F485500
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 912 | 322 | 905 | 302 |
Family's Representative Sequence
| Representative Sequence | 3300005445|Ga0070708_100038506|Ga0070708_1000385063 |
| Length | 273 |
| Sequence | MSVRPAPLARXXXXAGGPLSLRGLLEREGAFSWVMLAPGVLFLLAFVAYPFFYGIYLSLQDRPVARAGAFVGLANFATLLGEGVFWQVTRNTFVYTLVTTVLKLLGGLAMALVINQSFRARNLVRAVLLLPFIVPTILSTIAWMWIFDPTFSVINWTLVKTGAMVSIIVVNTWRGIPFYGITLLAGLQTISPDLYEAAAIDGASATQRFWHVTLPIIKPILIIVTMFSVIFTFADFQIVYALTHGGPANATQVFVTYAFDLGMSGGQLGLRRE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 2 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 3 | 3300003349 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM | Metagenome | Rhizosphere |
| 4 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 5 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 36 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 44 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 51 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 53 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 54 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 55 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 57 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 58 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 59 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 60 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 61 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 62 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 63 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 64 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 65 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 66 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 67 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 68 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 73 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 74 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 75 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 76 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 77 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 78 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 79 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 80 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 82 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 83 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 95 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 110 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 112 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 113 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 114 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 115 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 179 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 182 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 183 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 184 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 185 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 186 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 187 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 188 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 189 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 190 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 191 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 192 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 193 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 194 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 195 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 196 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 197 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 198 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 199 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 200 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 201 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 202 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 203 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 204 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 205 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 206 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 207 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 208 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 209 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 210 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 211 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 212 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 213 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 214 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 215 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 216 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 217 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 218 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 219 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 220 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 221 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 222 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 223 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 224 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 225 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 226 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 227 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 228 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 229 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 230 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 231 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 232 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 233 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 272 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 273 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 274 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 275 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 276 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 277 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 278 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 279 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 280 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 281 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 282 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 283 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 292 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 300 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 303 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 304 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 305 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 306 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 307 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 308 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 309 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 310 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 311 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 312 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 313 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 318 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 319 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 320 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 321 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 322 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.89 |
| Metatranscriptomes | 0.11 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.33 |
| Nodule | 0 |
| Rhizoplane | 1.64 |
| Rhizosphere | 95.83 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.19 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10007226 | 3300003203 | Bacteria | 5081 |
| 2 | rootH1_10091158 | 3300003323 | Bacteria | 1843 |
| 3 | JGI26129J50193_1001876 | 3300003349 | Bacteria | 1458 |
| 4 | JGI25404J52841_10004850 | 3300003659 | Bacteria | 2757 |
| 5 | Ga0065715_10096737 | 3300005293 | Bacteria | 3830 |
| 6 | Ga0065707_10102712 | 3300005295 | Bacteria | 2789 |
| 7 | Ga0065707_10252752 | 3300005295 | Bacteria | 1120 |
| 8 | Ga0070676_10024086 | 3300005328 | Bacteria | 3425 |
| 9 | Ga0070683_100025536 | 3300005329 | Bacteria | 5307 |
| 10 | Ga0070670_100000678 | 3300005331 | Bacteria | 26436 |
| 11 | Ga0068869_100012374 | 3300005334 | Bacteria | 5639 |
| 12 | Ga0068869_100143220 | 3300005334 | Bacteria | 1848 |
| 13 | Ga0068869_100386091 | 3300005334 | Bacteria | 1149 |
| 14 | Ga0070680_100001152 | 3300005336 | Bacteria | 18981 |
| 15 | Ga0070680_100032601 | 3300005336 | Bacteria | 4194 |
| 16 | Ga0070680_100160103 | 3300005336 | Bacteria | 1892 |
| 17 | Ga0070680_100318626 | 3300005336 | Bacteria | 1320 |
| 18 | Ga0070682_100002090 | 3300005337 | Bacteria | 11117 |
| 19 | Ga0070682_100250887 | 3300005337 | Bacteria | 1276 |
| 20 | Ga0070660_100001587 | 3300005339 | Bacteria | 15632 |
| 21 | Ga0070660_100028160 | 3300005339 | Bacteria | 4201 |
| 22 | Ga0070689_100106356 | 3300005340 | Bacteria | 2226 |
| 23 | Ga0070689_100118493 | 3300005340 | Bacteria | 2112 |
| 24 | Ga0070691_10008450 | 3300005341 | Bacteria | 4711 |
| 25 | Ga0070691_10081892 | 3300005341 | Bacteria | 1582 |
| 26 | Ga0070661_100002632 | 3300005344 | Bacteria | 12276 |
| 27 | Ga0070661_100320984 | 3300005344 | Bacteria | 1210 |
| 28 | Ga0070692_10192900 | 3300005345 | Bacteria | 1188 |
| 29 | Ga0070673_100356231 | 3300005364 | Unclassified | 1300 |
| 30 | Ga0070688_100025917 | 3300005365 | Bacteria | 3477 |
| 31 | Ga0070659_100003091 | 3300005366 | Bacteria | 11834 |
| 32 | Ga0070703_10020720 | 3300005406 | Unclassified | 1916 |
| 33 | Ga0070703_10075326 | 3300005406 | Bacteria | 1137 |
| 34 | Ga0070709_10003361 | 3300005434 | Bacteria | 8601 |
| 35 | Ga0070709_10014136 | 3300005434 | Bacteria | 4509 |
| 36 | Ga0070709_10108701 | 3300005434 | Bacteria | 1860 |
| 37 | Ga0070714_100005721 | 3300005435 | Bacteria | 9527 |
| 38 | Ga0070714_100023397 | 3300005435 | Bacteria | 5075 |
| 39 | Ga0070714_100033768 | 3300005435 | Bacteria | 4280 |
| 40 | Ga0070714_100041668 | 3300005435 | Bacteria | 3876 |
| 41 | Ga0070714_100148132 | 3300005435 | Bacteria | 2113 |
| 42 | Ga0070713_100008252 | 3300005436 | Bacteria | 7383 |
| 43 | Ga0070713_100029448 | 3300005436 | Bacteria | 4350 |
| 44 | Ga0070713_100038058 | 3300005436 | Bacteria | 3894 |
| 45 | Ga0070713_100180134 | 3300005436 | Bacteria | 1898 |
| 46 | Ga0070713_100205911 | 3300005436 | Bacteria | 1779 |
| 47 | Ga0070713_100224175 | 3300005436 | Bacteria | 1706 |
| 48 | Ga0070710_10000739 | 3300005437 | Bacteria | 15565 |
| 49 | Ga0070710_10003900 | 3300005437 | Bacteria | 7065 |
| 50 | Ga0070710_10005213 | 3300005437 | Bacteria | 6160 |
| 51 | Ga0070710_10242321 | 3300005437 | Bacteria | 1156 |
| 52 | Ga0070701_10007287 | 3300005438 | Bacteria | 4712 |
| 53 | Ga0070711_100001284 | 3300005439 | Bacteria | 13635 |
| 54 | Ga0070711_100002104 | 3300005439 | Bacteria | 11259 |
| 55 | Ga0070711_100121044 | 3300005439 | Bacteria | 1936 |
| 56 | Ga0070705_100002566 | 3300005440 | Bacteria | 9122 |
| 57 | Ga0070705_100144254 | 3300005440 | Bacteria | 1571 |
| 58 | Ga0070705_100145868 | 3300005440 | Bacteria | 1563 |
| 59 | Ga0070700_100013535 | 3300005441 | Bacteria | 4583 |
| 60 | Ga0070700_100028698 | 3300005441 | Bacteria | 3312 |
| 61 | Ga0070694_100001010 | 3300005444 | Bacteria | 16001 |
| 62 | Ga0070694_100024660 | 3300005444 | Bacteria | 3883 |
| 63 | Ga0070694_100026288 | 3300005444 | Bacteria | 3771 |
| 64 | Ga0070694_100051125 | 3300005444 | Bacteria | 2788 |
| 65 | Ga0070694_100074285 | 3300005444 | Bacteria | 2349 |
| 66 | Ga0070694_100075110 | 3300005444 | Bacteria | 2337 |
| 67 | Ga0070694_100086335 | 3300005444 | Bacteria | 2192 |
| 68 | Ga0070694_100103267 | 3300005444 | Bacteria | 2019 |
| 69 | Ga0070694_100213079 | 3300005444 | Bacteria | 1446 |
| 70 | Ga0070708_100011602 | 3300005445 | Bacteria | 7173 |
| 71 | Ga0070708_100038506 | 3300005445 | Bacteria | 4177 |
| 72 | Ga0070708_100057912 | 3300005445 | Bacteria | 3452 |
| 73 | Ga0070708_100064817 | 3300005445 | Bacteria | 3274 |
| 74 | Ga0070708_100106276 | 3300005445 | Bacteria | 2576 |
| 75 | Ga0070708_100216182 | 3300005445 | Bacteria | 1797 |
| 76 | Ga0070708_100230410 | 3300005445 | Unclassified | 1738 |
| 77 | Ga0070708_100329456 | 3300005445 | Bacteria | 1439 |
| 78 | Ga0070663_100001727 | 3300005455 | Bacteria | 12124 |
| 79 | Ga0070663_100250792 | 3300005455 | Bacteria | 1401 |
| 80 | Ga0070663_100346372 | 3300005455 | Bacteria | 1202 |
| 81 | Ga0070662_100012116 | 3300005457 | Bacteria | 5709 |
| 82 | Ga0070662_100014904 | 3300005457 | Bacteria | 5199 |
| 83 | Ga0070662_100045195 | 3300005457 | Bacteria | 3158 |
| 84 | Ga0070662_100055559 | 3300005457 | Bacteria | 2873 |
| 85 | Ga0070681_10030359 | 3300005458 | Bacteria | 5423 |
| 86 | Ga0070681_10049537 | 3300005458 | Bacteria | 4194 |
| 87 | Ga0070681_10060246 | 3300005458 | Bacteria | 3773 |
| 88 | Ga0070681_10079163 | 3300005458 | Bacteria | 3243 |
| 89 | Ga0070681_10323844 | 3300005458 | Bacteria | 1451 |
| 90 | Ga0068867_100020324 | 3300005459 | Bacteria | 4732 |
| 91 | Ga0068867_100064865 | 3300005459 | Bacteria | 2716 |
| 92 | Ga0068867_100424535 | 3300005459 | Bacteria | 1127 |
| 93 | Ga0070706_100004042 | 3300005467 | Bacteria | 14246 |
| 94 | Ga0070706_100082686 | 3300005467 | Bacteria | 2974 |
| 95 | Ga0070706_100191269 | 3300005467 | Bacteria | 1912 |
| 96 | Ga0070706_100277066 | 3300005467 | Bacteria | 1565 |
| 97 | Ga0070706_100364414 | 3300005467 | Bacteria | 1346 |
| 98 | Ga0070707_100024463 | 3300005468 | Bacteria | 5720 |
| 99 | Ga0070707_100092901 | 3300005468 | Bacteria | 2921 |
| 100 | Ga0070707_100162857 | 3300005468 | Bacteria | 2173 |
| 101 | Ga0070698_100003260 | 3300005471 | Bacteria | 17827 |
| 102 | Ga0070698_100009511 | 3300005471 | Bacteria | 10410 |
| 103 | Ga0070698_100080100 | 3300005471 | Bacteria | 3261 |
| 104 | Ga0070698_100140456 | 3300005471 | Bacteria | 2367 |
| 105 | Ga0070698_100640889 | 3300005471 | Bacteria | 1003 |
| 106 | Ga0070699_100034226 | 3300005518 | Bacteria | 4391 |
| 107 | Ga0070699_100093065 | 3300005518 | Bacteria | 2637 |
| 108 | Ga0070699_100135005 | 3300005518 | Unclassified | 2177 |
| 109 | Ga0070699_100190973 | 3300005518 | Bacteria | 1819 |
| 110 | Ga0070699_100306814 | 3300005518 | Bacteria | 1424 |
| 111 | Ga0070679_100010038 | 3300005530 | Bacteria | 8968 |
| 112 | Ga0070679_100021604 | 3300005530 | Bacteria | 6285 |
| 113 | Ga0070679_100029692 | 3300005530 | Bacteria | 5394 |
| 114 | Ga0070679_100043082 | 3300005530 | Bacteria | 4496 |
| 115 | Ga0070679_100128297 | 3300005530 | Bacteria | 2518 |
| 116 | Ga0070679_100159783 | 3300005530 | Bacteria | 2228 |
| 117 | Ga0070684_100007445 | 3300005535 | Bacteria | 8512 |
| 118 | Ga0070684_100024412 | 3300005535 | Bacteria | 5072 |
| 119 | Ga0070684_100024429 | 3300005535 | Bacteria | 5070 |
| 120 | Ga0070684_100042164 | 3300005535 | Bacteria | 3938 |
| 121 | Ga0070697_100012030 | 3300005536 | Bacteria | 6773 |
| 122 | Ga0070697_100046177 | 3300005536 | Bacteria | 3530 |
| 123 | Ga0070697_100068040 | 3300005536 | Bacteria | 2914 |
| 124 | Ga0070697_100094201 | 3300005536 | Unclassified | 2481 |
| 125 | Ga0070697_100134407 | 3300005536 | Bacteria | 2076 |
| 126 | Ga0070697_100218558 | 3300005536 | Bacteria | 1624 |
| 127 | Ga0068853_100327176 | 3300005539 | Bacteria | 1422 |
| 128 | Ga0070672_100130019 | 3300005543 | Bacteria | 2068 |
| 129 | Ga0070686_100011978 | 3300005544 | Bacteria | 4931 |
| 130 | Ga0070686_100175496 | 3300005544 | Bacteria | 1519 |
| 131 | Ga0070695_100001392 | 3300005545 | Bacteria | 13407 |
| 132 | Ga0070695_100006099 | 3300005545 | Bacteria | 7122 |
| 133 | Ga0070695_100009327 | 3300005545 | Bacteria | 5835 |
| 134 | Ga0070695_100011421 | 3300005545 | Bacteria | 5313 |
| 135 | Ga0070695_100016804 | 3300005545 | Bacteria | 4434 |
| 136 | Ga0070695_100017320 | 3300005545 | Bacteria | 4368 |
| 137 | Ga0070695_100115640 | 3300005545 | Bacteria | 1828 |
| 138 | Ga0070696_100003863 | 3300005546 | Bacteria | 10005 |
| 139 | Ga0070696_100065476 | 3300005546 | Bacteria | 2548 |
| 140 | Ga0070696_100148166 | 3300005546 | Bacteria | 1720 |
| 141 | Ga0070693_100002188 | 3300005547 | Bacteria | 8958 |
| 142 | Ga0070693_100017613 | 3300005547 | Bacteria | 3717 |
| 143 | Ga0070693_100301730 | 3300005547 | Bacteria | 1080 |
| 144 | Ga0070704_100045070 | 3300005549 | Bacteria | 3067 |
| 145 | Ga0070704_100195380 | 3300005549 | Bacteria | 1629 |
| 146 | Ga0070704_100270541 | 3300005549 | Bacteria | 1404 |
| 147 | Ga0070704_100463344 | 3300005549 | Bacteria | 1094 |
| 148 | Ga0068855_100001585 | 3300005563 | Bacteria | 28565 |
| 149 | Ga0068855_100213130 | 3300005563 | Bacteria | 2169 |
| 150 | Ga0070664_100417264 | 3300005564 | Bacteria | 1229 |
| 151 | Ga0068857_100032819 | 3300005577 | Bacteria | 4589 |
| 152 | Ga0068857_100133693 | 3300005577 | Bacteria | 2239 |
| 153 | Ga0068857_100140670 | 3300005577 | Bacteria | 2181 |
| 154 | Ga0068854_100003455 | 3300005578 | Bacteria | 9861 |
| 155 | Ga0068856_100004059 | 3300005614 | Bacteria | 14651 |
| 156 | Ga0070702_100309864 | 3300005615 | Unclassified | 1096 |
| 157 | Ga0068859_100009042 | 3300005617 | Bacteria | 10063 |
| 158 | Ga0068859_100026660 | 3300005617 | Bacteria | 5795 |
| 159 | Ga0068864_100001941 | 3300005618 | Bacteria | 16979 |
| 160 | Ga0068866_10016349 | 3300005718 | Bacteria | 3316 |
| 161 | Ga0068861_100181558 | 3300005719 | Bacteria | 1752 |
| 162 | Ga0068870_10005871 | 3300005840 | Bacteria | 5391 |
| 163 | Ga0068863_100004989 | 3300005841 | Bacteria | 13081 |
| 164 | Ga0068858_100052941 | 3300005842 | Bacteria | 3756 |
| 165 | Ga0068858_100147848 | 3300005842 | Bacteria | 2208 |
| 166 | Ga0068858_100322395 | 3300005842 | Bacteria | 1477 |
| 167 | Ga0068860_100008117 | 3300005843 | Bacteria | 10455 |
| 168 | Ga0068860_100018586 | 3300005843 | Bacteria | 6760 |
| 169 | Ga0068860_100082542 | 3300005843 | Bacteria | 3057 |
| 170 | Ga0068860_100286546 | 3300005843 | Bacteria | 1611 |
| 171 | Ga0068862_100005118 | 3300005844 | Bacteria | 11020 |
| 172 | Ga0068862_100006591 | 3300005844 | Bacteria | 9627 |
| 173 | Ga0068862_100008683 | 3300005844 | Bacteria | 8407 |
| 174 | Ga0068862_100009075 | 3300005844 | Bacteria | 8230 |
| 175 | Ga0068862_100057949 | 3300005844 | Bacteria | 3323 |
| 176 | Ga0068862_100096600 | 3300005844 | Bacteria | 2579 |
| 177 | Ga0068862_100196793 | 3300005844 | Bacteria | 1816 |
| 178 | Ga0081455_10000654 | 3300005937 | Bacteria | 44913 |
| 179 | Ga0081540_1001040 | 3300005983 | Bacteria | 24821 |
| 180 | Ga0081540_1018677 | 3300005983 | Bacteria | 4244 |
| 181 | Ga0081540_1034102 | 3300005983 | Bacteria | 2751 |
| 182 | Ga0081540_1061808 | 3300005983 | Bacteria | 1783 |
| 183 | Ga0081540_1100530 | 3300005983 | Bacteria | 1247 |
| 184 | Ga0081539_10000050 | 3300005985 | Bacteria | 269342 |
| 185 | Ga0081539_10004618 | 3300005985 | Bacteria | 15001 |
| 186 | Ga0070717_10000240 | 3300006028 | Bacteria | 37664 |
| 187 | Ga0070717_10104818 | 3300006028 | Bacteria | 2406 |
| 188 | Ga0070717_10318894 | 3300006028 | Bacteria | 1384 |
| 189 | Ga0070715_10008833 | 3300006163 | Bacteria | 3527 |
| 190 | Ga0070715_10051610 | 3300006163 | Unclassified | 1771 |
| 191 | Ga0070716_100030323 | 3300006173 | Bacteria | 2932 |
| 192 | Ga0070716_100056844 | 3300006173 | Bacteria | 2246 |
| 193 | Ga0070712_100002037 | 3300006175 | Bacteria | 12385 |
| 194 | Ga0070712_100006939 | 3300006175 | Bacteria | 7060 |
| 195 | Ga0070712_100021018 | 3300006175 | Bacteria | 4279 |
| 196 | Ga0070712_100036963 | 3300006175 | Bacteria | 3325 |
| 197 | Ga0068871_100070800 | 3300006358 | Bacteria | 2867 |
| 198 | Ga0075428_100001512 | 3300006844 | Bacteria | 24887 |
| 199 | Ga0075428_100010565 | 3300006844 | Bacteria | 10262 |
| 200 | Ga0075428_100010747 | 3300006844 | Bacteria | 10175 |
| 201 | Ga0075428_100012236 | 3300006844 | Bacteria | 9542 |
| 202 | Ga0075428_100017963 | 3300006844 | Bacteria | 7816 |
| 203 | Ga0075428_100048174 | 3300006844 | Bacteria | 4678 |
| 204 | Ga0075428_100063494 | 3300006844 | Bacteria | 4043 |
| 205 | Ga0075428_100126678 | 3300006844 | Bacteria | 2779 |
| 206 | Ga0075428_100143473 | 3300006844 | Bacteria | 2596 |
| 207 | Ga0075428_100565033 | 3300006844 | Bacteria | 1216 |
| 208 | Ga0075430_100000343 | 3300006846 | Bacteria | 33706 |
| 209 | Ga0075430_100003797 | 3300006846 | Bacteria | 12711 |
| 210 | Ga0075430_100050849 | 3300006846 | Bacteria | 3493 |
| 211 | Ga0075430_100070760 | 3300006846 | Bacteria | 2926 |
| 212 | Ga0075430_100076281 | 3300006846 | Bacteria | 2810 |
| 213 | Ga0075430_100088391 | 3300006846 | Bacteria | 2593 |
| 214 | Ga0075430_100122494 | 3300006846 | Bacteria | 2168 |
| 215 | Ga0075431_100000589 | 3300006847 | Bacteria | 30672 |
| 216 | Ga0075431_100001751 | 3300006847 | Bacteria | 20407 |
| 217 | Ga0075431_100008413 | 3300006847 | Bacteria | 10331 |
| 218 | Ga0075431_100009950 | 3300006847 | Bacteria | 9552 |
| 219 | Ga0075431_100012318 | 3300006847 | Bacteria | 8628 |
| 220 | Ga0075431_100016199 | 3300006847 | Bacteria | 7561 |
| 221 | Ga0075431_100025473 | 3300006847 | Bacteria | 6063 |
| 222 | Ga0075431_100029013 | 3300006847 | Bacteria | 5691 |
| 223 | Ga0075431_100031288 | 3300006847 | Bacteria | 5481 |
| 224 | Ga0075431_100037966 | 3300006847 | Bacteria | 4959 |
| 225 | Ga0075431_100058943 | 3300006847 | Bacteria | 3962 |
| 226 | Ga0075431_100078855 | 3300006847 | Bacteria | 3400 |
| 227 | Ga0075431_100100049 | 3300006847 | Bacteria | 2991 |
| 228 | Ga0075431_100263653 | 3300006847 | Bacteria | 1748 |
| 229 | Ga0075431_100273383 | 3300006847 | Bacteria | 1712 |
| 230 | Ga0075431_100576075 | 3300006847 | Bacteria | 1111 |
| 231 | Ga0075433_10000065 | 3300006852 | Bacteria | 46718 |
| 232 | Ga0075433_10000967 | 3300006852 | Bacteria | 20371 |
| 233 | Ga0075433_10002763 | 3300006852 | Bacteria | 13428 |
| 234 | Ga0075433_10004058 | 3300006852 | Bacteria | 11341 |
| 235 | Ga0075433_10004066 | 3300006852 | Bacteria | 11332 |
| 236 | Ga0075433_10007957 | 3300006852 | Bacteria | 8439 |
| 237 | Ga0075433_10017132 | 3300006852 | Bacteria | 5993 |
| 238 | Ga0075433_10025834 | 3300006852 | Bacteria | 4966 |
| 239 | Ga0075433_10026832 | 3300006852 | Bacteria | 4881 |
| 240 | Ga0075433_10082758 | 3300006852 | Bacteria | 2831 |
| 241 | Ga0075433_10192730 | 3300006852 | Bacteria | 1813 |
| 242 | Ga0075433_10266316 | 3300006852 | Bacteria | 1519 |
| 243 | Ga0075433_10387788 | 3300006852 | Bacteria | 1233 |
| 244 | Ga0075434_100001212 | 3300006871 | Bacteria | 21423 |
| 245 | Ga0075434_100001353 | 3300006871 | Bacteria | 20574 |
| 246 | Ga0075434_100002288 | 3300006871 | Bacteria | 16750 |
| 247 | Ga0075434_100003549 | 3300006871 | Bacteria | 13930 |
| 248 | Ga0075434_100040122 | 3300006871 | Bacteria | 4637 |
| 249 | Ga0075434_100064872 | 3300006871 | Bacteria | 3637 |
| 250 | Ga0075434_100121403 | 3300006871 | Bacteria | 2628 |
| 251 | Ga0075434_100166986 | 3300006871 | Bacteria | 2221 |
| 252 | Ga0075434_100285706 | 3300006871 | Unclassified | 1669 |
| 253 | Ga0075429_100000014 | 3300006880 | Bacteria | 79603 |
| 254 | Ga0075429_100000710 | 3300006880 | Bacteria | 26042 |
| 255 | Ga0075429_100000807 | 3300006880 | Bacteria | 24634 |
| 256 | Ga0075429_100005652 | 3300006880 | Bacteria | 10783 |
| 257 | Ga0075429_100014342 | 3300006880 | Bacteria | 6872 |
| 258 | Ga0075429_100039288 | 3300006880 | Bacteria | 4119 |
| 259 | Ga0075429_100041783 | 3300006880 | Bacteria | 3993 |
| 260 | Ga0075429_100188441 | 3300006880 | Bacteria | 1808 |
| 261 | Ga0075429_100202118 | 3300006880 | Bacteria | 1741 |
| 262 | Ga0075429_100259612 | 3300006880 | Bacteria | 1521 |
| 263 | Ga0075429_100306443 | 3300006880 | Bacteria | 1390 |
| 264 | Ga0075436_100002041 | 3300006914 | Bacteria | 13918 |
| 265 | Ga0075436_100053692 | 3300006914 | Bacteria | 2782 |
| 266 | Ga0097620_100009043 | 3300006931 | Bacteria | 10063 |
| 267 | Ga0097620_100026660 | 3300006931 | Bacteria | 5795 |
| 268 | Ga0097620_100391329 | 3300006931 | Bacteria | 1486 |
| 269 | Ga0075435_100001556 | 3300007076 | Bacteria | 14805 |
| 270 | Ga0075435_100012879 | 3300007076 | Bacteria | 6202 |
| 271 | Ga0075435_100047753 | 3300007076 | Bacteria | 3438 |
| 272 | Ga0075435_100091710 | 3300007076 | Bacteria | 2508 |
| 273 | Ga0075435_100215257 | 3300007076 | Unclassified | 1630 |
| 274 | Ga0075435_100242739 | 3300007076 | Bacteria | 1532 |
| 275 | Ga0075435_100347176 | 3300007076 | Bacteria | 1272 |
| 276 | Ga0099795_10008622 | 3300007788 | Bacteria | 2917 |
| 277 | Ga0105240_10067558 | 3300009093 | Bacteria | 4431 |
| 278 | Ga0105240_10282127 | 3300009093 | Bacteria | 1908 |
| 279 | Ga0105240_10474560 | 3300009093 | Bacteria | 1395 |
| 280 | Ga0111539_10001266 | 3300009094 | Bacteria | 33726 |
| 281 | Ga0111539_10002621 | 3300009094 | Bacteria | 23856 |
| 282 | Ga0111539_10011657 | 3300009094 | Bacteria | 11027 |
| 283 | Ga0111539_10016847 | 3300009094 | Bacteria | 9050 |
| 284 | Ga0111539_10057849 | 3300009094 | Bacteria | 4602 |
| 285 | Ga0111539_10120428 | 3300009094 | Bacteria | 3075 |
| 286 | Ga0111539_10193423 | 3300009094 | Bacteria | 2373 |
| 287 | Ga0111539_10344964 | 3300009094 | Bacteria | 1733 |
| 288 | Ga0111539_10412847 | 3300009094 | Bacteria | 1572 |
| 289 | Ga0111539_10438239 | 3300009094 | Bacteria | 1521 |
| 290 | Ga0105247_10043972 | 3300009101 | Bacteria | 2738 |
| 291 | Ga0114129_10003240 | 3300009147 | Bacteria | 22849 |
| 292 | Ga0114129_10010224 | 3300009147 | Bacteria | 13384 |
| 293 | Ga0114129_10012541 | 3300009147 | Bacteria | 12070 |
| 294 | Ga0114129_10019542 | 3300009147 | Bacteria | 9646 |
| 295 | Ga0114129_10028618 | 3300009147 | Bacteria | 7895 |
| 296 | Ga0114129_10029401 | 3300009147 | Bacteria | 7784 |
| 297 | Ga0114129_10040648 | 3300009147 | Bacteria | 6554 |
| 298 | Ga0114129_10047361 | 3300009147 | Bacteria | 6041 |
| 299 | Ga0114129_10068567 | 3300009147 | Bacteria | 4945 |
| 300 | Ga0114129_10124874 | 3300009147 | Bacteria | 3539 |
| 301 | Ga0114129_10190951 | 3300009147 | Bacteria | 2781 |
| 302 | Ga0114129_10198809 | 3300009147 | Bacteria | 2716 |
| 303 | Ga0114129_10372182 | 3300009147 | Bacteria | 1888 |
| 304 | Ga0114129_10409785 | 3300009147 | Bacteria | 1785 |
| 305 | Ga0114129_10505019 | 3300009147 | Bacteria | 1579 |
| 306 | Ga0114129_10794236 | 3300009147 | Bacteria | 1208 |
| 307 | Ga0114129_10861665 | 3300009147 | Bacteria | 1151 |
| 308 | Ga0105243_10138448 | 3300009148 | Bacteria | 2074 |
| 309 | Ga0105243_10220896 | 3300009148 | Bacteria | 1675 |
| 310 | Ga0105241_10002609 | 3300009174 | Bacteria | 13517 |
| 311 | Ga0105241_10068576 | 3300009174 | Bacteria | 2748 |
| 312 | Ga0105241_10179783 | 3300009174 | Bacteria | 1754 |
| 313 | Ga0105241_10359719 | 3300009174 | Bacteria | 1266 |
| 314 | Ga0105242_10048005 | 3300009176 | Bacteria | 3468 |
| 315 | Ga0105242_10154162 | 3300009176 | Bacteria | 2005 |
| 316 | Ga0105242_10213692 | 3300009176 | Bacteria | 1720 |
| 317 | Ga0105248_10101693 | 3300009177 | Bacteria | 3239 |
| 318 | Ga0105248_10122207 | 3300009177 | Bacteria | 2937 |
| 319 | Ga0105248_10134069 | 3300009177 | Bacteria | 2794 |
| 320 | Ga0105237_10043407 | 3300009545 | Bacteria | 4528 |
| 321 | Ga0105238_10058109 | 3300009551 | Bacteria | 3878 |
| 322 | Ga0105238_10377872 | 3300009551 | Bacteria | 1408 |
| 323 | Ga0105238_10496295 | 3300009551 | Unclassified | 1221 |
| 324 | Ga0105238_10582665 | 3300009551 | Bacteria | 1125 |
| 325 | Ga0105249_10027079 | 3300009553 | Bacteria | 5171 |
| 326 | Ga0105249_10055271 | 3300009553 | Bacteria | 3631 |
| 327 | Ga0105249_10097034 | 3300009553 | Bacteria | 2766 |
| 328 | Ga0105249_10102256 | 3300009553 | Bacteria | 2697 |
| 329 | Ga0105249_10168434 | 3300009553 | Bacteria | 2122 |
| 330 | Ga0105249_10212794 | 3300009553 | Bacteria | 1898 |
| 331 | Ga0105249_10275699 | 3300009553 | Bacteria | 1677 |
| 332 | Ga0105249_10570728 | 3300009553 | Bacteria | 1184 |
| 333 | Ga0099796_10000792 | 3300010159 | Bacteria | 5709 |
| 334 | Ga0105239_10047530 | 3300010375 | Bacteria | 4703 |
| 335 | Ga0105239_10129225 | 3300010375 | Bacteria | 2809 |
| 336 | Ga0105239_10711132 | 3300010375 | Unclassified | 1149 |
| 337 | Ga0105246_10509144 | 3300011119 | Bacteria | 1024 |
| 338 | Ga0157373_10007390 | 3300013100 | Bacteria | 8175 |
| 339 | Ga0157371_10036655 | 3300013102 | Bacteria | 3512 |
| 340 | Ga0157370_10016104 | 3300013104 | Bacteria | 7578 |
| 341 | Ga0157370_10036360 | 3300013104 | Bacteria | 4778 |
| 342 | Ga0157369_10008310 | 3300013105 | Bacteria | 11898 |
| 343 | Ga0157369_10023551 | 3300013105 | Bacteria | 6858 |
| 344 | Ga0157369_10238188 | 3300013105 | Bacteria | 1901 |
| 345 | Ga0157374_10143214 | 3300013296 | Bacteria | 2321 |
| 346 | Ga0157378_10107437 | 3300013297 | Bacteria | 2554 |
| 347 | Ga0157378_10315604 | 3300013297 | Unclassified | 1517 |
| 348 | Ga0163162_10524533 | 3300013306 | Bacteria | 1314 |
| 349 | Ga0157372_10000347 | 3300013307 | Bacteria | 51034 |
| 350 | Ga0157372_10076210 | 3300013307 | Bacteria | 3786 |
| 351 | Ga0157372_10199731 | 3300013307 | Bacteria | 2316 |
| 352 | Ga0163163_10025815 | 3300014325 | Bacteria | 5604 |
| 353 | Ga0163163_10211291 | 3300014325 | Bacteria | 1990 |
| 354 | Ga0163163_10442207 | 3300014325 | Bacteria | 1360 |
| 355 | Ga0157380_10450497 | 3300014326 | Bacteria | 1236 |
| 356 | Ga0157379_10163408 | 3300014968 | Bacteria | 2010 |
| 357 | Ga0157379_10259059 | 3300014968 | Bacteria | 1580 |
| 358 | Ga0157379_10297994 | 3300014968 | Bacteria | 1469 |
| 359 | Ga0157379_10416197 | 3300014968 | Bacteria | 1237 |
| 360 | Ga0157376_10293581 | 3300014969 | Bacteria | 1536 |
| 361 | Ga0182007_10020576 | 3300015262 | Bacteria | 2357 |
| 362 | Ga0163161_10305754 | 3300017792 | Bacteria | 1253 |
| 363 | Ga0206356_11047833 | 3300020070 | Bacteria | 1424 |
| 364 | Ga0213874_10011593 | 3300021377 | Bacteria | 2238 |
| 365 | Ga0213874_10022030 | 3300021377 | Bacteria | 1764 |
| 366 | Ga0213876_10087546 | 3300021384 | Bacteria | 1649 |
| 367 | Ga0213875_10000003 | 3300021388 | Bacteria | 719367 |
| 368 | Ga0207653_10010824 | 3300025885 | Bacteria | 2847 |
| 369 | Ga0207653_10075959 | 3300025885 | Unclassified | 1155 |
| 370 | Ga0207692_10002939 | 3300025898 | Bacteria | 6600 |
| 371 | Ga0207692_10007559 | 3300025898 | Bacteria | 4456 |
| 372 | Ga0207692_10010611 | 3300025898 | Bacteria | 3889 |
| 373 | Ga0207692_10028454 | 3300025898 | Bacteria | 2644 |
| 374 | Ga0207692_10107528 | 3300025898 | Bacteria | 1542 |
| 375 | Ga0207688_10007589 | 3300025901 | Bacteria | 5903 |
| 376 | Ga0207685_10005228 | 3300025905 | Bacteria | 3402 |
| 377 | Ga0207699_10000184 | 3300025906 | Bacteria | 37990 |
| 378 | Ga0207699_10005400 | 3300025906 | Bacteria | 6123 |
| 379 | Ga0207699_10007536 | 3300025906 | Bacteria | 5325 |
| 380 | Ga0207645_10017408 | 3300025907 | Bacteria | 4744 |
| 381 | Ga0207645_10071122 | 3300025907 | Bacteria | 2226 |
| 382 | Ga0207643_10001080 | 3300025908 | Bacteria | 16124 |
| 383 | Ga0207684_10004601 | 3300025910 | Bacteria | 12957 |
| 384 | Ga0207684_10004627 | 3300025910 | Bacteria | 12921 |
| 385 | Ga0207684_10012156 | 3300025910 | Bacteria | 7492 |
| 386 | Ga0207684_10092188 | 3300025910 | Bacteria | 2582 |
| 387 | Ga0207684_10127396 | 3300025910 | Bacteria | 2185 |
| 388 | Ga0207684_10290272 | 3300025910 | Unclassified | 1410 |
| 389 | Ga0207684_10386659 | 3300025910 | Bacteria | 1203 |
| 390 | Ga0207654_10004145 | 3300025911 | Bacteria | 7306 |
| 391 | Ga0207707_10000381 | 3300025912 | Bacteria | 46274 |
| 392 | Ga0207707_10004363 | 3300025912 | Bacteria | 12505 |
| 393 | Ga0207707_10005225 | 3300025912 | Bacteria | 11379 |
| 394 | Ga0207707_10022196 | 3300025912 | Bacteria | 5548 |
| 395 | Ga0207707_10084269 | 3300025912 | Bacteria | 2776 |
| 396 | Ga0207707_10179742 | 3300025912 | Bacteria | 1847 |
| 397 | Ga0207695_10055385 | 3300025913 | Bacteria | 4133 |
| 398 | Ga0207695_10159114 | 3300025913 | Bacteria | 2191 |
| 399 | Ga0207695_10287550 | 3300025913 | Bacteria | 1537 |
| 400 | Ga0207671_10056234 | 3300025914 | Bacteria | 2915 |
| 401 | Ga0207671_10069776 | 3300025914 | Bacteria | 2619 |
| 402 | Ga0207671_10150427 | 3300025914 | Bacteria | 1798 |
| 403 | Ga0207693_10002453 | 3300025915 | Bacteria | 16107 |
| 404 | Ga0207693_10007608 | 3300025915 | Bacteria | 8900 |
| 405 | Ga0207693_10008194 | 3300025915 | Bacteria | 8564 |
| 406 | Ga0207693_10021040 | 3300025915 | Bacteria | 5184 |
| 407 | Ga0207693_10033392 | 3300025915 | Bacteria | 4061 |
| 408 | Ga0207693_10140716 | 3300025915 | Bacteria | 1897 |
| 409 | Ga0207693_10150639 | 3300025915 | Unclassified | 1829 |
| 410 | Ga0207663_10006005 | 3300025916 | Bacteria | 6175 |
| 411 | Ga0207663_10125523 | 3300025916 | Bacteria | 1765 |
| 412 | Ga0207660_10005541 | 3300025917 | Bacteria | 8199 |
| 413 | Ga0207660_10022679 | 3300025917 | Bacteria | 4231 |
| 414 | Ga0207660_10104627 | 3300025917 | Bacteria | 2120 |
| 415 | Ga0207662_10038478 | 3300025918 | Bacteria | 2803 |
| 416 | Ga0207657_10000925 | 3300025919 | Bacteria | 31095 |
| 417 | Ga0207652_10001534 | 3300025921 | Bacteria | 20361 |
| 418 | Ga0207652_10003752 | 3300025921 | Bacteria | 12460 |
| 419 | Ga0207652_10024807 | 3300025921 | Bacteria | 4977 |
| 420 | Ga0207652_10079842 | 3300025921 | Bacteria | 2859 |
| 421 | Ga0207652_10201467 | 3300025921 | Bacteria | 1791 |
| 422 | Ga0207646_10007164 | 3300025922 | Bacteria | 11395 |
| 423 | Ga0207646_10014019 | 3300025922 | Bacteria | 7629 |
| 424 | Ga0207646_10016781 | 3300025922 | Bacteria | 6869 |
| 425 | Ga0207646_10045568 | 3300025922 | Bacteria | 3937 |
| 426 | Ga0207646_10048272 | 3300025922 | Bacteria | 3816 |
| 427 | Ga0207646_10092888 | 3300025922 | Bacteria | 2701 |
| 428 | Ga0207646_10166782 | 3300025922 | Bacteria | 1988 |
| 429 | Ga0207646_10207485 | 3300025922 | Bacteria | 1770 |
| 430 | Ga0207646_10227702 | 3300025922 | Unclassified | 1684 |
| 431 | Ga0207694_10093774 | 3300025924 | Bacteria | 2372 |
| 432 | Ga0207650_10006688 | 3300025925 | Bacteria | 7862 |
| 433 | Ga0207687_10454049 | 3300025927 | Bacteria | 1063 |
| 434 | Ga0207700_10011666 | 3300025928 | Bacteria | 5617 |
| 435 | Ga0207700_10018539 | 3300025928 | Bacteria | 4680 |
| 436 | Ga0207700_10028000 | 3300025928 | Bacteria | 3954 |
| 437 | Ga0207700_10048004 | 3300025928 | Bacteria | 3168 |
| 438 | Ga0207700_10153850 | 3300025928 | Bacteria | 1903 |
| 439 | Ga0207700_10166466 | 3300025928 | Bacteria | 1835 |
| 440 | Ga0207664_10004648 | 3300025929 | Bacteria | 9314 |
| 441 | Ga0207664_10006892 | 3300025929 | Bacteria | 7855 |
| 442 | Ga0207664_10016165 | 3300025929 | Bacteria | 5437 |
| 443 | Ga0207664_10036921 | 3300025929 | Bacteria | 3778 |
| 444 | Ga0207664_10042184 | 3300025929 | Bacteria | 3560 |
| 445 | Ga0207664_10260823 | 3300025929 | Bacteria | 1515 |
| 446 | Ga0207690_10003419 | 3300025932 | Bacteria | 9475 |
| 447 | Ga0207706_10022010 | 3300025933 | Bacteria | 5722 |
| 448 | Ga0207706_10045887 | 3300025933 | Bacteria | 3870 |
| 449 | Ga0207706_10050917 | 3300025933 | Bacteria | 3658 |
| 450 | Ga0207706_10051466 | 3300025933 | Bacteria | 3637 |
| 451 | Ga0207686_10090369 | 3300025934 | Bacteria | 2020 |
| 452 | Ga0207709_10115734 | 3300025935 | Bacteria | 1801 |
| 453 | Ga0207670_10103072 | 3300025936 | Bacteria | 2041 |
| 454 | Ga0207670_10163615 | 3300025936 | Unclassified | 1663 |
| 455 | Ga0207665_10003072 | 3300025939 | Bacteria | 11204 |
| 456 | Ga0207665_10135072 | 3300025939 | Bacteria | 1755 |
| 457 | Ga0207665_10289465 | 3300025939 | Bacteria | 1221 |
| 458 | Ga0207691_10060852 | 3300025940 | Bacteria | 3431 |
| 459 | Ga0207691_10110671 | 3300025940 | Bacteria | 2443 |
| 460 | Ga0207691_10120801 | 3300025940 | Bacteria | 2322 |
| 461 | Ga0207711_10019107 | 3300025941 | Bacteria | 5702 |
| 462 | Ga0207711_10061833 | 3300025941 | Bacteria | 3229 |
| 463 | Ga0207689_10000250 | 3300025942 | Bacteria | 48225 |
| 464 | Ga0207689_10012034 | 3300025942 | Bacteria | 7414 |
| 465 | Ga0207689_10023888 | 3300025942 | Bacteria | 5128 |
| 466 | Ga0207689_10074152 | 3300025942 | Bacteria | 2796 |
| 467 | Ga0207689_10086631 | 3300025942 | Bacteria | 2574 |
| 468 | Ga0207661_10009379 | 3300025944 | Bacteria | 7016 |
| 469 | Ga0207679_10003431 | 3300025945 | Bacteria | 9779 |
| 470 | Ga0207667_10001657 | 3300025949 | Bacteria | 28057 |
| 471 | Ga0207667_10002990 | 3300025949 | Bacteria | 20997 |
| 472 | Ga0207712_10013516 | 3300025961 | Bacteria | 5235 |
| 473 | Ga0207712_10066220 | 3300025961 | Bacteria | 2582 |
| 474 | Ga0207712_10094433 | 3300025961 | Bacteria | 2209 |
| 475 | Ga0207712_10165793 | 3300025961 | Bacteria | 1722 |
| 476 | Ga0207640_10000925 | 3300025981 | Bacteria | 16459 |
| 477 | Ga0207703_10029463 | 3300026035 | Bacteria | 4331 |
| 478 | Ga0207703_10522627 | 3300026035 | Bacteria | 1116 |
| 479 | Ga0207639_10005303 | 3300026041 | Bacteria | 8701 |
| 480 | Ga0207639_10230617 | 3300026041 | Bacteria | 1604 |
| 481 | Ga0207639_10515274 | 3300026041 | Bacteria | 1095 |
| 482 | Ga0207678_10002573 | 3300026067 | Bacteria | 16535 |
| 483 | Ga0207708_10038721 | 3300026075 | Bacteria | 3632 |
| 484 | Ga0207708_10054625 | 3300026075 | Bacteria | 3045 |
| 485 | Ga0207708_10091112 | 3300026075 | Bacteria | 2351 |
| 486 | Ga0207708_10145818 | 3300026075 | Bacteria | 1860 |
| 487 | Ga0207702_10000979 | 3300026078 | Bacteria | 29227 |
| 488 | Ga0207702_10037160 | 3300026078 | Bacteria | 4075 |
| 489 | Ga0207641_10038507 | 3300026088 | Bacteria | 3998 |
| 490 | Ga0207648_10005180 | 3300026089 | Bacteria | 13198 |
| 491 | Ga0207648_10030847 | 3300026089 | Bacteria | 4743 |
| 492 | Ga0207648_10049757 | 3300026089 | Bacteria | 3666 |
| 493 | Ga0207648_10155324 | 3300026089 | Bacteria | 2020 |
| 494 | Ga0207676_10364016 | 3300026095 | Bacteria | 1341 |
| 495 | Ga0207674_10004434 | 3300026116 | Bacteria | 16875 |
| 496 | Ga0207674_10012224 | 3300026116 | Bacteria | 9602 |
| 497 | Ga0207674_10036172 | 3300026116 | Bacteria | 5148 |
| 498 | Ga0207674_10136440 | 3300026116 | Bacteria | 2415 |
| 499 | Ga0207674_10209161 | 3300026116 | Bacteria | 1900 |
| 500 | Ga0207674_10256786 | 3300026116 | Bacteria | 1695 |
| 501 | Ga0207675_100087937 | 3300026118 | Bacteria | 2919 |
| 502 | Ga0207683_10118271 | 3300026121 | Bacteria | 2377 |
| 503 | Ga0207698_10123762 | 3300026142 | Bacteria | 2195 |
| 504 | Ga0209981_1001702 | 3300027378 | Bacteria | 2784 |
| 505 | Ga0209981_1004630 | 3300027378 | Bacteria | 1809 |
| 506 | Ga0209996_1000427 | 3300027395 | Bacteria | 5083 |
| 507 | Ga0209995_1002081 | 3300027471 | Bacteria | 3144 |
| 508 | Ga0209999_1000272 | 3300027543 | Bacteria | 7611 |
| 509 | Ga0209982_1001858 | 3300027552 | Bacteria | 2916 |
| 510 | Ga0209970_1001273 | 3300027614 | Bacteria | 4451 |
| 511 | Ga0210002_1000887 | 3300027617 | Bacteria | 4107 |
| 512 | Ga0209983_1000101 | 3300027665 | Bacteria | 14499 |
| 513 | Ga0209983_1000711 | 3300027665 | Bacteria | 7190 |
| 514 | Ga0209588_1005624 | 3300027671 | Bacteria | 3600 |
| 515 | Ga0209588_1015545 | 3300027671 | Bacteria | 2341 |
| 516 | Ga0209971_1000003 | 3300027682 | Bacteria | 110664 |
| 517 | Ga0209971_1000008 | 3300027682 | Bacteria | 102612 |
| 518 | Ga0209971_1007671 | 3300027682 | Bacteria | 2561 |
| 519 | Ga0209966_1000045 | 3300027695 | Bacteria | 52459 |
| 520 | Ga0209998_10000016 | 3300027717 | Bacteria | 85166 |
| 521 | Ga0209998_10006972 | 3300027717 | Bacteria | 2344 |
| 522 | Ga0209974_10000022 | 3300027876 | Bacteria | 36601 |
| 523 | Ga0209974_10000073 | 3300027876 | Bacteria | 26904 |
| 524 | Ga0209974_10022881 | 3300027876 | Bacteria | 2068 |
| 525 | Ga0207428_10000063 | 3300027907 | Bacteria | 151868 |
| 526 | Ga0207428_10000091 | 3300027907 | Bacteria | 125388 |
| 527 | Ga0207428_10000253 | 3300027907 | Bacteria | 73122 |
| 528 | Ga0207428_10001363 | 3300027907 | Bacteria | 25962 |
| 529 | Ga0207428_10008093 | 3300027907 | Bacteria | 9533 |
| 530 | Ga0207428_10021082 | 3300027907 | Bacteria | 5522 |
| 531 | Ga0207428_10116258 | 3300027907 | Bacteria | 2054 |
| 532 | Ga0268265_10006724 | 3300028380 | Bacteria | 7782 |
| 533 | Ga0268265_10006929 | 3300028380 | Bacteria | 7666 |
| 534 | Ga0268265_10019399 | 3300028380 | Bacteria | 4726 |
| 535 | Ga0268265_10023027 | 3300028380 | Bacteria | 4386 |
| 536 | Ga0268265_10070909 | 3300028380 | Bacteria | 2712 |
| 537 | Ga0268265_10074090 | 3300028380 | Bacteria | 2661 |
| 538 | Ga0268265_10079504 | 3300028380 | Bacteria | 2582 |
| 539 | Ga0268265_10091524 | 3300028380 | Bacteria | 2432 |
| 540 | Ga0268264_10040497 | 3300028381 | Bacteria | 3849 |
| 541 | Ga0268264_10278143 | 3300028381 | Unclassified | 1566 |
| 542 | Ga0268264_10530784 | 3300028381 | Bacteria | 1152 |
| 543 | Ga0265334_10040586 | 3300028573 | Bacteria | 1822 |
| 544 | Ga0307408_100324329 | 3300031548 | Bacteria | 1298 |
| 545 | Ga0307508_10000005 | 3300031616 | Bacteria | 286511 |
| 546 | Ga0307508_10021355 | 3300031616 | Bacteria | 5886 |
| 547 | Ga0265314_10001303 | 3300031711 | Bacteria | 28283 |
| 548 | Ga0307410_10038103 | 3300031852 | Bacteria | 3146 |
| 549 | Ga0307407_10213031 | 3300031903 | Bacteria | 1302 |
| 550 | Ga0307409_100442934 | 3300031995 | Bacteria | 1252 |
| 551 | Ga0373926_0029604 | 3300035083 | Bacteria | 1925 |
| 552 | Ga0373928_0013917 | 3300035084 | Bacteria | 1620 |
| 553 | Ga0373934_0012646 | 3300035086 | Bacteria | 3185 |
| 554 | Ga0373940_0045048 | 3300035088 | Bacteria | 1224 |
| 555 | Ga0373944_0078274 | 3300035089 | Bacteria | 1088 |
| 556 | Ga0373949_0004095 | 3300035090 | Bacteria | 3373 |
| 557 | Ga0373923_0006598 | 3300035111 | Bacteria | 4022 |
| 558 | Ga0373923_0026956 | 3300035111 | Bacteria | 2289 |
| 559 | Ga0373936_0007064 | 3300035113 | Bacteria | 4224 |
| 560 | Ga0373939_0011648 | 3300035114 | Bacteria | 2225 |
| 561 | Ga0373941_0006452 | 3300035115 | Bacteria | 2827 |
| 562 | Ga0373945_0034530 | 3300035116 | Bacteria | 1803 |
| 563 | Ga0373953_0010488 | 3300035117 | Bacteria | 3226 |
| 564 | Ga0373953_0044992 | 3300035117 | Bacteria | 1767 |
| 565 | Ga0373954_0035689 | 3300035118 | Bacteria | 2307 |
| 566 | Ga0373954_0054864 | 3300035118 | Bacteria | 1874 |
| 567 | Ga0373956_0004587 | 3300035119 | Bacteria | 5519 |
| 568 | Ga0373956_0030187 | 3300035119 | Bacteria | 2368 |
| 569 | Ga0373960_0008679 | 3300035121 | Bacteria | 2442 |
| 570 | Ga0373960_0032362 | 3300035121 | Unclassified | 1468 |
| 571 | Ga0373943_0199547 | 3300035170 | Bacteria | 1107 |
| 572 | Ga0373955_0010599 | 3300035172 | Bacteria | 4359 |
| 573 | Ga0373955_0070712 | 3300035172 | Bacteria | 1950 |
| 574 | Ga0373961_0072141 | 3300035241 | Bacteria | 1070 |
| 575 | Ga0373924_0006137 | 3300035410 | Bacteria | 4291 |
| 576 | Ga0373924_0026977 | 3300035410 | Bacteria | 2282 |
| 577 | Ga0373931_0004839 | 3300035691 | Bacteria | 6184 |
| 578 | Ga0373931_0005096 | 3300035691 | Bacteria | 6048 |
| 579 | Ga0373931_0018090 | 3300035691 | Bacteria | 3499 |
| 580 | Ga0373931_0018818 | 3300035691 | Bacteria | 3438 |
| 581 | Ga0373931_0057570 | 3300035691 | Unclassified | 2085 |
| 582 | Ga0373931_0107664 | 3300035691 | Bacteria | 1577 |
| 583 | Ga0373935_0047469 | 3300035692 | Bacteria | 2716 |
| 584 | Ga0373935_0071529 | 3300035692 | Bacteria | 2238 |
| 585 | Ga0373935_0167004 | 3300035692 | Bacteria | 1503 |
| 586 | Ga0373927_0072278 | 3300035695 | Bacteria | 2232 |
| 587 | Ga0373927_0146501 | 3300035695 | Bacteria | 1546 |
| 588 | Ga0373933_0003431 | 3300035724 | Bacteria | 8832 |
| 589 | Ga0373933_0016036 | 3300035724 | Bacteria | 4185 |
| 590 | Ga0373947_0036707 | 3300035725 | Bacteria | 2906 |
| 591 | Ga0373947_0039675 | 3300035725 | Bacteria | 2802 |
| 592 | Ga0373937_0225531 | 3300036401 | Bacteria | 1764 |
| 593 | Ga0373937_0330574 | 3300036401 | Bacteria | 1442 |
| 594 | Ga0373925_0074387 | 3300037068 | Bacteria | 2573 |
| 595 | Ga0373925_0158300 | 3300037068 | Bacteria | 1782 |
| 596 | Ga0373925_0209318 | 3300037068 | Bacteria | 1553 |
| 597 | Ga0373925_0359709 | 3300037068 | Bacteria | 1183 |
| 598 | Ga0373925_0509127 | 3300037068 | Bacteria | 988 |
| 599 | Ga0395899_0030724 | 3300037312 | Bacteria | 4039 |
| 600 | Ga0395900_0013350 | 3300037418 | Bacteria | 8396 |
| 601 | Ga0395900_0041942 | 3300037418 | Bacteria | 4715 |
| 602 | Ga0395900_0268057 | 3300037418 | Bacteria | 1703 |
| 603 | Ga0395898_0021886 | 3300037466 | Bacteria | 6477 |
| 604 | Ga0395898_0124898 | 3300037466 | Bacteria | 2465 |
| 605 | Ga0436364_0352307 | 3300037853 | Bacteria | 885 |
| 606 | Ga0436364_0521241 | 3300037853 | Bacteria | 1490 |
| 607 | Ga0436364_0832396 | 3300037853 | Bacteria | 21955 |
| 608 | Ga0395901_0000688 | 3300038443 | Bacteria | 38764 |
| 609 | Ga0395901_0003897 | 3300038443 | Bacteria | 15006 |
| 610 | Ga0395901_0040438 | 3300038443 | Bacteria | 4830 |
| 611 | Ga0395901_0154478 | 3300038443 | Bacteria | 2411 |
| 612 | Ga0242420_023015 | 3300038996 | Bacteria | 1123 |
| 613 | Ga0436365_0262673 | 3300039437 | Bacteria | 2173 |
| 614 | Ga0436365_0646666 | 3300039437 | Bacteria | 3450 |
| 615 | Ga0436365_0701279 | 3300039437 | Bacteria | 2146 |
| 616 | Ga0436360_0288674 | 3300039438 | Bacteria | 3013 |
| 617 | Ga0436360_0427393 | 3300039438 | Bacteria | 1929 |
| 618 | Ga0436360_0432140 | 3300039438 | Bacteria | 1465 |
| 619 | Ga0436360_0621665 | 3300039438 | Bacteria | 2655 |
| 620 | Ga0436360_0634297 | 3300039438 | Bacteria | 3436 |
| 621 | Ga0436361_0565162 | 3300039447 | Bacteria | 3104 |
| 622 | Ga0436361_0804636 | 3300039447 | Bacteria | 1621 |
| 623 | Ga0436363_0384424 | 3300039450 | Bacteria | 4704 |
| 624 | Ga0436363_0412808 | 3300039450 | Bacteria | 1391 |
| 625 | Ga0436363_1362005 | 3300039450 | Bacteria | 978 |
| 626 | Ga0436363_1450587 | 3300039450 | Bacteria | 3162 |
| 627 | Ga0436363_1461858 | 3300039450 | Bacteria | 2953 |
| 628 | Ga0436362_0280096 | 3300039453 | Bacteria | 2495 |
| 629 | Ga0436362_0355831 | 3300039453 | Bacteria | 6148 |
| 630 | Ga0436362_1044336 | 3300039453 | Bacteria | 3303 |
| 631 | Ga0439448_0001996 | 3300042005 | Bacteria | 5451 |
| 632 | Ga0439459_0005954 | 3300042438 | Bacteria | 2019 |
| 633 | Ga0439464_0000185 | 3300042439 | Bacteria | 10818 |
| 634 | Ga0439460_0000645 | 3300042461 | Bacteria | 7665 |
| 635 | Ga0439460_0002041 | 3300042461 | Bacteria | 4842 |
| 636 | Ga0451577_0003647 | 3300042876 | Bacteria | 16886 |
| 637 | Ga0451577_0014234 | 3300042876 | Bacteria | 7415 |
| 638 | Ga0451577_0144248 | 3300042876 | Bacteria | 2140 |
| 639 | Ga0451577_0195116 | 3300042876 | Bacteria | 1827 |
| 640 | Ga0453683_0008311 | 3300044673 | Bacteria | 6976 |
| 641 | Ga0453683_0019448 | 3300044673 | Bacteria | 4349 |
| 642 | Ga0453683_0032513 | 3300044673 | Bacteria | 3292 |
| 643 | Ga0453683_0091398 | 3300044673 | Bacteria | 1908 |
| 644 | Ga0453684_0033865 | 3300044712 | Bacteria | 7108 |
| 645 | Ga0453684_0072440 | 3300044712 | Bacteria | 4349 |
| 646 | Ga0453684_0306855 | 3300044712 | Unclassified | 1802 |
| 647 | Ga0451576_0007779 | 3300045051 | Bacteria | 12719 |
| 648 | Ga0451576_0008007 | 3300045051 | Bacteria | 12488 |
| 649 | Ga0451576_0046553 | 3300045051 | Bacteria | 4566 |
| 650 | Ga0451576_0101787 | 3300045051 | Bacteria | 2987 |
| 651 | Ga0495592_0036539 | 3300046454 | Bacteria | 3699 |
| 652 | Ga0495592_0038473 | 3300046454 | Bacteria | 3600 |
| 653 | Ga0495629_0012711 | 3300046459 | Bacteria | 6095 |
| 654 | Ga0495629_0077308 | 3300046459 | Bacteria | 2323 |
| 655 | Ga0495629_0309345 | 3300046459 | Bacteria | 1081 |
| 656 | Ga0495641_0108816 | 3300046461 | Bacteria | 1237 |
| 657 | Ga0495651_0142333 | 3300046462 | Bacteria | 1737 |
| 658 | Ga0495653_0002423 | 3300046463 | Bacteria | 14846 |
| 659 | Ga0495580_0004048 | 3300046472 | Bacteria | 12367 |
| 660 | Ga0495580_0124609 | 3300046472 | Bacteria | 1788 |
| 661 | Ga0495582_0063387 | 3300046473 | Bacteria | 2042 |
| 662 | Ga0495662_0048832 | 3300046476 | Bacteria | 2043 |
| 663 | Ga0495662_0137303 | 3300046476 | Bacteria | 1203 |
| 664 | Ga0495664_0003422 | 3300046477 | Bacteria | 8627 |
| 665 | Ga0495594_0075029 | 3300046499 | Bacteria | 1885 |
| 666 | Ga0495608_0008830 | 3300046511 | Bacteria | 7052 |
| 667 | Ga0495628_0041389 | 3300046516 | Bacteria | 3678 |
| 668 | Ga0495628_0045948 | 3300046516 | Bacteria | 3470 |
| 669 | Ga0495666_0044901 | 3300046526 | Bacteria | 2133 |
| 670 | Ga0495652_0084105 | 3300046529 | Bacteria | 2617 |
| 671 | Ga0495652_0095305 | 3300046529 | Bacteria | 2425 |
| 672 | Ga0495665_0026882 | 3300046531 | Bacteria | 3090 |
| 673 | Ga0495640_0024793 | 3300046533 | Bacteria | 4358 |
| 674 | Ga0495640_0092712 | 3300046533 | Bacteria | 1992 |
| 675 | Ga0495640_0205603 | 3300046533 | Bacteria | 1246 |
| 676 | Ga0495587_0020063 | 3300046536 | Bacteria | 4129 |
| 677 | Ga0495587_0025261 | 3300046536 | Bacteria | 3630 |
| 678 | Ga0495645_0008413 | 3300046543 | Bacteria | 7209 |
| 679 | Ga0495645_0026093 | 3300046543 | Bacteria | 4240 |
| 680 | Ga0495645_0073883 | 3300046543 | Bacteria | 2455 |
| 681 | Ga0495667_0004876 | 3300046559 | Bacteria | 9070 |
| 682 | Ga0495667_0026765 | 3300046559 | Bacteria | 3885 |
| 683 | Ga0495667_0040322 | 3300046559 | Bacteria | 3101 |
| 684 | Ga0495667_0054978 | 3300046559 | Bacteria | 2618 |
| 685 | Ga0495667_0077177 | 3300046559 | Bacteria | 2167 |
| 686 | Ga0495634_0033815 | 3300046642 | Bacteria | 3511 |
| 687 | Ga0495634_0034511 | 3300046642 | Bacteria | 3471 |
| 688 | Ga0495634_0067441 | 3300046642 | Bacteria | 2367 |
| 689 | Ga0495635_0034112 | 3300046663 | Bacteria | 3531 |
| 690 | Ga0495635_0040398 | 3300046663 | Bacteria | 3224 |
| 691 | Ga0495635_0042167 | 3300046663 | Bacteria | 3151 |
| 692 | Ga0495588_0068110 | 3300046674 | Bacteria | 1848 |
| 693 | Ga0495599_0014789 | 3300046678 | Bacteria | 4831 |
| 694 | Ga0495599_0015541 | 3300046678 | Bacteria | 4725 |
| 695 | Ga0495623_0009138 | 3300046679 | Bacteria | 6429 |
| 696 | Ga0495646_0014497 | 3300046680 | Bacteria | 5011 |
| 697 | Ga0495658_0126059 | 3300046683 | Bacteria | 1554 |
| 698 | Ga0495658_0180948 | 3300046683 | Bacteria | 1308 |
| 699 | Ga0495658_0253170 | 3300046683 | Bacteria | 1108 |
| 700 | Ga0495658_0282203 | 3300046683 | Bacteria | 1048 |
| 701 | Ga0495624_0036743 | 3300046690 | Bacteria | 3156 |
| 702 | Ga0495624_0077858 | 3300046690 | Bacteria | 2057 |
| 703 | Ga0495670_0238481 | 3300046691 | Bacteria | 968 |
| 704 | Ga0495600_0082782 | 3300046809 | Bacteria | 2094 |
| 705 | Ga0495600_0092479 | 3300046809 | Bacteria | 1972 |
| 706 | Ga0495581_0086789 | 3300047315 | Bacteria | 1814 |
| 707 | Ga0495604_0002404 | 3300047317 | Bacteria | 14988 |
| 708 | Ga0495604_0090384 | 3300047317 | Bacteria | 2274 |
| 709 | Ga0495674_0007810 | 3300047319 | Bacteria | 10213 |
| 710 | Ga0495674_0142647 | 3300047319 | Bacteria | 2013 |
| 711 | Ga0495676_0102548 | 3300047321 | Bacteria | 2114 |
| 712 | Ga0495680_0002651 | 3300047322 | Bacteria | 18113 |
| 713 | Ga0495680_0070091 | 3300047322 | Bacteria | 2674 |
| 714 | Ga0495680_0072484 | 3300047322 | Bacteria | 2620 |
| 715 | Ga0495675_0005549 | 3300047444 | Bacteria | 7696 |
| 716 | Ga0495675_0071843 | 3300047444 | Bacteria | 2184 |
| 717 | Ga0495684_0026505 | 3300047471 | Bacteria | 4455 |
| 718 | Ga0495684_0048644 | 3300047471 | Bacteria | 3242 |
| 719 | Ga0495684_0080492 | 3300047471 | Bacteria | 2473 |
| 720 | Ga0495593_0052161 | 3300047673 | Bacteria | 2162 |
| 721 | Ga0495602_0000299 | 3300048088 | Bacteria | 45610 |
| 722 | Ga0495602_0077080 | 3300048088 | Bacteria | 2822 |
| 723 | Ga0495602_0139861 | 3300048088 | Bacteria | 1917 |
| 724 | Ga0496101_0093130 | 3300048904 | Bacteria | 2244 |
| 725 | Ga0496102_0037600 | 3300048905 | Bacteria | 4367 |
| 726 | Ga0496103_0049390 | 3300048906 | Bacteria | 2601 |
| 727 | Ga0496106_0019397 | 3300048909 | Bacteria | 5044 |
| 728 | Ga0496106_0180393 | 3300048909 | Unclassified | 1676 |
| 729 | Ga0496108_0088795 | 3300048911 | Bacteria | 2627 |
| 730 | Ga0496108_0314175 | 3300048911 | Bacteria | 1365 |
| 731 | Ga0496109_0051215 | 3300048912 | Bacteria | 3761 |
| 732 | Ga0496110_0054677 | 3300048913 | Bacteria | 3512 |
| 733 | Ga0496112_0024728 | 3300048915 | Bacteria | 5758 |
| 734 | Ga0496112_0073214 | 3300048915 | Bacteria | 3387 |
| 735 | Ga0496112_0307729 | 3300048915 | Bacteria | 1530 |
| 736 | Ga0496113_0017599 | 3300048916 | Bacteria | 4964 |
| 737 | Ga0496113_0032907 | 3300048916 | Bacteria | 3771 |
| 738 | Ga0496115_0035422 | 3300048918 | Bacteria | 3948 |
| 739 | Ga0496121_0048028 | 3300048924 | Bacteria | 3636 |
| 740 | Ga0496126_0027923 | 3300048929 | Bacteria | 5382 |
| 741 | Ga0501031_0030752 | 3300049568 | Bacteria | 3503 |
| 742 | Ga0501038_0179810 | 3300049574 | Bacteria | 1707 |
| 743 | Ga0501039_0016008 | 3300049575 | Bacteria | 5743 |
| 744 | Ga0501040_0010906 | 3300049576 | Bacteria | 5942 |
| 745 | Ga0501040_0015905 | 3300049576 | Bacteria | 4973 |
| 746 | Ga0501040_0023255 | 3300049576 | Bacteria | 4155 |
| 747 | Ga0501041_0005485 | 3300049577 | Bacteria | 7424 |
| 748 | Ga0501041_0006986 | 3300049577 | Bacteria | 6622 |
| 749 | Ga0501042_0006201 | 3300049578 | Bacteria | 7761 |
| 750 | Ga0501042_0023145 | 3300049578 | Bacteria | 4343 |
| 751 | Ga0501042_0077509 | 3300049578 | Bacteria | 2380 |
| 752 | Ga0501046_0000295 | 3300049580 | Bacteria | 50418 |
| 753 | Ga0501046_0001418 | 3300049580 | Bacteria | 23061 |
| 754 | Ga0501046_0121250 | 3300049580 | Bacteria | 1989 |
| 755 | Ga0501070_0013607 | 3300049586 | Bacteria | 6857 |
| 756 | Ga0501070_0158292 | 3300049586 | Bacteria | 1868 |
| 757 | Ga0501072_0113004 | 3300049588 | Bacteria | 2162 |
| 758 | Ga0501073_0077732 | 3300049589 | Bacteria | 2309 |
| 759 | Ga0501074_0006949 | 3300049590 | Bacteria | 8175 |
| 760 | Ga0501074_0028505 | 3300049590 | Bacteria | 4047 |
| 761 | Ga0501074_0116793 | 3300049590 | Bacteria | 1909 |
| 762 | Ga0501074_0117798 | 3300049590 | Bacteria | 1900 |
| 763 | Ga0501075_0094521 | 3300049591 | Bacteria | 2269 |
| 764 | Ga0501076_0035680 | 3300049592 | Bacteria | 3891 |
| 765 | Ga0501077_0181332 | 3300049593 | Bacteria | 1338 |
| 766 | Ga0501079_0000617 | 3300049741 | Bacteria | 23595 |
| 767 | Ga0501079_0005572 | 3300049741 | Bacteria | 9396 |
| 768 | Ga0501079_0010629 | 3300049741 | Bacteria | 7005 |
| 769 | Ga0501080_0059104 | 3300049742 | Bacteria | 3568 |
| 770 | Ga0501080_0061225 | 3300049742 | Bacteria | 3505 |
| 771 | Ga0501081_0011693 | 3300049743 | Bacteria | 5746 |
| 772 | Ga0501081_0036762 | 3300049743 | Bacteria | 3339 |
| 773 | Ga0501081_0083950 | 3300049743 | Bacteria | 2233 |
| 774 | Ga0501083_0043295 | 3300049744 | Bacteria | 3051 |
| 775 | Ga0501083_0080809 | 3300049744 | Bacteria | 2155 |
| 776 | Ga0501035_0072138 | 3300049822 | Bacteria | 3057 |
| 777 | Ga0501045_0000318 | 3300049824 | Bacteria | 28148 |
| 778 | Ga0501045_0000939 | 3300049824 | Bacteria | 19048 |
| 779 | nmdc:mga0yw44_127385_c1 | 3300050492 | Bacteria | 1645 |
| 780 | nmdc:mga05p37_12107_c1 | 3300050507 | Bacteria | 10298 |
| 781 | nmdc:mga05p37_125061_c1 | 3300050507 | Unclassified | 3158 |
| 782 | nmdc:mga05p37_13768_c1 | 3300050507 | Bacteria | 9692 |
| 783 | nmdc:mga05p37_217042_c1 | 3300050507 | Bacteria | 2310 |
| 784 | nmdc:mga05p37_259534_c1 | 3300050507 | Bacteria | 2080 |
| 785 | nmdc:mga05p37_27232_c2 | 3300050507 | Bacteria | 6071 |
| 786 | nmdc:mga05p37_27794_c1 | 3300050507 | Bacteria | 6891 |
| 787 | nmdc:mga05p37_31506_c1 | 3300050507 | Bacteria | 6477 |
| 788 | nmdc:mga05p37_40434_c1 | 3300050507 | Bacteria | 5727 |
| 789 | nmdc:mga05p37_42837_c1 | 3300050507 | Bacteria | 5565 |
| 790 | nmdc:mga05p37_4931_c1 | 3300050507 | Bacteria | 15633 |
| 791 | nmdc:mga05p37_56142_c1 | 3300050507 | Bacteria | 4848 |
| 792 | nmdc:mga05p37_5780_c1 | 3300050507 | Bacteria | 14546 |
| 793 | nmdc:mga05p37_58251_c1 | 3300050507 | Bacteria | 4758 |
| 794 | nmdc:mga05p37_6086_c1 | 3300050507 | Bacteria | 14209 |
| 795 | nmdc:mga05p37_676558_c1 | 3300050507 | Bacteria | 1151 |
| 796 | nmdc:mga05p37_68705_c1 | 3300050507 | Bacteria | 4357 |
| 797 | nmdc:mga05p37_7199_c1 | 3300050507 | Bacteria | 13124 |
| 798 | nmdc:mga05p37_76551_c1 | 3300050507 | Bacteria | 4119 |
| 799 | nmdc:mga05p37_8072_c1 | 3300050507 | Bacteria | 12436 |
| 800 | nmdc:mga05p37_94672_c1 | 3300050507 | Bacteria | 3680 |
| 801 | nmdc:mga05p37_98210_c1 | 3300050507 | Bacteria | 3607 |
| 802 | nmdc:mga09592_137351_c1 | 3300050508 | Bacteria | 2106 |
| 803 | nmdc:mga09592_148559_c1 | 3300050508 | Bacteria | 2021 |
| 804 | nmdc:mga09592_1636_c1 | 3300050508 | Bacteria | 18036 |
| 805 | nmdc:mga09592_168049_c1 | 3300050508 | Bacteria | 1896 |
| 806 | nmdc:mga09592_17687_c1 | 3300050508 | Bacteria | 3769 |
| 807 | nmdc:mga09592_1890_c1 | 3300050508 | Bacteria | 16868 |
| 808 | nmdc:mga09592_3205_c1 | 3300050508 | Bacteria | 13246 |
| 809 | nmdc:mga09592_333039_c1 | 3300050508 | Bacteria | 1314 |
| 810 | nmdc:mga09592_33859_c1 | 3300050508 | Bacteria | 4269 |
| 811 | nmdc:mga09592_34576_c1 | 3300050508 | Bacteria | 4225 |
| 812 | nmdc:mga09592_350768_c1 | 3300050508 | Bacteria | 1277 |
| 813 | nmdc:mga09592_41229_c1 | 3300050508 | Bacteria | 3036 |
| 814 | nmdc:mga09592_4123_c1 | 3300050508 | Bacteria | 11741 |
| 815 | nmdc:mga09592_56141_c1 | 3300050508 | Bacteria | 3328 |
| 816 | nmdc:mga0qj67_13398_c1 | 3300050509 | Bacteria | 6185 |
| 817 | nmdc:mga0qj67_23809_c1 | 3300050509 | Bacteria | 4715 |
| 818 | nmdc:mga0qj67_257_c1 | 3300050509 | Bacteria | 36250 |
| 819 | nmdc:mga0qj67_30012_c1 | 3300050509 | Bacteria | 4227 |
| 820 | nmdc:mga0qj67_313531_c1 | 3300050509 | Bacteria | 1270 |
| 821 | nmdc:mga0qj67_35029_c1 | 3300050509 | Bacteria | 3924 |
| 822 | nmdc:mga0qj67_40703_c1 | 3300050509 | Bacteria | 3652 |
| 823 | nmdc:mga0qj67_53973_c1 | 3300050509 | Bacteria | 3182 |
| 824 | nmdc:mga0qj67_582_c1 | 3300050509 | Bacteria | 24949 |
| 825 | nmdc:mga06r32_121051_c1 | 3300050510 | Bacteria | 2582 |
| 826 | nmdc:mga06r32_12541_c2 | 3300050510 | Bacteria | 4812 |
| 827 | nmdc:mga06r32_13444_c1 | 3300050510 | Bacteria | 7413 |
| 828 | nmdc:mga06r32_164798_c1 | 3300050510 | Bacteria | 2199 |
| 829 | nmdc:mga06r32_16890_c1 | 3300050510 | Bacteria | 6657 |
| 830 | nmdc:mga06r32_229376_c1 | 3300050510 | Bacteria | 1845 |
| 831 | nmdc:mga06r32_233134_c1 | 3300050510 | Bacteria | 1829 |
| 832 | nmdc:mga06r32_26507_c1 | 3300050510 | Bacteria | 5405 |
| 833 | nmdc:mga06r32_414_c1 | 3300050510 | Bacteria | 35862 |
| 834 | nmdc:mga06r32_52069_c1 | 3300050510 | Bacteria | 3920 |
| 835 | nmdc:mga06r32_63091_c1 | 3300050510 | Bacteria | 3571 |
| 836 | nmdc:mga06r32_633_c1 | 3300050510 | Bacteria | 30525 |
| 837 | nmdc:mga06r32_69344_c1 | 3300050510 | Bacteria | 3407 |
| 838 | nmdc:mga06r32_75407_c1 | 3300050510 | Bacteria | 3273 |
| 839 | nmdc:mga08y16_13643_c1 | 3300050511 | Bacteria | 8555 |
| 840 | nmdc:mga08y16_184751_c1 | 3300050511 | Bacteria | 2164 |
| 841 | nmdc:mga08y16_1952_c1 | 3300050511 | Bacteria | 21031 |
| 842 | nmdc:mga08y16_222349_c1 | 3300050511 | Bacteria | 1954 |
| 843 | nmdc:mga08y16_252_c1 | 3300050511 | Bacteria | 48080 |
| 844 | nmdc:mga08y16_348710_c1 | 3300050511 | Bacteria | 1521 |
| 845 | nmdc:mga08y16_35210_c1 | 3300050511 | Bacteria | 5259 |
| 846 | nmdc:mga08y16_372490_c1 | 3300050511 | Unclassified | 1465 |
| 847 | nmdc:mga08y16_51576_c1 | 3300050511 | Bacteria | 4304 |
| 848 | nmdc:mga08y16_540591_c1 | 3300050511 | Bacteria | 1180 |
| 849 | nmdc:mga0n895_104233_c1 | 3300050512 | Bacteria | 2849 |
| 850 | nmdc:mga0n895_14949_c1 | 3300050512 | Bacteria | 7071 |
| 851 | nmdc:mga0n895_17822_c1 | 3300050512 | Bacteria | 6557 |
| 852 | nmdc:mga0n895_22123_c1 | 3300050512 | Bacteria | 5958 |
| 853 | nmdc:mga0n895_238676_c1 | 3300050512 | Bacteria | 1844 |
| 854 | nmdc:mga0n895_246253_c1 | 3300050512 | Bacteria | 1814 |
| 855 | nmdc:mga0n895_24907_c1 | 3300050512 | Bacteria | 5647 |
| 856 | nmdc:mga0n895_272681_c1 | 3300050512 | Bacteria | 1716 |
| 857 | nmdc:mga0n895_3667_c1 | 3300050512 | Bacteria | 12407 |
| 858 | nmdc:mga0n895_410898_c1 | 3300050512 | Unclassified | 1368 |
| 859 | nmdc:mga0n895_6563_c1 | 3300050512 | Bacteria | 9903 |
| 860 | nmdc:mga0n895_81790_c1 | 3300050512 | Bacteria | 3219 |
| 861 | nmdc:mga0n895_99145_c1 | 3300050512 | Bacteria | 2921 |
| 862 | nmdc:mga0rr50_102045_c1 | 3300050513 | Bacteria | 2256 |
| 863 | nmdc:mga0rr50_13494_c1 | 3300050513 | Bacteria | 5321 |
| 864 | nmdc:mga0rr50_185420_c1 | 3300050513 | Bacteria | 1703 |
| 865 | nmdc:mga0rr50_341742_c1 | 3300050513 | Bacteria | 1258 |
| 866 | nmdc:mga0rr50_5513_c1 | 3300050513 | Bacteria | 7560 |
| 867 | nmdc:mga0rr50_9196_c1 | 3300050513 | Bacteria | 6196 |
| 868 | nmdc:mga08x19_14900_c1 | 3300050514 | Bacteria | 4722 |
| 869 | nmdc:mga08x19_1627_c1 | 3300050514 | Bacteria | 13903 |
| 870 | nmdc:mga08x19_190933_c1 | 3300050514 | Bacteria | 1401 |
| 871 | nmdc:mga08x19_38095_c1 | 3300050514 | Bacteria | 3053 |
| 872 | nmdc:mga08x19_512_c1 | 3300050514 | Bacteria | 25768 |
| 873 | nmdc:mga0a205_105647_c1 | 3300050515 | Bacteria | 2715 |
| 874 | nmdc:mga0a205_106128_c1 | 3300050515 | Bacteria | 2707 |
| 875 | nmdc:mga0a205_1869_c1 | 3300050515 | Bacteria | 18245 |
| 876 | nmdc:mga0a205_193951_c1 | 3300050515 | Bacteria | 1923 |
| 877 | nmdc:mga0a205_207862_c1 | 3300050515 | Bacteria | 1846 |
| 878 | nmdc:mga0a205_2135_c1 | 3300050515 | Bacteria | 17365 |
| 879 | nmdc:mga0a205_269_c1 | 3300050515 | Bacteria | 37657 |
| 880 | nmdc:mga0a205_32206_c1 | 3300050515 | Bacteria | 1774 |
| 881 | nmdc:mga0a205_3306_c1 | 3300050515 | Bacteria | 14349 |
| 882 | nmdc:mga0a205_364835_c1 | 3300050515 | Bacteria | 1311 |
| 883 | nmdc:mga0a205_41062_c1 | 3300050515 | Bacteria | 4455 |
| 884 | nmdc:mga0a205_54054_c1 | 3300050515 | Bacteria | 3877 |
| 885 | nmdc:mga0a205_64096_c1 | 3300050515 | Bacteria | 3549 |
| 886 | nmdc:mga0a205_6420_c1 | 3300050515 | Bacteria | 10627 |
| 887 | nmdc:mga0a205_78957_c1 | 3300050515 | Bacteria | 3180 |
| 888 | Ga0495601_0005899 | 3300053077 | Bacteria | 7141 |
| 889 | Ga0495601_0067041 | 3300053077 | Bacteria | 2286 |
| 890 | Ga0495612_0001163 | 3300053078 | Bacteria | 10814 |
| 891 | Ga0495612_0122115 | 3300053078 | Bacteria | 1121 |
| 892 | Ga0495595_0036278 | 3300053084 | Bacteria | 2236 |
| 893 | Ga0495595_0041733 | 3300053084 | Bacteria | 2100 |
| 894 | Ga0495595_0097612 | 3300053084 | Bacteria | 1415 |
| 895 | Ga0495619_0056155 | 3300053085 | Bacteria | 2609 |
| 896 | Ga0495619_0100927 | 3300053085 | Bacteria | 1964 |
| 897 | Ga0500644_0018660 | 3300053088 | Bacteria | 2036 |
| 898 | Ga0500636_0151724 | 3300053177 | Bacteria | 1272 |
| 899 | Ga0501084_0001227 | 3300054114 | Bacteria | 20192 |
| 900 | Ga0501084_0138286 | 3300054114 | Bacteria | 2050 |
| 901 | Ga0501082_0000512 | 3300060353 | Bacteria | 34419 |
| 902 | Ga0501082_0005149 | 3300060353 | Bacteria | 11382 |
| 903 | Ga0466962_0020771 | 3300061719 | Bacteria | 3156 |
| 904 | Ga0530510_0016829 | 3300061734 | Bacteria | 5178 |
| 905 | Ga0530510_0089864 | 3300061734 | Bacteria | 2240 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035170 | Ga0373943_0199547 | Ga0373943_0199547_262_1095 | 265 |
| 2 | 3300005445 | Ga0070708_100038506 | Ga0070708_1000385063 | 266 |
| 3 | 3300009094 | Ga0111539_10057849 | Ga0111539_100578492 | 267 |
| 4 | 3300009147 | Ga0114129_10409785 | Ga0114129_104097852 | 267 |
| 5 | 3300050507 | nmdc:mga05p37_12107_c1 | nmdc:mga05p37_12107_c1_8392_9276 | 267 |
| 6 | 3300050511 | nmdc:mga08y16_372490_c1 | nmdc:mga08y16_372490_c1_269_1153 | 267 |
| 7 | 3300050515 | nmdc:mga0a205_364835_c1 | nmdc:mga0a205_364835_c1_86_970 | 267 |
| 8 | 3300005468 | Ga0070707_100162857 | Ga0070707_1001628572 | 268 |
| 9 | 3300028573 | Ga0265334_10040586 | Ga0265334_100405862 | 268 |
| 10 | 3300048916 | Ga0496113_0032907 | Ga0496113_0032907_2932_3759 | 268 |
| 11 | 3300027671 | Ga0209588_1005624 | Ga0209588_10056244 | 269 |
| 12 | 3300026116 | Ga0207674_10012224 | Ga0207674_100122247 | 270 |
| 13 | 3300005364 | Ga0070673_100356231 | Ga0070673_1003562312 | 272 |
| 14 | 3300021377 | Ga0213874_10022030 | Ga0213874_100220302 | 272 |
| 15 | 3300039437 | Ga0436365_0262673 | Ga0436365_0262673_104_1039 | 272 |
| 16 | 3300039450 | Ga0436363_1461858 | Ga0436363_1461858_1307_2242 | 272 |
| 17 | 3300050507 | nmdc:mga05p37_58251_c1 | nmdc:mga05p37_58251_c1_2910_3773 | 272 |
| 18 | 3300050508 | nmdc:mga09592_56141_c1 | nmdc:mga09592_56141_c1_1480_2343 | 272 |
| 19 | 3300050509 | nmdc:mga0qj67_35029_c1 | nmdc:mga0qj67_35029_c1_688_1551 | 272 |
| 20 | 3300050510 | nmdc:mga06r32_26507_c1 | nmdc:mga06r32_26507_c1_2374_3237 | 272 |
| 21 | 3300005445 | Ga0070708_100329456 | Ga0070708_1003294562 | 274 |
| 22 | 3300005468 | Ga0070707_100024463 | Ga0070707_1000244634 | 274 |
| 23 | 3300005471 | Ga0070698_100080100 | Ga0070698_1000801002 | 274 |
| 24 | 3300006028 | Ga0070717_10318894 | Ga0070717_103188942 | 274 |
| 25 | 3300025922 | Ga0207646_10014019 | Ga0207646_100140198 | 275 |
| 26 | 3300005434 | Ga0070709_10003361 | Ga0070709_100033613 | 276 |
| 27 | 3300005436 | Ga0070713_100008252 | Ga0070713_1000082527 | 276 |
| 28 | 3300005437 | Ga0070710_10005213 | Ga0070710_100052135 | 276 |
| 29 | 3300007788 | Ga0099795_10008622 | Ga0099795_100086222 | 276 |
| 30 | 3300010159 | Ga0099796_10000792 | Ga0099796_100007922 | 276 |
| 31 | 3300025898 | Ga0207692_10007559 | Ga0207692_100075593 | 276 |
| 32 | 3300025906 | Ga0207699_10005400 | Ga0207699_100054004 | 276 |
| 33 | 3300025921 | Ga0207652_10201467 | Ga0207652_102014672 | 276 |
| 34 | 3300025928 | Ga0207700_10018539 | Ga0207700_100185393 | 276 |
| 35 | 3300025929 | Ga0207664_10006892 | Ga0207664_100068924 | 276 |
| 36 | 3300035241 | Ga0373961_0072141 | Ga0373961_0072141_78_908 | 276 |
| 37 | 3300035692 | Ga0373935_0071529 | Ga0373935_0071529_689_1627 | 276 |
| 38 | 3300035695 | Ga0373927_0072278 | Ga0373927_0072278_1051_1989 | 276 |
| 39 | 3300037068 | Ga0373925_0509127 | Ga0373925_0509127_13_951 | 276 |
| 40 | 3300037853 | Ga0436364_0352307 | Ga0436364_0352307_44_874 | 276 |
| 41 | 3300039450 | Ga0436363_1362005 | Ga0436363_1362005_22_852 | 276 |
| 42 | 3300044673 | Ga0453683_0091398 | Ga0453683_0091398_990_1820 | 276 |
| 43 | 3300050509 | nmdc:mga0qj67_313531_c1 | nmdc:mga0qj67_313531_c1_21_851 | 276 |
| 44 | 3300009094 | Ga0111539_10002621 | Ga0111539_1000262116 | 277 |
| 45 | 3300039438 | Ga0436360_0427393 | Ga0436360_0427393_936_1874 | 277 |
| 46 | 3300050509 | nmdc:mga0qj67_30012_c1 | nmdc:mga0qj67_30012_c1_3374_4207 | 277 |
| 47 | 3300053088 | Ga0500644_0018660 | Ga0500644_0018660_519_1391 | 278 |
| 48 | 3300005293 | Ga0065715_10096737 | Ga0065715_100967373 | 280 |
| 49 | 3300005328 | Ga0070676_10024086 | Ga0070676_100240864 | 280 |
| 50 | 3300005331 | Ga0070670_100000678 | Ga0070670_10000067831 | 280 |
| 51 | 3300005336 | Ga0070680_100001152 | Ga0070680_1000011525 | 280 |
| 52 | 3300005337 | Ga0070682_100002090 | Ga0070682_1000020905 | 280 |
| 53 | 3300005339 | Ga0070660_100001587 | Ga0070660_1000015875 | 280 |
| 54 | 3300005344 | Ga0070661_100002632 | Ga0070661_1000026327 | 280 |
| 55 | 3300005366 | Ga0070659_100003091 | Ga0070659_1000030912 | 280 |
| 56 | 3300005406 | Ga0070703_10020720 | Ga0070703_100207202 | 280 |
| 57 | 3300005440 | Ga0070705_100002566 | Ga0070705_10000256611 | 280 |
| 58 | 3300005444 | Ga0070694_100001010 | Ga0070694_10000101010 | 280 |
| 59 | 3300005455 | Ga0070663_100001727 | Ga0070663_10000172712 | 280 |
| 60 | 3300005457 | Ga0070662_100014904 | Ga0070662_1000149045 | 280 |
| 61 | 3300005459 | Ga0068867_100020324 | Ga0068867_1000203241 | 280 |
| 62 | 3300005530 | Ga0070679_100010038 | Ga0070679_1000100382 | 280 |
| 63 | 3300005535 | Ga0070684_100024412 | Ga0070684_1000244121 | 280 |
| 64 | 3300005545 | Ga0070695_100009327 | Ga0070695_1000093275 | 280 |
| 65 | 3300005546 | Ga0070696_100003863 | Ga0070696_1000038632 | 280 |
| 66 | 3300005547 | Ga0070693_100017613 | Ga0070693_1000176132 | 280 |
| 67 | 3300005563 | Ga0068855_100001585 | Ga0068855_10000158522 | 280 |
| 68 | 3300005577 | Ga0068857_100140670 | Ga0068857_1001406702 | 280 |
| 69 | 3300005578 | Ga0068854_100003455 | Ga0068854_10000345511 | 280 |
| 70 | 3300005614 | Ga0068856_100004059 | Ga0068856_1000040595 | 280 |
| 71 | 3300005615 | Ga0070702_100309864 | Ga0070702_1003098641 | 280 |
| 72 | 3300005617 | Ga0068859_100009042 | Ga0068859_10000904210 | 280 |
| 73 | 3300005618 | Ga0068864_100001941 | Ga0068864_1000019416 | 280 |
| 74 | 3300005840 | Ga0068870_10005871 | Ga0068870_100058712 | 280 |
| 75 | 3300005841 | Ga0068863_100004989 | Ga0068863_1000049899 | 280 |
| 76 | 3300005842 | Ga0068858_100147848 | Ga0068858_1001478482 | 280 |
| 77 | 3300005843 | Ga0068860_100018586 | Ga0068860_1000185863 | 280 |
| 78 | 3300005844 | Ga0068862_100005118 | Ga0068862_10000511812 | 280 |
| 79 | 3300005844 | Ga0068862_100057949 | Ga0068862_1000579492 | 280 |
| 80 | 3300006852 | Ga0075433_10007957 | Ga0075433_100079576 | 280 |
| 81 | 3300006871 | Ga0075434_100285706 | Ga0075434_1002857062 | 280 |
| 82 | 3300006931 | Ga0097620_100009043 | Ga0097620_10000904310 | 280 |
| 83 | 3300007076 | Ga0075435_100215257 | Ga0075435_1002152572 | 280 |
| 84 | 3300009174 | Ga0105241_10002609 | Ga0105241_1000260910 | 280 |
| 85 | 3300009177 | Ga0105248_10101693 | Ga0105248_101016932 | 280 |
| 86 | 3300009551 | Ga0105238_10496295 | Ga0105238_104962952 | 280 |
| 87 | 3300010375 | Ga0105239_10711132 | Ga0105239_107111321 | 280 |
| 88 | 3300013100 | Ga0157373_10007390 | Ga0157373_100073904 | 280 |
| 89 | 3300013102 | Ga0157371_10036655 | Ga0157371_100366553 | 280 |
| 90 | 3300013105 | Ga0157369_10008310 | Ga0157369_100083109 | 280 |
| 91 | 3300013297 | Ga0157378_10315604 | Ga0157378_103156042 | 280 |
| 92 | 3300013307 | Ga0157372_10000347 | Ga0157372_1000034746 | 280 |
| 93 | 3300025901 | Ga0207688_10007589 | Ga0207688_100075893 | 280 |
| 94 | 3300025907 | Ga0207645_10017408 | Ga0207645_100174082 | 280 |
| 95 | 3300025908 | Ga0207643_10001080 | Ga0207643_100010806 | 280 |
| 96 | 3300025911 | Ga0207654_10004145 | Ga0207654_100041459 | 280 |
| 97 | 3300025912 | Ga0207707_10005225 | Ga0207707_100052259 | 280 |
| 98 | 3300025917 | Ga0207660_10005541 | Ga0207660_1000554111 | 280 |
| 99 | 3300025919 | Ga0207657_10000925 | Ga0207657_100009255 | 280 |
| 100 | 3300025921 | Ga0207652_10003752 | Ga0207652_100037528 | 280 |
| 101 | 3300025922 | Ga0207646_10092888 | Ga0207646_100928882 | 280 |
| 102 | 3300025925 | Ga0207650_10006688 | Ga0207650_100066882 | 280 |
| 103 | 3300025932 | Ga0207690_10003419 | Ga0207690_1000341911 | 280 |
| 104 | 3300025936 | Ga0207670_10103072 | Ga0207670_101030721 | 280 |
| 105 | 3300025940 | Ga0207691_10120801 | Ga0207691_101208012 | 280 |
| 106 | 3300025942 | Ga0207689_10000250 | Ga0207689_1000025012 | 280 |
| 107 | 3300025945 | Ga0207679_10003431 | Ga0207679_1000343111 | 280 |
| 108 | 3300025949 | Ga0207667_10001657 | Ga0207667_1000165712 | 280 |
| 109 | 3300025981 | Ga0207640_10000925 | Ga0207640_1000092514 | 280 |
| 110 | 3300026041 | Ga0207639_10005303 | Ga0207639_100053036 | 280 |
| 111 | 3300026067 | Ga0207678_10002573 | Ga0207678_100025738 | 280 |
| 112 | 3300026078 | Ga0207702_10000979 | Ga0207702_1000097926 | 280 |
| 113 | 3300026089 | Ga0207648_10005180 | Ga0207648_100051809 | 280 |
| 114 | 3300026116 | Ga0207674_10004434 | Ga0207674_1000443414 | 280 |
| 115 | 3300028380 | Ga0268265_10006724 | Ga0268265_100067249 | 280 |
| 116 | 3300035090 | Ga0373949_0004095 | Ga0373949_0004095_24_971 | 280 |
| 117 | 3300035121 | Ga0373960_0032362 | Ga0373960_0032362_64_1011 | 280 |
| 118 | 3300035691 | Ga0373931_0057570 | Ga0373931_0057570_525_1472 | 280 |
| 119 | 3300042005 | Ga0439448_0001996 | Ga0439448_0001996_2466_3413 | 280 |
| 120 | 3300042438 | Ga0439459_0005954 | Ga0439459_0005954_252_1199 | 280 |
| 121 | 3300044712 | Ga0453684_0306855 | Ga0453684_0306855_369_1316 | 280 |
| 122 | 3300048909 | Ga0496106_0180393 | Ga0496106_0180393_62_1009 | 280 |
| 123 | 3300050512 | nmdc:mga0n895_81790_c1 | nmdc:mga0n895_81790_c1_846_1793 | 280 |
| 124 | 3300050515 | nmdc:mga0a205_105647_c1 | nmdc:mga0a205_105647_c1_1162_2109 | 280 |
| 125 | 3300005444 | Ga0070694_100026288 | Ga0070694_1000262882 | 281 |
| 126 | 3300005547 | Ga0070693_100002188 | Ga0070693_1000021889 | 281 |
| 127 | 3300025907 | Ga0207645_10071122 | Ga0207645_100711222 | 281 |
| 128 | 3300025935 | Ga0207709_10115734 | Ga0207709_101157342 | 281 |
| 129 | 3300025942 | Ga0207689_10023888 | Ga0207689_100238884 | 281 |
| 130 | 3300025961 | Ga0207712_10094433 | Ga0207712_100944332 | 281 |
| 131 | 3300026089 | Ga0207648_10030847 | Ga0207648_100308474 | 281 |
| 132 | 3300028380 | Ga0268265_10074090 | Ga0268265_100740901 | 281 |
| 133 | 3300046459 | Ga0495629_0309345 | Ga0495629_0309345_226_1071 | 281 |
| 134 | 3300005334 | Ga0068869_100012374 | Ga0068869_1000123745 | 282 |
| 135 | 3300005334 | Ga0068869_100386091 | Ga0068869_1003860911 | 282 |
| 136 | 3300005365 | Ga0070688_100025917 | Ga0070688_1000259173 | 282 |
| 137 | 3300005406 | Ga0070703_10075326 | Ga0070703_100753261 | 282 |
| 138 | 3300005436 | Ga0070713_100205911 | Ga0070713_1002059112 | 282 |
| 139 | 3300005438 | Ga0070701_10007287 | Ga0070701_100072872 | 282 |
| 140 | 3300005440 | Ga0070705_100145868 | Ga0070705_1001458682 | 282 |
| 141 | 3300005444 | Ga0070694_100051125 | Ga0070694_1000511252 | 282 |
| 142 | 3300005444 | Ga0070694_100074285 | Ga0070694_1000742852 | 282 |
| 143 | 3300005444 | Ga0070694_100213079 | Ga0070694_1002130792 | 282 |
| 144 | 3300005544 | Ga0070686_100175496 | Ga0070686_1001754962 | 282 |
| 145 | 3300005545 | Ga0070695_100006099 | Ga0070695_1000060992 | 282 |
| 146 | 3300005545 | Ga0070695_100017320 | Ga0070695_1000173202 | 282 |
| 147 | 3300005549 | Ga0070704_100195380 | Ga0070704_1001953802 | 282 |
| 148 | 3300005617 | Ga0068859_100026660 | Ga0068859_1000266603 | 282 |
| 149 | 3300005843 | Ga0068860_100082542 | Ga0068860_1000825423 | 282 |
| 150 | 3300005844 | Ga0068862_100096600 | Ga0068862_1000966002 | 282 |
| 151 | 3300005844 | Ga0068862_100196793 | Ga0068862_1001967932 | 282 |
| 152 | 3300006173 | Ga0070716_100056844 | Ga0070716_1000568442 | 282 |
| 153 | 3300006852 | Ga0075433_10000967 | Ga0075433_1000096719 | 282 |
| 154 | 3300006931 | Ga0097620_100026660 | Ga0097620_1000266603 | 282 |
| 155 | 3300009147 | Ga0114129_10372182 | Ga0114129_103721822 | 282 |
| 156 | 3300009147 | Ga0114129_10861665 | Ga0114129_108616651 | 282 |
| 157 | 3300009176 | Ga0105242_10213692 | Ga0105242_102136922 | 282 |
| 158 | 3300009553 | Ga0105249_10027079 | Ga0105249_100270793 | 282 |
| 159 | 3300009553 | Ga0105249_10055271 | Ga0105249_100552714 | 282 |
| 160 | 3300009553 | Ga0105249_10168434 | Ga0105249_101684342 | 282 |
| 161 | 3300025885 | Ga0207653_10010824 | Ga0207653_100108242 | 282 |
| 162 | 3300025918 | Ga0207662_10038478 | Ga0207662_100384783 | 282 |
| 163 | 3300025922 | Ga0207646_10166782 | Ga0207646_101667821 | 282 |
| 164 | 3300025927 | Ga0207687_10454049 | Ga0207687_104540491 | 282 |
| 165 | 3300025928 | Ga0207700_10166466 | Ga0207700_101664661 | 282 |
| 166 | 3300025929 | Ga0207664_10260823 | Ga0207664_102608232 | 282 |
| 167 | 3300025939 | Ga0207665_10003072 | Ga0207665_100030722 | 282 |
| 168 | 3300025942 | Ga0207689_10012034 | Ga0207689_100120347 | 282 |
| 169 | 3300025942 | Ga0207689_10086631 | Ga0207689_100866312 | 282 |
| 170 | 3300025961 | Ga0207712_10066220 | Ga0207712_100662202 | 282 |
| 171 | 3300026075 | Ga0207708_10038721 | Ga0207708_100387213 | 282 |
| 172 | 3300026075 | Ga0207708_10054625 | Ga0207708_100546252 | 282 |
| 173 | 3300026089 | Ga0207648_10155324 | Ga0207648_101553242 | 282 |
| 174 | 3300026116 | Ga0207674_10256786 | Ga0207674_102567862 | 282 |
| 175 | 3300028380 | Ga0268265_10023027 | Ga0268265_100230272 | 282 |
| 176 | 3300028380 | Ga0268265_10079504 | Ga0268265_100795043 | 282 |
| 177 | 3300031852 | Ga0307410_10038103 | Ga0307410_100381034 | 282 |
| 178 | 3300031903 | Ga0307407_10213031 | Ga0307407_102130312 | 282 |
| 179 | 3300031995 | Ga0307409_100442934 | Ga0307409_1004429342 | 282 |
| 180 | 3300039437 | Ga0436365_0646666 | Ga0436365_0646666_242_1183 | 282 |
| 181 | 3300039453 | Ga0436362_0355831 | Ga0436362_0355831_3473_4414 | 282 |
| 182 | 3300042461 | Ga0439460_0002041 | Ga0439460_0002041_1838_2785 | 282 |
| 183 | 3300044673 | Ga0453683_0008311 | Ga0453683_0008311_6022_6954 | 282 |
| 184 | 3300045051 | Ga0451576_0008007 | Ga0451576_0008007_6490_7437 | 282 |
| 185 | 3300050507 | nmdc:mga05p37_31506_c1 | nmdc:mga05p37_31506_c1_1922_2869 | 282 |
| 186 | 3300050507 | nmdc:mga05p37_676558_c1 | nmdc:mga05p37_676558_c1_47_979 | 282 |
| 187 | 3300050512 | nmdc:mga0n895_17822_c1 | nmdc:mga0n895_17822_c1_719_1666 | 282 |
| 188 | 3300050513 | nmdc:mga0rr50_9196_c1 | nmdc:mga0rr50_9196_c1_4764_5711 | 282 |
| 189 | 3300050514 | nmdc:mga08x19_1627_c1 | nmdc:mga08x19_1627_c1_174_1121 | 282 |
| 190 | 3300050515 | nmdc:mga0a205_1869_c1 | nmdc:mga0a205_1869_c1_8635_9582 | 282 |
| 191 | 3300005444 | Ga0070694_100103267 | Ga0070694_1001032672 | 285 |
| 192 | 3300005467 | Ga0070706_100082686 | Ga0070706_1000826863 | 285 |
| 193 | 3300005445 | Ga0070708_100230410 | Ga0070708_1002304102 | 286 |
| 194 | 3300005467 | Ga0070706_100191269 | Ga0070706_1001912692 | 286 |
| 195 | 3300005471 | Ga0070698_100003260 | Ga0070698_1000032606 | 286 |
| 196 | 3300005536 | Ga0070697_100094201 | Ga0070697_1000942013 | 286 |
| 197 | 3300006028 | Ga0070717_10000240 | Ga0070717_1000024031 | 286 |
| 198 | 3300046691 | Ga0495670_0238481 | Ga0495670_0238481_85_945 | 286 |
| 199 | 3300006847 | Ga0075431_100001751 | Ga0075431_10000175114 | 288 |
| 200 | 3300006880 | Ga0075429_100000710 | Ga0075429_10000071014 | 288 |
| 201 | 3300009093 | Ga0105240_10282127 | Ga0105240_102821272 | 288 |
| 202 | 3300009147 | Ga0114129_10028618 | Ga0114129_100286184 | 288 |
| 203 | 3300009551 | Ga0105238_10377872 | Ga0105238_103778722 | 288 |
| 204 | 3300025913 | Ga0207695_10159114 | Ga0207695_101591142 | 288 |
| 205 | 3300025913 | Ga0207695_10287550 | Ga0207695_102875502 | 288 |
| 206 | 3300025917 | Ga0207660_10104627 | Ga0207660_101046272 | 288 |
| 207 | 3300025924 | Ga0207694_10093774 | Ga0207694_100937742 | 288 |
| 208 | 3300025944 | Ga0207661_10009379 | Ga0207661_100093793 | 288 |
| 209 | 3300027682 | Ga0209971_1007671 | Ga0209971_10076712 | 288 |
| 210 | 3300027876 | Ga0209974_10022881 | Ga0209974_100228812 | 288 |
| 211 | 3300037466 | Ga0395898_0124898 | Ga0395898_0124898_615_1481 | 288 |
| 212 | 3300046543 | Ga0495645_0008413 | Ga0495645_0008413_10_876 | 288 |
| 213 | 3300049580 | Ga0501046_0121250 | Ga0501046_0121250_797_1663 | 288 |
| 214 | 3300049586 | Ga0501070_0013607 | Ga0501070_0013607_1577_2443 | 288 |
| 215 | 3300049589 | Ga0501073_0077732 | Ga0501073_0077732_648_1514 | 288 |
| 216 | 3300049590 | Ga0501074_0117798 | Ga0501074_0117798_80_946 | 288 |
| 217 | 3300049742 | Ga0501080_0059104 | Ga0501080_0059104_1745_2611 | 288 |
| 218 | 3300050507 | nmdc:mga05p37_98210_c1 | nmdc:mga05p37_98210_c1_1241_2188 | 288 |
| 219 | 3300050508 | nmdc:mga09592_3205_c1 | nmdc:mga09592_3205_c1_2203_3150 | 288 |
| 220 | 3300050509 | nmdc:mga0qj67_23809_c1 | nmdc:mga0qj67_23809_c1_2501_3448 | 288 |
| 221 | 3300050510 | nmdc:mga06r32_63091_c1 | nmdc:mga06r32_63091_c1_1764_2711 | 288 |
| 222 | 3300053077 | Ga0495601_0067041 | Ga0495601_0067041_715_1581 | 288 |
| 223 | 3300061719 | Ga0466962_0020771 | Ga0466962_0020771_323_1189 | 288 |
| 224 | 3300005458 | Ga0070681_10030359 | Ga0070681_100303593 | 289 |
| 225 | 3300006871 | Ga0075434_100166986 | Ga0075434_1001669862 | 289 |
| 226 | 3300009147 | Ga0114129_10040648 | Ga0114129_100406483 | 289 |
| 227 | 3300025912 | Ga0207707_10022196 | Ga0207707_100221963 | 289 |
| 228 | 3300050507 | nmdc:mga05p37_56142_c1 | nmdc:mga05p37_56142_c1_2523_3470 | 289 |
| 229 | 3300048915 | Ga0496112_0073214 | Ga0496112_0073214_15_887 | 290 |
| 230 | 3300003349 | JGI26129J50193_1001876 | JGI26129J50193_10018762 | 291 |
| 231 | 3300005545 | Ga0070695_100001392 | Ga0070695_10000139214 | 291 |
| 232 | 3300006846 | Ga0075430_100050849 | Ga0075430_1000508493 | 291 |
| 233 | 3300007076 | Ga0075435_100091710 | Ga0075435_1000917102 | 291 |
| 234 | 3300009094 | Ga0111539_10193423 | Ga0111539_101934232 | 291 |
| 235 | 3300009147 | Ga0114129_10124874 | Ga0114129_101248742 | 291 |
| 236 | 3300009553 | Ga0105249_10275699 | Ga0105249_102756992 | 291 |
| 237 | 3300009553 | Ga0105249_10570728 | Ga0105249_105707281 | 291 |
| 238 | 3300013307 | Ga0157372_10076210 | Ga0157372_100762102 | 291 |
| 239 | 3300025933 | Ga0207706_10045887 | Ga0207706_100458874 | 291 |
| 240 | 3300027378 | Ga0209981_1004630 | Ga0209981_10046302 | 291 |
| 241 | 3300027665 | Ga0209983_1000711 | Ga0209983_10007112 | 291 |
| 242 | 3300027682 | Ga0209971_1000008 | Ga0209971_100000845 | 291 |
| 243 | 3300027717 | Ga0209998_10000016 | Ga0209998_1000001657 | 291 |
| 244 | 3300027876 | Ga0209974_10000073 | Ga0209974_100000733 | 291 |
| 245 | 3300039450 | Ga0436363_0412808 | Ga0436363_0412808_243_1133 | 291 |
| 246 | 3300049574 | Ga0501038_0179810 | Ga0501038_0179810_739_1686 | 291 |
| 247 | 3300049575 | Ga0501039_0016008 | Ga0501039_0016008_1884_2831 | 291 |
| 248 | 3300049576 | Ga0501040_0015905 | Ga0501040_0015905_105_1052 | 291 |
| 249 | 3300049578 | Ga0501042_0006201 | Ga0501042_0006201_431_1378 | 291 |
| 250 | 3300049580 | Ga0501046_0000295 | Ga0501046_0000295_8719_9666 | 291 |
| 251 | 3300049590 | Ga0501074_0006949 | Ga0501074_0006949_4348_5295 | 291 |
| 252 | 3300049741 | Ga0501079_0000617 | Ga0501079_0000617_6397_7344 | 291 |
| 253 | 3300049743 | Ga0501081_0011693 | Ga0501081_0011693_3827_4774 | 291 |
| 254 | 3300049824 | Ga0501045_0000318 | Ga0501045_0000318_22030_22977 | 291 |
| 255 | 3300050507 | nmdc:mga05p37_40434_c1 | nmdc:mga05p37_40434_c1_2969_3847 | 291 |
| 256 | 3300050508 | nmdc:mga09592_1636_c1 | nmdc:mga09592_1636_c1_2118_2996 | 291 |
| 257 | 3300050509 | nmdc:mga0qj67_13398_c1 | nmdc:mga0qj67_13398_c1_3371_4249 | 291 |
| 258 | 3300050510 | nmdc:mga06r32_16890_c1 | nmdc:mga06r32_16890_c1_2593_3471 | 291 |
| 259 | 3300050511 | nmdc:mga08y16_51576_c1 | nmdc:mga08y16_51576_c1_3183_4061 | 291 |
| 260 | 3300050513 | nmdc:mga0rr50_102045_c1 | nmdc:mga0rr50_102045_c1_378_1256 | 291 |
| 261 | 3300050515 | nmdc:mga0a205_41062_c1 | nmdc:mga0a205_41062_c1_1801_2679 | 291 |
| 262 | 3300053078 | Ga0495612_0122115 | Ga0495612_0122115_82_975 | 291 |
| 263 | 3300054114 | Ga0501084_0001227 | Ga0501084_0001227_15024_15971 | 291 |
| 264 | 3300060353 | Ga0501082_0000512 | Ga0501082_0000512_16591_17538 | 291 |
| 265 | 3300005458 | Ga0070681_10323844 | Ga0070681_103238442 | 292 |
| 266 | 3300006847 | Ga0075431_100012318 | Ga0075431_1000123184 | 292 |
| 267 | 3300044673 | Ga0453683_0019448 | Ga0453683_0019448_826_1764 | 292 |
| 268 | 3300050507 | nmdc:mga05p37_125061_c1 | nmdc:mga05p37_125061_c1_810_1754 | 292 |
| 269 | 3300005536 | Ga0070697_100134407 | Ga0070697_1001344072 | 293 |
| 270 | 3300006852 | Ga0075433_10387788 | Ga0075433_103877881 | 293 |
| 271 | 3300015262 | Ga0182007_10020576 | Ga0182007_100205762 | 293 |
| 272 | 3300050512 | nmdc:mga0n895_238676_c1 | nmdc:mga0n895_238676_c1_108_1055 | 293 |
| 273 | 3300050512 | nmdc:mga0n895_410898_c1 | nmdc:mga0n895_410898_c1_304_1203 | 293 |
| 274 | 3300005439 | Ga0070711_100002104 | Ga0070711_1000021048 | 294 |
| 275 | 3300005518 | Ga0070699_100190973 | Ga0070699_1001909732 | 294 |
| 276 | 3300005985 | Ga0081539_10004618 | Ga0081539_100046186 | 294 |
| 277 | 3300006175 | Ga0070712_100006939 | Ga0070712_1000069394 | 294 |
| 278 | 3300009147 | Ga0114129_10198809 | Ga0114129_101988092 | 294 |
| 279 | 3300014325 | Ga0163163_10442207 | Ga0163163_104422072 | 294 |
| 280 | 3300025910 | Ga0207684_10386659 | Ga0207684_103866592 | 294 |
| 281 | 3300025915 | Ga0207693_10002453 | Ga0207693_1000245310 | 294 |
| 282 | 3300025922 | Ga0207646_10016781 | Ga0207646_100167812 | 294 |
| 283 | 3300003659 | JGI25404J52841_10004850 | JGI25404J52841_100048501 | 296 |
| 284 | 3300005445 | Ga0070708_100064817 | Ga0070708_1000648172 | 296 |
| 285 | 3300005471 | Ga0070698_100009511 | Ga0070698_1000095117 | 296 |
| 286 | 3300005518 | Ga0070699_100135005 | Ga0070699_1001350052 | 296 |
| 287 | 3300005536 | Ga0070697_100012030 | Ga0070697_1000120304 | 296 |
| 288 | 3300005983 | Ga0081540_1018677 | Ga0081540_10186774 | 296 |
| 289 | 3300006175 | Ga0070712_100002037 | Ga0070712_1000020379 | 296 |
| 290 | 3300009553 | Ga0105249_10102256 | Ga0105249_101022562 | 296 |
| 291 | 3300025910 | Ga0207684_10290272 | Ga0207684_102902722 | 296 |
| 292 | 3300025915 | Ga0207693_10007608 | Ga0207693_1000760812 | 296 |
| 293 | 3300026088 | Ga0207641_10038507 | Ga0207641_100385072 | 296 |
| 294 | 3300035088 | Ga0373940_0045048 | Ga0373940_0045048_64_1011 | 296 |
| 295 | 3300035114 | Ga0373939_0011648 | Ga0373939_0011648_62_1009 | 296 |
| 296 | 3300045051 | Ga0451576_0101787 | Ga0451576_0101787_1455_2402 | 296 |
| 297 | 3300046472 | Ga0495580_0004048 | Ga0495580_0004048_11346_12293 | 296 |
| 298 | 3300050512 | nmdc:mga0n895_104233_c1 | nmdc:mga0n895_104233_c1_604_1551 | 296 |
| 299 | 3300050515 | nmdc:mga0a205_78957_c1 | nmdc:mga0a205_78957_c1_1830_2777 | 296 |
| 300 | 3300013104 | Ga0157370_10016104 | Ga0157370_100161042 | 297 |
| 301 | 3300005295 | Ga0065707_10252752 | Ga0065707_102527521 | 298 |
| 302 | 3300005436 | Ga0070713_100224175 | Ga0070713_1002241752 | 298 |
| 303 | 3300005439 | Ga0070711_100121044 | Ga0070711_1001210442 | 298 |
| 304 | 3300005983 | Ga0081540_1034102 | Ga0081540_10341022 | 298 |
| 305 | 3300006847 | Ga0075431_100025473 | Ga0075431_1000254735 | 298 |
| 306 | 3300006847 | Ga0075431_100058943 | Ga0075431_1000589432 | 298 |
| 307 | 3300006852 | Ga0075433_10082758 | Ga0075433_100827582 | 298 |
| 308 | 3300006880 | Ga0075429_100039288 | Ga0075429_1000392883 | 298 |
| 309 | 3300009553 | Ga0105249_10212794 | Ga0105249_102127942 | 298 |
| 310 | 3300025916 | Ga0207663_10125523 | Ga0207663_101255232 | 298 |
| 311 | 3300025929 | Ga0207664_10042184 | Ga0207664_100421842 | 298 |
| 312 | 3300026078 | Ga0207702_10037160 | Ga0207702_100371602 | 298 |
| 313 | 3300037312 | Ga0395899_0030724 | Ga0395899_0030724_742_1674 | 298 |
| 314 | 3300037418 | Ga0395900_0268057 | Ga0395900_0268057_737_1690 | 298 |
| 315 | 3300037466 | Ga0395898_0021886 | Ga0395898_0021886_2253_3206 | 298 |
| 316 | 3300038443 | Ga0395901_0003897 | Ga0395901_0003897_12846_13778 | 298 |
| 317 | 3300048915 | Ga0496112_0024728 | Ga0496112_0024728_420_1358 | 298 |
| 318 | 3300050507 | nmdc:mga05p37_5780_c1 | nmdc:mga05p37_5780_c1_156_1052 | 298 |
| 319 | 3300050507 | nmdc:mga05p37_7199_c1 | nmdc:mga05p37_7199_c1_957_1862 | 298 |
| 320 | 3300050508 | nmdc:mga09592_168049_c1 | nmdc:mga09592_168049_c1_289_1185 | 298 |
| 321 | 3300050508 | nmdc:mga09592_17687_c1 | nmdc:mga09592_17687_c1_957_1862 | 298 |
| 322 | 3300050510 | nmdc:mga06r32_12541_c2 | nmdc:mga06r32_12541_c2_1084_1989 | 298 |
| 323 | 3300050512 | nmdc:mga0n895_24907_c1 | nmdc:mga0n895_24907_c1_4729_5625 | 298 |
| 324 | 3300050513 | nmdc:mga0rr50_5513_c1 | nmdc:mga0rr50_5513_c1_6489_7385 | 298 |
| 325 | 3300050514 | nmdc:mga08x19_14900_c1 | nmdc:mga08x19_14900_c1_2372_3310 | 298 |
| 326 | 3300050514 | nmdc:mga08x19_512_c1 | nmdc:mga08x19_512_c1_4202_5098 | 298 |
| 327 | 3300050515 | nmdc:mga0a205_106128_c1 | nmdc:mga0a205_106128_c1_818_1723 | 298 |
| 328 | 3300050515 | nmdc:mga0a205_207862_c1 | nmdc:mga0a205_207862_c1_851_1780 | 298 |
| 329 | 3300005467 | Ga0070706_100364414 | Ga0070706_1003644142 | 300 |
| 330 | 3300009148 | Ga0105243_10138448 | Ga0105243_101384482 | 300 |
| 331 | 3300025910 | Ga0207684_10127396 | Ga0207684_101273962 | 300 |
| 332 | 3300005435 | Ga0070714_100033768 | Ga0070714_1000337684 | 301 |
| 333 | 3300005436 | Ga0070713_100029448 | Ga0070713_1000294483 | 301 |
| 334 | 3300005437 | Ga0070710_10000739 | Ga0070710_100007394 | 301 |
| 335 | 3300005439 | Ga0070711_100001284 | Ga0070711_1000012844 | 301 |
| 336 | 3300006173 | Ga0070716_100030323 | Ga0070716_1000303233 | 301 |
| 337 | 3300025898 | Ga0207692_10002939 | Ga0207692_100029395 | 301 |
| 338 | 3300025906 | Ga0207699_10000184 | Ga0207699_100001847 | 301 |
| 339 | 3300025916 | Ga0207663_10006005 | Ga0207663_100060054 | 301 |
| 340 | 3300025928 | Ga0207700_10048004 | Ga0207700_100480043 | 301 |
| 341 | 3300025929 | Ga0207664_10004648 | Ga0207664_100046488 | 301 |
| 342 | 3300025939 | Ga0207665_10135072 | Ga0207665_101350722 | 301 |
| 343 | 3300031711 | Ga0265314_10001303 | Ga0265314_100013033 | 301 |
| 344 | 3300053177 | Ga0500636_0151724 | Ga0500636_0151724_274_1209 | 301 |
| 345 | 3300005340 | Ga0070689_100118493 | Ga0070689_1001184932 | 302 |
| 346 | 3300005345 | Ga0070692_10192900 | Ga0070692_101929001 | 302 |
| 347 | 3300005455 | Ga0070663_100346372 | Ga0070663_1003463722 | 302 |
| 348 | 3300005459 | Ga0068867_100424535 | Ga0068867_1004245351 | 302 |
| 349 | 3300005543 | Ga0070672_100130019 | Ga0070672_1001300192 | 302 |
| 350 | 3300005843 | Ga0068860_100286546 | Ga0068860_1002865462 | 302 |
| 351 | 3300006175 | Ga0070712_100036963 | Ga0070712_1000369632 | 302 |
| 352 | 3300006844 | Ga0075428_100012236 | Ga0075428_10001223611 | 302 |
| 353 | 3300009094 | Ga0111539_10001266 | Ga0111539_1000126635 | 302 |
| 354 | 3300009174 | Ga0105241_10068576 | Ga0105241_100685762 | 302 |
| 355 | 3300009553 | Ga0105249_10097034 | Ga0105249_100970341 | 302 |
| 356 | 3300011119 | Ga0105246_10509144 | Ga0105246_105091441 | 302 |
| 357 | 3300017792 | Ga0163161_10305754 | Ga0163161_103057541 | 302 |
| 358 | 3300025915 | Ga0207693_10021040 | Ga0207693_100210404 | 302 |
| 359 | 3300025940 | Ga0207691_10060852 | Ga0207691_100608522 | 302 |
| 360 | 3300027907 | Ga0207428_10008093 | Ga0207428_100080933 | 302 |
| 361 | 3300035691 | Ga0373931_0005096 | Ga0373931_0005096_3520_4446 | 302 |
| 362 | 3300035691 | Ga0373931_0107664 | Ga0373931_0107664_87_1016 | 302 |
| 363 | 3300048911 | Ga0496108_0088795 | Ga0496108_0088795_1528_2454 | 302 |
| 364 | 3300048915 | Ga0496112_0307729 | Ga0496112_0307729_566_1492 | 302 |
| 365 | 3300050492 | nmdc:mga0yw44_127385_c1 | nmdc:mga0yw44_127385_c1_489_1418 | 302 |
| 366 | 3300050511 | nmdc:mga08y16_35210_c1 | nmdc:mga08y16_35210_c1_516_1442 | 302 |
| 367 | 3300005295 | Ga0065707_10102712 | Ga0065707_101027121 | 303 |
| 368 | 3300005334 | Ga0068869_100143220 | Ga0068869_1001432202 | 303 |
| 369 | 3300005336 | Ga0070680_100318626 | Ga0070680_1003186262 | 303 |
| 370 | 3300005340 | Ga0070689_100106356 | Ga0070689_1001063561 | 303 |
| 371 | 3300005341 | Ga0070691_10081892 | Ga0070691_100818921 | 303 |
| 372 | 3300005435 | Ga0070714_100148132 | Ga0070714_1001481322 | 303 |
| 373 | 3300005440 | Ga0070705_100144254 | Ga0070705_1001442542 | 303 |
| 374 | 3300005441 | Ga0070700_100028698 | Ga0070700_1000286982 | 303 |
| 375 | 3300005444 | Ga0070694_100024660 | Ga0070694_1000246602 | 303 |
| 376 | 3300005444 | Ga0070694_100086335 | Ga0070694_1000863352 | 303 |
| 377 | 3300005445 | Ga0070708_100011602 | Ga0070708_1000116026 | 303 |
| 378 | 3300005445 | Ga0070708_100057912 | Ga0070708_1000579123 | 303 |
| 379 | 3300005445 | Ga0070708_100106276 | Ga0070708_1001062763 | 303 |
| 380 | 3300005445 | Ga0070708_100216182 | Ga0070708_1002161822 | 303 |
| 381 | 3300005457 | Ga0070662_100045195 | Ga0070662_1000451952 | 303 |
| 382 | 3300005457 | Ga0070662_100055559 | Ga0070662_1000555592 | 303 |
| 383 | 3300005459 | Ga0068867_100064865 | Ga0068867_1000648651 | 303 |
| 384 | 3300005467 | Ga0070706_100004042 | Ga0070706_1000040429 | 303 |
| 385 | 3300005467 | Ga0070706_100277066 | Ga0070706_1002770661 | 303 |
| 386 | 3300005468 | Ga0070707_100092901 | Ga0070707_1000929013 | 303 |
| 387 | 3300005471 | Ga0070698_100140456 | Ga0070698_1001404562 | 303 |
| 388 | 3300005471 | Ga0070698_100640889 | Ga0070698_1006408891 | 303 |
| 389 | 3300005518 | Ga0070699_100034226 | Ga0070699_1000342263 | 303 |
| 390 | 3300005518 | Ga0070699_100093065 | Ga0070699_1000930652 | 303 |
| 391 | 3300005518 | Ga0070699_100306814 | Ga0070699_1003068142 | 303 |
| 392 | 3300005530 | Ga0070679_100159783 | Ga0070679_1001597832 | 303 |
| 393 | 3300005536 | Ga0070697_100068040 | Ga0070697_1000680403 | 303 |
| 394 | 3300005536 | Ga0070697_100218558 | Ga0070697_1002185582 | 303 |
| 395 | 3300005544 | Ga0070686_100011978 | Ga0070686_1000119783 | 303 |
| 396 | 3300005545 | Ga0070695_100011421 | Ga0070695_1000114214 | 303 |
| 397 | 3300005545 | Ga0070695_100115640 | Ga0070695_1001156402 | 303 |
| 398 | 3300005546 | Ga0070696_100065476 | Ga0070696_1000654762 | 303 |
| 399 | 3300005546 | Ga0070696_100148166 | Ga0070696_1001481662 | 303 |
| 400 | 3300005549 | Ga0070704_100045070 | Ga0070704_1000450702 | 303 |
| 401 | 3300005549 | Ga0070704_100270541 | Ga0070704_1002705412 | 303 |
| 402 | 3300005549 | Ga0070704_100463344 | Ga0070704_1004633441 | 303 |
| 403 | 3300005842 | Ga0068858_100322395 | Ga0068858_1003223952 | 303 |
| 404 | 3300005843 | Ga0068860_100008117 | Ga0068860_1000081178 | 303 |
| 405 | 3300005844 | Ga0068862_100006591 | Ga0068862_1000065917 | 303 |
| 406 | 3300005844 | Ga0068862_100009075 | Ga0068862_1000090755 | 303 |
| 407 | 3300005937 | Ga0081455_10000654 | Ga0081455_1000065438 | 303 |
| 408 | 3300005983 | Ga0081540_1061808 | Ga0081540_10618082 | 303 |
| 409 | 3300005985 | Ga0081539_10000050 | Ga0081539_10000050238 | 303 |
| 410 | 3300006844 | Ga0075428_100001512 | Ga0075428_10000151210 | 303 |
| 411 | 3300006844 | Ga0075428_100010747 | Ga0075428_1000107476 | 303 |
| 412 | 3300006844 | Ga0075428_100048174 | Ga0075428_1000481745 | 303 |
| 413 | 3300006844 | Ga0075428_100063494 | Ga0075428_1000634944 | 303 |
| 414 | 3300006844 | Ga0075428_100126678 | Ga0075428_1001266784 | 303 |
| 415 | 3300006844 | Ga0075428_100143473 | Ga0075428_1001434733 | 303 |
| 416 | 3300006844 | Ga0075428_100565033 | Ga0075428_1005650332 | 303 |
| 417 | 3300006846 | Ga0075430_100000343 | Ga0075430_10000034336 | 303 |
| 418 | 3300006846 | Ga0075430_100003797 | Ga0075430_10000379713 | 303 |
| 419 | 3300006846 | Ga0075430_100070760 | Ga0075430_1000707602 | 303 |
| 420 | 3300006846 | Ga0075430_100076281 | Ga0075430_1000762812 | 303 |
| 421 | 3300006847 | Ga0075431_100000589 | Ga0075431_1000005898 | 303 |
| 422 | 3300006847 | Ga0075431_100008413 | Ga0075431_1000084133 | 303 |
| 423 | 3300006847 | Ga0075431_100016199 | Ga0075431_1000161993 | 303 |
| 424 | 3300006847 | Ga0075431_100037966 | Ga0075431_1000379662 | 303 |
| 425 | 3300006847 | Ga0075431_100078855 | Ga0075431_1000788552 | 303 |
| 426 | 3300006847 | Ga0075431_100100049 | Ga0075431_1001000492 | 303 |
| 427 | 3300006847 | Ga0075431_100263653 | Ga0075431_1002636532 | 303 |
| 428 | 3300006847 | Ga0075431_100273383 | Ga0075431_1002733832 | 303 |
| 429 | 3300006847 | Ga0075431_100576075 | Ga0075431_1005760751 | 303 |
| 430 | 3300006852 | Ga0075433_10000065 | Ga0075433_100000653 | 303 |
| 431 | 3300006852 | Ga0075433_10004058 | Ga0075433_1000405810 | 303 |
| 432 | 3300006852 | Ga0075433_10026832 | Ga0075433_100268327 | 303 |
| 433 | 3300006852 | Ga0075433_10266316 | Ga0075433_102663162 | 303 |
| 434 | 3300006871 | Ga0075434_100001212 | Ga0075434_10000121213 | 303 |
| 435 | 3300006871 | Ga0075434_100001353 | Ga0075434_1000013532 | 303 |
| 436 | 3300006871 | Ga0075434_100003549 | Ga0075434_10000354914 | 303 |
| 437 | 3300006871 | Ga0075434_100064872 | Ga0075434_1000648724 | 303 |
| 438 | 3300006871 | Ga0075434_100121403 | Ga0075434_1001214032 | 303 |
| 439 | 3300006880 | Ga0075429_100000014 | Ga0075429_10000001455 | 303 |
| 440 | 3300006880 | Ga0075429_100000807 | Ga0075429_10000080721 | 303 |
| 441 | 3300006880 | Ga0075429_100005652 | Ga0075429_10000565210 | 303 |
| 442 | 3300006880 | Ga0075429_100041783 | Ga0075429_1000417833 | 303 |
| 443 | 3300006880 | Ga0075429_100188441 | Ga0075429_1001884412 | 303 |
| 444 | 3300006880 | Ga0075429_100202118 | Ga0075429_1002021182 | 303 |
| 445 | 3300006880 | Ga0075429_100259612 | Ga0075429_1002596122 | 303 |
| 446 | 3300006880 | Ga0075429_100306443 | Ga0075429_1003064431 | 303 |
| 447 | 3300006914 | Ga0075436_100053692 | Ga0075436_1000536923 | 303 |
| 448 | 3300007076 | Ga0075435_100001556 | Ga0075435_1000015567 | 303 |
| 449 | 3300007076 | Ga0075435_100012879 | Ga0075435_1000128792 | 303 |
| 450 | 3300007076 | Ga0075435_100047753 | Ga0075435_1000477532 | 303 |
| 451 | 3300007076 | Ga0075435_100347176 | Ga0075435_1003471761 | 303 |
| 452 | 3300009093 | Ga0105240_10474560 | Ga0105240_104745602 | 303 |
| 453 | 3300009094 | Ga0111539_10011657 | Ga0111539_100116572 | 303 |
| 454 | 3300009094 | Ga0111539_10016847 | Ga0111539_100168477 | 303 |
| 455 | 3300009094 | Ga0111539_10344964 | Ga0111539_103449642 | 303 |
| 456 | 3300009094 | Ga0111539_10412847 | Ga0111539_104128472 | 303 |
| 457 | 3300009094 | Ga0111539_10438239 | Ga0111539_104382392 | 303 |
| 458 | 3300009101 | Ga0105247_10043972 | Ga0105247_100439723 | 303 |
| 459 | 3300009147 | Ga0114129_10003240 | Ga0114129_100032402 | 303 |
| 460 | 3300009147 | Ga0114129_10010224 | Ga0114129_1001022414 | 303 |
| 461 | 3300009147 | Ga0114129_10012541 | Ga0114129_100125413 | 303 |
| 462 | 3300009147 | Ga0114129_10019542 | Ga0114129_100195427 | 303 |
| 463 | 3300009147 | Ga0114129_10029401 | Ga0114129_100294011 | 303 |
| 464 | 3300009147 | Ga0114129_10047361 | Ga0114129_100473613 | 303 |
| 465 | 3300009147 | Ga0114129_10068567 | Ga0114129_100685672 | 303 |
| 466 | 3300009147 | Ga0114129_10190951 | Ga0114129_101909512 | 303 |
| 467 | 3300009147 | Ga0114129_10505019 | Ga0114129_105050192 | 303 |
| 468 | 3300009147 | Ga0114129_10794236 | Ga0114129_107942361 | 303 |
| 469 | 3300009177 | Ga0105248_10122207 | Ga0105248_101222073 | 303 |
| 470 | 3300013297 | Ga0157378_10107437 | Ga0157378_101074372 | 303 |
| 471 | 3300014326 | Ga0157380_10450497 | Ga0157380_104504972 | 303 |
| 472 | 3300014968 | Ga0157379_10416197 | Ga0157379_104161972 | 303 |
| 473 | 3300025885 | Ga0207653_10075959 | Ga0207653_100759591 | 303 |
| 474 | 3300025910 | Ga0207684_10004601 | Ga0207684_100046014 | 303 |
| 475 | 3300025910 | Ga0207684_10004627 | Ga0207684_100046275 | 303 |
| 476 | 3300025910 | Ga0207684_10012156 | Ga0207684_100121565 | 303 |
| 477 | 3300025910 | Ga0207684_10092188 | Ga0207684_100921882 | 303 |
| 478 | 3300025912 | Ga0207707_10179742 | Ga0207707_101797422 | 303 |
| 479 | 3300025921 | Ga0207652_10079842 | Ga0207652_100798421 | 303 |
| 480 | 3300025922 | Ga0207646_10045568 | Ga0207646_100455681 | 303 |
| 481 | 3300025922 | Ga0207646_10048272 | Ga0207646_100482723 | 303 |
| 482 | 3300025922 | Ga0207646_10227702 | Ga0207646_102277022 | 303 |
| 483 | 3300025928 | Ga0207700_10028000 | Ga0207700_100280001 | 303 |
| 484 | 3300025929 | Ga0207664_10016165 | Ga0207664_100161655 | 303 |
| 485 | 3300025933 | Ga0207706_10022010 | Ga0207706_100220107 | 303 |
| 486 | 3300025933 | Ga0207706_10051466 | Ga0207706_100514662 | 303 |
| 487 | 3300025936 | Ga0207670_10163615 | Ga0207670_101636152 | 303 |
| 488 | 3300025940 | Ga0207691_10110671 | Ga0207691_101106712 | 303 |
| 489 | 3300025941 | Ga0207711_10061833 | Ga0207711_100618331 | 303 |
| 490 | 3300025942 | Ga0207689_10074152 | Ga0207689_100741522 | 303 |
| 491 | 3300025961 | Ga0207712_10013516 | Ga0207712_100135164 | 303 |
| 492 | 3300026035 | Ga0207703_10522627 | Ga0207703_105226272 | 303 |
| 493 | 3300026075 | Ga0207708_10091112 | Ga0207708_100911121 | 303 |
| 494 | 3300026075 | Ga0207708_10145818 | Ga0207708_101458182 | 303 |
| 495 | 3300026089 | Ga0207648_10049757 | Ga0207648_100497572 | 303 |
| 496 | 3300027378 | Ga0209981_1001702 | Ga0209981_10017023 | 303 |
| 497 | 3300027395 | Ga0209996_1000427 | Ga0209996_10004274 | 303 |
| 498 | 3300027471 | Ga0209995_1002081 | Ga0209995_10020812 | 303 |
| 499 | 3300027543 | Ga0209999_1000272 | Ga0209999_10002722 | 303 |
| 500 | 3300027552 | Ga0209982_1001858 | Ga0209982_10018582 | 303 |
| 501 | 3300027614 | Ga0209970_1001273 | Ga0209970_10012734 | 303 |
| 502 | 3300027617 | Ga0210002_1000887 | Ga0210002_10008875 | 303 |
| 503 | 3300027665 | Ga0209983_1000101 | Ga0209983_10001013 | 303 |
| 504 | 3300027671 | Ga0209588_1015545 | Ga0209588_10155452 | 303 |
| 505 | 3300027682 | Ga0209971_1000003 | Ga0209971_100000352 | 303 |
| 506 | 3300027695 | Ga0209966_1000045 | Ga0209966_10000454 | 303 |
| 507 | 3300027717 | Ga0209998_10006972 | Ga0209998_100069722 | 303 |
| 508 | 3300027876 | Ga0209974_10000022 | Ga0209974_1000002236 | 303 |
| 509 | 3300027907 | Ga0207428_10000063 | Ga0207428_1000006365 | 303 |
| 510 | 3300027907 | Ga0207428_10000091 | Ga0207428_1000009143 | 303 |
| 511 | 3300027907 | Ga0207428_10000253 | Ga0207428_100002532 | 303 |
| 512 | 3300027907 | Ga0207428_10116258 | Ga0207428_101162582 | 303 |
| 513 | 3300028380 | Ga0268265_10006929 | Ga0268265_100069297 | 303 |
| 514 | 3300028380 | Ga0268265_10070909 | Ga0268265_100709092 | 303 |
| 515 | 3300028380 | Ga0268265_10091524 | Ga0268265_100915242 | 303 |
| 516 | 3300028381 | Ga0268264_10040497 | Ga0268264_100404972 | 303 |
| 517 | 3300028381 | Ga0268264_10278143 | Ga0268264_102781431 | 303 |
| 518 | 3300031548 | Ga0307408_100324329 | Ga0307408_1003243292 | 303 |
| 519 | 3300037418 | Ga0395900_0013350 | Ga0395900_0013350_1889_2821 | 303 |
| 520 | 3300038443 | Ga0395901_0000688 | Ga0395901_0000688_34636_35568 | 303 |
| 521 | 3300038996 | Ga0242420_023015 | Ga0242420_023015_22_954 | 303 |
| 522 | 3300042439 | Ga0439464_0000185 | Ga0439464_0000185_9009_9941 | 303 |
| 523 | 3300042461 | Ga0439460_0000645 | Ga0439460_0000645_243_1175 | 303 |
| 524 | 3300042876 | Ga0451577_0014234 | Ga0451577_0014234_3358_4290 | 303 |
| 525 | 3300042876 | Ga0451577_0195116 | Ga0451577_0195116_537_1469 | 303 |
| 526 | 3300044712 | Ga0453684_0072440 | Ga0453684_0072440_1229_2161 | 303 |
| 527 | 3300045051 | Ga0451576_0046553 | Ga0451576_0046553_1912_2844 | 303 |
| 528 | 3300049568 | Ga0501031_0030752 | Ga0501031_0030752_1025_1960 | 303 |
| 529 | 3300049576 | Ga0501040_0010906 | Ga0501040_0010906_931_1863 | 303 |
| 530 | 3300049576 | Ga0501040_0023255 | Ga0501040_0023255_2684_3619 | 303 |
| 531 | 3300049577 | Ga0501041_0005485 | Ga0501041_0005485_3101_4033 | 303 |
| 532 | 3300049577 | Ga0501041_0006986 | Ga0501041_0006986_2519_3454 | 303 |
| 533 | 3300049578 | Ga0501042_0023145 | Ga0501042_0023145_2700_3632 | 303 |
| 534 | 3300049578 | Ga0501042_0077509 | Ga0501042_0077509_509_1444 | 303 |
| 535 | 3300049580 | Ga0501046_0001418 | Ga0501046_0001418_483_1415 | 303 |
| 536 | 3300049586 | Ga0501070_0158292 | Ga0501070_0158292_274_1209 | 303 |
| 537 | 3300049588 | Ga0501072_0113004 | Ga0501072_0113004_994_1929 | 303 |
| 538 | 3300049590 | Ga0501074_0028505 | Ga0501074_0028505_2372_3304 | 303 |
| 539 | 3300049590 | Ga0501074_0116793 | Ga0501074_0116793_351_1286 | 303 |
| 540 | 3300049591 | Ga0501075_0094521 | Ga0501075_0094521_332_1264 | 303 |
| 541 | 3300049592 | Ga0501076_0035680 | Ga0501076_0035680_922_1857 | 303 |
| 542 | 3300049593 | Ga0501077_0181332 | Ga0501077_0181332_100_1032 | 303 |
| 543 | 3300049741 | Ga0501079_0005572 | Ga0501079_0005572_4638_5570 | 303 |
| 544 | 3300049741 | Ga0501079_0010629 | Ga0501079_0010629_443_1378 | 303 |
| 545 | 3300049742 | Ga0501080_0061225 | Ga0501080_0061225_1336_2271 | 303 |
| 546 | 3300049743 | Ga0501081_0036762 | Ga0501081_0036762_217_1149 | 303 |
| 547 | 3300049743 | Ga0501081_0083950 | Ga0501081_0083950_92_1027 | 303 |
| 548 | 3300049744 | Ga0501083_0043295 | Ga0501083_0043295_1695_2630 | 303 |
| 549 | 3300049744 | Ga0501083_0080809 | Ga0501083_0080809_332_1264 | 303 |
| 550 | 3300049822 | Ga0501035_0072138 | Ga0501035_0072138_255_1190 | 303 |
| 551 | 3300049824 | Ga0501045_0000939 | Ga0501045_0000939_15350_16282 | 303 |
| 552 | 3300050507 | nmdc:mga05p37_13768_c1 | nmdc:mga05p37_13768_c1_5732_6664 | 303 |
| 553 | 3300050507 | nmdc:mga05p37_217042_c1 | nmdc:mga05p37_217042_c1_761_1693 | 303 |
| 554 | 3300050507 | nmdc:mga05p37_259534_c1 | nmdc:mga05p37_259534_c1_889_1821 | 303 |
| 555 | 3300050507 | nmdc:mga05p37_27232_c2 | nmdc:mga05p37_27232_c2_3319_4251 | 303 |
| 556 | 3300050507 | nmdc:mga05p37_27794_c1 | nmdc:mga05p37_27794_c1_3310_4242 | 303 |
| 557 | 3300050507 | nmdc:mga05p37_42837_c1 | nmdc:mga05p37_42837_c1_1343_2275 | 303 |
| 558 | 3300050507 | nmdc:mga05p37_4931_c1 | nmdc:mga05p37_4931_c1_6560_7492 | 303 |
| 559 | 3300050507 | nmdc:mga05p37_6086_c1 | nmdc:mga05p37_6086_c1_3124_4056 | 303 |
| 560 | 3300050507 | nmdc:mga05p37_68705_c1 | nmdc:mga05p37_68705_c1_1728_2660 | 303 |
| 561 | 3300050507 | nmdc:mga05p37_76551_c1 | nmdc:mga05p37_76551_c1_421_1353 | 303 |
| 562 | 3300050507 | nmdc:mga05p37_8072_c1 | nmdc:mga05p37_8072_c1_1063_1995 | 303 |
| 563 | 3300050508 | nmdc:mga09592_137351_c1 | nmdc:mga09592_137351_c1_388_1320 | 303 |
| 564 | 3300050508 | nmdc:mga09592_148559_c1 | nmdc:mga09592_148559_c1_497_1429 | 303 |
| 565 | 3300050508 | nmdc:mga09592_1890_c1 | nmdc:mga09592_1890_c1_14742_15674 | 303 |
| 566 | 3300050508 | nmdc:mga09592_333039_c1 | nmdc:mga09592_333039_c1_55_987 | 303 |
| 567 | 3300050508 | nmdc:mga09592_33859_c1 | nmdc:mga09592_33859_c1_1495_2427 | 303 |
| 568 | 3300050508 | nmdc:mga09592_34576_c1 | nmdc:mga09592_34576_c1_1410_2342 | 303 |
| 569 | 3300050508 | nmdc:mga09592_350768_c1 | nmdc:mga09592_350768_c1_314_1246 | 303 |
| 570 | 3300050508 | nmdc:mga09592_41229_c1 | nmdc:mga09592_41229_c1_969_1901 | 303 |
| 571 | 3300050508 | nmdc:mga09592_4123_c1 | nmdc:mga09592_4123_c1_8571_9503 | 303 |
| 572 | 3300050509 | nmdc:mga0qj67_257_c1 | nmdc:mga0qj67_257_c1_10313_11245 | 303 |
| 573 | 3300050509 | nmdc:mga0qj67_53973_c1 | nmdc:mga0qj67_53973_c1_696_1628 | 303 |
| 574 | 3300050509 | nmdc:mga0qj67_582_c1 | nmdc:mga0qj67_582_c1_23356_24288 | 303 |
| 575 | 3300050510 | nmdc:mga06r32_121051_c1 | nmdc:mga06r32_121051_c1_1178_2110 | 303 |
| 576 | 3300050510 | nmdc:mga06r32_13444_c1 | nmdc:mga06r32_13444_c1_2517_3449 | 303 |
| 577 | 3300050510 | nmdc:mga06r32_164798_c1 | nmdc:mga06r32_164798_c1_464_1396 | 303 |
| 578 | 3300050510 | nmdc:mga06r32_229376_c1 | nmdc:mga06r32_229376_c1_165_1097 | 303 |
| 579 | 3300050510 | nmdc:mga06r32_233134_c1 | nmdc:mga06r32_233134_c1_601_1533 | 303 |
| 580 | 3300050510 | nmdc:mga06r32_414_c1 | nmdc:mga06r32_414_c1_1018_1950 | 303 |
| 581 | 3300050510 | nmdc:mga06r32_633_c1 | nmdc:mga06r32_633_c1_10531_11463 | 303 |
| 582 | 3300050510 | nmdc:mga06r32_69344_c1 | nmdc:mga06r32_69344_c1_249_1181 | 303 |
| 583 | 3300050510 | nmdc:mga06r32_75407_c1 | nmdc:mga06r32_75407_c1_922_1854 | 303 |
| 584 | 3300050511 | nmdc:mga08y16_13643_c1 | nmdc:mga08y16_13643_c1_1253_2185 | 303 |
| 585 | 3300050511 | nmdc:mga08y16_184751_c1 | nmdc:mga08y16_184751_c1_548_1480 | 303 |
| 586 | 3300050511 | nmdc:mga08y16_252_c1 | nmdc:mga08y16_252_c1_739_1671 | 303 |
| 587 | 3300050511 | nmdc:mga08y16_348710_c1 | nmdc:mga08y16_348710_c1_351_1283 | 303 |
| 588 | 3300050512 | nmdc:mga0n895_14949_c1 | nmdc:mga0n895_14949_c1_3949_4881 | 303 |
| 589 | 3300050512 | nmdc:mga0n895_22123_c1 | nmdc:mga0n895_22123_c1_1616_2548 | 303 |
| 590 | 3300050512 | nmdc:mga0n895_246253_c1 | nmdc:mga0n895_246253_c1_257_1189 | 303 |
| 591 | 3300050512 | nmdc:mga0n895_272681_c1 | nmdc:mga0n895_272681_c1_759_1691 | 303 |
| 592 | 3300050512 | nmdc:mga0n895_3667_c1 | nmdc:mga0n895_3667_c1_11316_12248 | 303 |
| 593 | 3300050512 | nmdc:mga0n895_99145_c1 | nmdc:mga0n895_99145_c1_1279_2211 | 303 |
| 594 | 3300050513 | nmdc:mga0rr50_13494_c1 | nmdc:mga0rr50_13494_c1_3626_4558 | 303 |
| 595 | 3300050513 | nmdc:mga0rr50_185420_c1 | nmdc:mga0rr50_185420_c1_214_1146 | 303 |
| 596 | 3300050513 | nmdc:mga0rr50_341742_c1 | nmdc:mga0rr50_341742_c1_311_1243 | 303 |
| 597 | 3300050514 | nmdc:mga08x19_190933_c1 | nmdc:mga08x19_190933_c1_17_949 | 303 |
| 598 | 3300050514 | nmdc:mga08x19_38095_c1 | nmdc:mga08x19_38095_c1_508_1440 | 303 |
| 599 | 3300050515 | nmdc:mga0a205_193951_c1 | nmdc:mga0a205_193951_c1_917_1849 | 303 |
| 600 | 3300050515 | nmdc:mga0a205_269_c1 | nmdc:mga0a205_269_c1_26240_27172 | 303 |
| 601 | 3300050515 | nmdc:mga0a205_32206_c1 | nmdc:mga0a205_32206_c1_779_1711 | 303 |
| 602 | 3300050515 | nmdc:mga0a205_54054_c1 | nmdc:mga0a205_54054_c1_1571_2503 | 303 |
| 603 | 3300050515 | nmdc:mga0a205_64096_c1 | nmdc:mga0a205_64096_c1_2059_2991 | 303 |
| 604 | 3300050515 | nmdc:mga0a205_6420_c1 | nmdc:mga0a205_6420_c1_5167_6099 | 303 |
| 605 | 3300054114 | Ga0501084_0138286 | Ga0501084_0138286_333_1265 | 303 |
| 606 | 3300060353 | Ga0501082_0005149 | Ga0501082_0005149_895_1827 | 303 |
| 607 | 3300061734 | Ga0530510_0016829 | Ga0530510_0016829_4063_4995 | 303 |
| 608 | 3300061734 | Ga0530510_0089864 | Ga0530510_0089864_994_1929 | 303 |
| 609 | 3300003323 | rootH1_10091158 | rootH1_100911582 | 304 |
| 610 | 3300005329 | Ga0070683_100025536 | Ga0070683_1000255362 | 304 |
| 611 | 3300005336 | Ga0070680_100032601 | Ga0070680_1000326013 | 304 |
| 612 | 3300005336 | Ga0070680_100160103 | Ga0070680_1001601032 | 304 |
| 613 | 3300005337 | Ga0070682_100250887 | Ga0070682_1002508872 | 304 |
| 614 | 3300005339 | Ga0070660_100028160 | Ga0070660_1000281602 | 304 |
| 615 | 3300005341 | Ga0070691_10008450 | Ga0070691_100084503 | 304 |
| 616 | 3300005344 | Ga0070661_100320984 | Ga0070661_1003209841 | 304 |
| 617 | 3300005434 | Ga0070709_10108701 | Ga0070709_101087012 | 304 |
| 618 | 3300005435 | Ga0070714_100023397 | Ga0070714_1000233975 | 304 |
| 619 | 3300005435 | Ga0070714_100041668 | Ga0070714_1000416682 | 304 |
| 620 | 3300005437 | Ga0070710_10242321 | Ga0070710_102423211 | 304 |
| 621 | 3300005441 | Ga0070700_100013535 | Ga0070700_1000135352 | 304 |
| 622 | 3300005444 | Ga0070694_100075110 | Ga0070694_1000751102 | 304 |
| 623 | 3300005455 | Ga0070663_100250792 | Ga0070663_1002507922 | 304 |
| 624 | 3300005458 | Ga0070681_10049537 | Ga0070681_100495372 | 304 |
| 625 | 3300005458 | Ga0070681_10060246 | Ga0070681_100602463 | 304 |
| 626 | 3300005458 | Ga0070681_10079163 | Ga0070681_100791633 | 304 |
| 627 | 3300005530 | Ga0070679_100021604 | Ga0070679_1000216045 | 304 |
| 628 | 3300005530 | Ga0070679_100043082 | Ga0070679_1000430822 | 304 |
| 629 | 3300005530 | Ga0070679_100128297 | Ga0070679_1001282972 | 304 |
| 630 | 3300005535 | Ga0070684_100007445 | Ga0070684_1000074455 | 304 |
| 631 | 3300005535 | Ga0070684_100024429 | Ga0070684_1000244292 | 304 |
| 632 | 3300005535 | Ga0070684_100042164 | Ga0070684_1000421643 | 304 |
| 633 | 3300005536 | Ga0070697_100046177 | Ga0070697_1000461773 | 304 |
| 634 | 3300005539 | Ga0068853_100327176 | Ga0068853_1003271761 | 304 |
| 635 | 3300005545 | Ga0070695_100016804 | Ga0070695_1000168042 | 304 |
| 636 | 3300005547 | Ga0070693_100301730 | Ga0070693_1003017301 | 304 |
| 637 | 3300005563 | Ga0068855_100213130 | Ga0068855_1002131302 | 304 |
| 638 | 3300005564 | Ga0070664_100417264 | Ga0070664_1004172642 | 304 |
| 639 | 3300005577 | Ga0068857_100032819 | Ga0068857_1000328193 | 304 |
| 640 | 3300005577 | Ga0068857_100133693 | Ga0068857_1001336932 | 304 |
| 641 | 3300005718 | Ga0068866_10016349 | Ga0068866_100163492 | 304 |
| 642 | 3300005719 | Ga0068861_100181558 | Ga0068861_1001815582 | 304 |
| 643 | 3300005842 | Ga0068858_100052941 | Ga0068858_1000529411 | 304 |
| 644 | 3300005983 | Ga0081540_1001040 | Ga0081540_100104015 | 304 |
| 645 | 3300005983 | Ga0081540_1100530 | Ga0081540_11005302 | 304 |
| 646 | 3300006163 | Ga0070715_10008833 | Ga0070715_100088333 | 304 |
| 647 | 3300006163 | Ga0070715_10051610 | Ga0070715_100516102 | 304 |
| 648 | 3300006358 | Ga0068871_100070800 | Ga0068871_1000708002 | 304 |
| 649 | 3300006852 | Ga0075433_10025834 | Ga0075433_100258342 | 304 |
| 650 | 3300006871 | Ga0075434_100002288 | Ga0075434_1000022885 | 304 |
| 651 | 3300009093 | Ga0105240_10067558 | Ga0105240_100675582 | 304 |
| 652 | 3300009094 | Ga0111539_10120428 | Ga0111539_101204282 | 304 |
| 653 | 3300009148 | Ga0105243_10220896 | Ga0105243_102208962 | 304 |
| 654 | 3300009174 | Ga0105241_10179783 | Ga0105241_101797832 | 304 |
| 655 | 3300009174 | Ga0105241_10359719 | Ga0105241_103597192 | 304 |
| 656 | 3300009176 | Ga0105242_10048005 | Ga0105242_100480052 | 304 |
| 657 | 3300009176 | Ga0105242_10154162 | Ga0105242_101541622 | 304 |
| 658 | 3300009545 | Ga0105237_10043407 | Ga0105237_100434072 | 304 |
| 659 | 3300009551 | Ga0105238_10058109 | Ga0105238_100581092 | 304 |
| 660 | 3300009551 | Ga0105238_10582665 | Ga0105238_105826652 | 304 |
| 661 | 3300010375 | Ga0105239_10047530 | Ga0105239_100475303 | 304 |
| 662 | 3300010375 | Ga0105239_10129225 | Ga0105239_101292252 | 304 |
| 663 | 3300013104 | Ga0157370_10036360 | Ga0157370_100363602 | 304 |
| 664 | 3300013105 | Ga0157369_10023551 | Ga0157369_100235512 | 304 |
| 665 | 3300013296 | Ga0157374_10143214 | Ga0157374_101432142 | 304 |
| 666 | 3300013307 | Ga0157372_10199731 | Ga0157372_101997312 | 304 |
| 667 | 3300014325 | Ga0163163_10025815 | Ga0163163_100258155 | 304 |
| 668 | 3300014325 | Ga0163163_10211291 | Ga0163163_102112912 | 304 |
| 669 | 3300014968 | Ga0157379_10163408 | Ga0157379_101634082 | 304 |
| 670 | 3300014968 | Ga0157379_10259059 | Ga0157379_102590592 | 304 |
| 671 | 3300014969 | Ga0157376_10293581 | Ga0157376_102935812 | 304 |
| 672 | 3300020070 | Ga0206356_11047833 | Ga0206356_110478332 | 304 |
| 673 | 3300021377 | Ga0213874_10011593 | Ga0213874_100115932 | 304 |
| 674 | 3300021384 | Ga0213876_10087546 | Ga0213876_100875462 | 304 |
| 675 | 3300021388 | Ga0213875_10000003 | Ga0213875_10000003479 | 304 |
| 676 | 3300025898 | Ga0207692_10028454 | Ga0207692_100284542 | 304 |
| 677 | 3300025898 | Ga0207692_10107528 | Ga0207692_101075282 | 304 |
| 678 | 3300025905 | Ga0207685_10005228 | Ga0207685_100052282 | 304 |
| 679 | 3300025912 | Ga0207707_10000381 | Ga0207707_100003815 | 304 |
| 680 | 3300025912 | Ga0207707_10004363 | Ga0207707_100043636 | 304 |
| 681 | 3300025912 | Ga0207707_10084269 | Ga0207707_100842692 | 304 |
| 682 | 3300025913 | Ga0207695_10055385 | Ga0207695_100553853 | 304 |
| 683 | 3300025914 | Ga0207671_10056234 | Ga0207671_100562342 | 304 |
| 684 | 3300025914 | Ga0207671_10069776 | Ga0207671_100697762 | 304 |
| 685 | 3300025914 | Ga0207671_10150427 | Ga0207671_101504272 | 304 |
| 686 | 3300025915 | Ga0207693_10033392 | Ga0207693_100333923 | 304 |
| 687 | 3300025915 | Ga0207693_10150639 | Ga0207693_101506391 | 304 |
| 688 | 3300025917 | Ga0207660_10022679 | Ga0207660_100226792 | 304 |
| 689 | 3300025921 | Ga0207652_10001534 | Ga0207652_100015343 | 304 |
| 690 | 3300025921 | Ga0207652_10024807 | Ga0207652_100248072 | 304 |
| 691 | 3300025929 | Ga0207664_10036921 | Ga0207664_100369214 | 304 |
| 692 | 3300025939 | Ga0207665_10289465 | Ga0207665_102894652 | 304 |
| 693 | 3300025941 | Ga0207711_10019107 | Ga0207711_100191073 | 304 |
| 694 | 3300025949 | Ga0207667_10002990 | Ga0207667_100029903 | 304 |
| 695 | 3300026035 | Ga0207703_10029463 | Ga0207703_100294634 | 304 |
| 696 | 3300026041 | Ga0207639_10230617 | Ga0207639_102306172 | 304 |
| 697 | 3300026041 | Ga0207639_10515274 | Ga0207639_105152742 | 304 |
| 698 | 3300026095 | Ga0207676_10364016 | Ga0207676_103640162 | 304 |
| 699 | 3300026116 | Ga0207674_10036172 | Ga0207674_100361722 | 304 |
| 700 | 3300026116 | Ga0207674_10136440 | Ga0207674_101364402 | 304 |
| 701 | 3300026116 | Ga0207674_10209161 | Ga0207674_102091612 | 304 |
| 702 | 3300026118 | Ga0207675_100087937 | Ga0207675_1000879372 | 304 |
| 703 | 3300026142 | Ga0207698_10123762 | Ga0207698_101237622 | 304 |
| 704 | 3300028381 | Ga0268264_10530784 | Ga0268264_105307841 | 304 |
| 705 | 3300035083 | Ga0373926_0029604 | Ga0373926_0029604_951_1883 | 304 |
| 706 | 3300035084 | Ga0373928_0013917 | Ga0373928_0013917_288_1220 | 304 |
| 707 | 3300035086 | Ga0373934_0012646 | Ga0373934_0012646_1132_2064 | 304 |
| 708 | 3300035089 | Ga0373944_0078274 | Ga0373944_0078274_88_1020 | 304 |
| 709 | 3300035111 | Ga0373923_0006598 | Ga0373923_0006598_1473_2405 | 304 |
| 710 | 3300035113 | Ga0373936_0007064 | Ga0373936_0007064_2677_3609 | 304 |
| 711 | 3300035115 | Ga0373941_0006452 | Ga0373941_0006452_812_1744 | 304 |
| 712 | 3300035116 | Ga0373945_0034530 | Ga0373945_0034530_851_1783 | 304 |
| 713 | 3300035117 | Ga0373953_0010488 | Ga0373953_0010488_710_1642 | 304 |
| 714 | 3300035118 | Ga0373954_0054864 | Ga0373954_0054864_312_1244 | 304 |
| 715 | 3300035119 | Ga0373956_0004587 | Ga0373956_0004587_3914_4846 | 304 |
| 716 | 3300035119 | Ga0373956_0030187 | Ga0373956_0030187_203_1135 | 304 |
| 717 | 3300035121 | Ga0373960_0008679 | Ga0373960_0008679_904_1836 | 304 |
| 718 | 3300035172 | Ga0373955_0010599 | Ga0373955_0010599_2325_3257 | 304 |
| 719 | 3300035410 | Ga0373924_0026977 | Ga0373924_0026977_245_1177 | 304 |
| 720 | 3300035691 | Ga0373931_0004839 | Ga0373931_0004839_1812_2744 | 304 |
| 721 | 3300035691 | Ga0373931_0018090 | Ga0373931_0018090_1641_2573 | 304 |
| 722 | 3300035691 | Ga0373931_0018818 | Ga0373931_0018818_2169_3101 | 304 |
| 723 | 3300035692 | Ga0373935_0047469 | Ga0373935_0047469_193_1125 | 304 |
| 724 | 3300035724 | Ga0373933_0003431 | Ga0373933_0003431_3978_4910 | 304 |
| 725 | 3300035725 | Ga0373947_0036707 | Ga0373947_0036707_1026_1958 | 304 |
| 726 | 3300036401 | Ga0373937_0225531 | Ga0373937_0225531_56_988 | 304 |
| 727 | 3300036401 | Ga0373937_0330574 | Ga0373937_0330574_80_1012 | 304 |
| 728 | 3300037068 | Ga0373925_0209318 | Ga0373925_0209318_165_1097 | 304 |
| 729 | 3300037068 | Ga0373925_0359709 | Ga0373925_0359709_16_948 | 304 |
| 730 | 3300037853 | Ga0436364_0521241 | Ga0436364_0521241_17_949 | 304 |
| 731 | 3300037853 | Ga0436364_0832396 | Ga0436364_0832396_15835_16767 | 304 |
| 732 | 3300038443 | Ga0395901_0154478 | Ga0395901_0154478_1292_2224 | 304 |
| 733 | 3300039437 | Ga0436365_0701279 | Ga0436365_0701279_922_1854 | 304 |
| 734 | 3300039438 | Ga0436360_0288674 | Ga0436360_0288674_899_1831 | 304 |
| 735 | 3300039438 | Ga0436360_0432140 | Ga0436360_0432140_301_1233 | 304 |
| 736 | 3300039438 | Ga0436360_0621665 | Ga0436360_0621665_1647_2579 | 304 |
| 737 | 3300039438 | Ga0436360_0634297 | Ga0436360_0634297_1823_2755 | 304 |
| 738 | 3300039447 | Ga0436361_0565162 | Ga0436361_0565162_1842_2774 | 304 |
| 739 | 3300039447 | Ga0436361_0804636 | Ga0436361_0804636_561_1493 | 304 |
| 740 | 3300039450 | Ga0436363_0384424 | Ga0436363_0384424_2190_3122 | 304 |
| 741 | 3300039450 | Ga0436363_1450587 | Ga0436363_1450587_1968_2900 | 304 |
| 742 | 3300039453 | Ga0436362_0280096 | Ga0436362_0280096_1486_2415 | 304 |
| 743 | 3300039453 | Ga0436362_1044336 | Ga0436362_1044336_723_1655 | 304 |
| 744 | 3300046454 | Ga0495592_0036539 | Ga0495592_0036539_2090_3022 | 304 |
| 745 | 3300046454 | Ga0495592_0038473 | Ga0495592_0038473_1003_1935 | 304 |
| 746 | 3300046459 | Ga0495629_0012711 | Ga0495629_0012711_1259_2191 | 304 |
| 747 | 3300046459 | Ga0495629_0077308 | Ga0495629_0077308_859_1791 | 304 |
| 748 | 3300046461 | Ga0495641_0108816 | Ga0495641_0108816_97_1029 | 304 |
| 749 | 3300046462 | Ga0495651_0142333 | Ga0495651_0142333_726_1658 | 304 |
| 750 | 3300046463 | Ga0495653_0002423 | Ga0495653_0002423_1702_2634 | 304 |
| 751 | 3300046472 | Ga0495580_0124609 | Ga0495580_0124609_16_948 | 304 |
| 752 | 3300046473 | Ga0495582_0063387 | Ga0495582_0063387_10_942 | 304 |
| 753 | 3300046476 | Ga0495662_0048832 | Ga0495662_0048832_1036_1968 | 304 |
| 754 | 3300046476 | Ga0495662_0137303 | Ga0495662_0137303_229_1161 | 304 |
| 755 | 3300046499 | Ga0495594_0075029 | Ga0495594_0075029_833_1765 | 304 |
| 756 | 3300046516 | Ga0495628_0041389 | Ga0495628_0041389_2418_3350 | 304 |
| 757 | 3300046516 | Ga0495628_0045948 | Ga0495628_0045948_802_1734 | 304 |
| 758 | 3300046526 | Ga0495666_0044901 | Ga0495666_0044901_203_1135 | 304 |
| 759 | 3300046529 | Ga0495652_0084105 | Ga0495652_0084105_1339_2271 | 304 |
| 760 | 3300046531 | Ga0495665_0026882 | Ga0495665_0026882_195_1127 | 304 |
| 761 | 3300046533 | Ga0495640_0024793 | Ga0495640_0024793_1661_2593 | 304 |
| 762 | 3300046533 | Ga0495640_0205603 | Ga0495640_0205603_272_1204 | 304 |
| 763 | 3300046536 | Ga0495587_0025261 | Ga0495587_0025261_1060_1992 | 304 |
| 764 | 3300046543 | Ga0495645_0073883 | Ga0495645_0073883_194_1126 | 304 |
| 765 | 3300046559 | Ga0495667_0026765 | Ga0495667_0026765_1262_2194 | 304 |
| 766 | 3300046559 | Ga0495667_0040322 | Ga0495667_0040322_1084_2016 | 304 |
| 767 | 3300046559 | Ga0495667_0077177 | Ga0495667_0077177_791_1723 | 304 |
| 768 | 3300046642 | Ga0495634_0033815 | Ga0495634_0033815_809_1741 | 304 |
| 769 | 3300046642 | Ga0495634_0034511 | Ga0495634_0034511_1709_2641 | 304 |
| 770 | 3300046642 | Ga0495634_0067441 | Ga0495634_0067441_145_1077 | 304 |
| 771 | 3300046663 | Ga0495635_0040398 | Ga0495635_0040398_1338_2270 | 304 |
| 772 | 3300046663 | Ga0495635_0042167 | Ga0495635_0042167_559_1491 | 304 |
| 773 | 3300046674 | Ga0495588_0068110 | Ga0495588_0068110_395_1327 | 304 |
| 774 | 3300046678 | Ga0495599_0015541 | Ga0495599_0015541_64_996 | 304 |
| 775 | 3300046679 | Ga0495623_0009138 | Ga0495623_0009138_1874_2806 | 304 |
| 776 | 3300046680 | Ga0495646_0014497 | Ga0495646_0014497_1478_2410 | 304 |
| 777 | 3300046683 | Ga0495658_0126059 | Ga0495658_0126059_78_1010 | 304 |
| 778 | 3300046683 | Ga0495658_0180948 | Ga0495658_0180948_145_1077 | 304 |
| 779 | 3300046683 | Ga0495658_0282203 | Ga0495658_0282203_76_1008 | 304 |
| 780 | 3300046690 | Ga0495624_0036743 | Ga0495624_0036743_1346_2278 | 304 |
| 781 | 3300046690 | Ga0495624_0077858 | Ga0495624_0077858_1039_1971 | 304 |
| 782 | 3300046809 | Ga0495600_0092479 | Ga0495600_0092479_427_1359 | 304 |
| 783 | 3300047315 | Ga0495581_0086789 | Ga0495581_0086789_62_994 | 304 |
| 784 | 3300047317 | Ga0495604_0002404 | Ga0495604_0002404_3846_4778 | 304 |
| 785 | 3300047317 | Ga0495604_0090384 | Ga0495604_0090384_547_1479 | 304 |
| 786 | 3300047319 | Ga0495674_0142647 | Ga0495674_0142647_586_1518 | 304 |
| 787 | 3300047321 | Ga0495676_0102548 | Ga0495676_0102548_276_1208 | 304 |
| 788 | 3300047322 | Ga0495680_0002651 | Ga0495680_0002651_16188_17120 | 304 |
| 789 | 3300047322 | Ga0495680_0070091 | Ga0495680_0070091_956_1888 | 304 |
| 790 | 3300047444 | Ga0495675_0005549 | Ga0495675_0005549_5020_5952 | 304 |
| 791 | 3300047471 | Ga0495684_0026505 | Ga0495684_0026505_1862_2794 | 304 |
| 792 | 3300047471 | Ga0495684_0048644 | Ga0495684_0048644_701_1633 | 304 |
| 793 | 3300047673 | Ga0495593_0052161 | Ga0495593_0052161_746_1678 | 304 |
| 794 | 3300048088 | Ga0495602_0139861 | Ga0495602_0139861_427_1359 | 304 |
| 795 | 3300048904 | Ga0496101_0093130 | Ga0496101_0093130_414_1346 | 304 |
| 796 | 3300048905 | Ga0496102_0037600 | Ga0496102_0037600_179_1111 | 304 |
| 797 | 3300048906 | Ga0496103_0049390 | Ga0496103_0049390_404_1336 | 304 |
| 798 | 3300048909 | Ga0496106_0019397 | Ga0496106_0019397_692_1624 | 304 |
| 799 | 3300048911 | Ga0496108_0314175 | Ga0496108_0314175_86_1018 | 304 |
| 800 | 3300048912 | Ga0496109_0051215 | Ga0496109_0051215_304_1236 | 304 |
| 801 | 3300048913 | Ga0496110_0054677 | Ga0496110_0054677_341_1273 | 304 |
| 802 | 3300048916 | Ga0496113_0017599 | Ga0496113_0017599_2221_3153 | 304 |
| 803 | 3300048918 | Ga0496115_0035422 | Ga0496115_0035422_2940_3872 | 304 |
| 804 | 3300048924 | Ga0496121_0048028 | Ga0496121_0048028_1408_2340 | 304 |
| 805 | 3300048929 | Ga0496126_0027923 | Ga0496126_0027923_36_968 | 304 |
| 806 | 3300050512 | nmdc:mga0n895_6563_c1 | nmdc:mga0n895_6563_c1_8049_8981 | 304 |
| 807 | 3300053077 | Ga0495601_0005899 | Ga0495601_0005899_543_1475 | 304 |
| 808 | 3300053084 | Ga0495595_0036278 | Ga0495595_0036278_80_1012 | 304 |
| 809 | 3300053084 | Ga0495595_0041733 | Ga0495595_0041733_70_1002 | 304 |
| 810 | 3300053085 | Ga0495619_0056155 | Ga0495619_0056155_1247_2179 | 304 |
| 811 | 3300005434 | Ga0070709_10014136 | Ga0070709_100141362 | 305 |
| 812 | 3300005435 | Ga0070714_100005721 | Ga0070714_1000057213 | 305 |
| 813 | 3300005436 | Ga0070713_100038058 | Ga0070713_1000380584 | 305 |
| 814 | 3300005436 | Ga0070713_100180134 | Ga0070713_1001801342 | 305 |
| 815 | 3300005437 | Ga0070710_10003900 | Ga0070710_100039001 | 305 |
| 816 | 3300005530 | Ga0070679_100029692 | Ga0070679_1000296922 | 305 |
| 817 | 3300006028 | Ga0070717_10104818 | Ga0070717_101048183 | 305 |
| 818 | 3300006175 | Ga0070712_100021018 | Ga0070712_1000210182 | 305 |
| 819 | 3300006852 | Ga0075433_10192730 | Ga0075433_101927301 | 305 |
| 820 | 3300009177 | Ga0105248_10134069 | Ga0105248_101340692 | 305 |
| 821 | 3300013105 | Ga0157369_10238188 | Ga0157369_102381882 | 305 |
| 822 | 3300013306 | Ga0163162_10524533 | Ga0163162_105245332 | 305 |
| 823 | 3300014968 | Ga0157379_10297994 | Ga0157379_102979942 | 305 |
| 824 | 3300025898 | Ga0207692_10010611 | Ga0207692_100106114 | 305 |
| 825 | 3300025906 | Ga0207699_10007536 | Ga0207699_100075363 | 305 |
| 826 | 3300025915 | Ga0207693_10008194 | Ga0207693_100081946 | 305 |
| 827 | 3300025915 | Ga0207693_10140716 | Ga0207693_101407162 | 305 |
| 828 | 3300025928 | Ga0207700_10011666 | Ga0207700_100116665 | 305 |
| 829 | 3300025928 | Ga0207700_10153850 | Ga0207700_101538501 | 305 |
| 830 | 3300025934 | Ga0207686_10090369 | Ga0207686_100903692 | 305 |
| 831 | 3300026121 | Ga0207683_10118271 | Ga0207683_101182712 | 305 |
| 832 | 3300031616 | Ga0307508_10000005 | Ga0307508_10000005144 | 305 |
| 833 | 3300031616 | Ga0307508_10021355 | Ga0307508_100213558 | 305 |
| 834 | 3300035111 | Ga0373923_0026956 | Ga0373923_0026956_812_1753 | 305 |
| 835 | 3300035117 | Ga0373953_0044992 | Ga0373953_0044992_426_1367 | 305 |
| 836 | 3300035118 | Ga0373954_0035689 | Ga0373954_0035689_704_1645 | 305 |
| 837 | 3300035172 | Ga0373955_0070712 | Ga0373955_0070712_224_1165 | 305 |
| 838 | 3300035410 | Ga0373924_0006137 | Ga0373924_0006137_1777_2718 | 305 |
| 839 | 3300035695 | Ga0373927_0146501 | Ga0373927_0146501_394_1329 | 305 |
| 840 | 3300035724 | Ga0373933_0016036 | Ga0373933_0016036_1851_2792 | 305 |
| 841 | 3300035725 | Ga0373947_0039675 | Ga0373947_0039675_1631_2569 | 305 |
| 842 | 3300037068 | Ga0373925_0074387 | Ga0373925_0074387_652_1593 | 305 |
| 843 | 3300037068 | Ga0373925_0158300 | Ga0373925_0158300_604_1542 | 305 |
| 844 | 3300046477 | Ga0495664_0003422 | Ga0495664_0003422_2425_3369 | 305 |
| 845 | 3300046511 | Ga0495608_0008830 | Ga0495608_0008830_1178_2119 | 305 |
| 846 | 3300046529 | Ga0495652_0095305 | Ga0495652_0095305_643_1587 | 305 |
| 847 | 3300046533 | Ga0495640_0092712 | Ga0495640_0092712_641_1579 | 305 |
| 848 | 3300046536 | Ga0495587_0020063 | Ga0495587_0020063_359_1303 | 305 |
| 849 | 3300046543 | Ga0495645_0026093 | Ga0495645_0026093_3034_3978 | 305 |
| 850 | 3300046559 | Ga0495667_0004876 | Ga0495667_0004876_6608_7549 | 305 |
| 851 | 3300046559 | Ga0495667_0054978 | Ga0495667_0054978_986_1930 | 305 |
| 852 | 3300046663 | Ga0495635_0034112 | Ga0495635_0034112_160_1104 | 305 |
| 853 | 3300046678 | Ga0495599_0014789 | Ga0495599_0014789_133_1077 | 305 |
| 854 | 3300046683 | Ga0495658_0253170 | Ga0495658_0253170_84_1022 | 305 |
| 855 | 3300046809 | Ga0495600_0082782 | Ga0495600_0082782_228_1169 | 305 |
| 856 | 3300047319 | Ga0495674_0007810 | Ga0495674_0007810_7013_7957 | 305 |
| 857 | 3300047322 | Ga0495680_0072484 | Ga0495680_0072484_978_1919 | 305 |
| 858 | 3300047444 | Ga0495675_0071843 | Ga0495675_0071843_720_1664 | 305 |
| 859 | 3300047471 | Ga0495684_0080492 | Ga0495684_0080492_527_1468 | 305 |
| 860 | 3300048088 | Ga0495602_0000299 | Ga0495602_0000299_38011_38955 | 305 |
| 861 | 3300048088 | Ga0495602_0077080 | Ga0495602_0077080_189_1130 | 305 |
| 862 | 3300053078 | Ga0495612_0001163 | Ga0495612_0001163_726_1670 | 305 |
| 863 | 3300053084 | Ga0495595_0097612 | Ga0495595_0097612_213_1154 | 305 |
| 864 | 3300053085 | Ga0495619_0100927 | Ga0495619_0100927_949_1893 | 305 |
| 865 | 3300035692 | Ga0373935_0167004 | Ga0373935_0167004_531_1475 | 306 |
| 866 | 3300006844 | Ga0075428_100010565 | Ga0075428_1000105655 | 308 |
| 867 | 3300006847 | Ga0075431_100029013 | Ga0075431_1000290134 | 308 |
| 868 | 3300006852 | Ga0075433_10017132 | Ga0075433_100171325 | 308 |
| 869 | 3300006880 | Ga0075429_100014342 | Ga0075429_1000143425 | 308 |
| 870 | 3300025961 | Ga0207712_10165793 | Ga0207712_101657932 | 308 |
| 871 | 3300027907 | Ga0207428_10021082 | Ga0207428_100210825 | 308 |
| 872 | 3300050511 | nmdc:mga08y16_222349_c1 | nmdc:mga08y16_222349_c1_805_1743 | 309 |
| 873 | 3300005457 | Ga0070662_100012116 | Ga0070662_1000121162 | 311 |
| 874 | 3300005844 | Ga0068862_100008683 | Ga0068862_1000086837 | 311 |
| 875 | 3300006844 | Ga0075428_100017963 | Ga0075428_1000179637 | 311 |
| 876 | 3300006852 | Ga0075433_10004066 | Ga0075433_100040668 | 311 |
| 877 | 3300025933 | Ga0207706_10050917 | Ga0207706_100509173 | 311 |
| 878 | 3300027907 | Ga0207428_10001363 | Ga0207428_1000136318 | 311 |
| 879 | 3300028380 | Ga0268265_10019399 | Ga0268265_100193993 | 311 |
| 880 | 3300042876 | Ga0451577_0003647 | Ga0451577_0003647_7033_7974 | 311 |
| 881 | 3300044673 | Ga0453683_0032513 | Ga0453683_0032513_1677_2618 | 311 |
| 882 | 3300045051 | Ga0451576_0007779 | Ga0451576_0007779_4521_5462 | 311 |
| 883 | 3300050511 | nmdc:mga08y16_1952_c1 | nmdc:mga08y16_1952_c1_7429_8370 | 311 |
| 884 | 3300050515 | nmdc:mga0a205_2135_c1 | nmdc:mga0a205_2135_c1_7070_8011 | 311 |
| 885 | 3300006846 | Ga0075430_100088391 | Ga0075430_1000883913 | 312 |
| 886 | 3300006847 | Ga0075431_100031288 | Ga0075431_1000312882 | 312 |
| 887 | 3300006931 | Ga0097620_100391329 | Ga0097620_1003913292 | 312 |
| 888 | 3300009147 | Ga0114129_10003240 | Ga0114129_100032405 | 312 |
| 889 | 3300025922 | Ga0207646_10007164 | Ga0207646_100071647 | 312 |
| 890 | 3300025922 | Ga0207646_10207485 | Ga0207646_102074852 | 312 |
| 891 | 3300042876 | Ga0451577_0144248 | Ga0451577_0144248_505_1443 | 312 |
| 892 | 3300044712 | Ga0453684_0033865 | Ga0453684_0033865_2920_3858 | 312 |
| 893 | 3300050507 | nmdc:mga05p37_13768_c1 | nmdc:mga05p37_13768_c1_2884_3822 | 312 |
| 894 | 3300050509 | nmdc:mga0qj67_30012_c1 | nmdc:mga0qj67_30012_c1_600_1538 | 312 |
| 895 | 3300050510 | nmdc:mga06r32_52069_c1 | nmdc:mga06r32_52069_c1_1184_2122 | 312 |
| 896 | 3300050511 | nmdc:mga08y16_540591_c1 | nmdc:mga08y16_540591_c1_54_1001 | 312 |
| 897 | 3300003203 | JGI25406J46586_10007226 | JGI25406J46586_100072262 | 314 |
| 898 | 3300005985 | Ga0081539_10000050 | Ga0081539_10000050235 | 314 |
| 899 | 3300006844 | Ga0075428_100010747 | Ga0075428_1000107479 | 314 |
| 900 | 3300006846 | Ga0075430_100122494 | Ga0075430_1001224942 | 314 |
| 901 | 3300006847 | Ga0075431_100009950 | Ga0075431_1000099504 | 314 |
| 902 | 3300006852 | Ga0075433_10002763 | Ga0075433_1000276316 | 314 |
| 903 | 3300006871 | Ga0075434_100040122 | Ga0075434_1000401225 | 314 |
| 904 | 3300006914 | Ga0075436_100002041 | Ga0075436_1000020411 | 314 |
| 905 | 3300007076 | Ga0075435_100242739 | Ga0075435_1002427392 | 314 |
| 906 | 3300037418 | Ga0395900_0041942 | Ga0395900_0041942_3613_4557 | 314 |
| 907 | 3300038443 | Ga0395901_0040438 | Ga0395901_0040438_1389_2333 | 314 |
| 908 | 3300050507 | nmdc:mga05p37_94672_c1 | nmdc:mga05p37_94672_c1_1555_2499 | 314 |
| 909 | 3300050508 | nmdc:mga09592_1890_c1 | nmdc:mga09592_1890_c1_11009_11953 | 314 |
| 910 | 3300050509 | nmdc:mga0qj67_40703_c1 | nmdc:mga0qj67_40703_c1_2242_3186 | 314 |
| 911 | 3300050510 | nmdc:mga06r32_633_c1 | nmdc:mga06r32_633_c1_14252_15196 | 314 |
| 912 | 3300050515 | nmdc:mga0a205_3306_c1 | nmdc:mga0a205_3306_c1_361_1305 | 314 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
PF00528
BPD_transp_1
Binding-protein-dependent transport system inner membrane component
103
265
0.89
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7cad-assembly1.cif.gz_A | mycobacterium smegmatis sugabc complex | 0.9319 | 32 | 310 |
| 8hpl-assembly1.cif.gz_A | lpqy-sugabc in state 1 | 0.9196 | 32 | 307 |
| 7cad-assembly1.cif.gz_A | mycobacterium smegmatis sugabc complex | 0.9159 | 32 | 310 |
| 8ja7-assembly1.cif.gz_A | cryo-em structure of mycobacterium tuberculosis lpqy-sugabc in complex with trehalose | 0.9071 | 32 | 307 |
| 8hps-assembly1.cif.gz_A | lpqy-sugabc in state 5 | 0.9008 | 32 | 311 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P71896_49_286_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.951 | 74 | 313 | 1.10.3720.10 |
| af_P0AFR7_53_289_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.95 | 73 | 312 | 1.10.3720.10 |
| af_P0AFR7_53_289_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9423 | 73 | 312 | 1.10.3720.10 |
| af_O53484_49_294_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9393 | 73 | 313 | 1.10.3720.10 |
| af_I6XFF3_60_302_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9364 | 74 | 313 | 1.10.3720.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A537JZM6-F1-model_v4 | Sugar ABC transporter permease | 0.9689 | 40 | 314 |
GO:0005886
GO:0055085 |
| AF-A0A2V6QB61-F1-model_v4 | ABC transporter permease | 0.9669 | 26 | 314 |
GO:0005886
GO:0055085 |
| AF-A0A529FPK8-F1-model_v4 | Sugar ABC transporter permease | 0.9661 | 52 | 306 |
GO:0005886
GO:0055085 |
| AF-A0A536Z2D9-F1-model_v4 | Sugar ABC transporter permease | 0.966 | 52 | 313 |
GO:0005886
GO:0055085 |
| AF-A0A2V3XZ74-F1-model_v4 | Carbohydrate ABC transporter membrane protein 1 (CUT1 family) | 0.9647 | 33 | 314 |
GO:0005886
GO:0055085 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar