 Bacteria 4359
573 Ga0373955_0070712 3300035172 Bacteria 1950
574 Ga0373961_0072141 3300035241 Bacteria 1070
575 Ga0373924_0006137 3300035410 Bacteria 4291
576 Ga0373924_0026977 3300035410 Bacteria 2282
577 Ga0373931_0004839 3300035691 Bacteria 6184
578 Ga0373931_0005096 3300035691 Bacteria 6048
579 Ga0373931_0018090 3300035691 Bacteria 3499
580 Ga0373931_0018818 3300035691 Bacteria 3438
581 Ga0373931_0057570 3300035691 Unclassified 2085
582 Ga0373931_0107664 3300035691 Bacteria 1577
583 Ga0373935_0047469 3300035692 Bacteria 2716
584 Ga0373935_0071529 3300035692 Bacteria 2238
585 Ga0373935_0167004 3300035692 Bacteria 1503
586 Ga0373927_0072278 3300035695 Bacteria 2232
587 Ga0373927_0146501 3300035695 Bacteria 1546
588 Ga0373933_0003431 3300035724 Bacteria 8832
589 Ga0373933_0016036 3300035724 Bacteria 4185
590 Ga0373947_0036707 3300035725 Bacteria 2906
591 Ga0373947_0039675 3300035725 Bacteria 2802
592 Ga0373937_0225531 3300036401 Bacteria 1764
593 Ga0373937_0330574 3300036401 Bacteria 1442
594 Ga0373925_0074387 3300037068 Bacteria 2573
595 Ga0373925_0158300 3300037068 Bacteria 1782
596 Ga0373925_0209318 3300037068 Bacteria 1553
597 Ga0373925_0359709 3300037068 Bacteria 1183
598 Ga0373925_0509127 3300037068 Bacteria 988
599 Ga0395899_0030724 3300037312 Bacteria 4039
600 Ga0395900_0013350 3300037418 Bacteria 8396
601 Ga0395900_0041942 3300037418 Bacteria 4715
602 Ga0395900_0268057 3300037418 Bacteria 1703
603 Ga0395898_0021886 3300037466 Bacteria 6477
604 Ga0395898_0124898 3300037466 Bacteria 2465
605 Ga0436364_0352307 3300037853 Bacteria 885
606 Ga0436364_0521241 3300037853 Bacteria 1490
607 Ga0436364_0832396 3300037853 Bacteria 21955
608 Ga0395901_0000688 3300038443 Bacteria 38764
609 Ga0395901_0003897 3300038443 Bacteria 15006
610 Ga0395901_0040438 3300038443 Bacteria 4830
611 Ga0395901_0154478 3300038443 Bacteria 2411
612 Ga0242420_023015 3300038996 Bacteria 1123
613 Ga0436365_0262673 3300039437 Bacteria 2173
614 Ga0436365_0646666 3300039437 Bacteria 3450
615 Ga0436365_0701279 3300039437 Bacteria 2146
616 Ga0436360_0288674 3300039438 Bacteria 3013
617 Ga0436360_0427393 3300039438 Bacteria 1929
618 Ga0436360_0432140 3300039438 Bacteria 1465
619 Ga0436360_0621665 3300039438 Bacteria 2655
620 Ga0436360_0634297 3300039438 Bacteria 3436
621 Ga0436361_0565162 3300039447 Bacteria 3104
622 Ga0436361_0804636 3300039447 Bacteria 1621
623 Ga0436363_0384424 3300039450 Bacteria 4704
624 Ga0436363_0412808 3300039450 Bacteria 1391
625 Ga0436363_1362005 3300039450 Bacteria 978
626 Ga0436363_1450587 3300039450 Bacteria 3162
627 Ga0436363_1461858 3300039450 Bacteria 2953
628 Ga0436362_0280096 3300039453 Bacteria 2495
629 Ga0436362_0355831 3300039453 Bacteria 6148
630 Ga0436362_1044336 3300039453 Bacteria 3303
631 Ga0439448_0001996 3300042005 Bacteria 5451
632 Ga0439459_0005954 3300042438 Bacteria 2019
633 Ga0439464_0000185 3300042439 Bacteria 10818
634 Ga0439460_0000645 3300042461 Bacteria 7665
635 Ga0439460_0002041 3300042461 Bacteria 4842
636 Ga0451577_0003647 3300042876 Bacteria 16886
637 Ga0451577_0014234 3300042876 Bacteria 7415
638 Ga0451577_0144248 3300042876 Bacteria 2140
639 Ga0451577_0195116 3300042876 Bacteria 1827
640 Ga0453683_0008311 3300044673 Bacteria 6976
641 Ga0453683_0019448 3300044673 Bacteria 4349
642 Ga0453683_0032513 3300044673 Bacteria 3292
643 Ga0453683_0091398 3300044673 Bacteria 1908
644 Ga0453684_0033865 3300044712 Bacteria 7108
645 Ga0453684_0072440 3300044712 Bacteria 4349
646 Ga0453684_0306855 3300044712 Unclassified 1802
647 Ga0451576_0007779 3300045051 Bacteria 12719
648 Ga0451576_0008007 3300045051 Bacteria 12488
649 Ga0451576_0046553 3300045051 Bacteria 4566
650 Ga0451576_0101787 3300045051 Bacteria 2987
651 Ga0495592_0036539 3300046454 Bacteria 3699
652 Ga0495592_0038473 3300046454 Bacteria 3600
653 Ga0495629_0012711 3300046459 Bacteria 6095
654 Ga0495629_0077308 3300046459 Bacteria 2323
655 Ga0495629_0309345 3300046459 Bacteria 1081
656 Ga0495641_0108816 3300046461 Bacteria 1237
657 Ga0495651_0142333 3300046462 Bacteria 1737
658 Ga0495653_0002423 3300046463 Bacteria 14846
659 Ga0495580_0004048 3300046472 Bacteria 12367
660 Ga0495580_0124609 3300046472 Bacteria 1788
661 Ga0495582_0063387 3300046473 Bacteria 2042
662 Ga0495662_0048832 3300046476 Bacteria 2043
663 Ga0495662_0137303 3300046476 Bacteria 1203
664 Ga0495664_0003422 3300046477 Bacteria 8627
665 Ga0495594_0075029 3300046499 Bacteria 1885
666 Ga0495608_0008830 3300046511 Bacteria 7052
667 Ga0495628_0041389 3300046516 Bacteria 3678
668 Ga0495628_0045948 3300046516 Bacteria 3470
669 Ga0495666_0044901 3300046526 Bacteria 2133
670 Ga0495652_0084105 3300046529 Bacteria 2617
671 Ga0495652_0095305 3300046529 Bacteria 2425
672 Ga0495665_0026882 3300046531 Bacteria 3090
673 Ga0495640_0024793 3300046533 Bacteria 4358
674 Ga0495640_0092712 3300046533 Bacteria 1992
675 Ga0495640_0205603 3300046533 Bacteria 1246
676 Ga0495587_0020063 3300046536 Bacteria 4129
677 Ga0495587_0025261 3300046536 Bacteria 3630
678 Ga0495645_0008413 3300046543 Bacteria 7209
679 Ga0495645_0026093 3300046543 Bacteria 4240
680 Ga0495645_0073883 3300046543 Bacteria 2455
681 Ga0495667_0004876 3300046559 Bacteria 9070
682 Ga0495667_0026765 3300046559 Bacteria 3885
683 Ga0495667_0040322 3300046559 Bacteria 3101
684 Ga0495667_0054978 3300046559 Bacteria 2618
685 Ga0495667_0077177 3300046559 Bacteria 2167
686 Ga0495634_0033815 3300046642 Bacteria 3511
687 Ga0495634_0034511 3300046642 Bacteria 3471
688 Ga0495634_0067441 3300046642 Bacteria 2367
689 Ga0495635_0034112 3300046663 Bacteria 3531
690 Ga0495635_0040398 3300046663 Bacteria 3224
691 Ga0495635_0042167 3300046663 Bacteria 3151
692 Ga0495588_0068110 3300046674 Bacteria 1848
693 Ga0495599_0014789 3300046678 Bacteria 4831
694 Ga0495599_0015541 3300046678 Bacteria 4725
695 Ga0495623_0009138 3300046679 Bacteria 6429
696 Ga0495646_0014497 3300046680 Bacteria 5011
697 Ga0495658_0126059 3300046683 Bacteria 1554
698 Ga0495658_0180948 3300046683 Bacteria 1308
699 Ga0495658_0253170 3300046683 Bacteria 1108
700 Ga0495658_0282203 3300046683 Bacteria 1048
701 Ga0495624_0036743 3300046690 Bacteria 3156
702 Ga0495624_0077858 3300046690 Bacteria 2057
703 Ga0495670_0238481 3300046691 Bacteria 968
704 Ga0495600_0082782 3300046809 Bacteria 2094
705 Ga0495600_0092479 3300046809 Bacteria 1972
706 Ga0495581_0086789 3300047315 Bacteria 1814
707 Ga0495604_0002404 3300047317 Bacteria 14988
708 Ga0495604_0090384 3300047317 Bacteria 2274
709 Ga0495674_0007810 3300047319 Bacteria 10213
710 Ga0495674_0142647 3300047319 Bacteria 2013
711 Ga0495676_0102548 3300047321 Bacteria 2114
712 Ga0495680_0002651 3300047322 Bacteria 18113
713 Ga0495680_0070091 3300047322 Bacteria 2674
714 Ga0495680_0072484 3300047322 Bacteria 2620
715 Ga0495675_0005549 3300047444 Bacteria 7696
716 Ga0495675_0071843 3300047444 Bacteria 2184
717 Ga0495684_0026505 3300047471 Bacteria 4455
718 Ga0495684_0048644 3300047471 Bacteria 3242
719 Ga0495684_0080492 3300047471 Bacteria 2473
720 Ga0495593_0052161 3300047673 Bacteria 2162
721 Ga0495602_0000299 3300048088 Bacteria 45610
722 Ga0495602_0077080 3300048088 Bacteria 2822
723 Ga0495602_0139861 3300048088 Bacteria 1917
724 Ga0496101_0093130 3300048904 Bacteria 2244
725 Ga0496102_0037600 3300048905 Bacteria 4367
726 Ga0496103_0049390 3300048906 Bacteria 2601
727 Ga0496106_0019397 3300048909 Bacteria 5044
728 Ga0496106_0180393 3300048909 Unclassified 1676
729 Ga0496108_0088795 3300048911 Bacteria 2627
730 Ga0496108_0314175 3300048911 Bacteria 1365
731 Ga0496109_0051215 3300048912 Bacteria 3761
732 Ga0496110_0054677 3300048913 Bacteria 3512
733 Ga0496112_0024728 3300048915 Bacteria 5758
734 Ga0496112_0073214 3300048915 Bacteria 3387
735 Ga0496112_0307729 3300048915 Bacteria 1530
736 Ga0496113_0017599 3300048916 Bacteria 4964
737 Ga0496113_0032907 3300048916 Bacteria 3771
738 Ga0496115_0035422 3300048918 Bacteria 3948
739 Ga0496121_0048028 3300048924 Bacteria 3636
740 Ga0496126_0027923 3300048929 Bacteria 5382
741 Ga0501031_0030752 3300049568 Bacteria 3503
742 Ga0501038_0179810 3300049574 Bacteria 1707
743 Ga0501039_0016008 3300049575 Bacteria 5743
744 Ga0501040_0010906 3300049576 Bacteria 5942
745 Ga0501040_0015905 3300049576 Bacteria 4973
746 Ga0501040_0023255 3300049576 Bacteria 4155
747 Ga0501041_0005485 3300049577 Bacteria 7424
748 Ga0501041_0006986 3300049577 Bacteria 6622
749 Ga0501042_0006201 3300049578 Bacteria 7761
750 Ga0501042_0023145 3300049578 Bacteria 4343
751 Ga0501042_0077509 3300049578 Bacteria 2380
752 Ga0501046_0000295 3300049580 Bacteria 50418
753 Ga0501046_0001418 3300049580 Bacteria 23061
754 Ga0501046_0121250 3300049580 Bacteria 1989
755 Ga0501070_0013607 3300049586 Bacteria 6857
756 Ga0501070_0158292 3300049586 Bacteria 1868
757 Ga0501072_0113004 3300049588 Bacteria 2162
758 Ga0501073_0077732 3300049589 Bacteria 2309
759 Ga0501074_0006949 3300049590 Bacteria 8175
760 Ga0501074_0028505 3300049590 Bacteria 4047
761 Ga0501074_0116793 3300049590 Bacteria 1909
762 Ga0501074_0117798 3300049590 Bacteria 1900
763 Ga0501075_0094521 3300049591 Bacteria 2269
764 Ga0501076_0035680 3300049592 Bacteria 3891
765 Ga0501077_0181332 3300049593 Bacteria 1338
766 Ga0501079_0000617 3300049741 Bacteria 23595
767 Ga0501079_0005572 3300049741 Bacteria 9396
768 Ga0501079_0010629 3300049741 Bacteria 7005
769 Ga0501080_0059104 3300049742 Bacteria 3568
770 Ga0501080_0061225 3300049742 Bacteria 3505
771 Ga0501081_0011693 3300049743 Bacteria 5746
772 Ga0501081_0036762 3300049743 Bacteria 3339
773 Ga0501081_0083950 3300049743 Bacteria 2233
774 Ga0501083_0043295 3300049744 Bacteria 3051
775 Ga0501083_0080809 3300049744 Bacteria 2155
776 Ga0501035_0072138 3300049822 Bacteria 3057
777 Ga0501045_0000318 3300049824 Bacteria 28148
778 Ga0501045_0000939 3300049824 Bacteria 19048
779 nmdc:mga0yw44_127385_c1 3300050492 Bacteria 1645
780 nmdc:mga05p37_12107_c1 3300050507 Bacteria 10298
781 nmdc:mga05p37_125061_c1 3300050507 Unclassified 3158
782 nmdc:mga05p37_13768_c1 3300050507 Bacteria 9692
783 nmdc:mga05p37_217042_c1 3300050507 Bacteria 2310
784 nmdc:mga05p37_259534_c1 3300050507 Bacteria 2080
785 nmdc:mga05p37_27232_c2 3300050507 Bacteria 6071
786 nmdc:mga05p37_27794_c1 3300050507 Bacteria 6891
787 nmdc:mga05p37_31506_c1 3300050507 Bacteria 6477
788 nmdc:mga05p37_40434_c1 3300050507 Bacteria 5727
789 nmdc:mga05p37_42837_c1 3300050507 Bacteria 5565
790 nmdc:mga05p37_4931_c1 3300050507 Bacteria 15633
791 nmdc:mga05p37_56142_c1 3300050507 Bacteria 4848
792 nmdc:mga05p37_5780_c1 3300050507 Bacteria 14546
793 nmdc:mga05p37_58251_c1 3300050507 Bacteria 4758
794 nmdc:mga05p37_6086_c1 3300050507 Bacteria 14209
795 nmdc:mga05p37_676558_c1 3300050507 Bacteria 1151
796 nmdc:mga05p37_68705_c1 3300050507 Bacteria 4357
797 nmdc:mga05p37_7199_c1 3300050507 Bacteria 13124
798 nmdc:mga05p37_76551_c1 3300050507 Bacteria 4119
799 nmdc:mga05p37_8072_c1 3300050507 Bacteria 12436
800 nmdc:mga05p37_94672_c1 3300050507 Bacteria 3680
801 nmdc:mga05p37_98210_c1 3300050507 Bacteria 3607
802 nmdc:mga09592_137351_c1 3300050508 Bacteria 2106
803 nmdc:mga09592_148559_c1 3300050508 Bacteria 2021
804 nmdc:mga09592_1636_c1 3300050508 Bacteria 18036
805 nmdc:mga09592_168049_c1 3300050508 Bacteria 1896
806 nmdc:mga09592_17687_c1 3300050508 Bacteria 3769
807 nmdc:mga09592_1890_c1 3300050508 Bacteria 16868
808 nmdc:mga09592_3205_c1 3300050508 Bacteria 13246
809 nmdc:mga09592_333039_c1 3300050508 Bacteria 1314
810 nmdc:mga09592_33859_c1 3300050508 Bacteria 4269
811 nmdc:mga09592_34576_c1 3300050508 Bacteria 4225
812 nmdc:mga09592_350768_c1 3300050508 Bacteria 1277
813 nmdc:mga09592_41229_c1 3300050508 Bacteria 3036
814 nmdc:mga09592_4123_c1 3300050508 Bacteria 11741
815 nmdc:mga09592_56141_c1 3300050508 Bacteria 3328
816 nmdc:mga0qj67_13398_c1 3300050509 Bacteria 6185
817 nmdc:mga0qj67_23809_c1 3300050509 Bacteria 4715
818 nmdc:mga0qj67_257_c1 3300050509 Bacteria 36250
819 nmdc:mga0qj67_30012_c1 3300050509 Bacteria 4227
820 nmdc:mga0qj67_313531_c1 3300050509 Bacteria 1270
821 nmdc:mga0qj67_35029_c1 3300050509 Bacteria 3924
822 nmdc:mga0qj67_40703_c1 3300050509 Bacteria 3652
823 nmdc:mga0qj67_53973_c1 3300050509 Bacteria 3182
824 nmdc:mga0qj67_582_c1 3300050509 Bacteria 24949
825 nmdc:mga06r32_121051_c1 3300050510 Bacteria 2582
826 nmdc:mga06r32_12541_c2 3300050510 Bacteria 4812
827 nmdc:mga06r32_13444_c1 3300050510 Bacteria 7413
828 nmdc:mga06r32_164798_c1 3300050510 Bacteria 2199
829 nmdc:mga06r32_16890_c1 3300050510 Bacteria 6657
830 nmdc:mga06r32_229376_c1 3300050510 Bacteria 1845
831 nmdc:mga06r32_233134_c1 3300050510 Bacteria 1829
832 nmdc:mga06r32_26507_c1 3300050510 Bacteria 5405
833 nmdc:mga06r32_414_c1 3300050510 Bacteria 35862
834 nmdc:mga06r32_52069_c1 3300050510 Bacteria 3920
835 nmdc:mga06r32_63091_c1 3300050510 Bacteria 3571
836 nmdc:mga06r32_633_c1 3300050510 Bacteria 30525
837 nmdc:mga06r32_69344_c1 3300050510 Bacteria 3407
838 nmdc:mga06r32_75407_c1 3300050510 Bacteria 3273
839 nmdc:mga08y16_13643_c1 3300050511 Bacteria 8555
840 nmdc:mga08y16_184751_c1 3300050511 Bacteria 2164
841 nmdc:mga08y16_1952_c1 3300050511 Bacteria 21031
842 nmdc:mga08y16_222349_c1 3300050511 Bacteria 1954
843 nmdc:mga08y16_252_c1 3300050511 Bacteria 48080
844 nmdc:mga08y16_348710_c1 3300050511 Bacteria 1521
845 nmdc:mga08y16_35210_c1 3300050511 Bacteria 5259
846 nmdc:mga08y16_372490_c1 3300050511 Unclassified 1465
847 nmdc:mga08y16_51576_c1 3300050511 Bacteria 4304
848 nmdc:mga08y16_540591_c1 3300050511 Bacteria 1180
849 nmdc:mga0n895_104233_c1 3300050512 Bacteria 2849
850 nmdc:mga0n895_14949_c1 3300050512 Bacteria 7071
851 nmdc:mga0n895_17822_c1 3300050512 Bacteria 6557
852 nmdc:mga0n895_22123_c1 3300050512 Bacteria 5958
853 nmdc:mga0n895_238676_c1 3300050512 Bacteria 1844
854 nmdc:mga0n895_246253_c1 3300050512 Bacteria 1814
855 nmdc:mga0n895_24907_c1 3300050512 Bacteria 5647
856 nmdc:mga0n895_272681_c1 3300050512 Bacteria 1716
857 nmdc:mga0n895_3667_c1 3300050512 Bacteria 12407
858 nmdc:mga0n895_410898_c1 3300050512 Unclassified 1368
859 nmdc:mga0n895_6563_c1 3300050512 Bacteria 9903
860 nmdc:mga0n895_81790_c1 3300050512 Bacteria 3219
861 nmdc:mga0n895_99145_c1 3300050512 Bacteria 2921
862 nmdc:mga0rr50_102045_c1 3300050513 Bacteria 2256
863 nmdc:mga0rr50_13494_c1 3300050513 Bacteria 5321
864 nmdc:mga0rr50_185420_c1 3300050513 Bacteria 1703
865 nmdc:mga0rr50_341742_c1 3300050513 Bacteria 1258
866 nmdc:mga0rr50_5513_c1 3300050513 Bacteria 7560
867 nmdc:mga0rr50_9196_c1 3300050513 Bacteria 6196
868 nmdc:mga08x19_14900_c1 3300050514 Bacteria 4722
869 nmdc:mga08x19_1627_c1 3300050514 Bacteria 13903
870 nmdc:mga08x19_190933_c1 3300050514 Bacteria 1401
871 nmdc:mga08x19_38095_c1 3300050514 Bacteria 3053
872 nmdc:mga08x19_512_c1 3300050514 Bacteria 25768
873 nmdc:mga0a205_105647_c1 3300050515 Bacteria 2715
874 nmdc:mga0a205_106128_c1 3300050515 Bacteria 2707
875 nmdc:mga0a205_1869_c1 3300050515 Bacteria 18245
876 nmdc:mga0a205_193951_c1 3300050515 Bacteria 1923
877 nmdc:mga0a205_207862_c1 3300050515 Bacteria 1846
878 nmdc:mga0a205_2135_c1 3300050515 Bacteria 17365
879 nmdc:mga0a205_269_c1 3300050515 Bacteria 37657
880 nmdc:mga0a205_32206_c1 3300050515 Bacteria 1774
881 nmdc:mga0a205_3306_c1 3300050515 Bacteria 14349
882 nmdc:mga0a205_364835_c1 3300050515 Bacteria 1311
883 nmdc:mga0a205_41062_c1 3300050515 Bacteria 4455
884 nmdc:mga0a205_54054_c1 3300050515 Bacteria 3877
885 nmdc:mga0a205_64096_c1 3300050515 Bacteria 3549
886 nmdc:mga0a205_6420_c1 3300050515 Bacteria 10627
887 nmdc:mga0a205_78957_c1 3300050515 Bacteria 3180
888 Ga0495601_0005899 3300053077 Bacteria 7141
889 Ga0495601_0067041 3300053077 Bacteria 2286
890 Ga0495612_0001163 3300053078 Bacteria 10814
891 Ga0495612_0122115 3300053078 Bacteria 1121
892 Ga0495595_0036278 3300053084 Bacteria 2236
893 Ga0495595_0041733 3300053084 Bacteria 2100
894 Ga0495595_0097612 3300053084 Bacteria 1415
895 Ga0495619_0056155 3300053085 Bacteria 2609
896 Ga0495619_0100927 3300053085 Bacteria 1964
897 Ga0500644_0018660 3300053088 Bacteria 2036
898 Ga0500636_0151724 3300053177 Bacteria 1272
899 Ga0501084_0001227 3300054114 Bacteria 20192
900 Ga0501084_0138286 3300054114 Bacteria 2050
901 Ga0501082_0000512 3300060353 Bacteria 34419
902 Ga0501082_0005149 3300060353 Bacteria 11382
903 Ga0466962_0020771 3300061719 Bacteria 3156
904 Ga0530510_0016829 3300061734 Bacteria 5178
905 Ga0530510_0089864 3300061734 Bacteria 2240

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035170 Ga0373943_0199547 Ga0373943_0199547_262_1095 265
2 3300005445 Ga0070708_100038506 Ga0070708_1000385063 266
3 3300009094 Ga0111539_10057849 Ga0111539_100578492 267
4 3300009147 Ga0114129_10409785 Ga0114129_104097852 267
5 3300050507 nmdc:mga05p37_12107_c1 nmdc:mga05p37_12107_c1_8392_9276 267
6 3300050511 nmdc:mga08y16_372490_c1 nmdc:mga08y16_372490_c1_269_1153 267
7 3300050515 nmdc:mga0a205_364835_c1 nmdc:mga0a205_364835_c1_86_970 267
8 3300005468 Ga0070707_100162857 Ga0070707_1001628572 268
9 3300028573 Ga0265334_10040586 Ga0265334_100405862 268
10 3300048916 Ga0496113_0032907 Ga0496113_0032907_2932_3759 268
11 3300027671 Ga0209588_1005624 Ga0209588_10056244 269
12 3300026116 Ga0207674_10012224 Ga0207674_100122247 270
13 3300005364 Ga0070673_100356231 Ga0070673_1003562312 272
14 3300021377 Ga0213874_10022030 Ga0213874_100220302 272
15 3300039437 Ga0436365_0262673 Ga0436365_0262673_104_1039 272
16 3300039450 Ga0436363_1461858 Ga0436363_1461858_1307_2242 272
17 3300050507 nmdc:mga05p37_58251_c1 nmdc:mga05p37_58251_c1_2910_3773 272
18 3300050508 nmdc:mga09592_56141_c1 nmdc:mga09592_56141_c1_1480_2343 272
19 3300050509 nmdc:mga0qj67_35029_c1 nmdc:mga0qj67_35029_c1_688_1551 272
20 3300050510 nmdc:mga06r32_26507_c1 nmdc:mga06r32_26507_c1_2374_3237 272
21 3300005445 Ga0070708_100329456 Ga0070708_1003294562 274
22 3300005468 Ga0070707_100024463 Ga0070707_1000244634 274
23 3300005471 Ga0070698_100080100 Ga0070698_1000801002 274
24 3300006028 Ga0070717_10318894 Ga0070717_103188942 274
25 3300025922 Ga0207646_10014019 Ga0207646_100140198 275
26 3300005434 Ga0070709_10003361 Ga0070709_100033613 276
27 3300005436 Ga0070713_100008252 Ga0070713_1000082527 276
28 3300005437 Ga0070710_10005213 Ga0070710_100052135 276
29 3300007788 Ga0099795_10008622 Ga0099795_100086222 276
30 3300010159 Ga0099796_10000792 Ga0099796_100007922 276
31 3300025898 Ga0207692_10007559 Ga0207692_100075593 276
32 3300025906 Ga0207699_10005400 Ga0207699_100054004 276
33 3300025921 Ga0207652_10201467 Ga0207652_102014672 276
34 3300025928 Ga0207700_10018539 Ga0207700_100185393 276
35 3300025929 Ga0207664_10006892 Ga0207664_100068924 276
36 3300035241 Ga0373961_0072141 Ga0373961_0072141_78_908 276
37 3300035692 Ga0373935_0071529 Ga0373935_0071529_689_1627 276
38 3300035695 Ga0373927_0072278 Ga0373927_0072278_1051_1989 276
39 3300037068 Ga0373925_0509127 Ga0373925_0509127_13_951 276
40 3300037853 Ga0436364_0352307 Ga0436364_0352307_44_874 276
41 3300039450 Ga0436363_1362005 Ga0436363_1362005_22_852 276
42 3300044673 Ga0453683_0091398 Ga0453683_0091398_990_1820 276
43 3300050509 nmdc:mga0qj67_313531_c1 nmdc:mga0qj67_313531_c1_21_851 276
44 3300009094 Ga0111539_10002621 Ga0111539_1000262116 277
45 3300039438 Ga0436360_0427393 Ga0436360_0427393_936_1874 277
46 3300050509 nmdc:mga0qj67_30012_c1 nmdc:mga0qj67_30012_c1_3374_4207 277
47 3300053088 Ga0500644_0018660 Ga0500644_0018660_519_1391 278
48 3300005293 Ga0065715_10096737 Ga0065715_100967373 280
49 3300005328 Ga0070676_10024086 Ga0070676_100240864 280
50 3300005331 Ga0070670_100000678 Ga0070670_10000067831 280
51 3300005336 Ga0070680_100001152 Ga0070680_1000011525 280
52 3300005337 Ga0070682_100002090 Ga0070682_1000020905 280
53 3300005339 Ga0070660_100001587 Ga0070660_1000015875 280
54 3300005344 Ga0070661_100002632 Ga0070661_1000026327 280
55 3300005366 Ga0070659_100003091 Ga0070659_1000030912 280
56 3300005406 Ga0070703_10020720 Ga0070703_100207202 280
57 3300005440 Ga0070705_100002566 Ga0070705_10000256611 280
58 3300005444 Ga0070694_100001010 Ga0070694_10000101010 280
59 3300005455 Ga0070663_100001727 Ga0070663_10000172712 280
60 3300005457 Ga0070662_100014904 Ga0070662_1000149045 280
61 3300005459 Ga0068867_100020324 Ga0068867_1000203241 280
62 3300005530 Ga0070679_100010038 Ga0070679_1000100382 280
63 3300005535 Ga0070684_100024412 Ga0070684_1000244121 280
64 3300005545 Ga0070695_100009327 Ga0070695_1000093275 280
65 3300005546 Ga0070696_100003863 Ga0070696_1000038632 280
66 3300005547 Ga0070693_100017613 Ga0070693_1000176132 280
67 3300005563 Ga0068855_100001585 Ga0068855_10000158522 280
68 3300005577 Ga0068857_100140670 Ga0068857_1001406702 280
69 3300005578 Ga0068854_100003455 Ga0068854_10000345511 280
70 3300005614 Ga0068856_100004059 Ga0068856_1000040595 280
71 3300005615 Ga0070702_100309864 Ga0070702_1003098641 280
72 3300005617 Ga0068859_100009042 Ga0068859_10000904210 280
73 3300005618 Ga0068864_100001941 Ga0068864_1000019416 280
74 3300005840 Ga0068870_10005871 Ga0068870_100058712 280
75 3300005841 Ga0068863_100004989 Ga0068863_1000049899 280
76 3300005842 Ga0068858_100147848 Ga0068858_1001478482 280
77 3300005843 Ga0068860_100018586 Ga0068860_1000185863 280
78 3300005844 Ga0068862_100005118 Ga0068862_10000511812 280
79 3300005844 Ga0068862_100057949 Ga0068862_1000579492 280
80 3300006852 Ga0075433_10007957 Ga0075433_100079576 280
81 3300006871 Ga0075434_100285706 Ga0075434_1002857062 280
82 3300006931 Ga0097620_100009043 Ga0097620_10000904310 280
83 3300007076 Ga0075435_100215257 Ga0075435_1002152572 280
84 3300009174 Ga0105241_10002609 Ga0105241_1000260910 280
85 3300009177 Ga0105248_10101693 Ga0105248_101016932 280
86 3300009551 Ga0105238_10496295 Ga0105238_104962952 280
87 3300010375 Ga0105239_10711132 Ga0105239_107111321 280
88 3300013100 Ga0157373_10007390 Ga0157373_100073904 280
89 3300013102 Ga0157371_10036655 Ga0157371_100366553 280
90 3300013105 Ga0157369_10008310 Ga0157369_100083109 280
91 3300013297 Ga0157378_10315604 Ga0157378_103156042 280
92 3300013307 Ga0157372_10000347 Ga0157372_1000034746 280
93 3300025901 Ga0207688_10007589 Ga0207688_100075893 280
94 3300025907 Ga0207645_10017408 Ga0207645_100174082 280
95 3300025908 Ga0207643_10001080 Ga0207643_100010806 280
96 3300025911 Ga0207654_10004145 Ga0207654_100041459 280
97 3300025912 Ga0207707_10005225 Ga0207707_100052259 280
98 3300025917 Ga0207660_10005541 Ga0207660_1000554111 280
99 3300025919 Ga0207657_10000925 Ga0207657_100009255 280
100 3300025921 Ga0207652_10003752 Ga0207652_100037528 280
101 3300025922 Ga0207646_10092888 Ga0207646_100928882 280
102 3300025925 Ga0207650_10006688 Ga0207650_100066882 280
103 3300025932 Ga0207690_10003419 Ga0207690_1000341911 280
104 3300025936 Ga0207670_10103072 Ga0207670_101030721 280
105 3300025940 Ga0207691_10120801 Ga0207691_101208012 280
106 3300025942 Ga0207689_10000250 Ga0207689_1000025012 280
107 3300025945 Ga0207679_10003431 Ga0207679_1000343111 280
108 3300025949 Ga0207667_10001657 Ga0207667_1000165712 280
109 3300025981 Ga0207640_10000925 Ga0207640_1000092514 280
110 3300026041 Ga0207639_10005303 Ga0207639_100053036 280
111 3300026067 Ga0207678_10002573 Ga0207678_100025738 280
112 3300026078 Ga0207702_10000979 Ga0207702_1000097926 280
113 3300026089 Ga0207648_10005180 Ga0207648_100051809 280
114 3300026116 Ga0207674_10004434 Ga0207674_1000443414 280
115 3300028380 Ga0268265_10006724 Ga0268265_100067249 280
116 3300035090 Ga0373949_0004095 Ga0373949_0004095_24_971 280
117 3300035121 Ga0373960_0032362 Ga0373960_0032362_64_1011 280
118 3300035691 Ga0373931_0057570 Ga0373931_0057570_525_1472 280
119 3300042005 Ga0439448_0001996 Ga0439448_0001996_2466_3413 280
120 3300042438 Ga0439459_0005954 Ga0439459_0005954_252_1199 280
121 3300044712 Ga0453684_0306855 Ga0453684_0306855_369_1316 280
122 3300048909 Ga0496106_0180393 Ga0496106_0180393_62_1009 280
123 3300050512 nmdc:mga0n895_81790_c1 nmdc:mga0n895_81790_c1_846_1793 280
124 3300050515 nmdc:mga0a205_105647_c1 nmdc:mga0a205_105647_c1_1162_2109 280
125 3300005444 Ga0070694_100026288 Ga0070694_1000262882 281
126 3300005547 Ga0070693_100002188 Ga0070693_1000021889 281
127 3300025907 Ga0207645_10071122 Ga0207645_100711222 281
128 3300025935 Ga0207709_10115734 Ga0207709_101157342 281
129 3300025942 Ga0207689_10023888 Ga0207689_100238884 281
130 3300025961 Ga0207712_10094433 Ga0207712_100944332 281
131 3300026089 Ga0207648_10030847 Ga0207648_100308474 281
132 3300028380 Ga0268265_10074090 Ga0268265_100740901 281
133 3300046459 Ga0495629_0309345 Ga0495629_0309345_226_1071 281
134 3300005334 Ga0068869_100012374 Ga0068869_1000123745 282
135 3300005334 Ga0068869_100386091 Ga0068869_1003860911 282
136 3300005365 Ga0070688_100025917 Ga0070688_1000259173 282
137 3300005406 Ga0070703_10075326 Ga0070703_100753261 282
138 3300005436 Ga0070713_100205911 Ga0070713_1002059112 282
139 3300005438 Ga0070701_10007287 Ga0070701_100072872 282
140 3300005440 Ga0070705_100145868 Ga0070705_1001458682 282
141 3300005444 Ga0070694_100051125 Ga0070694_1000511252 282
142 3300005444 Ga0070694_100074285 Ga0070694_1000742852 282
143 3300005444 Ga0070694_100213079 Ga0070694_1002130792 282
144 3300005544 Ga0070686_100175496 Ga0070686_1001754962 282
145 3300005545 Ga0070695_100006099 Ga0070695_1000060992 282
146 3300005545 Ga0070695_100017320 Ga0070695_1000173202 282
147 3300005549 Ga0070704_100195380 Ga0070704_1001953802 282
148 3300005617 Ga0068859_100026660 Ga0068859_1000266603 282
149 3300005843 Ga0068860_100082542 Ga0068860_1000825423 282
150 3300005844 Ga0068862_100096600 Ga0068862_1000966002 282
151 3300005844 Ga0068862_100196793 Ga0068862_1001967932 282
152 3300006173 Ga0070716_100056844 Ga0070716_1000568442 282
153 3300006852 Ga0075433_10000967 Ga0075433_1000096719 282
154 3300006931 Ga0097620_100026660 Ga0097620_1000266603 282
155 3300009147 Ga0114129_10372182 Ga0114129_103721822 282
156 3300009147 Ga0114129_10861665 Ga0114129_108616651 282
157 3300009176 Ga0105242_10213692 Ga0105242_102136922 282
158 3300009553 Ga0105249_10027079 Ga0105249_100270793 282
159 3300009553 Ga0105249_10055271 Ga0105249_100552714 282
160 3300009553 Ga0105249_10168434 Ga0105249_101684342 282
161 3300025885 Ga0207653_10010824 Ga0207653_100108242 282
162 3300025918 Ga0207662_10038478 Ga0207662_100384783 282
163 3300025922 Ga0207646_10166782 Ga0207646_101667821 282
164 3300025927 Ga0207687_10454049 Ga0207687_104540491 282
165 3300025928 Ga0207700_10166466 Ga0207700_101664661 282
166 3300025929 Ga0207664_10260823 Ga0207664_102608232 282
167 3300025939 Ga0207665_10003072 Ga0207665_100030722 282
168 3300025942 Ga0207689_10012034 Ga0207689_100120347 282
169 3300025942 Ga0207689_10086631 Ga0207689_100866312 282
170 3300025961 Ga0207712_10066220 Ga0207712_100662202 282
171 3300026075 Ga0207708_10038721 Ga0207708_100387213 282
172 3300026075 Ga0207708_10054625 Ga0207708_100546252 282
173 3300026089 Ga0207648_10155324 Ga0207648_101553242 282
174 3300026116 Ga0207674_10256786 Ga0207674_102567862 282
175 3300028380 Ga0268265_10023027 Ga0268265_100230272 282
176 3300028380 Ga0268265_10079504 Ga0268265_100795043 282
177 3300031852 Ga0307410_10038103 Ga0307410_100381034 282
178 3300031903 Ga0307407_10213031 Ga0307407_102130312 282
179 3300031995 Ga0307409_100442934 Ga0307409_1004429342 282
180 3300039437 Ga0436365_0646666 Ga0436365_0646666_242_1183 282
181 3300039453 Ga0436362_0355831 Ga0436362_0355831_3473_4414 282
182 3300042461 Ga0439460_0002041 Ga0439460_0002041_1838_2785 282
183 3300044673 Ga0453683_0008311 Ga0453683_0008311_6022_6954 282
184 3300045051 Ga0451576_0008007 Ga0451576_0008007_6490_7437 282
185 3300050507 nmdc:mga05p37_31506_c1 nmdc:mga05p37_31506_c1_1922_2869 282
186 3300050507 nmdc:mga05p37_676558_c1 nmdc:mga05p37_676558_c1_47_979 282
187 3300050512 nmdc:mga0n895_17822_c1 nmdc:mga0n895_17822_c1_719_1666 282
188 3300050513 nmdc:mga0rr50_9196_c1 nmdc:mga0rr50_9196_c1_4764_5711 282
189 3300050514 nmdc:mga08x19_1627_c1 nmdc:mga08x19_1627_c1_174_1121 282
190 3300050515 nmdc:mga0a205_1869_c1 nmdc:mga0a205_1869_c1_8635_9582 282
191 3300005444 Ga0070694_100103267 Ga0070694_1001032672 285
192 3300005467 Ga0070706_100082686 Ga0070706_1000826863 285
193 3300005445 Ga0070708_100230410 Ga0070708_1002304102 286
194 3300005467 Ga0070706_100191269 Ga0070706_1001912692 286
195 3300005471 Ga0070698_100003260 Ga0070698_1000032606 286
196 3300005536 Ga0070697_100094201 Ga0070697_1000942013 286
197 3300006028 Ga0070717_10000240 Ga0070717_1000024031 286
198 3300046691 Ga0495670_0238481 Ga0495670_0238481_85_945 286
199 3300006847 Ga0075431_100001751 Ga0075431_10000175114 288
200 3300006880 Ga0075429_100000710 Ga0075429_10000071014 288
201 3300009093 Ga0105240_10282127 Ga0105240_102821272 288
202 3300009147 Ga0114129_10028618 Ga0114129_100286184 288
203 3300009551 Ga0105238_10377872 Ga0105238_103778722 288
204 3300025913 Ga0207695_10159114 Ga0207695_101591142 288
205 3300025913 Ga0207695_10287550 Ga0207695_102875502 288
206 3300025917 Ga0207660_10104627 Ga0207660_101046272 288
207 3300025924 Ga0207694_10093774 Ga0207694_100937742 288
208 3300025944 Ga0207661_10009379 Ga0207661_100093793 288
209 3300027682 Ga0209971_1007671 Ga0209971_10076712 288
210 3300027876 Ga0209974_10022881 Ga0209974_100228812 288
211 3300037466 Ga0395898_0124898 Ga0395898_0124898_615_1481 288
212 3300046543 Ga0495645_0008413 Ga0495645_0008413_10_876 288
213 3300049580 Ga0501046_0121250 Ga0501046_0121250_797_1663 288
214 3300049586 Ga0501070_0013607 Ga0501070_0013607_1577_2443 288
215 3300049589 Ga0501073_0077732 Ga0501073_0077732_648_1514 288
216 3300049590 Ga0501074_0117798 Ga0501074_0117798_80_946 288
217 3300049742 Ga0501080_0059104 Ga0501080_0059104_1745_2611 288
218 3300050507 nmdc:mga05p37_98210_c1 nmdc:mga05p37_98210_c1_1241_2188 288
219 3300050508 nmdc:mga09592_3205_c1 nmdc:mga09592_3205_c1_2203_3150 288
220 3300050509 nmdc:mga0qj67_23809_c1 nmdc:mga0qj67_23809_c1_2501_3448 288
221 3300050510 nmdc:mga06r32_63091_c1 nmdc:mga06r32_63091_c1_1764_2711 288
222 3300053077 Ga0495601_0067041 Ga0495601_0067041_715_1581 288
223 3300061719 Ga0466962_0020771 Ga0466962_0020771_323_1189 288
224 3300005458 Ga0070681_10030359 Ga0070681_100303593 289
225 3300006871 Ga0075434_100166986 Ga0075434_1001669862 289
226 3300009147 Ga0114129_10040648 Ga0114129_100406483 289
227 3300025912 Ga0207707_10022196 Ga0207707_100221963 289
228 3300050507 nmdc:mga05p37_56142_c1 nmdc:mga05p37_56142_c1_2523_3470 289
229 3300048915 Ga0496112_0073214 Ga0496112_0073214_15_887 290
230 3300003349 JGI26129J50193_1001876 JGI26129J50193_10018762 291
231 3300005545 Ga0070695_100001392 Ga0070695_10000139214 291
232 3300006846 Ga0075430_100050849 Ga0075430_1000508493 291
233 3300007076 Ga0075435_100091710 Ga0075435_1000917102 291
234 3300009094 Ga0111539_10193423 Ga0111539_101934232 291
235 3300009147 Ga0114129_10124874 Ga0114129_101248742 291
236 3300009553 Ga0105249_10275699 Ga0105249_102756992 291
237 3300009553 Ga0105249_10570728 Ga0105249_105707281 291
238 3300013307 Ga0157372_10076210 Ga0157372_100762102 291
239 3300025933 Ga0207706_10045887 Ga0207706_100458874 291
240 3300027378 Ga0209981_1004630 Ga0209981_10046302 291
241 3300027665 Ga0209983_1000711 Ga0209983_10007112 291
242 3300027682 Ga0209971_1000008 Ga0209971_100000845 291
243 3300027717 Ga0209998_10000016 Ga0209998_1000001657 291
244 3300027876 Ga0209974_10000073 Ga0209974_100000733 291
245 3300039450 Ga0436363_0412808 Ga0436363_0412808_243_1133 291
246 3300049574 Ga0501038_0179810 Ga0501038_0179810_739_1686 291
247 3300049575 Ga0501039_0016008 Ga0501039_0016008_1884_2831 291
248 3300049576 Ga0501040_0015905 Ga0501040_0015905_105_1052 291
249 3300049578 Ga0501042_0006201 Ga0501042_0006201_431_1378 291
250 3300049580 Ga0501046_0000295 Ga0501046_0000295_8719_9666 291
251 3300049590 Ga0501074_0006949 Ga0501074_0006949_4348_5295 291
252 3300049741 Ga0501079_0000617 Ga0501079_0000617_6397_7344 291
253 3300049743 Ga0501081_0011693 Ga0501081_0011693_3827_4774 291
254 3300049824 Ga0501045_0000318 Ga0501045_0000318_22030_22977 291
255 3300050507 nmdc:mga05p37_40434_c1 nmdc:mga05p37_40434_c1_2969_3847 291
256 3300050508 nmdc:mga09592_1636_c1 nmdc:mga09592_1636_c1_2118_2996 291
257 3300050509 nmdc:mga0qj67_13398_c1 nmdc:mga0qj67_13398_c1_3371_4249 291
258 3300050510 nmdc:mga06r32_16890_c1 nmdc:mga06r32_16890_c1_2593_3471 291
259 3300050511 nmdc:mga08y16_51576_c1 nmdc:mga08y16_51576_c1_3183_4061 291
260 3300050513 nmdc:mga0rr50_102045_c1 nmdc:mga0rr50_102045_c1_378_1256 291
261 3300050515 nmdc:mga0a205_41062_c1 nmdc:mga0a205_41062_c1_1801_2679 291
262 3300053078 Ga0495612_0122115 Ga0495612_0122115_82_975 291
263 3300054114 Ga0501084_0001227 Ga0501084_0001227_15024_15971 291
264 3300060353 Ga0501082_0000512 Ga0501082_0000512_16591_17538 291
265 3300005458 Ga0070681_10323844 Ga0070681_103238442 292
266 3300006847 Ga0075431_100012318 Ga0075431_1000123184 292
267 3300044673 Ga0453683_0019448 Ga0453683_0019448_826_1764 292
268 3300050507 nmdc:mga05p37_125061_c1 nmdc:mga05p37_125061_c1_810_1754 292
269 3300005536 Ga0070697_100134407 Ga0070697_1001344072 293
270 3300006852 Ga0075433_10387788 Ga0075433_103877881 293
271 3300015262 Ga0182007_10020576 Ga0182007_100205762 293
272 3300050512 nmdc:mga0n895_238676_c1 nmdc:mga0n895_238676_c1_108_1055 293
273 3300050512 nmdc:mga0n895_410898_c1 nmdc:mga0n895_410898_c1_304_1203 293
274 3300005439 Ga0070711_100002104 Ga0070711_1000021048 294
275 3300005518 Ga0070699_100190973 Ga0070699_1001909732 294
276 3300005985 Ga0081539_10004618 Ga0081539_100046186 294
277 3300006175 Ga0070712_100006939 Ga0070712_1000069394 294
278 3300009147 Ga0114129_10198809 Ga0114129_101988092 294
279 3300014325 Ga0163163_10442207 Ga0163163_104422072 294
280 3300025910 Ga0207684_10386659 Ga0207684_103866592 294
281 3300025915 Ga0207693_10002453 Ga0207693_1000245310 294
282 3300025922 Ga0207646_10016781 Ga0207646_100167812 294
283 3300003659 JGI25404J52841_10004850 JGI25404J52841_100048501 296
284 3300005445 Ga0070708_100064817 Ga0070708_1000648172 296
285 3300005471 Ga0070698_100009511 Ga0070698_1000095117 296
286 3300005518 Ga0070699_100135005 Ga0070699_1001350052 296
287 3300005536 Ga0070697_100012030 Ga0070697_1000120304 296
288 3300005983 Ga0081540_1018677 Ga0081540_10186774 296
289 3300006175 Ga0070712_100002037 Ga0070712_1000020379 296
290 3300009553 Ga0105249_10102256 Ga0105249_101022562 296
291 3300025910 Ga0207684_10290272 Ga0207684_102902722 296
292 3300025915 Ga0207693_10007608 Ga0207693_1000760812 296
293 3300026088 Ga0207641_10038507 Ga0207641_100385072 296
294 3300035088 Ga0373940_0045048 Ga0373940_0045048_64_1011 296
295 3300035114 Ga0373939_0011648 Ga0373939_0011648_62_1009 296
296 3300045051 Ga0451576_0101787 Ga0451576_0101787_1455_2402 296
297 3300046472 Ga0495580_0004048 Ga0495580_0004048_11346_12293 296
298 3300050512 nmdc:mga0n895_104233_c1 nmdc:mga0n895_104233_c1_604_1551 296
299 3300050515 nmdc:mga0a205_78957_c1 nmdc:mga0a205_78957_c1_1830_2777 296
300 3300013104 Ga0157370_10016104 Ga0157370_100161042 297
301 3300005295 Ga0065707_10252752 Ga0065707_102527521 298
302 3300005436 Ga0070713_100224175 Ga0070713_1002241752 298
303 3300005439 Ga0070711_100121044 Ga0070711_1001210442 298
304 3300005983 Ga0081540_1034102 Ga0081540_10341022 298
305 3300006847 Ga0075431_100025473 Ga0075431_1000254735 298
306 3300006847 Ga0075431_100058943 Ga0075431_1000589432 298
307 3300006852 Ga0075433_10082758 Ga0075433_100827582 298
308 3300006880 Ga0075429_100039288 Ga0075429_1000392883 298
309 3300009553 Ga0105249_10212794 Ga0105249_102127942 298
310 3300025916 Ga0207663_10125523 Ga0207663_101255232 298
311 3300025929 Ga0207664_10042184 Ga0207664_100421842 298
312 3300026078 Ga0207702_10037160 Ga0207702_100371602 298
313 3300037312 Ga0395899_0030724 Ga0395899_0030724_742_1674 298
314 3300037418 Ga0395900_0268057 Ga0395900_0268057_737_1690 298
315 3300037466 Ga0395898_0021886 Ga0395898_0021886_2253_3206 298
316 3300038443 Ga0395901_0003897 Ga0395901_0003897_12846_13778 298
317 3300048915 Ga0496112_0024728 Ga0496112_0024728_420_1358 298
318 3300050507 nmdc:mga05p37_5780_c1 nmdc:mga05p37_5780_c1_156_1052 298
319 3300050507 nmdc:mga05p37_7199_c1 nmdc:mga05p37_7199_c1_957_1862 298
320 3300050508 nmdc:mga09592_168049_c1 nmdc:mga09592_168049_c1_289_1185 298
321 3300050508 nmdc:mga09592_17687_c1 nmdc:mga09592_17687_c1_957_1862 298
322 3300050510 nmdc:mga06r32_12541_c2 nmdc:mga06r32_12541_c2_1084_1989 298
323 3300050512 nmdc:mga0n895_24907_c1 nmdc:mga0n895_24907_c1_4729_5625 298
324 3300050513 nmdc:mga0rr50_5513_c1 nmdc:mga0rr50_5513_c1_6489_7385 298
325 3300050514 nmdc:mga08x19_14900_c1 nmdc:mga08x19_14900_c1_2372_3310 298
326 3300050514 nmdc:mga08x19_512_c1 nmdc:mga08x19_512_c1_4202_5098 298
327 3300050515 nmdc:mga0a205_106128_c1 nmdc:mga0a205_106128_c1_818_1723 298
328 3300050515 nmdc:mga0a205_207862_c1 nmdc:mga0a205_207862_c1_851_1780 298
329 3300005467 Ga0070706_100364414 Ga0070706_1003644142 300
330 3300009148 Ga0105243_10138448 Ga0105243_101384482 300
331 3300025910 Ga0207684_10127396 Ga0207684_101273962 300
332 3300005435 Ga0070714_100033768 Ga0070714_1000337684 301
333 3300005436 Ga0070713_100029448 Ga0070713_1000294483 301
334 3300005437 Ga0070710_10000739 Ga0070710_100007394 301
335 3300005439 Ga0070711_100001284 Ga0070711_1000012844 301
336 3300006173 Ga0070716_100030323 Ga0070716_1000303233 301
337 3300025898 Ga0207692_10002939 Ga0207692_100029395 301
338 3300025906 Ga0207699_10000184 Ga0207699_100001847 301
339 3300025916 Ga0207663_10006005 Ga0207663_100060054 301
340 3300025928 Ga0207700_10048004 Ga0207700_100480043 301
341 3300025929 Ga0207664_10004648 Ga0207664_100046488 301
342 3300025939 Ga0207665_10135072 Ga0207665_101350722 301
343 3300031711 Ga0265314_10001303 Ga0265314_100013033 301
344 3300053177 Ga0500636_0151724 Ga0500636_0151724_274_1209 301
345 3300005340 Ga0070689_100118493 Ga0070689_1001184932 302
346 3300005345 Ga0070692_10192900 Ga0070692_101929001 302
347 3300005455 Ga0070663_100346372 Ga0070663_1003463722 302
348 3300005459 Ga0068867_100424535 Ga0068867_1004245351 302
349 3300005543 Ga0070672_100130019 Ga0070672_1001300192 302
350 3300005843 Ga0068860_100286546 Ga0068860_1002865462 302
351 3300006175 Ga0070712_100036963 Ga0070712_1000369632 302
352 3300006844 Ga0075428_100012236 Ga0075428_10001223611 302
353 3300009094 Ga0111539_10001266 Ga0111539_1000126635 302
354 3300009174 Ga0105241_10068576 Ga0105241_100685762 302
355 3300009553 Ga0105249_10097034 Ga0105249_100970341 302
356 3300011119 Ga0105246_10509144 Ga0105246_105091441 302
357 3300017792 Ga0163161_10305754 Ga0163161_103057541 302
358 3300025915 Ga0207693_10021040 Ga0207693_100210404 302
359 3300025940 Ga0207691_10060852 Ga0207691_100608522 302
360 3300027907 Ga0207428_10008093 Ga0207428_100080933 302
361 3300035691 Ga0373931_0005096 Ga0373931_0005096_3520_4446 302
362 3300035691 Ga0373931_0107664 Ga0373931_0107664_87_1016 302
363 3300048911 Ga0496108_0088795 Ga0496108_0088795_1528_2454 302
364 3300048915 Ga0496112_0307729 Ga0496112_0307729_566_1492 302
365 3300050492 nmdc:mga0yw44_127385_c1 nmdc:mga0yw44_127385_c1_489_1418 302
366 3300050511 nmdc:mga08y16_35210_c1 nmdc:mga08y16_35210_c1_516_1442 302
367 3300005295 Ga0065707_10102712 Ga0065707_101027121 303
368 3300005334 Ga0068869_100143220 Ga0068869_1001432202 303
369 3300005336 Ga0070680_100318626 Ga0070680_1003186262 303
370 3300005340 Ga0070689_100106356 Ga0070689_1001063561 303
371 3300005341 Ga0070691_10081892 Ga0070691_100818921 303
372 3300005435 Ga0070714_100148132 Ga0070714_1001481322 303
373 3300005440 Ga0070705_100144254 Ga0070705_1001442542 303
374 3300005441 Ga0070700_100028698 Ga0070700_1000286982 303
375 3300005444 Ga0070694_100024660 Ga0070694_1000246602 303
376 3300005444 Ga0070694_100086335 Ga0070694_1000863352 303
377 3300005445 Ga0070708_100011602 Ga0070708_1000116026 303
378 3300005445 Ga0070708_100057912 Ga0070708_1000579123 303
379 3300005445 Ga0070708_100106276 Ga0070708_1001062763 303
380 3300005445 Ga0070708_100216182 Ga0070708_1002161822 303
381 3300005457 Ga0070662_100045195 Ga0070662_1000451952 303
382 3300005457 Ga0070662_100055559 Ga0070662_1000555592 303
383 3300005459 Ga0068867_100064865 Ga0068867_1000648651 303
384 3300005467 Ga0070706_100004042 Ga0070706_1000040429 303
385 3300005467 Ga0070706_100277066 Ga0070706_1002770661 303
386 3300005468 Ga0070707_100092901 Ga0070707_1000929013 303
387 3300005471 Ga0070698_100140456 Ga0070698_1001404562 303
388 3300005471 Ga0070698_100640889 Ga0070698_1006408891 303
389 3300005518 Ga0070699_100034226 Ga0070699_1000342263 303
390 3300005518 Ga0070699_100093065 Ga0070699_1000930652 303
391 3300005518 Ga0070699_100306814 Ga0070699_1003068142 303
392 3300005530 Ga0070679_100159783 Ga0070679_1001597832 303
393 3300005536 Ga0070697_100068040 Ga0070697_1000680403 303
394 3300005536 Ga0070697_100218558 Ga0070697_1002185582 303
395 3300005544 Ga0070686_100011978 Ga0070686_1000119783 303
396 3300005545 Ga0070695_100011421 Ga0070695_1000114214 303
397 3300005545 Ga0070695_100115640 Ga0070695_1001156402 303
398 3300005546 Ga0070696_100065476 Ga0070696_1000654762 303
399 3300005546 Ga0070696_100148166 Ga0070696_1001481662 303
400 3300005549 Ga0070704_100045070 Ga0070704_1000450702 303
401 3300005549 Ga0070704_100270541 Ga0070704_1002705412 303
402 3300005549 Ga0070704_100463344 Ga0070704_1004633441 303
403 3300005842 Ga0068858_100322395 Ga0068858_1003223952 303
404 3300005843 Ga0068860_100008117 Ga0068860_1000081178 303
405 3300005844 Ga0068862_100006591 Ga0068862_1000065917 303
406 3300005844 Ga0068862_100009075 Ga0068862_1000090755 303
407 3300005937 Ga0081455_10000654 Ga0081455_1000065438 303
408 3300005983 Ga0081540_1061808 Ga0081540_10618082 303
409 3300005985 Ga0081539_10000050 Ga0081539_10000050238 303
410 3300006844 Ga0075428_100001512 Ga0075428_10000151210 303
411 3300006844 Ga0075428_100010747 Ga0075428_1000107476 303
412 3300006844 Ga0075428_100048174 Ga0075428_1000481745 303
413 3300006844 Ga0075428_100063494 Ga0075428_1000634944 303
414 3300006844 Ga0075428_100126678 Ga0075428_1001266784 303
415 3300006844 Ga0075428_100143473 Ga0075428_1001434733 303
416 3300006844 Ga0075428_100565033 Ga0075428_1005650332 303
417 3300006846 Ga0075430_100000343 Ga0075430_10000034336 303
418 3300006846 Ga0075430_100003797 Ga0075430_10000379713 303
419 3300006846 Ga0075430_100070760 Ga0075430_1000707602 303
420 3300006846 Ga0075430_100076281 Ga0075430_1000762812 303
421 3300006847 Ga0075431_100000589 Ga0075431_1000005898 303
422 3300006847 Ga0075431_100008413 Ga0075431_1000084133 303
423 3300006847 Ga0075431_100016199 Ga0075431_1000161993 303
424 3300006847 Ga0075431_100037966 Ga0075431_1000379662 303
425 3300006847 Ga0075431_100078855 Ga0075431_1000788552 303
426 3300006847 Ga0075431_100100049 Ga0075431_1001000492 303
427 3300006847 Ga0075431_100263653 Ga0075431_1002636532 303
428 3300006847 Ga0075431_100273383 Ga0075431_1002733832 303
429 3300006847 Ga0075431_100576075 Ga0075431_1005760751 303
430 3300006852 Ga0075433_10000065 Ga0075433_100000653 303
431 3300006852 Ga0075433_10004058 Ga0075433_1000405810 303
432 3300006852 Ga0075433_10026832 Ga0075433_100268327 303
433 3300006852 Ga0075433_10266316 Ga0075433_102663162 303
434 3300006871 Ga0075434_100001212 Ga0075434_10000121213 303
435 3300006871 Ga0075434_100001353 Ga0075434_1000013532 303
436 3300006871 Ga0075434_100003549 Ga0075434_10000354914 303
437 3300006871 Ga0075434_100064872 Ga0075434_1000648724 303
438 3300006871 Ga0075434_100121403 Ga0075434_1001214032 303
439 3300006880 Ga0075429_100000014 Ga0075429_10000001455 303
440 3300006880 Ga0075429_100000807 Ga0075429_10000080721 303
441 3300006880 Ga0075429_100005652 Ga0075429_10000565210 303
442 3300006880 Ga0075429_100041783 Ga0075429_1000417833 303
443 3300006880 Ga0075429_100188441 Ga0075429_1001884412 303
444 3300006880 Ga0075429_100202118 Ga0075429_1002021182 303
445 3300006880 Ga0075429_100259612 Ga0075429_1002596122 303
446 3300006880 Ga0075429_100306443 Ga0075429_1003064431 303
447 3300006914 Ga0075436_100053692 Ga0075436_1000536923 303
448 3300007076 Ga0075435_100001556 Ga0075435_1000015567 303
449 3300007076 Ga0075435_100012879 Ga0075435_1000128792 303
450 3300007076 Ga0075435_100047753 Ga0075435_1000477532 303
451 3300007076 Ga0075435_100347176 Ga0075435_1003471761 303
452 3300009093 Ga0105240_10474560 Ga0105240_104745602 303
453 3300009094 Ga0111539_10011657 Ga0111539_100116572 303
454 3300009094 Ga0111539_10016847 Ga0111539_100168477 303
455 3300009094 Ga0111539_10344964 Ga0111539_103449642 303
456 3300009094 Ga0111539_10412847 Ga0111539_104128472 303
457 3300009094 Ga0111539_10438239 Ga0111539_104382392 303
458 3300009101 Ga0105247_10043972 Ga0105247_100439723 303
459 3300009147 Ga0114129_10003240 Ga0114129_100032402 303
460 3300009147 Ga0114129_10010224 Ga0114129_1001022414 303
461 3300009147 Ga0114129_10012541 Ga0114129_100125413 303
462 3300009147 Ga0114129_10019542 Ga0114129_100195427 303
463 3300009147 Ga0114129_10029401 Ga0114129_100294011 303
464 3300009147 Ga0114129_10047361 Ga0114129_100473613 303
465 3300009147 Ga0114129_10068567 Ga0114129_100685672 303
466 3300009147 Ga0114129_10190951 Ga0114129_101909512 303
467 3300009147 Ga0114129_10505019 Ga0114129_105050192 303
468 3300009147 Ga0114129_10794236 Ga0114129_107942361 303
469 3300009177 Ga0105248_10122207 Ga0105248_101222073 303
470 3300013297 Ga0157378_10107437 Ga0157378_101074372 303
471 3300014326 Ga0157380_10450497 Ga0157380_104504972 303
472 3300014968 Ga0157379_10416197 Ga0157379_104161972 303
473 3300025885 Ga0207653_10075959 Ga0207653_100759591 303
474 3300025910 Ga0207684_10004601 Ga0207684_100046014 303
475 3300025910 Ga0207684_10004627 Ga0207684_100046275 303
476 3300025910 Ga0207684_10012156 Ga0207684_100121565 303
477 3300025910 Ga0207684_10092188 Ga0207684_100921882 303
478 3300025912 Ga0207707_10179742 Ga0207707_101797422 303
479 3300025921 Ga0207652_10079842 Ga0207652_100798421 303
480 3300025922 Ga0207646_10045568 Ga0207646_100455681 303
481 3300025922 Ga0207646_10048272 Ga0207646_100482723 303
482 3300025922 Ga0207646_10227702 Ga0207646_102277022 303
483 3300025928 Ga0207700_10028000 Ga0207700_100280001 303
484 3300025929 Ga0207664_10016165 Ga0207664_100161655 303
485 3300025933 Ga0207706_10022010 Ga0207706_100220107 303
486 3300025933 Ga0207706_10051466 Ga0207706_100514662 303
487 3300025936 Ga0207670_10163615 Ga0207670_101636152 303
488 3300025940 Ga0207691_10110671 Ga0207691_101106712 303
489 3300025941 Ga0207711_10061833 Ga0207711_100618331 303
490 3300025942 Ga0207689_10074152 Ga0207689_100741522 303
491 3300025961 Ga0207712_10013516 Ga0207712_100135164 303
492 3300026035 Ga0207703_10522627 Ga0207703_105226272 303
493 3300026075 Ga0207708_10091112 Ga0207708_100911121 303
494 3300026075 Ga0207708_10145818 Ga0207708_101458182 303
495 3300026089 Ga0207648_10049757 Ga0207648_100497572 303
496 3300027378 Ga0209981_1001702 Ga0209981_10017023 303
497 3300027395 Ga0209996_1000427 Ga0209996_10004274 303
498 3300027471 Ga0209995_1002081 Ga0209995_10020812 303
499 3300027543 Ga0209999_1000272 Ga0209999_10002722 303
500 3300027552 Ga0209982_1001858 Ga0209982_10018582 303
501 3300027614 Ga0209970_1001273 Ga0209970_10012734 303
502 3300027617 Ga0210002_1000887 Ga0210002_10008875 303
503 3300027665 Ga0209983_1000101 Ga0209983_10001013 303
504 3300027671 Ga0209588_1015545 Ga0209588_10155452 303
505 3300027682 Ga0209971_1000003 Ga0209971_100000352 303
506 3300027695 Ga0209966_1000045 Ga0209966_10000454 303
507 3300027717 Ga0209998_10006972 Ga0209998_100069722 303
508 3300027876 Ga0209974_10000022 Ga0209974_1000002236 303
509 3300027907 Ga0207428_10000063 Ga0207428_1000006365 303
510 3300027907 Ga0207428_10000091 Ga0207428_1000009143 303
511 3300027907 Ga0207428_10000253 Ga0207428_100002532 303
512 3300027907 Ga0207428_10116258 Ga0207428_101162582 303
513 3300028380 Ga0268265_10006929 Ga0268265_100069297 303
514 3300028380 Ga0268265_10070909 Ga0268265_100709092 303
515 3300028380 Ga0268265_10091524 Ga0268265_100915242 303
516 3300028381 Ga0268264_10040497 Ga0268264_100404972 303
517 3300028381 Ga0268264_10278143 Ga0268264_102781431 303
518 3300031548 Ga0307408_100324329 Ga0307408_1003243292 303
519 3300037418 Ga0395900_0013350 Ga0395900_0013350_1889_2821 303
520 3300038443 Ga0395901_0000688 Ga0395901_0000688_34636_35568 303
521 3300038996 Ga0242420_023015 Ga0242420_023015_22_954 303
522 3300042439 Ga0439464_0000185 Ga0439464_0000185_9009_9941 303
523 3300042461 Ga0439460_0000645 Ga0439460_0000645_243_1175 303
524 3300042876 Ga0451577_0014234 Ga0451577_0014234_3358_4290 303
525 3300042876 Ga0451577_0195116 Ga0451577_0195116_537_1469 303
526 3300044712 Ga0453684_0072440 Ga0453684_0072440_1229_2161 303
527 3300045051 Ga0451576_0046553 Ga0451576_0046553_1912_2844 303
528 3300049568 Ga0501031_0030752 Ga0501031_0030752_1025_1960 303
529 3300049576 Ga0501040_0010906 Ga0501040_0010906_931_1863 303
530 3300049576 Ga0501040_0023255 Ga0501040_0023255_2684_3619 303
531 3300049577 Ga0501041_0005485 Ga0501041_0005485_3101_4033 303
532 3300049577 Ga0501041_0006986 Ga0501041_0006986_2519_3454 303
533 3300049578 Ga0501042_0023145 Ga0501042_0023145_2700_3632 303
534 3300049578 Ga0501042_0077509 Ga0501042_0077509_509_1444 303
535 3300049580 Ga0501046_0001418 Ga0501046_0001418_483_1415 303
536 3300049586 Ga0501070_0158292 Ga0501070_0158292_274_1209 303
537 3300049588 Ga0501072_0113004 Ga0501072_0113004_994_1929 303
538 3300049590 Ga0501074_0028505 Ga0501074_0028505_2372_3304 303
539 3300049590 Ga0501074_0116793 Ga0501074_0116793_351_1286 303
540 3300049591 Ga0501075_0094521 Ga0501075_0094521_332_1264 303
541 3300049592 Ga0501076_0035680 Ga0501076_0035680_922_1857 303
542 3300049593 Ga0501077_0181332 Ga0501077_0181332_100_1032 303
543 3300049741 Ga0501079_0005572 Ga0501079_0005572_4638_5570 303
544 3300049741 Ga0501079_0010629 Ga0501079_0010629_443_1378 303
545 3300049742 Ga0501080_0061225 Ga0501080_0061225_1336_2271 303
546 3300049743 Ga0501081_0036762 Ga0501081_0036762_217_1149 303
547 3300049743 Ga0501081_0083950 Ga0501081_0083950_92_1027 303
548 3300049744 Ga0501083_0043295 Ga0501083_0043295_1695_2630 303
549 3300049744 Ga0501083_0080809 Ga0501083_0080809_332_1264 303
550 3300049822 Ga0501035_0072138 Ga0501035_0072138_255_1190 303
551 3300049824 Ga0501045_0000939 Ga0501045_0000939_15350_16282 303
552 3300050507 nmdc:mga05p37_13768_c1 nmdc:mga05p37_13768_c1_5732_6664 303
553 3300050507 nmdc:mga05p37_217042_c1 nmdc:mga05p37_217042_c1_761_1693 303
554 3300050507 nmdc:mga05p37_259534_c1 nmdc:mga05p37_259534_c1_889_1821 303
555 3300050507 nmdc:mga05p37_27232_c2 nmdc:mga05p37_27232_c2_3319_4251 303
556 3300050507 nmdc:mga05p37_27794_c1 nmdc:mga05p37_27794_c1_3310_4242 303
557 3300050507 nmdc:mga05p37_42837_c1 nmdc:mga05p37_42837_c1_1343_2275 303
558 3300050507 nmdc:mga05p37_4931_c1 nmdc:mga05p37_4931_c1_6560_7492 303
559 3300050507 nmdc:mga05p37_6086_c1 nmdc:mga05p37_6086_c1_3124_4056 303
560 3300050507 nmdc:mga05p37_68705_c1 nmdc:mga05p37_68705_c1_1728_2660 303
561 3300050507 nmdc:mga05p37_76551_c1 nmdc:mga05p37_76551_c1_421_1353 303
562 3300050507 nmdc:mga05p37_8072_c1 nmdc:mga05p37_8072_c1_1063_1995 303
563 3300050508 nmdc:mga09592_137351_c1 nmdc:mga09592_137351_c1_388_1320 303
564 3300050508 nmdc:mga09592_148559_c1 nmdc:mga09592_148559_c1_497_1429 303
565 3300050508 nmdc:mga09592_1890_c1 nmdc:mga09592_1890_c1_14742_15674 303
566 3300050508 nmdc:mga09592_333039_c1 nmdc:mga09592_333039_c1_55_987 303
567 3300050508 nmdc:mga09592_33859_c1 nmdc:mga09592_33859_c1_1495_2427 303
568 3300050508 nmdc:mga09592_34576_c1 nmdc:mga09592_34576_c1_1410_2342 303
569 3300050508 nmdc:mga09592_350768_c1 nmdc:mga09592_350768_c1_314_1246 303
570 3300050508 nmdc:mga09592_41229_c1 nmdc:mga09592_41229_c1_969_1901 303
571 3300050508 nmdc:mga09592_4123_c1 nmdc:mga09592_4123_c1_8571_9503 303
572 3300050509 nmdc:mga0qj67_257_c1 nmdc:mga0qj67_257_c1_10313_11245 303
573 3300050509 nmdc:mga0qj67_53973_c1 nmdc:mga0qj67_53973_c1_696_1628 303
574 3300050509 nmdc:mga0qj67_582_c1 nmdc:mga0qj67_582_c1_23356_24288 303
575 3300050510 nmdc:mga06r32_121051_c1 nmdc:mga06r32_121051_c1_1178_2110 303
576 3300050510 nmdc:mga06r32_13444_c1 nmdc:mga06r32_13444_c1_2517_3449 303
577 3300050510 nmdc:mga06r32_164798_c1 nmdc:mga06r32_164798_c1_464_1396 303
578 3300050510 nmdc:mga06r32_229376_c1 nmdc:mga06r32_229376_c1_165_1097 303
579 3300050510 nmdc:mga06r32_233134_c1 nmdc:mga06r32_233134_c1_601_1533 303
580 3300050510 nmdc:mga06r32_414_c1 nmdc:mga06r32_414_c1_1018_1950 303
581 3300050510 nmdc:mga06r32_633_c1 nmdc:mga06r32_633_c1_10531_11463 303
582 3300050510 nmdc:mga06r32_69344_c1 nmdc:mga06r32_69344_c1_249_1181 303
583 3300050510 nmdc:mga06r32_75407_c1 nmdc:mga06r32_75407_c1_922_1854 303
584 3300050511 nmdc:mga08y16_13643_c1 nmdc:mga08y16_13643_c1_1253_2185 303
585 3300050511 nmdc:mga08y16_184751_c1 nmdc:mga08y16_184751_c1_548_1480 303
586 3300050511 nmdc:mga08y16_252_c1 nmdc:mga08y16_252_c1_739_1671 303
587 3300050511 nmdc:mga08y16_348710_c1 nmdc:mga08y16_348710_c1_351_1283 303
588 3300050512 nmdc:mga0n895_14949_c1 nmdc:mga0n895_14949_c1_3949_4881 303
589 3300050512 nmdc:mga0n895_22123_c1 nmdc:mga0n895_22123_c1_1616_2548 303
590 3300050512 nmdc:mga0n895_246253_c1 nmdc:mga0n895_246253_c1_257_1189 303
591 3300050512 nmdc:mga0n895_272681_c1 nmdc:mga0n895_272681_c1_759_1691 303
592 3300050512 nmdc:mga0n895_3667_c1 nmdc:mga0n895_3667_c1_11316_12248 303
593 3300050512 nmdc:mga0n895_99145_c1 nmdc:mga0n895_99145_c1_1279_2211 303
594 3300050513 nmdc:mga0rr50_13494_c1 nmdc:mga0rr50_13494_c1_3626_4558 303
595 3300050513 nmdc:mga0rr50_185420_c1 nmdc:mga0rr50_185420_c1_214_1146 303
596 3300050513 nmdc:mga0rr50_341742_c1 nmdc:mga0rr50_341742_c1_311_1243 303
597 3300050514 nmdc:mga08x19_190933_c1 nmdc:mga08x19_190933_c1_17_949 303
598 3300050514 nmdc:mga08x19_38095_c1 nmdc:mga08x19_38095_c1_508_1440 303
599 3300050515 nmdc:mga0a205_193951_c1 nmdc:mga0a205_193951_c1_917_1849 303
600 3300050515 nmdc:mga0a205_269_c1 nmdc:mga0a205_269_c1_26240_27172 303
601 3300050515 nmdc:mga0a205_32206_c1 nmdc:mga0a205_32206_c1_779_1711 303
602 3300050515 nmdc:mga0a205_54054_c1 nmdc:mga0a205_54054_c1_1571_2503 303
603 3300050515 nmdc:mga0a205_64096_c1 nmdc:mga0a205_64096_c1_2059_2991 303
604 3300050515 nmdc:mga0a205_6420_c1 nmdc:mga0a205_6420_c1_5167_6099 303
605 3300054114 Ga0501084_0138286 Ga0501084_0138286_333_1265 303
606 3300060353 Ga0501082_0005149 Ga0501082_0005149_895_1827 303
607 3300061734 Ga0530510_0016829 Ga0530510_0016829_4063_4995 303
608 3300061734 Ga0530510_0089864 Ga0530510_0089864_994_1929 303
609 3300003323 rootH1_10091158 rootH1_100911582 304
610 3300005329 Ga0070683_100025536 Ga0070683_1000255362 304
611 3300005336 Ga0070680_100032601 Ga0070680_1000326013 304
612 3300005336 Ga0070680_100160103 Ga0070680_1001601032 304
613 3300005337 Ga0070682_100250887 Ga0070682_1002508872 304
614 3300005339 Ga0070660_100028160 Ga0070660_1000281602 304
615 3300005341 Ga0070691_10008450 Ga0070691_100084503 304
616 3300005344 Ga0070661_100320984 Ga0070661_1003209841 304
617 3300005434 Ga0070709_10108701 Ga0070709_101087012 304
618 3300005435 Ga0070714_100023397 Ga0070714_1000233975 304
619 3300005435 Ga0070714_100041668 Ga0070714_1000416682 304
620 3300005437 Ga0070710_10242321 Ga0070710_102423211 304
621 3300005441 Ga0070700_100013535 Ga0070700_1000135352 304
622 3300005444 Ga0070694_100075110 Ga0070694_1000751102 304
623 3300005455 Ga0070663_100250792 Ga0070663_1002507922 304
624 3300005458 Ga0070681_10049537 Ga0070681_100495372 304
625 3300005458 Ga0070681_10060246 Ga0070681_100602463 304
626 3300005458 Ga0070681_10079163 Ga0070681_100791633 304
627 3300005530 Ga0070679_100021604 Ga0070679_1000216045 304
628 3300005530 Ga0070679_100043082 Ga0070679_1000430822 304
629 3300005530 Ga0070679_100128297 Ga0070679_1001282972 304
630 3300005535 Ga0070684_100007445 Ga0070684_1000074455 304
631 3300005535 Ga0070684_100024429 Ga0070684_1000244292 304
632 3300005535 Ga0070684_100042164 Ga0070684_1000421643 304
633 3300005536 Ga0070697_100046177 Ga0070697_1000461773 304
634 3300005539 Ga0068853_100327176 Ga0068853_1003271761 304
635 3300005545 Ga0070695_100016804 Ga0070695_1000168042 304
636 3300005547 Ga0070693_100301730 Ga0070693_1003017301 304
637 3300005563 Ga0068855_100213130 Ga0068855_1002131302 304
638 3300005564 Ga0070664_100417264 Ga0070664_1004172642 304
639 3300005577 Ga0068857_100032819 Ga0068857_1000328193 304
640 3300005577 Ga0068857_100133693 Ga0068857_1001336932 304
641 3300005718 Ga0068866_10016349 Ga0068866_100163492 304
642 3300005719 Ga0068861_100181558 Ga0068861_1001815582 304
643 3300005842 Ga0068858_100052941 Ga0068858_1000529411 304
644 3300005983 Ga0081540_1001040 Ga0081540_100104015 304
645 3300005983 Ga0081540_1100530 Ga0081540_11005302 304
646 3300006163 Ga0070715_10008833 Ga0070715_100088333 304
647 3300006163 Ga0070715_10051610 Ga0070715_100516102 304
648 3300006358 Ga0068871_100070800 Ga0068871_1000708002 304
649 3300006852 Ga0075433_10025834 Ga0075433_100258342 304
650 3300006871 Ga0075434_100002288 Ga0075434_1000022885 304
651 3300009093 Ga0105240_10067558 Ga0105240_100675582 304
652 3300009094 Ga0111539_10120428 Ga0111539_101204282 304
653 3300009148 Ga0105243_10220896 Ga0105243_102208962 304
654 3300009174 Ga0105241_10179783 Ga0105241_101797832 304
655 3300009174 Ga0105241_10359719 Ga0105241_103597192 304
656 3300009176 Ga0105242_10048005 Ga0105242_100480052 304
657 3300009176 Ga0105242_10154162 Ga0105242_101541622 304
658 3300009545 Ga0105237_10043407 Ga0105237_100434072 304
659 3300009551 Ga0105238_10058109 Ga0105238_100581092 304
660 3300009551 Ga0105238_10582665 Ga0105238_105826652 304
661 3300010375 Ga0105239_10047530 Ga0105239_100475303 304
662 3300010375 Ga0105239_10129225 Ga0105239_101292252 304
663 3300013104 Ga0157370_10036360 Ga0157370_100363602 304
664 3300013105 Ga0157369_10023551 Ga0157369_100235512 304
665 3300013296 Ga0157374_10143214 Ga0157374_101432142 304
666 3300013307 Ga0157372_10199731 Ga0157372_101997312 304
667 3300014325 Ga0163163_10025815 Ga0163163_100258155 304
668 3300014325 Ga0163163_10211291 Ga0163163_102112912 304
669 3300014968 Ga0157379_10163408 Ga0157379_101634082 304
670 3300014968 Ga0157379_10259059 Ga0157379_102590592 304
671 3300014969 Ga0157376_10293581 Ga0157376_102935812 304
672 3300020070 Ga0206356_11047833 Ga0206356_110478332 304
673 3300021377 Ga0213874_10011593 Ga0213874_100115932 304
674 3300021384 Ga0213876_10087546 Ga0213876_100875462 304
675 3300021388 Ga0213875_10000003 Ga0213875_10000003479 304
676 3300025898 Ga0207692_10028454 Ga0207692_100284542 304
677 3300025898 Ga0207692_10107528 Ga0207692_101075282 304
678 3300025905 Ga0207685_10005228 Ga0207685_100052282 304
679 3300025912 Ga0207707_10000381 Ga0207707_100003815 304
680 3300025912 Ga0207707_10004363 Ga0207707_100043636 304
681 3300025912 Ga0207707_10084269 Ga0207707_100842692 304
682 3300025913 Ga0207695_10055385 Ga0207695_100553853 304
683 3300025914 Ga0207671_10056234 Ga0207671_100562342 304
684 3300025914 Ga0207671_10069776 Ga0207671_100697762 304
685 3300025914 Ga0207671_10150427 Ga0207671_101504272 304
686 3300025915 Ga0207693_10033392 Ga0207693_100333923 304
687 3300025915 Ga0207693_10150639 Ga0207693_101506391 304
688 3300025917 Ga0207660_10022679 Ga0207660_100226792 304
689 3300025921 Ga0207652_10001534 Ga0207652_100015343 304
690 3300025921 Ga0207652_10024807 Ga0207652_100248072 304
691 3300025929 Ga0207664_10036921 Ga0207664_100369214 304
692 3300025939 Ga0207665_10289465 Ga0207665_102894652 304
693 3300025941 Ga0207711_10019107 Ga0207711_100191073 304
694 3300025949 Ga0207667_10002990 Ga0207667_100029903 304
695 3300026035 Ga0207703_10029463 Ga0207703_100294634 304
696 3300026041 Ga0207639_10230617 Ga0207639_102306172 304
697 3300026041 Ga0207639_10515274 Ga0207639_105152742 304
698 3300026095 Ga0207676_10364016 Ga0207676_103640162 304
699 3300026116 Ga0207674_10036172 Ga0207674_100361722 304
700 3300026116 Ga0207674_10136440 Ga0207674_101364402 304
701 3300026116 Ga0207674_10209161 Ga0207674_102091612 304
702 3300026118 Ga0207675_100087937 Ga0207675_1000879372 304
703 3300026142 Ga0207698_10123762 Ga0207698_101237622 304
704 3300028381 Ga0268264_10530784 Ga0268264_105307841 304
705 3300035083 Ga0373926_0029604 Ga0373926_0029604_951_1883 304
706 3300035084 Ga0373928_0013917 Ga0373928_0013917_288_1220 304
707 3300035086 Ga0373934_0012646 Ga0373934_0012646_1132_2064 304
708 3300035089 Ga0373944_0078274 Ga0373944_0078274_88_1020 304
709 3300035111 Ga0373923_0006598 Ga0373923_0006598_1473_2405 304
710 3300035113 Ga0373936_0007064 Ga0373936_0007064_2677_3609 304
711 3300035115 Ga0373941_0006452 Ga0373941_0006452_812_1744 304
712 3300035116 Ga0373945_0034530 Ga0373945_0034530_851_1783 304
713 3300035117 Ga0373953_0010488 Ga0373953_0010488_710_1642 304
714 3300035118 Ga0373954_0054864 Ga0373954_0054864_312_1244 304
715 3300035119 Ga0373956_0004587 Ga0373956_0004587_3914_4846 304
716 3300035119 Ga0373956_0030187 Ga0373956_0030187_203_1135 304
717 3300035121 Ga0373960_0008679 Ga0373960_0008679_904_1836 304
718 3300035172 Ga0373955_0010599 Ga0373955_0010599_2325_3257 304
719 3300035410 Ga0373924_0026977 Ga0373924_0026977_245_1177 304
720 3300035691 Ga0373931_0004839 Ga0373931_0004839_1812_2744 304
721 3300035691 Ga0373931_0018090 Ga0373931_0018090_1641_2573 304
722 3300035691 Ga0373931_0018818 Ga0373931_0018818_2169_3101 304
723 3300035692 Ga0373935_0047469 Ga0373935_0047469_193_1125 304
724 3300035724 Ga0373933_0003431 Ga0373933_0003431_3978_4910 304
725 3300035725 Ga0373947_0036707 Ga0373947_0036707_1026_1958 304
726 3300036401 Ga0373937_0225531 Ga0373937_0225531_56_988 304
727 3300036401 Ga0373937_0330574 Ga0373937_0330574_80_1012 304
728 3300037068 Ga0373925_0209318 Ga0373925_0209318_165_1097 304
729 3300037068 Ga0373925_0359709 Ga0373925_0359709_16_948 304
730 3300037853 Ga0436364_0521241 Ga0436364_0521241_17_949 304
731 3300037853 Ga0436364_0832396 Ga0436364_0832396_15835_16767 304
732 3300038443 Ga0395901_0154478 Ga0395901_0154478_1292_2224 304
733 3300039437 Ga0436365_0701279 Ga0436365_0701279_922_1854 304
734 3300039438 Ga0436360_0288674 Ga0436360_0288674_899_1831 304
735 3300039438 Ga0436360_0432140 Ga0436360_0432140_301_1233 304
736 3300039438 Ga0436360_0621665 Ga0436360_0621665_1647_2579 304
737 3300039438 Ga0436360_0634297 Ga0436360_0634297_1823_2755 304
738 3300039447 Ga0436361_0565162 Ga0436361_0565162_1842_2774 304
739 3300039447 Ga0436361_0804636 Ga0436361_0804636_561_1493 304
740 3300039450 Ga0436363_0384424 Ga0436363_0384424_2190_3122 304
741 3300039450 Ga0436363_1450587 Ga0436363_1450587_1968_2900 304
742 3300039453 Ga0436362_0280096 Ga0436362_0280096_1486_2415 304
743 3300039453 Ga0436362_1044336 Ga0436362_1044336_723_1655 304
744 3300046454 Ga0495592_0036539 Ga0495592_0036539_2090_3022 304
745 3300046454 Ga0495592_0038473 Ga0495592_0038473_1003_1935 304
746 3300046459 Ga0495629_0012711 Ga0495629_0012711_1259_2191 304
747 3300046459 Ga0495629_0077308 Ga0495629_0077308_859_1791 304
748 3300046461 Ga0495641_0108816 Ga0495641_0108816_97_1029 304
749 3300046462 Ga0495651_0142333 Ga0495651_0142333_726_1658 304
750 3300046463 Ga0495653_0002423 Ga0495653_0002423_1702_2634 304
751 3300046472 Ga0495580_0124609 Ga0495580_0124609_16_948 304
752 3300046473 Ga0495582_0063387 Ga0495582_0063387_10_942 304
753 3300046476 Ga0495662_0048832 Ga0495662_0048832_1036_1968 304
754 3300046476 Ga0495662_0137303 Ga0495662_0137303_229_1161 304
755 3300046499 Ga0495594_0075029 Ga0495594_0075029_833_1765 304
756 3300046516 Ga0495628_0041389 Ga0495628_0041389_2418_3350 304
757 3300046516 Ga0495628_0045948 Ga0495628_0045948_802_1734 304
758 3300046526 Ga0495666_0044901 Ga0495666_0044901_203_1135 304
759 3300046529 Ga0495652_0084105 Ga0495652_0084105_1339_2271 304
760 3300046531 Ga0495665_0026882 Ga0495665_0026882_195_1127 304
761 3300046533 Ga0495640_0024793 Ga0495640_0024793_1661_2593 304
762 3300046533 Ga0495640_0205603 Ga0495640_0205603_272_1204 304
763 3300046536 Ga0495587_0025261 Ga0495587_0025261_1060_1992 304
764 3300046543 Ga0495645_0073883 Ga0495645_0073883_194_1126 304
765 3300046559 Ga0495667_0026765 Ga0495667_0026765_1262_2194 304
766 3300046559 Ga0495667_0040322 Ga0495667_0040322_1084_2016 304
767 3300046559 Ga0495667_0077177 Ga0495667_0077177_791_1723 304
768 3300046642 Ga0495634_0033815 Ga0495634_0033815_809_1741 304
769 3300046642 Ga0495634_0034511 Ga0495634_0034511_1709_2641 304
770 3300046642 Ga0495634_0067441 Ga0495634_0067441_145_1077 304
771 3300046663 Ga0495635_0040398 Ga0495635_0040398_1338_2270 304
772 3300046663 Ga0495635_0042167 Ga0495635_0042167_559_1491 304
773 3300046674 Ga0495588_0068110 Ga0495588_0068110_395_1327 304
774 3300046678 Ga0495599_0015541 Ga0495599_0015541_64_996 304
775 3300046679 Ga0495623_0009138 Ga0495623_0009138_1874_2806 304
776 3300046680 Ga0495646_0014497 Ga0495646_0014497_1478_2410 304
777 3300046683 Ga0495658_0126059 Ga0495658_0126059_78_1010 304
778 3300046683 Ga0495658_0180948 Ga0495658_0180948_145_1077 304
779 3300046683 Ga0495658_0282203 Ga0495658_0282203_76_1008 304
780 3300046690 Ga0495624_0036743 Ga0495624_0036743_1346_2278 304
781 3300046690 Ga0495624_0077858 Ga0495624_0077858_1039_1971 304
782 3300046809 Ga0495600_0092479 Ga0495600_0092479_427_1359 304
783 3300047315 Ga0495581_0086789 Ga0495581_0086789_62_994 304
784 3300047317 Ga0495604_0002404 Ga0495604_0002404_3846_4778 304
785 3300047317 Ga0495604_0090384 Ga0495604_0090384_547_1479 304
786 3300047319 Ga0495674_0142647 Ga0495674_0142647_586_1518 304
787 3300047321 Ga0495676_0102548 Ga0495676_0102548_276_1208 304
788 3300047322 Ga0495680_0002651 Ga0495680_0002651_16188_17120 304
789 3300047322 Ga0495680_0070091 Ga0495680_0070091_956_1888 304
790 3300047444 Ga0495675_0005549 Ga0495675_0005549_5020_5952 304
791 3300047471 Ga0495684_0026505 Ga0495684_0026505_1862_2794 304
792 3300047471 Ga0495684_0048644 Ga0495684_0048644_701_1633 304
793 3300047673 Ga0495593_0052161 Ga0495593_0052161_746_1678 304
794 3300048088 Ga0495602_0139861 Ga0495602_0139861_427_1359 304
795 3300048904 Ga0496101_0093130 Ga0496101_0093130_414_1346 304
796 3300048905 Ga0496102_0037600 Ga0496102_0037600_179_1111 304
797 3300048906 Ga0496103_0049390 Ga0496103_0049390_404_1336 304
798 3300048909 Ga0496106_0019397 Ga0496106_0019397_692_1624 304
799 3300048911 Ga0496108_0314175 Ga0496108_0314175_86_1018 304
800 3300048912 Ga0496109_0051215 Ga0496109_0051215_304_1236 304
801 3300048913 Ga0496110_0054677 Ga0496110_0054677_341_1273 304
802 3300048916 Ga0496113_0017599 Ga0496113_0017599_2221_3153 304
803 3300048918 Ga0496115_0035422 Ga0496115_0035422_2940_3872 304
804 3300048924 Ga0496121_0048028 Ga0496121_0048028_1408_2340 304
805 3300048929 Ga0496126_0027923 Ga0496126_0027923_36_968 304
806 3300050512 nmdc:mga0n895_6563_c1 nmdc:mga0n895_6563_c1_8049_8981 304
807 3300053077 Ga0495601_0005899 Ga0495601_0005899_543_1475 304
808 3300053084 Ga0495595_0036278 Ga0495595_0036278_80_1012 304
809 3300053084 Ga0495595_0041733 Ga0495595_0041733_70_1002 304
810 3300053085 Ga0495619_0056155 Ga0495619_0056155_1247_2179 304
811 3300005434 Ga0070709_10014136 Ga0070709_100141362 305
812 3300005435 Ga0070714_100005721 Ga0070714_1000057213 305
813 3300005436 Ga0070713_100038058 Ga0070713_1000380584 305
814 3300005436 Ga0070713_100180134 Ga0070713_1001801342 305
815 3300005437 Ga0070710_10003900 Ga0070710_100039001 305
816 3300005530 Ga0070679_100029692 Ga0070679_1000296922 305
817 3300006028 Ga0070717_10104818 Ga0070717_101048183 305
818 3300006175 Ga0070712_100021018 Ga0070712_1000210182 305
819 3300006852 Ga0075433_10192730 Ga0075433_101927301 305
820 3300009177 Ga0105248_10134069 Ga0105248_101340692 305
821 3300013105 Ga0157369_10238188 Ga0157369_102381882 305
822 3300013306 Ga0163162_10524533 Ga0163162_105245332 305
823 3300014968 Ga0157379_10297994 Ga0157379_102979942 305
824 3300025898 Ga0207692_10010611 Ga0207692_100106114 305
825 3300025906 Ga0207699_10007536 Ga0207699_100075363 305
826 3300025915 Ga0207693_10008194 Ga0207693_100081946 305
827 3300025915 Ga0207693_10140716 Ga0207693_101407162 305
828 3300025928 Ga0207700_10011666 Ga0207700_100116665 305
829 3300025928 Ga0207700_10153850 Ga0207700_101538501 305
830 3300025934 Ga0207686_10090369 Ga0207686_100903692 305
831 3300026121 Ga0207683_10118271 Ga0207683_101182712 305
832 3300031616 Ga0307508_10000005 Ga0307508_10000005144 305
833 3300031616 Ga0307508_10021355 Ga0307508_100213558 305
834 3300035111 Ga0373923_0026956 Ga0373923_0026956_812_1753 305
835 3300035117 Ga0373953_0044992 Ga0373953_0044992_426_1367 305
836 3300035118 Ga0373954_0035689 Ga0373954_0035689_704_1645 305
837 3300035172 Ga0373955_0070712 Ga0373955_0070712_224_1165 305
838 3300035410 Ga0373924_0006137 Ga0373924_0006137_1777_2718 305
839 3300035695 Ga0373927_0146501 Ga0373927_0146501_394_1329 305
840 3300035724 Ga0373933_0016036 Ga0373933_0016036_1851_2792 305
841 3300035725 Ga0373947_0039675 Ga0373947_0039675_1631_2569 305
842 3300037068 Ga0373925_0074387 Ga0373925_0074387_652_1593 305
843 3300037068 Ga0373925_0158300 Ga0373925_0158300_604_1542 305
844 3300046477 Ga0495664_0003422 Ga0495664_0003422_2425_3369 305
845 3300046511 Ga0495608_0008830 Ga0495608_0008830_1178_2119 305
846 3300046529 Ga0495652_0095305 Ga0495652_0095305_643_1587 305
847 3300046533 Ga0495640_0092712 Ga0495640_0092712_641_1579 305
848 3300046536 Ga0495587_0020063 Ga0495587_0020063_359_1303 305
849 3300046543 Ga0495645_0026093 Ga0495645_0026093_3034_3978 305
850 3300046559 Ga0495667_0004876 Ga0495667_0004876_6608_7549 305
851 3300046559 Ga0495667_0054978 Ga0495667_0054978_986_1930 305
852 3300046663 Ga0495635_0034112 Ga0495635_0034112_160_1104 305
853 3300046678 Ga0495599_0014789 Ga0495599_0014789_133_1077 305
854 3300046683 Ga0495658_0253170 Ga0495658_0253170_84_1022 305
855 3300046809 Ga0495600_0082782 Ga0495600_0082782_228_1169 305
856 3300047319 Ga0495674_0007810 Ga0495674_0007810_7013_7957 305
857 3300047322 Ga0495680_0072484 Ga0495680_0072484_978_1919 305
858 3300047444 Ga0495675_0071843 Ga0495675_0071843_720_1664 305
859 3300047471 Ga0495684_0080492 Ga0495684_0080492_527_1468 305
860 3300048088 Ga0495602_0000299 Ga0495602_0000299_38011_38955 305
861 3300048088 Ga0495602_0077080 Ga0495602_0077080_189_1130 305
862 3300053078 Ga0495612_0001163 Ga0495612_0001163_726_1670 305
863 3300053084 Ga0495595_0097612 Ga0495595_0097612_213_1154 305
864 3300053085 Ga0495619_0100927 Ga0495619_0100927_949_1893 305
865 3300035692 Ga0373935_0167004 Ga0373935_0167004_531_1475 306
866 3300006844 Ga0075428_100010565 Ga0075428_1000105655 308
867 3300006847 Ga0075431_100029013 Ga0075431_1000290134 308
868 3300006852 Ga0075433_10017132 Ga0075433_100171325 308
869 3300006880 Ga0075429_100014342 Ga0075429_1000143425 308
870 3300025961 Ga0207712_10165793 Ga0207712_101657932 308
871 3300027907 Ga0207428_10021082 Ga0207428_100210825 308
872 3300050511 nmdc:mga08y16_222349_c1 nmdc:mga08y16_222349_c1_805_1743 309
873 3300005457 Ga0070662_100012116 Ga0070662_1000121162 311
874 3300005844 Ga0068862_100008683 Ga0068862_1000086837 311
875 3300006844 Ga0075428_100017963 Ga0075428_1000179637 311
876 3300006852 Ga0075433_10004066 Ga0075433_100040668 311
877 3300025933 Ga0207706_10050917 Ga0207706_100509173 311
878 3300027907 Ga0207428_10001363 Ga0207428_1000136318 311
879 3300028380 Ga0268265_10019399 Ga0268265_100193993 311
880 3300042876 Ga0451577_0003647 Ga0451577_0003647_7033_7974 311
881 3300044673 Ga0453683_0032513 Ga0453683_0032513_1677_2618 311
882 3300045051 Ga0451576_0007779 Ga0451576_0007779_4521_5462 311
883 3300050511 nmdc:mga08y16_1952_c1 nmdc:mga08y16_1952_c1_7429_8370 311
884 3300050515 nmdc:mga0a205_2135_c1 nmdc:mga0a205_2135_c1_7070_8011 311
885 3300006846 Ga0075430_100088391 Ga0075430_1000883913 312
886 3300006847 Ga0075431_100031288 Ga0075431_1000312882 312
887 3300006931 Ga0097620_100391329 Ga0097620_1003913292 312
888 3300009147 Ga0114129_10003240 Ga0114129_100032405 312
889 3300025922 Ga0207646_10007164 Ga0207646_100071647 312
890 3300025922 Ga0207646_10207485 Ga0207646_102074852 312
891 3300042876 Ga0451577_0144248 Ga0451577_0144248_505_1443 312
892 3300044712 Ga0453684_0033865 Ga0453684_0033865_2920_3858 312
893 3300050507 nmdc:mga05p37_13768_c1 nmdc:mga05p37_13768_c1_2884_3822 312
894 3300050509 nmdc:mga0qj67_30012_c1 nmdc:mga0qj67_30012_c1_600_1538 312
895 3300050510 nmdc:mga06r32_52069_c1 nmdc:mga06r32_52069_c1_1184_2122 312
896 3300050511 nmdc:mga08y16_540591_c1 nmdc:mga08y16_540591_c1_54_1001 312
897 3300003203 JGI25406J46586_10007226 JGI25406J46586_100072262 314
898 3300005985 Ga0081539_10000050 Ga0081539_10000050235 314
899 3300006844 Ga0075428_100010747 Ga0075428_1000107479 314
900 3300006846 Ga0075430_100122494 Ga0075430_1001224942 314
901 3300006847 Ga0075431_100009950 Ga0075431_1000099504 314
902 3300006852 Ga0075433_10002763 Ga0075433_1000276316 314
903 3300006871 Ga0075434_100040122 Ga0075434_1000401225 314
904 3300006914 Ga0075436_100002041 Ga0075436_1000020411 314
905 3300007076 Ga0075435_100242739 Ga0075435_1002427392 314
906 3300037418 Ga0395900_0041942 Ga0395900_0041942_3613_4557 314
907 3300038443 Ga0395901_0040438 Ga0395901_0040438_1389_2333 314
908 3300050507 nmdc:mga05p37_94672_c1 nmdc:mga05p37_94672_c1_1555_2499 314
909 3300050508 nmdc:mga09592_1890_c1 nmdc:mga09592_1890_c1_11009_11953 314
910 3300050509 nmdc:mga0qj67_40703_c1 nmdc:mga0qj67_40703_c1_2242_3186 314
911 3300050510 nmdc:mga06r32_633_c1 nmdc:mga06r32_633_c1_14252_15196 314
912 3300050515 nmdc:mga0a205_3306_c1 nmdc:mga0a205_3306_c1_361_1305 314

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

103

265

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
7cad-assembly1.cif.gz_A mycobacterium smegmatis sugabc complex 0.9319 32 310
8hpl-assembly1.cif.gz_A lpqy-sugabc in state 1 0.9196 32 307
7cad-assembly1.cif.gz_A mycobacterium smegmatis sugabc complex 0.9159 32 310
8ja7-assembly1.cif.gz_A cryo-em structure of mycobacterium tuberculosis lpqy-sugabc in complex with trehalose 0.9071 32 307
8hps-assembly1.cif.gz_A lpqy-sugabc in state 5 0.9008 32 311
ID Description Score Start End Superfamily
af_P71896_49_286_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.951 74 313 1.10.3720.10
af_P0AFR7_53_289_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.95 73 312 1.10.3720.10
af_P0AFR7_53_289_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9423 73 312 1.10.3720.10
af_O53484_49_294_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9393 73 313 1.10.3720.10
af_I6XFF3_60_302_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9364 74 313 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A537JZM6-F1-model_v4 Sugar ABC transporter permease 0.9689 40 314 GO:0005886
GO:0055085
AF-A0A2V6QB61-F1-model_v4 ABC transporter permease 0.9669 26 314 GO:0005886
GO:0055085
AF-A0A529FPK8-F1-model_v4 Sugar ABC transporter permease 0.9661 52 306 GO:0005886
GO:0055085
AF-A0A536Z2D9-F1-model_v4 Sugar ABC transporter permease 0.966 52 313 GO:0005886
GO:0055085
AF-A0A2V3XZ74-F1-model_v4 Carbohydrate ABC transporter membrane protein 1 (CUT1 family) 0.9647 33 314 GO:0005886
GO:0055085

Feature Viewer

pLDDT pTM Quality
79.4 0.74 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map