F485485

General Info

Members Datasets Scaffolds Average Seq Length
911 379 869 438

Family's Representative Sequence

Representative Sequence 3300053092|Ga0500583_0000164|Ga0500583_0000164_19545_20978
Length 477
Sequence VGIKKVPYLIVTSHLHSVARSVYFLLIASFLKNFFSMNQKLHFETLQLHAGQQIDPTTKARAVPIYQTTSYGFDSSAHAADLFGLRTFGNIYTRIMNPTTDVFEQRMAALEGGVAALATSSGQAAQFLALNNIMQAGDNFVSTSYLYGGTYNQFKISFKRLGIDARFVEGDDAENFVKHIDKNTKAIYLETIGNPRLNIPDFEKFAQLAKDYDLPLIVDNTFGAGGYLFRPLEHGAHVVVESATKWIGGHGTAIGGVIIDGGNYNWGNGKFPQFTEPSEGYHGLKFWDVFGEGNPLGLPNIAFAIRARVEGLRDFGPSLSPFNSFLLLQGLETLSLRVQRHVDNALTLATWLQEHPQVEFVEYPGLNTSPYNDLARKYLTNGFGGILNFGIKGEKEKASAFIDSLKLASHLANVGDAKTLVIHPASTTHEQLSAEEQLVAGVRPNQIRISVGIEHIEDIKADFEQAFEKVFANQLVA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
4 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
5 2617270889 Nostoc punctiforme PCC 73102 Isolate Unclassified
6 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
7 2643221670 Streptomyces sp. Root431 Isolate Unclassified
8 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
9 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
10 2738541273 Elizabethkingia sp. YR214 Isolate Unclassified
11 2738541278 Niastella sp. CF465 Isolate Unclassified
12 2738541283 Pedobacter sp. OK701 Isolate Unclassified
13 2738541284 Pedobacter sp. YR016 Isolate Unclassified
14 2738543014 Elizabethkingia sp. YR191 Isolate Unclassified
15 2738543023 Pedobacter sp. OK628 Isolate Unclassified
16 2739367866 Hymenobacter sp. YR204 Isolate Unclassified
17 2818991444 Filimonas endophytica 3197 Isolate Unclassified
18 2839989709 Pontibacter arcticus 2b14 Isolate Unclassified
19 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
20 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
21 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
22 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
23 2890737413 Parapedobacter sp. SGR-10 Isolate Rhizosphere
24 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
25 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
26 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
27 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
28 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
29 2913844669 Nostocales cyanobacterium LEGE 12452 Isolate Unclassified
30 2913939268 Nostoc sp. LEGE 12447 Isolate Unclassified
31 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
32 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
33 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
34 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
35 2919692658 Algoriphagus sp. 4150 Isolate Rhizosphere
36 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
37 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
38 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
39 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
40 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
41 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified
42 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
43 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
44 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
45 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
46 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
47 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
48 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
49 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
50 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
51 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
52 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
53 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
54 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
55 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
56 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
57 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
58 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
59 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
60 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
61 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
62 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
63 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
64 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
65 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
66 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
67 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
68 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
69 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
70 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
71 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
72 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
73 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
74 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
75 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
76 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
77 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
78 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
79 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
80 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
81 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
82 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
83 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
84 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
85 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
86 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
87 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
88 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
89 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
90 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
91 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
92 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
93 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
94 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
95 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
96 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
97 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
98 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
99 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
100 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
101 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
102 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
103 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
104 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
105 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
106 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
107 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
108 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
109 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
110 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
111 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
112 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
113 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
114 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
115 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
116 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
117 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
118 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
119 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
120 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
121 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
122 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
123 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
124 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
125 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
126 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
127 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
128 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
129 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
130 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
131 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
132 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
133 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
134 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
135 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
136 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
137 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
138 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
139 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
140 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
141 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
142 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
143 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
144 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
145 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
146 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
148 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
149 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
150 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
151 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
152 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
156 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
201 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
205 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
206 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
207 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
208 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
209 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
210 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
211 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
212 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
213 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
214 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
215 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
216 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
217 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
218 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
219 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
220 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
221 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
222 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
223 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
224 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
225 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
226 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
227 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
228 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
229 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
230 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
231 3300031614 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI4 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
232 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
233 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
234 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
235 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
236 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
237 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
238 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
239 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
240 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
241 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
242 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
243 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
244 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
245 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
246 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
247 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
248 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
249 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
250 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
251 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
252 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
253 3300036535 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU6 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
254 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
255 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
256 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
257 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
258 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
259 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
260 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
261 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
262 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
263 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
264 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
265 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
266 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
267 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
268 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
269 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
270 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
271 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
272 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
273 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
274 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
275 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
276 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
277 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
278 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
279 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
280 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
281 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
282 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
283 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
284 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
285 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
286 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
287 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
288 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
289 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
290 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
291 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
292 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
293 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
294 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
295 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
296 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
297 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
298 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
299 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
300 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
301 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
302 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
303 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
304 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
305 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
306 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
307 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
308 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
309 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
310 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
311 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
312 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
313 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
314 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
315 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
316 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
317 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
318 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
319 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
320 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
321 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
322 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
323 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
324 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
325 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
326 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
327 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
328 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
329 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
330 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
331 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
332 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
333 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
334 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
335 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
336 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
337 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
338 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
339 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
340 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
341 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
342 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
343 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
344 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
345 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
346 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
347 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
348 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
349 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
350 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
351 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
352 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
353 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
354 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
355 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
356 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
357 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
358 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
359 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
360 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
361 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
362 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
363 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
364 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
365 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
366 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
367 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
368 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
369 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
370 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
371 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
372 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
373 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
374 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
375 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
376 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
377 642555144 Nostoc punctiforme PCC 73102 Isolate Unclassified
378 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere
379 8056440228 Flavobacterium hibisci THG-HG1.4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.73
Metatranscriptomes 0.66
Isolates 4.61

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.83
Nodule 0
Rhizoplane 0.55
Rhizosphere 88.47
Stem 0
Stem Tuber 0
Unclassified 6.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_308077 2162886007 Bacteria 7601
2 MBSR1b_contig_6741876 2162886012 Bacteria 1699
3 JGI24737J22298_10000733 3300001990 Bacteria 11561
4 JGI24735J21928_10000014 3300002067 Bacteria 186670
5 JGI25162J39368_1000020 3300002737 Bacteria 254723
6 JGI25162J39368_1001888 3300002737 Bacteria 9626
7 JGI25164J39214_1002648 3300002772 Bacteria 2607
8 JGI25165J46597_1000898 3300003214 Bacteria 20764
9 rootH1_10001098 3300003316 Bacteria 10436
10 rootH2_10002858 3300003320 Bacteria 54174
11 rootH2_10035181 3300003320 Bacteria 29518
12 rootL2_10163790 3300003322 Bacteria 2135
13 rootH1_10003699 3300003323 Bacteria 25103
14 rootH1_10017423 3300003323 Bacteria 3453
15 rootH1_10126862 3300003323 Bacteria 4549
16 JGI25160J50197_1003564 3300003354 Bacteria 6924
17 Ga0055536_1013049 3300003781 Bacteria 3029
18 Ga0065165_1000169 3300005262 Bacteria 115398
19 Ga0065165_1001340 3300005262 Bacteria 27256
20 Ga0065714_10002361 3300005288 Bacteria 37849
21 Ga0065714_10002919 3300005288 Bacteria 20677
22 Ga0065704_10000238 3300005289 Bacteria 87424
23 Ga0065704_10001141 3300005289 Bacteria 9730
24 Ga0065712_10001455 3300005290 Bacteria 6332
25 Ga0070658_10000011 3300005327 Bacteria 294396
26 Ga0070658_10037328 3300005327 Bacteria 3916
27 Ga0070658_10073847 3300005327 Bacteria 2797
28 Ga0070658_10088639 3300005327 Bacteria 2548
29 Ga0070676_10001211 3300005328 Bacteria 12929
30 Ga0070676_10002877 3300005328 Bacteria 8890
31 Ga0070683_100018837 3300005329 Bacteria 6123
32 Ga0070683_100159915 3300005329 Bacteria 2137
33 Ga0070670_100027222 3300005331 Bacteria 4918
34 Ga0070670_100038903 3300005331 Bacteria 4090
35 Ga0070670_100063646 3300005331 Bacteria 3166
36 Ga0070670_100078187 3300005331 Bacteria 2842
37 Ga0070670_100147645 3300005331 Bacteria 2035
38 Ga0068869_100016541 3300005334 Bacteria 4973
39 Ga0068869_100031202 3300005334 Bacteria 3748
40 Ga0068869_100038954 3300005334 Bacteria 3390
41 Ga0070666_10001123 3300005335 Bacteria 16300
42 Ga0070666_10006658 3300005335 Bacteria 7104
43 Ga0070680_100005777 3300005336 Bacteria 9391
44 Ga0070680_100041291 3300005336 Bacteria 3740
45 Ga0070680_100059914 3300005336 Bacteria 3115
46 Ga0070680_100068002 3300005336 Bacteria 2923
47 Ga0070680_100131695 3300005336 Bacteria 2093
48 Ga0070682_100003177 3300005337 Bacteria 9097
49 Ga0068868_100014216 3300005338 Bacteria 5862
50 Ga0068868_100136348 3300005338 Bacteria 2012
51 Ga0070660_100029365 3300005339 Bacteria 4120
52 Ga0070660_100052356 3300005339 Bacteria 3147
53 Ga0070660_100086977 3300005339 Bacteria 2460
54 Ga0070660_100123237 3300005339 Bacteria 2070
55 Ga0070691_10000930 3300005341 Bacteria 11888
56 Ga0070687_100030867 3300005343 Bacteria 2623
57 Ga0070687_100052188 3300005343 Bacteria 2121
58 Ga0070661_100018952 3300005344 Bacteria 4900
59 Ga0070692_10103083 3300005345 Bacteria 1567
60 Ga0070668_100004450 3300005347 Bacteria 10396
61 Ga0070669_100008200 3300005353 Bacteria 7461
62 Ga0070675_100007148 3300005354 Bacteria 8599
63 Ga0070675_100012647 3300005354 Bacteria 6621
64 Ga0070671_100094133 3300005355 Bacteria 2511
65 Ga0070671_100122779 3300005355 Bacteria 2186
66 Ga0070673_100001702 3300005364 Bacteria 13067
67 Ga0070673_100003548 3300005364 Bacteria 9732
68 Ga0070673_100029933 3300005364 Bacteria 4067
69 Ga0070673_100040799 3300005364 Bacteria 3563
70 Ga0070673_100117815 3300005364 Bacteria 2211
71 Ga0070688_100005858 3300005365 Bacteria 6504
72 Ga0070659_100021644 3300005366 Bacteria 4900
73 Ga0070659_100026196 3300005366 Bacteria 4485
74 Ga0070659_100042229 3300005366 Bacteria 3565
75 Ga0070659_100046953 3300005366 Bacteria 3385
76 Ga0070659_100247454 3300005366 Bacteria 1477
77 Ga0070667_100024412 3300005367 Bacteria 5021
78 Ga0070667_100077159 3300005367 Bacteria 2845
79 Ga0070667_100222451 3300005367 Bacteria 1680
80 Ga0070663_100028577 3300005455 Bacteria 3798
81 Ga0070663_100144121 3300005455 Bacteria 1821
82 Ga0070678_100007368 3300005456 Bacteria 6522
83 Ga0070662_100004667 3300005457 Bacteria 8690
84 Ga0070681_10142682 3300005458 Bacteria 2324
85 Ga0070681_10261627 3300005458 Bacteria 1642
86 Ga0068867_100006003 3300005459 Bacteria 8611
87 Ga0068867_100016922 3300005459 Bacteria 5181
88 Ga0068867_100028131 3300005459 Bacteria 4045
89 Ga0070679_100001254 3300005530 Bacteria 22385
90 Ga0070679_100010318 3300005530 Bacteria 8855
91 Ga0070679_100015447 3300005530 Bacteria 7337
92 Ga0070679_100199057 3300005530 Bacteria 1970
93 Ga0070684_100104674 3300005535 Bacteria 2532
94 Ga0070684_100119774 3300005535 Bacteria 2367
95 Ga0070684_100217623 3300005535 Bacteria 1742
96 Ga0068853_100016543 3300005539 Bacteria 6073
97 Ga0068853_100024401 3300005539 Bacteria 5069
98 Ga0068853_100068924 3300005539 Bacteria 3076
99 Ga0070672_100022405 3300005543 Bacteria 4640
100 Ga0070695_100112949 3300005545 Bacteria 1846
101 Ga0070665_100000003 3300005548 Bacteria 811857
102 Ga0070665_100000008 3300005548 Bacteria 606341
103 Ga0068855_100000727 3300005563 Bacteria 40453
104 Ga0068855_100000998 3300005563 Bacteria 35254
105 Ga0068855_100002579 3300005563 Bacteria 22327
106 Ga0068855_100010877 3300005563 Bacteria 10983
107 Ga0068855_100056698 3300005563 Bacteria 4595
108 Ga0068855_100094815 3300005563 Bacteria 3441
109 Ga0068855_100144948 3300005563 Bacteria 2704
110 Ga0068855_100180723 3300005563 Bacteria 2385
111 Ga0068855_100242163 3300005563 Bacteria 2015
112 Ga0068855_100378740 3300005563 Bacteria 1554
113 Ga0068857_100004830 3300005577 Bacteria 11421
114 Ga0068854_100031522 3300005578 Bacteria 3685
115 Ga0068856_100000259 3300005614 Bacteria 57810
116 Ga0068856_100003419 3300005614 Bacteria 16056
117 Ga0068856_100012928 3300005614 Bacteria 8080
118 Ga0068856_100110022 3300005614 Bacteria 2752
119 Ga0068852_100003639 3300005616 Bacteria 10799
120 Ga0068852_100005665 3300005616 Bacteria 8958
121 Ga0068852_100008807 3300005616 Bacteria 7466
122 Ga0068852_100024969 3300005616 Bacteria 4836
123 Ga0068852_100025420 3300005616 Bacteria 4798
124 Ga0068852_100068319 3300005616 Bacteria 3110
125 Ga0068852_100077757 3300005616 Bacteria 2934
126 Ga0068859_100000023 3300005617 Bacteria 221914
127 Ga0068859_100010680 3300005617 Bacteria 9241
128 Ga0068859_100020142 3300005617 Bacteria 6697
129 Ga0068859_100318554 3300005617 Bacteria 1649
130 Ga0068864_100000733 3300005618 Bacteria 27467
131 Ga0068864_100009349 3300005618 Bacteria 8085
132 Ga0068864_100043103 3300005618 Bacteria 3863
133 Ga0068866_10003738 3300005718 Bacteria 6241
134 Ga0068861_100040252 3300005719 Bacteria 3494
135 Ga0068861_100099963 3300005719 Bacteria 2305
136 Ga0068861_100189055 3300005719 Bacteria 1720
137 Ga0068851_10022987 3300005834 Bacteria 3044
138 Ga0068863_100027572 3300005841 Bacteria 5418
139 Ga0068863_100028175 3300005841 Bacteria 5362
140 Ga0068858_100003125 3300005842 Bacteria 16572
141 Ga0068858_100003981 3300005842 Bacteria 14582
142 Ga0068858_100098620 3300005842 Bacteria 2724
143 Ga0068858_100146325 3300005842 Bacteria 2219
144 Ga0068860_100000059 3300005843 Bacteria 196400
145 Ga0068860_100001384 3300005843 Bacteria 26311
146 Ga0068860_100024605 3300005843 Bacteria 5814
147 Ga0068860_100040343 3300005843 Bacteria 4462
148 Ga0068862_100004782 3300005844 Bacteria 11396
149 Ga0068862_100027564 3300005844 Bacteria 4782
150 Ga0068862_100213640 3300005844 Bacteria 1744
151 Ga0075366_10007290 3300006195 Bacteria 6099
152 Ga0075366_10032558 3300006195 Bacteria 3069
153 Ga0097621_100000020 3300006237 Bacteria 86226
154 Ga0097621_100000487 3300006237 Bacteria 27766
155 Ga0097621_100051390 3300006237 Bacteria 3355
156 Ga0097621_100064504 3300006237 Bacteria 3012
157 Ga0097621_100088581 3300006237 Bacteria 2586
158 Ga0097621_100115725 3300006237 Bacteria 2270
159 Ga0097621_100267105 3300006237 Unclassified 1502
160 Ga0068871_100000416 3300006358 Bacteria 29438
161 Ga0068871_100000598 3300006358 Bacteria 24790
162 Ga0068871_100013343 3300006358 Bacteria 6098
163 Ga0068871_100021887 3300006358 Bacteria 4922
164 Ga0068871_100027178 3300006358 Bacteria 4472
165 Ga0075431_100057971 3300006847 Bacteria 3994
166 Ga0075429_100049891 3300006880 Bacteria 3641
167 Ga0068865_100000208 3300006881 Bacteria 32611
168 Ga0068865_100004850 3300006881 Bacteria 8134
169 Ga0068865_100011685 3300006881 Bacteria 5501
170 Ga0097620_100000023 3300006931 Bacteria 221914
171 Ga0097620_100010683 3300006931 Bacteria 9241
172 Ga0097620_100020142 3300006931 Bacteria 6697
173 Ga0097620_100318566 3300006931 Bacteria 1649
174 Ga0105240_10000767 3300009093 Bacteria 58332
175 Ga0105240_10001584 3300009093 Bacteria 38608
176 Ga0105240_10007530 3300009093 Bacteria 15793
177 Ga0105240_10031042 3300009093 Bacteria 6934
178 Ga0105240_10049859 3300009093 Bacteria 5281
179 Ga0105240_10095335 3300009093 Bacteria 3628
180 Ga0105240_10102281 3300009093 Bacteria 3482
181 Ga0105240_10119990 3300009093 Bacteria 3167
182 Ga0105240_10171848 3300009093 Bacteria 2566
183 Ga0111539_10006433 3300009094 Bacteria 15147
184 Ga0111539_10011432 3300009094 Bacteria 11143
185 Ga0111539_10295731 3300009094 Bacteria 1884
186 Ga0105245_10050473 3300009098 Bacteria 3728
187 Ga0105247_10008227 3300009101 Bacteria 6363
188 Ga0105247_10009048 3300009101 Bacteria 6063
189 Ga0114129_10174564 3300009147 Bacteria 2928
190 Ga0105243_10000012 3300009148 Bacteria 300885
191 Ga0105243_10031803 3300009148 Bacteria 4071
192 Ga0105243_10074134 3300009148 Bacteria 2760
193 Ga0105243_10159239 3300009148 Bacteria 1945
194 Ga0105241_10000861 3300009174 Bacteria 23026
195 Ga0105241_10002514 3300009174 Bacteria 13768
196 Ga0105241_10018003 3300009174 Bacteria 5193
197 Ga0105241_10043565 3300009174 Bacteria 3399
198 Ga0105241_10096885 3300009174 Bacteria 2338
199 Ga0105241_10189405 3300009174 Bacteria 1712
200 Ga0105242_10059690 3300009176 Bacteria 3131
201 Ga0105242_10067351 3300009176 Bacteria 2960
202 Ga0105248_10013691 3300009177 Bacteria 8928
203 Ga0105248_10040274 3300009177 Bacteria 5237
204 Ga0105237_10000044 3300009545 Bacteria 177828
205 Ga0105237_10000356 3300009545 Bacteria 64629
206 Ga0105237_10000971 3300009545 Bacteria 38512
207 Ga0105237_10001449 3300009545 Bacteria 31348
208 Ga0105237_10001750 3300009545 Bacteria 28065
209 Ga0105237_10001907 3300009545 Bacteria 26596
210 Ga0105237_10004465 3300009545 Bacteria 16170
211 Ga0105237_10006762 3300009545 Bacteria 12655
212 Ga0105237_10006763 3300009545 Bacteria 12654
213 Ga0105237_10007600 3300009545 Bacteria 11844
214 Ga0105237_10007857 3300009545 Bacteria 11628
215 Ga0105237_10027387 3300009545 Bacteria 5819
216 Ga0105237_10079069 3300009545 Bacteria 3278
217 Ga0105237_10123090 3300009545 Bacteria 2588
218 Ga0105237_10135189 3300009545 Bacteria 2460
219 Ga0105238_10013311 3300009551 Bacteria 8299
220 Ga0105238_10053188 3300009551 Bacteria 4069
221 Ga0105238_10109459 3300009551 Bacteria 2744
222 Ga0105238_10169826 3300009551 Bacteria 2157
223 Ga0105249_10002037 3300009553 Bacteria 17526
224 Ga0105249_10006492 3300009553 Bacteria 10174
225 Ga0105249_10008554 3300009553 Bacteria 8924
226 Ga0105249_10010023 3300009553 Bacteria 8315
227 Ga0105249_10019997 3300009553 Bacteria 5978
228 Ga0105249_10056653 3300009553 Bacteria 3588
229 Ga0105249_10058903 3300009553 Bacteria 3522
230 Ga0105239_10000005 3300010375 Bacteria 496066
231 Ga0105239_10000013 3300010375 Bacteria 327371
232 Ga0105239_10000072 3300010375 Eukaryota 141600
233 Ga0105239_10000081 3300010375 Bacteria 133686
234 Ga0105239_10000259 3300010375 Bacteria 78760
235 Ga0105239_10001040 3300010375 Bacteria 38650
236 Ga0105239_10002120 3300010375 Bacteria 25598
237 Ga0105239_10002563 3300010375 Bacteria 23044
238 Ga0105239_10016008 3300010375 Bacteria 8300
239 Ga0105239_10031256 3300010375 Bacteria 5856
240 Ga0105239_10038296 3300010375 Bacteria 5254
241 Ga0105239_10038468 3300010375 Bacteria 5243
242 Ga0105239_10051224 3300010375 Bacteria 4526
243 Ga0105239_10060044 3300010375 Bacteria 4173
244 Ga0105239_10258127 3300010375 Bacteria 1958
245 Ga0157373_10000597 3300013100 Bacteria 28042
246 Ga0157373_10004754 3300013100 Bacteria 10220
247 Ga0157373_10019227 3300013100 Bacteria 4974
248 Ga0157373_10062478 3300013100 Bacteria 2638
249 Ga0157371_10000724 3300013102 Bacteria 38696
250 Ga0157371_10001349 3300013102 Bacteria 25843
251 Ga0157371_10001703 3300013102 Bacteria 22394
252 Ga0157371_10002487 3300013102 Bacteria 17524
253 Ga0157371_10003887 3300013102 Bacteria 13314
254 Ga0157371_10006631 3300013102 Bacteria 9493
255 Ga0157371_10008420 3300013102 Bacteria 8214
256 Ga0157371_10010626 3300013102 Bacteria 7151
257 Ga0157371_10022883 3300013102 Bacteria 4571
258 Ga0157371_10025530 3300013102 Bacteria 4304
259 Ga0157371_10041765 3300013102 Bacteria 3272
260 Ga0157371_10111945 3300013102 Bacteria 1937
261 Ga0157370_10001989 3300013104 Bacteria 25133
262 Ga0157370_10003763 3300013104 Bacteria 17707
263 Ga0157370_10005319 3300013104 Bacteria 14456
264 Ga0157370_10010139 3300013104 Bacteria 9950
265 Ga0157370_10012521 3300013104 Bacteria 8793
266 Ga0157370_10037184 3300013104 Bacteria 4719
267 Ga0157370_10040253 3300013104 Bacteria 4513
268 Ga0157369_10014216 3300013105 Bacteria 8992
269 Ga0157369_10024325 3300013105 Bacteria 6740
270 Ga0157369_10033374 3300013105 Bacteria 5657
271 Ga0157369_10039532 3300013105 Bacteria 5154
272 Ga0157369_10067870 3300013105 Bacteria 3832
273 Ga0157369_10113581 3300013105 Bacteria 2877
274 Ga0157369_10152866 3300013105 Unclassified 2439
275 Ga0157369_10188032 3300013105 Bacteria 2171
276 Ga0157374_10000723 3300013296 Bacteria 28842
277 Ga0157374_10125412 3300013296 Bacteria 2482
278 Ga0157374_10242437 3300013296 Bacteria 1773
279 Ga0157378_10004726 3300013297 Bacteria 11942
280 Ga0157378_10034883 3300013297 Bacteria 4448
281 Ga0157378_10073585 3300013297 Bacteria 3072
282 Ga0157378_10249580 3300013297 Bacteria 1698
283 Ga0157378_10307648 3300013297 Bacteria 1536
284 Ga0163162_10000066 3300013306 Bacteria 100009
285 Ga0163162_10000164 3300013306 Bacteria 60866
286 Ga0163162_10000373 3300013306 Bacteria 40682
287 Ga0163162_10000697 3300013306 Bacteria 31013
288 Ga0163162_10000856 3300013306 Bacteria 28341
289 Ga0163162_10001561 3300013306 Bacteria 21390
290 Ga0163162_10004336 3300013306 Bacteria 13656
291 Ga0163162_10007340 3300013306 Bacteria 10714
292 Ga0163162_10013198 3300013306 Bacteria 8069
293 Ga0163162_10180640 3300013306 Bacteria 2236
294 Ga0163162_10202005 3300013306 Unclassified 2116
295 Ga0163162_10346582 3300013306 Bacteria 1618
296 Ga0157372_10000676 3300013307 Bacteria 37536
297 Ga0157372_10001143 3300013307 Bacteria 28799
298 Ga0157372_10004620 3300013307 Bacteria 14640
299 Ga0157372_10005956 3300013307 Bacteria 12962
300 Ga0157372_10022840 3300013307 Bacteria 6773
301 Ga0157372_10022931 3300013307 Bacteria 6761
302 Ga0157372_10062402 3300013307 Bacteria 4175
303 Ga0157372_10094460 3300013307 Bacteria 3405
304 Ga0157372_10100848 3300013307 Bacteria 3295
305 Ga0157372_10202863 3300013307 Bacteria 2297
306 Ga0157372_10359662 3300013307 Bacteria 1696
307 Ga0157375_10000383 3300013308 Bacteria 40397
308 Ga0157375_10019253 3300013308 Bacteria 6205
309 Ga0157375_10041242 3300013308 Bacteria 4455
310 Ga0157375_10122099 3300013308 Unclassified 2716
311 Ga0157375_10127950 3300013308 Bacteria 2657
312 Ga0163163_10000560 3300014325 Bacteria 32679
313 Ga0163163_10002931 3300014325 Bacteria 14436
314 Ga0163163_10144484 3300014325 Unclassified 2422
315 Ga0157380_10001590 3300014326 Bacteria 14970
316 Ga0182008_10000010 3300014497 Bacteria 301527
317 Ga0182008_10003765 3300014497 Bacteria 9034
318 Ga0157377_10004008 3300014745 Bacteria 6716
319 Ga0157377_10057473 3300014745 Bacteria 2212
320 Ga0157379_10034273 3300014968 Bacteria 4525
321 Ga0157376_10002437 3300014969 Bacteria 12579
322 Ga0157376_10003607 3300014969 Bacteria 10680
323 Ga0157376_10029923 3300014969 Bacteria 4340
324 Ga0157376_10036441 3300014969 Bacteria 3985
325 Ga0182006_1026019 3300015261 Bacteria 2399
326 Ga0182007_10010906 3300015262 Bacteria 3563
327 Ga0183373_1010 3300015682 Bacteria 196982
328 Ga0163161_10001190 3300017792 Bacteria 19553
329 Ga0163161_10067587 3300017792 Bacteria 2610
330 Ga0206351_10002408 3300020077 Bacteria 2600
331 Ga0206350_10114900 3300020080 Bacteria 1917
332 Ga0154015_1295413 3300020610 Bacteria 2058
333 Ga0209563_103756 3300025230 Bacteria 3056
334 Ga0207427_100785 3300025231 Bacteria 14472
335 Ga0209437_100085 3300025233 Bacteria 254790
336 Ga0209437_100101 3300025233 Bacteria 226668
337 Ga0209646_1001361 3300025246 Bacteria 6739
338 Ga0209026_1000987 3300025250 Bacteria 14160
339 Ga0209026_1001037 3300025250 Bacteria 13605
340 Ga0209233_1000124 3300025261 Bacteria 226743
341 Ga0209455_1004434 3300025272 Bacteria 4600
342 Ga0209676_1000329 3300025292 Bacteria 91571
343 Ga0209050_1008696 3300025298 Bacteria 5357
344 Ga0209050_1024684 3300025298 Bacteria 2070
345 Ga0207426_1000040 3300025302 Bacteria 433920
346 Ga0209257_1000299 3300025304 Bacteria 108881
347 Ga0207656_10025276 3300025321 Bacteria 2409
348 Ga0207710_10002430 3300025900 Bacteria 8659
349 Ga0207680_10000568 3300025903 Bacteria 17460
350 Ga0207647_10030716 3300025904 Bacteria 3463
351 Ga0207645_10000542 3300025907 Bacteria 31431
352 Ga0207645_10000544 3300025907 Bacteria 31399
353 Ga0207645_10124726 3300025907 Bacteria 1673
354 Ga0207705_10000015 3300025909 Bacteria 382901
355 Ga0207705_10002903 3300025909 Bacteria 13109
356 Ga0207705_10007368 3300025909 Bacteria 8088
357 Ga0207705_10036116 3300025909 Bacteria 3536
358 Ga0207705_10151766 3300025909 Bacteria 1736
359 Ga0207654_10002706 3300025911 Bacteria 8996
360 Ga0207654_10038517 3300025911 Bacteria 2683
361 Ga0207654_10038897 3300025911 Bacteria 2672
362 Ga0207707_10002565 3300025912 Bacteria 16286
363 Ga0207707_10072069 3300025912 Bacteria 3011
364 Ga0207695_10000170 3300025913 Bacteria 192469
365 Ga0207695_10000425 3300025913 Bacteria 93523
366 Ga0207695_10000916 3300025913 Bacteria 52837
367 Ga0207695_10011968 3300025913 Bacteria 10442
368 Ga0207695_10016283 3300025913 Bacteria 8709
369 Ga0207695_10070758 3300025913 Bacteria 3564
370 Ga0207695_10086253 3300025913 Bacteria 3167
371 Ga0207695_10114967 3300025913 Bacteria 2666
372 Ga0207695_10238178 3300025913 Bacteria 1722
373 Ga0207671_10000004 3300025914 Bacteria 1022356
374 Ga0207671_10001803 3300025914 Bacteria 23938
375 Ga0207671_10001864 3300025914 Bacteria 23482
376 Ga0207671_10002376 3300025914 Bacteria 20227
377 Ga0207671_10006717 3300025914 Bacteria 10189
378 Ga0207671_10007521 3300025914 Bacteria 9442
379 Ga0207671_10007560 3300025914 Bacteria 9410
380 Ga0207671_10007647 3300025914 Bacteria 9335
381 Ga0207671_10010890 3300025914 Bacteria 7455
382 Ga0207671_10011739 3300025914 Bacteria 7098
383 Ga0207671_10019488 3300025914 Bacteria 5187
384 Ga0207671_10044618 3300025914 Bacteria 3279
385 Ga0207663_10002822 3300025916 Bacteria 8385
386 Ga0207660_10008582 3300025917 Bacteria 6611
387 Ga0207660_10042766 3300025917 Bacteria 3181
388 Ga0207660_10049766 3300025917 Bacteria 2973
389 Ga0207662_10022892 3300025918 Bacteria 3586
390 Ga0207657_10008447 3300025919 Bacteria 10445
391 Ga0207657_10016158 3300025919 Bacteria 7206
392 Ga0207657_10057719 3300025919 Bacteria 3344
393 Ga0207657_10172084 3300025919 Bacteria 1754
394 Ga0207649_10042136 3300025920 Bacteria 2783
395 Ga0207652_10000337 3300025921 Bacteria 48786
396 Ga0207652_10002860 3300025921 Bacteria 14452
397 Ga0207652_10020852 3300025921 Bacteria 5402
398 Ga0207652_10032090 3300025921 Bacteria 4412
399 Ga0207694_10038631 3300025924 Bacteria 3671
400 Ga0207694_10050652 3300025924 Bacteria 3217
401 Ga0207694_10092164 3300025924 Bacteria 2392
402 Ga0207650_10067551 3300025925 Bacteria 2683
403 Ga0207659_10023637 3300025926 Unclassified 4105
404 Ga0207644_10024181 3300025931 Unclassified 4168
405 Ga0207644_10068752 3300025931 Bacteria 2585
406 Ga0207690_10112169 3300025932 Bacteria 1966
407 Ga0207706_10002738 3300025933 Bacteria 17152
408 Ga0207706_10009939 3300025933 Bacteria 8721
409 Ga0207706_10036819 3300025933 Bacteria 4346
410 Ga0207709_10000006 3300025935 Bacteria 800946
411 Ga0207709_10080165 3300025935 Bacteria 2101
412 Ga0207709_10119077 3300025935 Bacteria 1779
413 Ga0207704_10000512 3300025938 Bacteria 17246
414 Ga0207704_10009752 3300025938 Bacteria 4650
415 Ga0207691_10000060 3300025940 Bacteria 86844
416 Ga0207691_10223802 3300025940 Bacteria 1631
417 Ga0207711_10044751 3300025941 Bacteria 3780
418 Ga0207711_10066146 3300025941 Bacteria 3126
419 Ga0207689_10005494 3300025942 Bacteria 11337
420 Ga0207689_10006819 3300025942 Bacteria 10044
421 Ga0207689_10018897 3300025942 Bacteria 5812
422 Ga0207667_10000020 3300025949 Bacteria 374770
423 Ga0207667_10001127 3300025949 Bacteria 33693
424 Ga0207667_10001491 3300025949 Bacteria 29391
425 Ga0207667_10002289 3300025949 Bacteria 24067
426 Ga0207667_10014074 3300025949 Bacteria 9132
427 Ga0207667_10020765 3300025949 Bacteria 7296
428 Ga0207667_10056182 3300025949 Bacteria 4136
429 Ga0207667_10060829 3300025949 Bacteria 3953
430 Ga0207667_10072509 3300025949 Bacteria 3579
431 Ga0207667_10085791 3300025949 Bacteria 3259
432 Ga0207667_10139059 3300025949 Bacteria 2500
433 Ga0207667_10277008 3300025949 Bacteria 1714
434 Ga0207651_10013175 3300025960 Bacteria 4719
435 Ga0207651_10017395 3300025960 Bacteria 4248
436 Ga0207651_10052572 3300025960 Bacteria 2778
437 Ga0207651_10199908 3300025960 Bacteria 1601
438 Ga0207712_10089110 3300025961 Bacteria 2267
439 Ga0207712_10150765 3300025961 Bacteria 1796
440 Ga0207712_10186025 3300025961 Bacteria 1636
441 Ga0207668_10030727 3300025972 Bacteria 3532
442 Ga0207658_10001199 3300025986 Bacteria 20672
443 Ga0207658_10022335 3300025986 Unclassified 4405
444 Ga0207677_10012534 3300026023 Bacteria 4878
445 Ga0207677_10038042 3300026023 Bacteria 3150
446 Ga0207677_10114976 3300026023 Bacteria 2012
447 Ga0207703_10008491 3300026035 Bacteria 8116
448 Ga0207703_10059028 3300026035 Bacteria 3134
449 Ga0207639_10019114 3300026041 Bacteria 4880
450 Ga0207639_10020628 3300026041 Bacteria 4720
451 Ga0207639_10021022 3300026041 Bacteria 4681
452 Ga0207639_10034523 3300026041 Bacteria 3738
453 Ga0207639_10220561 3300026041 Bacteria 1637
454 Ga0207678_10008280 3300026067 Bacteria 9160
455 Ga0207702_10000820 3300026078 Bacteria 32858
456 Ga0207702_10036846 3300026078 Bacteria 4092
457 Ga0207702_10078276 3300026078 Bacteria 2862
458 Ga0207702_10085244 3300026078 Bacteria 2752
459 Ga0207702_10122965 3300026078 Bacteria 2325
460 Ga0207641_10000250 3300026088 Bacteria 68774
461 Ga0207641_10003961 3300026088 Bacteria 12936
462 Ga0207641_10025863 3300026088 Bacteria 4841
463 Ga0207641_10031708 3300026088 Bacteria 4384
464 Ga0207648_10003642 3300026089 Bacteria 16123
465 Ga0207648_10004739 3300026089 Bacteria 13898
466 Ga0207648_10064738 3300026089 Bacteria 3186
467 Ga0207648_10073470 3300026089 Unclassified 2980
468 Ga0207676_10013473 3300026095 Bacteria 5874
469 Ga0207676_10109544 3300026095 Bacteria 2308
470 Ga0207674_10004594 3300026116 Bacteria 16575
471 Ga0207674_10191636 3300026116 Bacteria 1994
472 Ga0207674_10209049 3300026116 Bacteria 1901
473 Ga0207674_10224157 3300026116 Bacteria 1828
474 Ga0207675_100000599 3300026118 Bacteria 35195
475 Ga0207675_100022077 3300026118 Bacteria 5925
476 Ga0207675_100105979 3300026118 Bacteria 2650
477 Ga0207698_10002595 3300026142 Bacteria 10744
478 Ga0207698_10024598 3300026142 Bacteria 4230
479 Ga0207698_10067134 3300026142 Bacteria 2827
480 Ga0207698_10072052 3300026142 Bacteria 2745
481 Ga0207698_10294430 3300026142 Bacteria 1508
482 Ga0207428_10057977 3300027907 Bacteria 3074
483 Ga0268266_10000016 3300028379 Bacteria 629101
484 Ga0268266_10000052 3300028379 Bacteria 296230
485 Ga0268266_10039046 3300028379 Bacteria 4043
486 Ga0268266_10157587 3300028379 Unclassified 2052
487 Ga0268265_10022155 3300028380 Bacteria 4459
488 Ga0268265_10068788 3300028380 Bacteria 2747
489 Ga0268264_10000015 3300028381 Bacteria 508501
490 Ga0268264_10001580 3300028381 Bacteria 21079
491 Ga0268264_10003253 3300028381 Bacteria 14053
492 Ga0268264_10038610 3300028381 Bacteria 3941
493 Ga0265337_1000681 3300028556 Bacteria 17912
494 Ga0265326_10000758 3300028558 Bacteria 11952
495 Ga0265326_10003795 3300028558 Bacteria 4924
496 Ga0265319_1000297 3300028563 Bacteria 36855
497 Ga0265319_1002577 3300028563 Bacteria 9787
498 Ga0265334_10001759 3300028573 Bacteria 10350
499 Ga0265334_10004780 3300028573 Bacteria 5952
500 Ga0265318_10015518 3300028577 Bacteria 3167
501 Ga0265318_10032088 3300028577 Bacteria 2034
502 Ga0265323_10000395 3300028653 Bacteria 25117
503 Ga0265323_10001271 3300028653 Bacteria 12634
504 Ga0265323_10012792 3300028653 Bacteria 3358
505 Ga0265323_10017597 3300028653 Bacteria 2774
506 Ga0265322_10005276 3300028654 Bacteria 3825
507 Ga0265322_10005878 3300028654 Bacteria 3618
508 Ga0265336_10000194 3300028666 Bacteria 42728
509 Ga0265336_10026823 3300028666 Bacteria 1808
510 Ga0307517_10008552 3300028786 Bacteria 14661
511 Ga0307517_10015597 3300028786 Bacteria 10079
512 Ga0307515_10000057 3300028794 Bacteria 261695
513 Ga0307515_10000133 3300028794 Bacteria 176091
514 Ga0307515_10000432 3300028794 Bacteria 100348
515 Ga0307515_10001738 3300028794 Bacteria 48492
516 Ga0265338_10000273 3300028800 Bacteria 94209
517 Ga0265338_10000527 3300028800 Bacteria 67253
518 Ga0265338_10002518 3300028800 Bacteria 27237
519 Ga0265338_10006323 3300028800 Bacteria 15136
520 Ga0265338_10008747 3300028800 Bacteria 12237
521 Ga0265338_10016341 3300028800 Bacteria 8083
522 Ga0265338_10030132 3300028800 Bacteria 5356
523 Ga0265338_10063636 3300028800 Bacteria 3215
524 Ga0265324_10001372 3300029957 Bacteria 14108
525 Ga0265324_10007618 3300029957 Bacteria 4368
526 Ga0316183_1126735 3300030742 Bacteria 6783
527 Ga0316181_1118713 3300030744 Bacteria 3631
528 Ga0265330_10001086 3300031235 Bacteria 16394
529 Ga0265330_10025643 3300031235 Bacteria 2671
530 Ga0265332_10001653 3300031238 Bacteria 12173
531 Ga0265332_10007014 3300031238 Bacteria 5100
532 Ga0265320_10000494 3300031240 Bacteria 30746
533 Ga0265320_10005528 3300031240 Bacteria 8105
534 Ga0265325_10010739 3300031241 Bacteria 5285
535 Ga0265325_10012429 3300031241 Bacteria 4868
536 Ga0265340_10002804 3300031247 Bacteria 9917
537 Ga0265339_10007060 3300031249 Bacteria 7291
538 Ga0265331_10058487 3300031250 Bacteria 1825
539 Ga0265327_10000618 3300031251 Bacteria 58585
540 Ga0265327_10008002 3300031251 Bacteria 7987
541 Ga0265327_10072023 3300031251 Bacteria 1727
542 Ga0265316_10005060 3300031344 Bacteria 12935
543 Ga0265316_10077499 3300031344 Unclassified 2553
544 Ga0307513_10147438 3300031456 Bacteria 2269
545 Ga0307509_10010102 3300031507 Bacteria 11636
546 Ga0307509_10072885 3300031507 Bacteria 3577
547 Ga0307408_100001775 3300031548 Bacteria 15744
548 Ga0265313_10004678 3300031595 Bacteria 10336
549 Ga0265313_10005311 3300031595 Bacteria 9523
550 Ga0265313_10012195 3300031595 Bacteria 5275
551 Ga0310103_105240 3300031614 Eukaryota 1710
552 Ga0265314_10006023 3300031711 Bacteria 10804
553 Ga0265342_10001151 3300031712 Bacteria 25226
554 Ga0265342_10100515 3300031712 Bacteria 1648
555 Ga0316576_10002660 3300031727 Bacteria 10212
556 Ga0316576_10057544 3300031727 Bacteria 2841
557 Ga0316576_10065179 3300031727 Bacteria 2677
558 Ga0316576_10085185 3300031727 Bacteria 2349
559 Ga0316578_10000458 3300031728 Bacteria 13584
560 Ga0316578_10027250 3300031728 Bacteria 3229
561 Ga0316578_10081680 3300031728 Bacteria 1923
562 Ga0307516_10002738 3300031730 Bacteria 23246
563 Ga0307405_10163947 3300031731 Bacteria 1578
564 Ga0316577_10005407 3300031733 Bacteria 6699
565 Ga0316577_10005994 3300031733 Bacteria 6405
566 Ga0307412_10000018 3300031911 Bacteria 284374
567 Ga0307412_10091651 3300031911 Bacteria 2128
568 Ga0307409_100051015 3300031995 Bacteria 3164
569 Ga0307414_10000392 3300032004 Bacteria 23857
570 Ga0307414_10000393 3300032004 Bacteria 23776
571 Ga0307414_10022716 3300032004 Bacteria 3963
572 Ga0307414_10030980 3300032004 Bacteria 3501
573 Ga0307414_10051783 3300032004 Bacteria 2852
574 Ga0307414_10055507 3300032004 Bacteria 2774
575 Ga0307414_10221590 3300032004 Bacteria 1553
576 Ga0307507_10000064 3300033179 Bacteria 161226
577 Ga0307510_10005874 3300033180 Bacteria 14639
578 Ga0307510_10007411 3300033180 Bacteria 13083
579 Ga0373934_0001565 3300035086 Bacteria 8391
580 Ga0373923_0036491 3300035111 Bacteria 2006
581 Ga0373954_0046145 3300035118 Bacteria 2036
582 Ga0373956_0064778 3300035119 Bacteria 1659
583 Ga0373957_0041473 3300035120 Bacteria 1733
584 Ga0316574_0009680 3300035398 Bacteria 5409
585 Ga0316574_0178878 3300035398 Bacteria 1365
586 Ga0373927_0005089 3300035695 Bacteria 9100
587 Ga0373933_0007494 3300035724 Bacteria 5959
588 Ga0373937_0013067 3300036401 Bacteria 7313
589 Ga0310110_009579 3300036535 Eukaryota 1419
590 Ga0316582_0000862 3300036647 Bacteria 12362
591 Ga0316584_0000202 3300036712 Bacteria 29256
592 Ga0316584_0000530 3300036712 Bacteria 20366
593 Ga0316584_0043722 3300036712 Bacteria 3341
594 Ga0373925_0027719 3300037068 Bacteria 4147
595 Ga0395899_0002054 3300037312 Bacteria 16582
596 Ga0395899_0006794 3300037312 Bacteria 8865
597 Ga0395899_0017979 3300037312 Bacteria 5379
598 Ga0395899_0061038 3300037312 Bacteria 2776
599 Ga0395899_0088854 3300037312 Bacteria 2241
600 Ga0395900_0005501 3300037418 Bacteria 13258
601 Ga0395900_0005682 3300037418 Bacteria 13040
602 Ga0395900_0007296 3300037418 Bacteria 11434
603 Ga0395900_0029586 3300037418 Bacteria 5619
604 Ga0395900_0124774 3300037418 Bacteria 2640
605 Ga0395900_0153735 3300037418 Bacteria 2350
606 Ga0395900_0277274 3300037418 Bacteria 1670
607 Ga0395898_0009433 3300037466 Bacteria 10251
608 Ga0395898_0039456 3300037466 Bacteria 4674
609 Ga0395898_0130890 3300037466 Bacteria 2403
610 Ga0395905_0000516 3300037471 Bacteria 52868
611 Ga0395905_0001254 3300037471 Bacteria 31416
612 Ga0395905_0036571 3300037471 Bacteria 4611
613 Ga0395901_0000861 3300038443 Bacteria 33403
614 Ga0395901_0003324 3300038443 Bacteria 16201
615 Ga0395901_0136614 3300038443 Bacteria 2576
616 Ga0395901_0226951 3300038443 Bacteria 1951
617 Ga0400485_16601 3300038735 Bacteria 5179
618 Ga0400483_039122 3300039062 Bacteria 2017
619 Ga0436361_0539750 3300039447 Bacteria 15869
620 Ga0439439_0028272 3300041406 Bacteria 1419
621 Ga0451853_2051003 3300041512 Bacteria 2181
622 Ga0450898_003736 3300042134 Bacteria 2204
623 Ga0451577_0000072 3300042876 Bacteria 237934
624 Ga0451577_0000202 3300042876 Bacteria 124050
625 Ga0451577_0000217 3300042876 Bacteria 119582
626 Ga0451577_0000364 3300042876 Bacteria 84063
627 Ga0451577_0000509 3300042876 Bacteria 65250
628 Ga0451577_0000954 3300042876 Bacteria 42396
629 Ga0451577_0002430 3300042876 Bacteria 22208
630 Ga0451577_0012393 3300042876 Bacteria 8008
631 Ga0451577_0018198 3300042876 Bacteria 6474
632 Ga0451577_0060152 3300042876 Bacteria 3387
633 Ga0451577_0069804 3300042876 Bacteria 3134
634 Ga0451577_0076157 3300042876 Bacteria 2992
635 Ga0451577_0085788 3300042876 Bacteria 2809
636 Ga0451577_0097992 3300042876 Bacteria 2619
637 Ga0451577_0128676 3300042876 Unclassified 2271
638 Ga0451577_0137791 3300042876 Bacteria 2192
639 Ga0451577_0151581 3300042876 Unclassified 2086
640 Ga0451577_0345532 3300042876 Bacteria 1350
641 Ga0466972_0000205 3300044658 Bacteria 43008
642 Ga0466972_0000946 3300044658 Bacteria 13963
643 Ga0453683_0000139 3300044673 Bacteria 105329
644 Ga0453683_0000178 3300044673 Bacteria 88310
645 Ga0453683_0000476 3300044673 Bacteria 46055
646 Ga0453683_0000625 3300044673 Bacteria 38567
647 Ga0453683_0001467 3300044673 Bacteria 20284
648 Ga0453683_0003005 3300044673 Bacteria 12626
649 Ga0453683_0005318 3300044673 Bacteria 8996
650 Ga0453683_0010590 3300044673 Bacteria 6106
651 Ga0453683_0010664 3300044673 Bacteria 6085
652 Ga0453683_0017963 3300044673 Bacteria 4543
653 Ga0453683_0029661 3300044673 Bacteria 3458
654 Ga0453683_0040902 3300044673 Bacteria 2910
655 Ga0453683_0099936 3300044673 Bacteria 1821
656 Ga0453684_0000004 3300044712 Bacteria 1469893
657 Ga0453684_0000081 3300044712 Bacteria 402985
658 Ga0453684_0000086 3300044712 Bacteria 397278
659 Ga0453684_0000186 3300044712 Bacteria 273302
660 Ga0453684_0000337 3300044712 Bacteria 195296
661 Ga0453684_0000393 3300044712 Bacteria 179711
662 Ga0453684_0000608 3300044712 Bacteria 131904
663 Ga0453684_0000630 3300044712 Bacteria 128059
664 Ga0453684_0001006 3300044712 Bacteria 91343
665 Ga0453684_0001244 3300044712 Bacteria 77266
666 Ga0453684_0001377 3300044712 Bacteria 70373
667 Ga0453684_0002144 3300044712 Bacteria 49481
668 Ga0453684_0004157 3300044712 Bacteria 31323
669 Ga0453684_0004417 3300044712 Bacteria 29726
670 Ga0453684_0005203 3300044712 Bacteria 26128
671 Ga0453684_0005297 3300044712 Bacteria 25730
672 Ga0453684_0006234 3300044712 Bacteria 22857
673 Ga0453684_0007491 3300044712 Bacteria 20033
674 Ga0453684_0009673 3300044712 Bacteria 16788
675 Ga0453684_0013156 3300044712 Bacteria 13492
676 Ga0453684_0013250 3300044712 Bacteria 13430
677 Ga0453684_0017180 3300044712 Bacteria 11238
678 Ga0453684_0018143 3300044712 Bacteria 10831
679 Ga0453684_0019610 3300044712 Bacteria 10277
680 Ga0453684_0022403 3300044712 Bacteria 9373
681 Ga0453684_0026462 3300044712 Bacteria 8375
682 Ga0453684_0030202 3300044712 Bacteria 7663
683 Ga0453684_0030327 3300044712 Bacteria 7643
684 Ga0453684_0030674 3300044712 Bacteria 7586
685 Ga0453684_0041170 3300044712 Bacteria 6255
686 Ga0453684_0045474 3300044712 Bacteria 5856
687 Ga0453684_0058981 3300044712 Bacteria 4953
688 Ga0453684_0059245 3300044712 Bacteria 4939
689 Ga0453684_0067008 3300044712 Bacteria 4568
690 Ga0453684_0077277 3300044712 Unclassified 4175
691 Ga0453684_0096362 3300044712 Bacteria 3635
692 Ga0453684_0120378 3300044712 Bacteria 3171
693 Ga0453684_0139207 3300044712 Bacteria 2901
694 Ga0453684_0186360 3300044712 Bacteria 2431
695 Ga0453684_0255106 3300044712 Bacteria 2012
696 Ga0453684_0289366 3300044712 Bacteria 1866
697 Ga0453684_0301019 3300044712 Bacteria 1823
698 Ga0466968_0016433 3300044735 Bacteria 2947
699 Ga0466970_0000529 3300044765 Bacteria 18707
700 Ga0466957_0001121 3300044842 Bacteria 13866
701 Ga0451576_0000065 3300045051 Bacteria 274445
702 Ga0451576_0000083 3300045051 Bacteria 236908
703 Ga0451576_0000145 3300045051 Bacteria 179711
704 Ga0451576_0000294 3300045051 Bacteria 122276
705 Ga0451576_0000683 3300045051 Bacteria 69004
706 Ga0451576_0000729 3300045051 Bacteria 66020
707 Ga0451576_0001394 3300045051 Bacteria 41542
708 Ga0451576_0007238 3300045051 Bacteria 13361
709 Ga0451576_0009193 3300045051 Bacteria 11482
710 Ga0451576_0011975 3300045051 Bacteria 9798
711 Ga0451576_0051793 3300045051 Bacteria 4303
712 Ga0451576_0069951 3300045051 Bacteria 3653
713 Ga0451576_0080236 3300045051 Bacteria 3395
714 Ga0451576_0115641 3300045051 Bacteria 2792
715 Ga0451576_0322578 3300045051 Bacteria 1616
716 Ga0466967_0208069 3300045976 Bacteria 1855
717 Ga0495638_0000001 3300046460 Bacteria 1114121
718 Ga0495638_0028055 3300046460 Bacteria 3638
719 Ga0495651_0052900 3300046462 Bacteria 3127
720 Ga0495651_0098879 3300046462 Bacteria 2176
721 Ga0495653_0266227 3300046463 Bacteria 1131
722 Ga0495650_0000003 3300046471 Bacteria 900730
723 Ga0495580_0010183 3300046472 Bacteria 7339
724 Ga0495580_0016439 3300046472 Bacteria 5552
725 Ga0495585_0000085 3300046492 Bacteria 97836
726 Ga0495585_0001006 3300046492 Bacteria 23544
727 Ga0495606_0000002 3300046507 Bacteria 554637
728 Ga0495606_0005474 3300046507 Bacteria 12155
729 Ga0495606_0016294 3300046507 Bacteria 5675
730 Ga0495608_0050979 3300046511 Bacteria 2744
731 Ga0495610_0023746 3300046512 Bacteria 3324
732 Ga0495616_0005113 3300046513 Bacteria 8150
733 Ga0495616_0006849 3300046513 Bacteria 6865
734 Ga0495628_0004159 3300046516 Bacteria 12878
735 Ga0495631_0008059 3300046518 Bacteria 5324
736 Ga0495648_0002775 3300046524 Bacteria 15798
737 Ga0495652_0188421 3300046529 Bacteria 1577
738 Ga0495587_0052965 3300046536 Bacteria 2393
739 Ga0495609_0033790 3300046538 Bacteria 2320
740 Ga0495633_0000014 3300046558 Bacteria 261742
741 Ga0495633_0089582 3300046558 Bacteria 1430
742 Ga0495667_0077050 3300046559 Bacteria 2169
743 Ga0495668_0000003 3300046616 Bacteria 695023
744 Ga0495668_0001784 3300046616 Bacteria 19658
745 Ga0495611_0000179 3300046648 Bacteria 45869
746 Ga0495625_0000005 3300046660 Bacteria 596135
747 Ga0495625_0000471 3300046660 Bacteria 60628
748 Ga0495625_0001258 3300046660 Bacteria 31973
749 Ga0495625_0010947 3300046660 Bacteria 7446
750 Ga0495625_0017844 3300046660 Bacteria 5546
751 Ga0495661_0054825 3300046665 Bacteria 2392
752 Ga0495661_0088277 3300046665 Bacteria 1770
753 Ga0495657_0078202 3300046675 Bacteria 2144
754 Ga0495599_0077856 3300046678 Bacteria 2070
755 Ga0495647_0037234 3300046681 Bacteria 1835
756 Ga0495658_0141371 3300046683 Bacteria 1472
757 Ga0495613_0097663 3300046689 Bacteria 2123
758 Ga0495649_0000003 3300046694 Bacteria 880817
759 Ga0495660_0007560 3300046810 Bacteria 6380
760 Ga0495672_0033988 3300047320 Bacteria 3155
761 Ga0495683_0028303 3300047323 Bacteria 2865
762 Ga0495687_000004 3300047443 Bacteria 779298
763 Ga0495687_000544 3300047443 Bacteria 45065
764 Ga0495687_000762 3300047443 Bacteria 34827
765 Ga0495675_0010457 3300047444 Bacteria 5799
766 Ga0495686_0000004 3300047472 Bacteria 869019
767 Ga0495686_0003602 3300047472 Bacteria 13287
768 Ga0495686_0051650 3300047472 Bacteria 2579
769 Ga0495686_0132507 3300047472 Bacteria 1476
770 Ga0496101_0012235 3300048904 Bacteria 5721
771 Ga0496102_0176702 3300048905 Unclassified 2011
772 Ga0496104_0261118 3300048907 Bacteria 1645
773 Ga0496109_0083335 3300048912 Bacteria 2949
774 Ga0496116_0004290 3300048919 Bacteria 13667
775 Ga0496117_0008979 3300048920 Bacteria 9407
776 Ga0496122_0000789 3300048925 Bacteria 60958
777 Ga0496122_0006722 3300048925 Bacteria 13087
778 Ga0496123_0006610 3300048926 Bacteria 11199
779 Ga0496123_0013257 3300048926 Bacteria 6943
780 Ga0496124_0042623 3300048927 Bacteria 3907
781 Ga0501323_000726 3300049539 Bacteria 2601
782 Ga0501031_0017014 3300049568 Bacteria 4723
783 Ga0501032_0000789 3300049569 Bacteria 25632
784 Ga0501032_0103951 3300049569 Bacteria 1882
785 Ga0501033_0125458 3300049570 Bacteria 1862
786 Ga0501034_0006168 3300049571 Bacteria 12923
787 Ga0501034_0041867 3300049571 Bacteria 4634
788 Ga0501034_0109443 3300049571 Bacteria 2754
789 Ga0501036_0001149 3300049572 Bacteria 20161
790 Ga0501036_0004247 3300049572 Bacteria 11553
791 Ga0501037_0027852 3300049573 Bacteria 4175
792 Ga0501038_0101201 3300049574 Bacteria 2399
793 Ga0501039_0025685 3300049575 Bacteria 4527
794 Ga0501041_0014564 3300049577 Bacteria 4669
795 Ga0501042_0003714 3300049578 Bacteria 9642
796 Ga0501043_0013354 3300049579 Bacteria 6422
797 Ga0501043_0055797 3300049579 Bacteria 3104
798 Ga0501046_0002549 3300049580 Bacteria 17045
799 Ga0501046_0012945 3300049580 Bacteria 7088
800 Ga0501047_0003691 3300049581 Bacteria 14416
801 Ga0501048_0003076 3300049582 Bacteria 12717
802 Ga0501068_0013864 3300049584 Bacteria 4595
803 Ga0501068_0075269 3300049584 Bacteria 2065
804 Ga0501069_0011303 3300049585 Bacteria 4734
805 Ga0501070_0006716 3300049586 Bacteria 9798
806 Ga0501070_0119081 3300049586 Bacteria 2182
807 Ga0501070_0225193 3300049586 Bacteria 1537
808 Ga0501071_0022656 3300049587 Bacteria 4381
809 Ga0501072_0002595 3300049588 Bacteria 13546
810 Ga0501073_0002127 3300049589 Bacteria 14843
811 Ga0501073_0046449 3300049589 Bacteria 3054
812 Ga0501074_0000268 3300049590 Bacteria 29703
813 Ga0501074_0071210 3300049590 Bacteria 2499
814 Ga0501075_0052536 3300049591 Bacteria 3064
815 Ga0501217_005267 3300049661 Bacteria 2699
816 Ga0501223_000517 3300049663 Bacteria 9302
817 Ga0501236_000066 3300049670 Bacteria 9409
818 Ga0501238_006873 3300049671 Bacteria 1471
819 Ga0501243_008676 3300049675 Bacteria 1571
820 Ga0501225_0044910 3300049705 Bacteria 1223
821 Ga0501079_0005838 3300049741 Bacteria 9206
822 Ga0501080_0009651 3300049742 Bacteria 8812
823 Ga0501080_0082493 3300049742 Bacteria 2986
824 Ga0501080_0290176 3300049742 Bacteria 1485
825 Ga0501081_0001456 3300049743 Bacteria 14500
826 Ga0501081_0096995 3300049743 Bacteria 2080
827 Ga0501083_0002364 3300049744 Bacteria 12916
828 Ga0501083_0045344 3300049744 Bacteria 2975
829 Ga0501035_0006540 3300049822 Bacteria 10934
830 Ga0501035_0063517 3300049822 Bacteria 3284
831 Ga0501044_0008384 3300049823 Bacteria 11335
832 Ga0501044_0130700 3300049823 Bacteria 2505
833 Ga0501045_0033653 3300049824 Bacteria 3716
834 nmdc:mga0k408_33017_c1 3300050493 Bacteria 2958
835 nmdc:mga0k408_6399_c1 3300050493 Bacteria 6283
836 nmdc:mga05p37_20368_c1 3300050507 Bacteria 8025
837 nmdc:mga09592_92181_c1 3300050508 Bacteria 2590
838 nmdc:mga06r32_49377_c1 3300050510 Bacteria 4023
839 nmdc:mga08y16_141376_c1 3300050511 Bacteria 2502
840 nmdc:mga08y16_254478_c1 3300050511 Bacteria 1814
841 nmdc:mga08y16_3286_c1 3300050511 Bacteria 16755
842 nmdc:mga08y16_5732_c1 3300050511 Bacteria 13017
843 nmdc:mga08y16_60600_c1 3300050511 Bacteria 3952
844 Ga0500583_0000077 3300053092 Bacteria 58479
845 Ga0500583_0000164 3300053092 Bacteria 27548
846 Ga0500583_0005181 3300053092 Bacteria 4340
847 Ga0500641_0059014 3300053096 Bacteria 1594
848 Ga0500562_002684 3300053108 Bacteria 4426
849 Ga0500608_001113 3300053122 Bacteria 9583
850 Ga0500614_012003 3300053123 Bacteria 1884
851 Ga0500618_000666 3300053125 Bacteria 20264
852 Ga0500618_008890 3300053125 Bacteria 2771
853 Ga0500559_0055216 3300053136 Bacteria 1761
854 Ga0500568_0000641 3300053139 Bacteria 25249
855 Ga0500616_0000009 3300053153 Bacteria 779095
856 Ga0500616_0007510 3300053153 Bacteria 6905
857 Ga0500622_0000009 3300053156 Bacteria 419980
858 Ga0500622_0000096 3300053156 Bacteria 90621
859 Ga0500622_0002927 3300053156 Bacteria 11867
860 Ga0500622_0003314 3300053156 Bacteria 10885
861 Ga0500622_0012934 3300053156 Bacteria 4508
862 Ga0500624_000970 3300053157 Bacteria 5869
863 Ga0500627_0036267 3300053158 Bacteria 2099
864 Ga0500611_000020 3300053727 Bacteria 105250
865 Ga0501084_0121959 3300054114 Bacteria 2192
866 Ga0501082_0002189 3300060353 Bacteria 17109
867 Ga0501082_0079639 3300060353 Bacteria 2826
868 Ga0530510_0003636 3300061734 Bacteria 10612
869 Ga0530510_0058992 3300061734 Bacteria 2775

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046463 Ga0495653_0266227 Ga0495653_0266227_14_1084 336
2 3300010375 Ga0105239_10000072 Ga0105239_10000072115 366
3 3300042876 Ga0451577_0345532 Ga0451577_0345532_219_1319 366
4 3300035111 Ga0373923_0036491 Ga0373923_0036491_147_1274 373
5 3300049705 Ga0501225_0044910 Ga0501225_0044910_87_1208 373
6 3300048925 Ga0496122_0006722 Ga0496122_0006722_11919_13046 374
7 3300038443 Ga0395901_0226951 Ga0395901_0226951_71_1222 375
8 3300041406 Ga0439439_0028272 Ga0439439_0028272_20_1168 375
9 3300046558 Ga0495633_0089582 Ga0495633_0089582_16_1161 375
10 3300053096 Ga0500641_0059014 Ga0500641_0059014_342_1490 375
11 3300035695 Ga0373927_0005089 Ga0373927_0005089_1992_3284 382
12 3300037068 Ga0373925_0027719 Ga0373925_0027719_278_1570 382
13 3300046472 Ga0495580_0016439 Ga0495580_0016439_2923_4215 382
14 3300036535 Ga0310110_009579 Ga0310110_009579_26_1219 383
15 3300060353 Ga0501082_0002189 Ga0501082_0002189_7152_8441 385
16 3300044712 Ga0453684_0301019 Ga0453684_0301019_236_1402 387
17 3300046689 Ga0495613_0097663 Ga0495613_0097663_660_1955 389
18 iso_pu_bacteria 2643221670 2644390541 393
19 iso_pu_bacteria 2918501144 2918504964 393
20 iso_pu_bacteria 2643221587 2643948034 394
21 iso_pu_bacteria 2643221677 2644433900 394
22 3300049742 Ga0501080_0290176 Ga0501080_0290176_11_1234 399
23 3300049574 Ga0501038_0101201 Ga0501038_0101201_20_1243 406
24 3300044712 Ga0453684_0004157 Ga0453684_0004157_12910_14181 408
25 3300046511 Ga0495608_0050979 Ga0495608_0050979_1422_2732 408
26 3300046665 Ga0495661_0054825 Ga0495661_0054825_1124_2368 408
27 3300005535 Ga0070684_100217623 Ga0070684_1002176231 420
28 3300013306 Ga0163162_10202005 Ga0163162_102020051 420
29 3300013308 Ga0157375_10122099 Ga0157375_101220991 420
30 3300031241 Ga0265325_10010739 Ga0265325_100107393 420
31 3300031728 Ga0316578_10000458 Ga0316578_100004582 420
32 3300031733 Ga0316577_10005994 Ga0316577_100059942 420
33 3300036647 Ga0316582_0000862 Ga0316582_0000862_5453_6766 420
34 3300036712 Ga0316584_0000202 Ga0316584_0000202_17314_18627 420
35 3300046472 Ga0495580_0010183 Ga0495580_0010183_595_1929 420
36 3300046516 Ga0495628_0004159 Ga0495628_0004159_10939_12348 420
37 3300042876 Ga0451577_0076157 Ga0451577_0076157_1365_2723 421
38 3300049569 Ga0501032_0000789 Ga0501032_0000789_17940_19265 421
39 3300049571 Ga0501034_0006168 Ga0501034_0006168_10086_11411 421
40 3300049572 Ga0501036_0001149 Ga0501036_0001149_13043_14368 421
41 3300049579 Ga0501043_0013354 Ga0501043_0013354_2752_4077 421
42 3300049580 Ga0501046_0012945 Ga0501046_0012945_5163_6488 421
43 3300049581 Ga0501047_0003691 Ga0501047_0003691_6369_7694 421
44 3300049582 Ga0501048_0003076 Ga0501048_0003076_10096_11421 421
45 3300049584 Ga0501068_0075269 Ga0501068_0075269_106_1431 421
46 3300049586 Ga0501070_0006716 Ga0501070_0006716_742_2067 421
47 3300049589 Ga0501073_0002127 Ga0501073_0002127_6664_7989 421
48 3300049590 Ga0501074_0000268 Ga0501074_0000268_8890_10215 421
49 3300049742 Ga0501080_0009651 Ga0501080_0009651_1119_2444 421
50 3300049744 Ga0501083_0002364 Ga0501083_0002364_6048_7373 421
51 3300049822 Ga0501035_0006540 Ga0501035_0006540_2123_3448 421
52 3300049823 Ga0501044_0008384 Ga0501044_0008384_1450_2775 421
53 3300044673 Ga0453683_0010664 Ga0453683_0010664_17_1339 422
54 3300045051 Ga0451576_0011975 Ga0451576_0011975_6253_7575 422
55 iso_pu_bacteria 2522125168 2522551106 422
56 3300042876 Ga0451577_0128676 Ga0451577_0128676_430_1707 423
57 3300044712 Ga0453684_0001244 Ga0453684_0001244_19995_21272 423
58 3300053153 Ga0500616_0007510 Ga0500616_0007510_1567_2892 424
59 iso_pu_bacteria 2738541273 2738698353 424
60 iso_pu_bacteria 2738543014 2739252679 424
61 3300005545 Ga0070695_100112949 Ga0070695_1001129491 425
62 3300005617 Ga0068859_100318554 Ga0068859_1003185541 425
63 3300006931 Ga0097620_100318566 Ga0097620_1003185661 425
64 3300035118 Ga0373954_0046145 Ga0373954_0046145_552_1886 425
65 3300036401 Ga0373937_0013067 Ga0373937_0013067_1576_2910 425
66 3300044712 Ga0453684_0005297 Ga0453684_0005297_24277_25605 425
67 3300046559 Ga0495667_0077050 Ga0495667_0077050_360_1694 425
68 3300005331 Ga0070670_100027222 Ga0070670_1000272221 426
69 3300031614 Ga0310103_105240 Ga0310103_1052401 426
70 3300044712 Ga0453684_0120378 Ga0453684_0120378_390_1727 426
71 3300003781 Ga0055536_1013049 Ga0055536_10130492 427
72 3300005262 Ga0065165_1000169 Ga0065165_10001692 427
73 3300009553 Ga0105249_10019997 Ga0105249_100199975 427
74 3300025292 Ga0209676_1000329 Ga0209676_100032915 427
75 3300025298 Ga0209050_1024684 Ga0209050_10246842 427
76 3300028653 Ga0265323_10017597 Ga0265323_100175971 428
77 3300031911 Ga0307412_10091651 Ga0307412_100916512 428
78 iso_pu_bacteria 2617270889 2617917579 428
79 iso_pu_bacteria 2738541284 2738760849 428
80 iso_pu_bacteria 2913844669 2913846074 428
81 iso_pu_bacteria 2913939268 2913941070 428
82 iso_pu_bacteria 2919692658 2919693343 428
83 iso_pu_bacteria 642555144 642605327 428
84 3300009545 Ga0105237_10000044 Ga0105237_10000044134 429
85 3300025914 Ga0207671_10000004 Ga0207671_10000004737 429
86 3300031238 Ga0265332_10007014 Ga0265332_100070144 429
87 3300031241 Ga0265325_10012429 Ga0265325_100124291 429
88 3300031727 Ga0316576_10057544 Ga0316576_100575441 429
89 3300031727 Ga0316576_10065179 Ga0316576_100651791 429
90 3300031727 Ga0316576_10085185 Ga0316576_100851852 429
91 3300031728 Ga0316578_10081680 Ga0316578_100816801 429
92 3300031733 Ga0316577_10005407 Ga0316577_100054073 429
93 3300035398 Ga0316574_0009680 Ga0316574_0009680_395_1705 429
94 3300036712 Ga0316584_0000530 Ga0316584_0000530_13697_14995 429
95 3300038735 Ga0400485_16601 Ga0400485_16601_2672_3991 429
96 3300044673 Ga0453683_0000625 Ga0453683_0000625_1280_2575 429
97 3300044673 Ga0453683_0029661 Ga0453683_0029661_726_2024 429
98 3300044712 Ga0453684_0019610 Ga0453684_0019610_3139_4434 429
99 3300045051 Ga0451576_0051793 Ga0451576_0051793_149_1447 429
100 3300049568 Ga0501031_0017014 Ga0501031_0017014_3201_4496 429
101 3300049572 Ga0501036_0004247 Ga0501036_0004247_181_1476 429
102 3300049573 Ga0501037_0027852 Ga0501037_0027852_997_2292 429
103 3300049575 Ga0501039_0025685 Ga0501039_0025685_1233_2528 429
104 3300049577 Ga0501041_0014564 Ga0501041_0014564_2385_3680 429
105 3300049578 Ga0501042_0003714 Ga0501042_0003714_802_2097 429
106 3300049580 Ga0501046_0002549 Ga0501046_0002549_10233_11528 429
107 3300049584 Ga0501068_0013864 Ga0501068_0013864_1153_2448 429
108 3300049586 Ga0501070_0225193 Ga0501070_0225193_193_1488 429
109 3300049587 Ga0501071_0022656 Ga0501071_0022656_1959_3254 429
110 3300049588 Ga0501072_0002595 Ga0501072_0002595_2102_3397 429
111 3300049590 Ga0501074_0071210 Ga0501074_0071210_1193_2488 429
112 3300049591 Ga0501075_0052536 Ga0501075_0052536_633_1928 429
113 3300049741 Ga0501079_0005838 Ga0501079_0005838_6737_8032 429
114 3300049742 Ga0501080_0082493 Ga0501080_0082493_71_1366 429
115 3300049743 Ga0501081_0001456 Ga0501081_0001456_1175_2470 429
116 3300049743 Ga0501081_0096995 Ga0501081_0096995_760_2055 429
117 3300049744 Ga0501083_0045344 Ga0501083_0045344_1305_2600 429
118 3300049824 Ga0501045_0033653 Ga0501045_0033653_1756_3051 429
119 3300054114 Ga0501084_0121959 Ga0501084_0121959_645_1940 429
120 3300060353 Ga0501082_0079639 Ga0501082_0079639_40_1335 429
121 3300061734 Ga0530510_0058992 Ga0530510_0058992_284_1579 429
122 iso_pu_bacteria 2599185184 2599477954 429
123 iso_pu_bacteria 2852623160 2852623668 429
124 iso_pu_bacteria 2884933994 2884937428 429
125 iso_pu_bacteria 2891633521 2891633668 429
126 iso_pu_bacteria 2928078545 2928079915 429
127 iso_pu_bacteria 2928147474 2928147630 429
128 iso_pu_bacteria 2932082852 2932088484 429
129 3300005339 Ga0070660_100029365 Ga0070660_1000293653 430
130 3300005343 Ga0070687_100030867 Ga0070687_1000308671 430
131 3300009094 Ga0111539_10295731 Ga0111539_102957312 430
132 3300025916 Ga0207663_10002822 Ga0207663_100028223 430
133 3300025918 Ga0207662_10022892 Ga0207662_100228922 430
134 3300025919 Ga0207657_10016158 Ga0207657_100161583 430
135 3300026142 Ga0207698_10072052 Ga0207698_100720521 430
136 3300028556 Ga0265337_1000681 Ga0265337_10006812 430
137 3300028558 Ga0265326_10000758 Ga0265326_100007589 430
138 3300028558 Ga0265326_10003795 Ga0265326_100037954 430
139 3300028563 Ga0265319_1000297 Ga0265319_100029730 430
140 3300028563 Ga0265319_1002577 Ga0265319_10025778 430
141 3300028573 Ga0265334_10001759 Ga0265334_1000175910 430
142 3300028573 Ga0265334_10004780 Ga0265334_100047805 430
143 3300028577 Ga0265318_10015518 Ga0265318_100155183 430
144 3300028577 Ga0265318_10032088 Ga0265318_100320881 430
145 3300028653 Ga0265323_10000395 Ga0265323_1000039517 430
146 3300028653 Ga0265323_10012792 Ga0265323_100127922 430
147 3300028654 Ga0265322_10005276 Ga0265322_100052762 430
148 3300028654 Ga0265322_10005878 Ga0265322_100058783 430
149 3300028666 Ga0265336_10000194 Ga0265336_1000019436 430
150 3300028666 Ga0265336_10026823 Ga0265336_100268232 430
151 3300028800 Ga0265338_10000273 Ga0265338_1000027324 430
152 3300028800 Ga0265338_10000527 Ga0265338_1000052714 430
153 3300028800 Ga0265338_10002518 Ga0265338_100025183 430
154 3300028800 Ga0265338_10006323 Ga0265338_100063234 430
155 3300028800 Ga0265338_10008747 Ga0265338_1000874710 430
156 3300028800 Ga0265338_10016341 Ga0265338_100163416 430
157 3300029957 Ga0265324_10001372 Ga0265324_100013728 430
158 3300029957 Ga0265324_10007618 Ga0265324_100076182 430
159 3300031235 Ga0265330_10001086 Ga0265330_1000108614 430
160 3300031235 Ga0265330_10025643 Ga0265330_100256433 430
161 3300031238 Ga0265332_10001653 Ga0265332_100016539 430
162 3300031240 Ga0265320_10000494 Ga0265320_100004944 430
163 3300031240 Ga0265320_10005528 Ga0265320_100055285 430
164 3300031247 Ga0265340_10002804 Ga0265340_100028042 430
165 3300031249 Ga0265339_10007060 Ga0265339_100070605 430
166 3300031250 Ga0265331_10058487 Ga0265331_100584871 430
167 3300031251 Ga0265327_10000618 Ga0265327_1000061839 430
168 3300031251 Ga0265327_10072023 Ga0265327_100720231 430
169 3300031344 Ga0265316_10077499 Ga0265316_100774991 430
170 3300031595 Ga0265313_10004678 Ga0265313_100046785 430
171 3300031595 Ga0265313_10005311 Ga0265313_100053117 430
172 3300031711 Ga0265314_10006023 Ga0265314_100060238 430
173 3300031712 Ga0265342_10001151 Ga0265342_1000115114 430
174 3300031712 Ga0265342_10100515 Ga0265342_101005151 430
175 3300031727 Ga0316576_10002660 Ga0316576_100026609 430
176 3300031728 Ga0316578_10027250 Ga0316578_100272502 430
177 3300032004 Ga0307414_10000392 Ga0307414_1000039211 430
178 3300039062 Ga0400483_039122 Ga0400483_039122_613_1914 430
179 3300042876 Ga0451577_0000364 Ga0451577_0000364_26557_27858 430
180 3300042876 Ga0451577_0012393 Ga0451577_0012393_3548_4849 430
181 3300042876 Ga0451577_0069804 Ga0451577_0069804_564_1862 430
182 3300042876 Ga0451577_0097992 Ga0451577_0097992_1082_2383 430
183 3300042876 Ga0451577_0137791 Ga0451577_0137791_350_1675 430
184 3300044673 Ga0453683_0000476 Ga0453683_0000476_28164_29465 430
185 3300044673 Ga0453683_0003005 Ga0453683_0003005_10896_12197 430
186 3300044673 Ga0453683_0017963 Ga0453683_0017963_2296_3600 430
187 3300044673 Ga0453683_0099936 Ga0453683_0099936_386_1687 430
188 3300044712 Ga0453684_0000081 Ga0453684_0000081_382355_383656 430
189 3300044712 Ga0453684_0000630 Ga0453684_0000630_65025_66326 430
190 3300044712 Ga0453684_0001377 Ga0453684_0001377_65331_66632 430
191 3300044712 Ga0453684_0005203 Ga0453684_0005203_6452_7753 430
192 3300044712 Ga0453684_0007491 Ga0453684_0007491_15557_16855 430
193 3300044712 Ga0453684_0013250 Ga0453684_0013250_3041_4342 430
194 3300044712 Ga0453684_0022403 Ga0453684_0022403_5175_6476 430
195 3300044712 Ga0453684_0026462 Ga0453684_0026462_2214_3515 430
196 3300044712 Ga0453684_0030327 Ga0453684_0030327_4435_5736 430
197 3300044712 Ga0453684_0030674 Ga0453684_0030674_4695_6020 430
198 3300044712 Ga0453684_0045474 Ga0453684_0045474_2117_3436 430
199 3300044712 Ga0453684_0059245 Ga0453684_0059245_1079_2380 430
200 3300044712 Ga0453684_0077277 Ga0453684_0077277_54_1355 430
201 3300044712 Ga0453684_0096362 Ga0453684_0096362_558_1859 430
202 3300044712 Ga0453684_0289366 Ga0453684_0289366_127_1428 430
203 3300045051 Ga0451576_0000294 Ga0451576_0000294_21326_22627 430
204 3300045051 Ga0451576_0000683 Ga0451576_0000683_38060_39361 430
205 3300045051 Ga0451576_0322578 Ga0451576_0322578_152_1453 430
206 3300049663 Ga0501223_000517 Ga0501223_000517_4771_6066 430
207 3300050511 nmdc:mga08y16_254478_c1 nmdc:mga08y16_254478_c1_253_1599 430
208 3300061734 Ga0530510_0003636 Ga0530510_0003636_8604_9938 430
209 iso_pu_bacteria 2721755487 2722729183 430
210 iso_pu_bacteria 2738541278 2738731240 430
211 iso_pu_bacteria 2738541283 2738756567 430
212 iso_pu_bacteria 2738543023 2739304006 430
213 iso_pu_bacteria 2818991444 2819587334 430
214 iso_pu_bacteria 2839989709 2839992282 430
215 iso_pu_bacteria 2842903701 2842906595 430
216 iso_pu_bacteria 2852627209 2852627338 430
217 iso_pu_bacteria 2890737413 2890738095 430
218 iso_pu_bacteria 2896317667 2896318001 430
219 iso_pu_bacteria 2896344016 2896345476 430
220 iso_pu_bacteria 2898713307 2898715848 430
221 iso_pu_bacteria 2904780799 2904780905 430
222 iso_pu_bacteria 2919177583 2919180631 430
223 iso_pu_bacteria 2919186247 2919187371 430
224 iso_pu_bacteria 2939664404 2939665362 430
225 iso_pu_bacteria 3003233435 3003235980 430
226 iso_pu_bacteria 8055588893 8055589469 430
227 3300005327 Ga0070658_10037328 Ga0070658_100373283 431
228 3300005328 Ga0070676_10001211 Ga0070676_100012112 431
229 3300005334 Ga0068869_100016541 Ga0068869_1000165414 431
230 3300005335 Ga0070666_10001123 Ga0070666_100011233 431
231 3300005335 Ga0070666_10006658 Ga0070666_100066585 431
232 3300005338 Ga0068868_100014216 Ga0068868_1000142163 431
233 3300005347 Ga0070668_100004450 Ga0070668_1000044503 431
234 3300005355 Ga0070671_100094133 Ga0070671_1000941331 431
235 3300005364 Ga0070673_100003548 Ga0070673_1000035486 431
236 3300005364 Ga0070673_100029933 Ga0070673_1000299333 431
237 3300005364 Ga0070673_100040799 Ga0070673_1000407993 431
238 3300005367 Ga0070667_100024412 Ga0070667_1000244123 431
239 3300005455 Ga0070663_100144121 Ga0070663_1001441212 431
240 3300005457 Ga0070662_100004667 Ga0070662_1000046675 431
241 3300005459 Ga0068867_100006003 Ga0068867_1000060033 431
242 3300005543 Ga0070672_100022405 Ga0070672_1000224052 431
243 3300005616 Ga0068852_100008807 Ga0068852_1000088074 431
244 3300005616 Ga0068852_100068319 Ga0068852_1000683192 431
245 3300005617 Ga0068859_100000023 Ga0068859_100000023101 431
246 3300005618 Ga0068864_100000733 Ga0068864_1000007333 431
247 3300005618 Ga0068864_100009349 Ga0068864_1000093495 431
248 3300005719 Ga0068861_100040252 Ga0068861_1000402522 431
249 3300005834 Ga0068851_10022987 Ga0068851_100229872 431
250 3300005841 Ga0068863_100027572 Ga0068863_1000275723 431
251 3300005841 Ga0068863_100028175 Ga0068863_1000281756 431
252 3300005842 Ga0068858_100003125 Ga0068858_10000312516 431
253 3300005842 Ga0068858_100003981 Ga0068858_1000039816 431
254 3300005842 Ga0068858_100146325 Ga0068858_1001463252 431
255 3300006237 Ga0097621_100051390 Ga0097621_1000513902 431
256 3300006237 Ga0097621_100064504 Ga0097621_1000645043 431
257 3300006237 Ga0097621_100115725 Ga0097621_1001157252 431
258 3300006358 Ga0068871_100013343 Ga0068871_1000133434 431
259 3300006358 Ga0068871_100021887 Ga0068871_1000218875 431
260 3300006358 Ga0068871_100027178 Ga0068871_1000271781 431
261 3300006881 Ga0068865_100004850 Ga0068865_1000048502 431
262 3300006931 Ga0097620_100000023 Ga0097620_100000023101 431
263 3300009093 Ga0105240_10095335 Ga0105240_100953352 431
264 3300009098 Ga0105245_10050473 Ga0105245_100504732 431
265 3300009101 Ga0105247_10008227 Ga0105247_100082272 431
266 3300009101 Ga0105247_10009048 Ga0105247_100090485 431
267 3300009148 Ga0105243_10031803 Ga0105243_100318033 431
268 3300009174 Ga0105241_10000861 Ga0105241_1000086110 431
269 3300009177 Ga0105248_10013691 Ga0105248_100136913 431
270 3300009545 Ga0105237_10001750 Ga0105237_1000175010 431
271 3300009553 Ga0105249_10006492 Ga0105249_100064926 431
272 3300009553 Ga0105249_10008554 Ga0105249_100085543 431
273 3300010375 Ga0105239_10038296 Ga0105239_100382963 431
274 3300013105 Ga0157369_10113581 Ga0157369_101135812 431
275 3300013296 Ga0157374_10125412 Ga0157374_101254123 431
276 3300013297 Ga0157378_10034883 Ga0157378_100348832 431
277 3300013297 Ga0157378_10307648 Ga0157378_103076481 431
278 3300013306 Ga0163162_10000373 Ga0163162_1000037317 431
279 3300013306 Ga0163162_10004336 Ga0163162_100043362 431
280 3300013306 Ga0163162_10013198 Ga0163162_100131985 431
281 3300013307 Ga0157372_10004620 Ga0157372_100046204 431
282 3300013307 Ga0157372_10062402 Ga0157372_100624023 431
283 3300013308 Ga0157375_10041242 Ga0157375_100412423 431
284 3300014325 Ga0163163_10002931 Ga0163163_100029315 431
285 3300014968 Ga0157379_10034273 Ga0157379_100342732 431
286 3300014969 Ga0157376_10002437 Ga0157376_100024374 431
287 3300014969 Ga0157376_10029923 Ga0157376_100299232 431
288 3300014969 Ga0157376_10036441 Ga0157376_100364412 431
289 3300025321 Ga0207656_10025276 Ga0207656_100252762 431
290 3300025903 Ga0207680_10000568 Ga0207680_100005683 431
291 3300025907 Ga0207645_10000542 Ga0207645_100005424 431
292 3300025907 Ga0207645_10124726 Ga0207645_101247262 431
293 3300025909 Ga0207705_10036116 Ga0207705_100361162 431
294 3300025911 Ga0207654_10038517 Ga0207654_100385172 431
295 3300025914 Ga0207671_10001864 Ga0207671_1000186410 431
296 3300025933 Ga0207706_10009939 Ga0207706_100099395 431
297 3300025935 Ga0207709_10119077 Ga0207709_101190771 431
298 3300025938 Ga0207704_10009752 Ga0207704_100097523 431
299 3300025940 Ga0207691_10000060 Ga0207691_100000603 431
300 3300025941 Ga0207711_10044751 Ga0207711_100447512 431
301 3300025942 Ga0207689_10005494 Ga0207689_100054943 431
302 3300025960 Ga0207651_10017395 Ga0207651_100173953 431
303 3300025972 Ga0207668_10030727 Ga0207668_100307272 431
304 3300025986 Ga0207658_10001199 Ga0207658_1000119914 431
305 3300026023 Ga0207677_10038042 Ga0207677_100380423 431
306 3300026035 Ga0207703_10008491 Ga0207703_100084911 431
307 3300026035 Ga0207703_10059028 Ga0207703_100590282 431
308 3300026041 Ga0207639_10019114 Ga0207639_100191142 431
309 3300026088 Ga0207641_10000250 Ga0207641_1000025057 431
310 3300026088 Ga0207641_10003961 Ga0207641_100039614 431
311 3300026088 Ga0207641_10031708 Ga0207641_100317082 431
312 3300026095 Ga0207676_10013473 Ga0207676_100134733 431
313 3300026118 Ga0207675_100105979 Ga0207675_1001059791 431
314 3300028379 Ga0268266_10039046 Ga0268266_100390463 431
315 3300028381 Ga0268264_10001580 Ga0268264_1000158011 431
316 3300028653 Ga0265323_10001271 Ga0265323_100012712 431
317 3300028794 Ga0307515_10000057 Ga0307515_10000057107 431
318 3300028800 Ga0265338_10063636 Ga0265338_100636362 431
319 3300031344 Ga0265316_10005060 Ga0265316_100050608 431
320 3300031507 Ga0307509_10072885 Ga0307509_100728853 431
321 3300035398 Ga0316574_0178878 Ga0316574_0178878_12_1316 431
322 3300042876 Ga0451577_0000202 Ga0451577_0000202_12166_13509 431
323 3300042876 Ga0451577_0000509 Ga0451577_0000509_59475_60779 431
324 3300042876 Ga0451577_0000954 Ga0451577_0000954_25896_27200 431
325 3300042876 Ga0451577_0002430 Ga0451577_0002430_3479_4783 431
326 3300042876 Ga0451577_0018198 Ga0451577_0018198_2320_3624 431
327 3300042876 Ga0451577_0060152 Ga0451577_0060152_1110_2414 431
328 3300042876 Ga0451577_0085788 Ga0451577_0085788_457_1761 431
329 3300042876 Ga0451577_0151581 Ga0451577_0151581_343_1647 431
330 3300044658 Ga0466972_0000205 Ga0466972_0000205_22319_23635 431
331 3300044673 Ga0453683_0000139 Ga0453683_0000139_75512_76816 431
332 3300044673 Ga0453683_0001467 Ga0453683_0001467_3079_4383 431
333 3300044673 Ga0453683_0010590 Ga0453683_0010590_309_1613 431
334 3300044673 Ga0453683_0040902 Ga0453683_0040902_295_1599 431
335 3300044712 Ga0453684_0000004 Ga0453684_0000004_422092_423435 431
336 3300044712 Ga0453684_0000086 Ga0453684_0000086_43016_44320 431
337 3300044712 Ga0453684_0000337 Ga0453684_0000337_28654_29958 431
338 3300044712 Ga0453684_0000393 Ga0453684_0000393_173936_175240 431
339 3300044712 Ga0453684_0000608 Ga0453684_0000608_80866_82170 431
340 3300044712 Ga0453684_0001006 Ga0453684_0001006_48590_49894 431
341 3300044712 Ga0453684_0004417 Ga0453684_0004417_14961_16265 431
342 3300044712 Ga0453684_0018143 Ga0453684_0018143_8152_9453 431
343 3300044712 Ga0453684_0041170 Ga0453684_0041170_1603_2907 431
344 3300044712 Ga0453684_0058981 Ga0453684_0058981_2217_3521 431
345 3300044712 Ga0453684_0067008 Ga0453684_0067008_1452_2756 431
346 3300044712 Ga0453684_0186360 Ga0453684_0186360_946_2250 431
347 3300044765 Ga0466970_0000529 Ga0466970_0000529_6595_7911 431
348 3300045051 Ga0451576_0000083 Ga0451576_0000083_48576_49880 431
349 3300045051 Ga0451576_0000145 Ga0451576_0000145_173936_175240 431
350 3300045051 Ga0451576_0001394 Ga0451576_0001394_1495_2799 431
351 3300045051 Ga0451576_0009193 Ga0451576_0009193_5345_6649 431
352 3300045051 Ga0451576_0069951 Ga0451576_0069951_1512_2816 431
353 3300045051 Ga0451576_0080236 Ga0451576_0080236_266_1570 431
354 3300045051 Ga0451576_0115641 Ga0451576_0115641_129_1433 431
355 3300046507 Ga0495606_0016294 Ga0495606_0016294_260_1573 431
356 3300046529 Ga0495652_0188421 Ga0495652_0188421_84_1403 431
357 3300046681 Ga0495647_0037234 Ga0495647_0037234_91_1419 431
358 3300046683 Ga0495658_0141371 Ga0495658_0141371_67_1395 431
359 3300046810 Ga0495660_0007560 Ga0495660_0007560_4826_6139 431
360 3300048912 Ga0496109_0083335 Ga0496109_0083335_896_2215 431
361 3300049823 Ga0501044_0130700 Ga0501044_0130700_251_1570 431
362 3300053136 Ga0500559_0055216 Ga0500559_0055216_376_1680 431
363 iso_pu_bacteria 2739367866 2740031596 431
364 iso_pu_bacteria 2919437846 2919441095 431
365 iso_pu_bacteria 2977232053 2977236133 431
366 iso_pu_bacteria 8056440228 8056440302 431
367 2162886012 MBSR1b_contig_6741876 MBSR1b_0096.00002990 432
368 3300001990 JGI24737J22298_10000733 JGI24737J22298_100007333 432
369 3300002067 JGI24735J21928_10000014 JGI24735J21928_100000147 432
370 3300003316 rootH1_10001098 rootH1_100010987 432
371 3300003320 rootH2_10002858 rootH2_100028589 432
372 3300003322 rootL2_10163790 rootL2_101637902 432
373 3300003323 rootH1_10003699 rootH1_1000369917 432
374 3300003323 rootH1_10017423 rootH1_100174231 432
375 3300003323 rootH1_10126862 rootH1_101268623 432
376 3300003354 JGI25160J50197_1003564 JGI25160J50197_10035644 432
377 3300005262 Ga0065165_1001340 Ga0065165_100134015 432
378 3300005288 Ga0065714_10002361 Ga0065714_100023619 432
379 3300005290 Ga0065712_10001455 Ga0065712_100014552 432
380 3300005327 Ga0070658_10000011 Ga0070658_10000011226 432
381 3300005328 Ga0070676_10002877 Ga0070676_100028778 432
382 3300005329 Ga0070683_100018837 Ga0070683_1000188374 432
383 3300005331 Ga0070670_100038903 Ga0070670_1000389031 432
384 3300005331 Ga0070670_100063646 Ga0070670_1000636461 432
385 3300005331 Ga0070670_100078187 Ga0070670_1000781871 432
386 3300005331 Ga0070670_100147645 Ga0070670_1001476452 432
387 3300005334 Ga0068869_100031202 Ga0068869_1000312022 432
388 3300005334 Ga0068869_100038954 Ga0068869_1000389542 432
389 3300005336 Ga0070680_100005777 Ga0070680_1000057777 432
390 3300005336 Ga0070680_100041291 Ga0070680_1000412912 432
391 3300005336 Ga0070680_100059914 Ga0070680_1000599142 432
392 3300005337 Ga0070682_100003177 Ga0070682_1000031774 432
393 3300005338 Ga0068868_100136348 Ga0068868_1001363482 432
394 3300005339 Ga0070660_100052356 Ga0070660_1000523562 432
395 3300005341 Ga0070691_10000930 Ga0070691_100009307 432
396 3300005343 Ga0070687_100052188 Ga0070687_1000521882 432
397 3300005344 Ga0070661_100018952 Ga0070661_1000189522 432
398 3300005353 Ga0070669_100008200 Ga0070669_1000082002 432
399 3300005354 Ga0070675_100007148 Ga0070675_1000071485 432
400 3300005354 Ga0070675_100012647 Ga0070675_1000126474 432
401 3300005355 Ga0070671_100122779 Ga0070671_1001227791 432
402 3300005364 Ga0070673_100001702 Ga0070673_10000170213 432
403 3300005364 Ga0070673_100117815 Ga0070673_1001178153 432
404 3300005365 Ga0070688_100005858 Ga0070688_1000058583 432
405 3300005366 Ga0070659_100026196 Ga0070659_1000261962 432
406 3300005366 Ga0070659_100046953 Ga0070659_1000469532 432
407 3300005366 Ga0070659_100247454 Ga0070659_1002474541 432
408 3300005367 Ga0070667_100077159 Ga0070667_1000771592 432
409 3300005367 Ga0070667_100222451 Ga0070667_1002224511 432
410 3300005456 Ga0070678_100007368 Ga0070678_1000073687 432
411 3300005458 Ga0070681_10261627 Ga0070681_102616271 432
412 3300005459 Ga0068867_100016922 Ga0068867_1000169223 432
413 3300005459 Ga0068867_100028131 Ga0068867_1000281312 432
414 3300005530 Ga0070679_100010318 Ga0070679_1000103185 432
415 3300005530 Ga0070679_100199057 Ga0070679_1001990571 432
416 3300005535 Ga0070684_100119774 Ga0070684_1001197742 432
417 3300005539 Ga0068853_100016543 Ga0068853_1000165435 432
418 3300005539 Ga0068853_100024401 Ga0068853_1000244012 432
419 3300005539 Ga0068853_100068924 Ga0068853_1000689242 432
420 3300005548 Ga0070665_100000003 Ga0070665_100000003472 432
421 3300005548 Ga0070665_100000008 Ga0070665_100000008460 432
422 3300005563 Ga0068855_100002579 Ga0068855_10000257911 432
423 3300005563 Ga0068855_100010877 Ga0068855_1000108774 432
424 3300005563 Ga0068855_100056698 Ga0068855_1000566983 432
425 3300005563 Ga0068855_100094815 Ga0068855_1000948154 432
426 3300005563 Ga0068855_100180723 Ga0068855_1001807232 432
427 3300005577 Ga0068857_100004830 Ga0068857_1000048303 432
428 3300005614 Ga0068856_100012928 Ga0068856_1000129287 432
429 3300005614 Ga0068856_100110022 Ga0068856_1001100223 432
430 3300005616 Ga0068852_100024969 Ga0068852_1000249694 432
431 3300005616 Ga0068852_100025420 Ga0068852_1000254202 432
432 3300005616 Ga0068852_100077757 Ga0068852_1000777572 432
433 3300005617 Ga0068859_100010680 Ga0068859_1000106802 432
434 3300005617 Ga0068859_100020142 Ga0068859_1000201423 432
435 3300005618 Ga0068864_100043103 Ga0068864_1000431032 432
436 3300005718 Ga0068866_10003738 Ga0068866_100037386 432
437 3300005719 Ga0068861_100099963 Ga0068861_1000999633 432
438 3300005719 Ga0068861_100189055 Ga0068861_1001890552 432
439 3300005842 Ga0068858_100098620 Ga0068858_1000986202 432
440 3300005843 Ga0068860_100000059 Ga0068860_10000005964 432
441 3300005843 Ga0068860_100001384 Ga0068860_1000013847 432
442 3300005843 Ga0068860_100024605 Ga0068860_1000246054 432
443 3300005843 Ga0068860_100040343 Ga0068860_1000403432 432
444 3300005844 Ga0068862_100004782 Ga0068862_1000047823 432
445 3300005844 Ga0068862_100027564 Ga0068862_1000275646 432
446 3300005844 Ga0068862_100213640 Ga0068862_1002136402 432
447 3300006195 Ga0075366_10007290 Ga0075366_100072902 432
448 3300006195 Ga0075366_10032558 Ga0075366_100325582 432
449 3300006237 Ga0097621_100000020 Ga0097621_10000002031 432
450 3300006237 Ga0097621_100000487 Ga0097621_1000004873 432
451 3300006237 Ga0097621_100088581 Ga0097621_1000885811 432
452 3300006237 Ga0097621_100267105 Ga0097621_1002671051 432
453 3300006358 Ga0068871_100000416 Ga0068871_10000041618 432
454 3300006358 Ga0068871_100000598 Ga0068871_1000005983 432
455 3300006847 Ga0075431_100057971 Ga0075431_1000579712 432
456 3300006880 Ga0075429_100049891 Ga0075429_1000498912 432
457 3300006881 Ga0068865_100000208 Ga0068865_10000020825 432
458 3300006881 Ga0068865_100011685 Ga0068865_1000116853 432
459 3300006931 Ga0097620_100010683 Ga0097620_1000106832 432
460 3300006931 Ga0097620_100020142 Ga0097620_1000201423 432
461 3300009093 Ga0105240_10000767 Ga0105240_100007674 432
462 3300009093 Ga0105240_10007530 Ga0105240_100075307 432
463 3300009093 Ga0105240_10049859 Ga0105240_100498593 432
464 3300009093 Ga0105240_10102281 Ga0105240_101022812 432
465 3300009093 Ga0105240_10119990 Ga0105240_101199902 432
466 3300009094 Ga0111539_10006433 Ga0111539_100064339 432
467 3300009094 Ga0111539_10011432 Ga0111539_100114329 432
468 3300009147 Ga0114129_10174564 Ga0114129_101745641 432
469 3300009148 Ga0105243_10074134 Ga0105243_100741342 432
470 3300009148 Ga0105243_10159239 Ga0105243_101592391 432
471 3300009174 Ga0105241_10002514 Ga0105241_100025146 432
472 3300009174 Ga0105241_10018003 Ga0105241_100180032 432
473 3300009174 Ga0105241_10043565 Ga0105241_100435652 432
474 3300009174 Ga0105241_10189405 Ga0105241_101894051 432
475 3300009176 Ga0105242_10059690 Ga0105242_100596902 432
476 3300009176 Ga0105242_10067351 Ga0105242_100673511 432
477 3300009177 Ga0105248_10040274 Ga0105248_100402742 432
478 3300009545 Ga0105237_10000356 Ga0105237_1000035648 432
479 3300009545 Ga0105237_10000971 Ga0105237_100009715 432
480 3300009545 Ga0105237_10004465 Ga0105237_1000446512 432
481 3300009545 Ga0105237_10006762 Ga0105237_100067626 432
482 3300009545 Ga0105237_10007600 Ga0105237_1000760013 432
483 3300009545 Ga0105237_10007857 Ga0105237_1000785711 432
484 3300009545 Ga0105237_10027387 Ga0105237_100273874 432
485 3300009545 Ga0105237_10123090 Ga0105237_101230902 432
486 3300009551 Ga0105238_10013311 Ga0105238_100133114 432
487 3300009551 Ga0105238_10053188 Ga0105238_100531882 432
488 3300009551 Ga0105238_10109459 Ga0105238_101094591 432
489 3300009551 Ga0105238_10169826 Ga0105238_101698262 432
490 3300009553 Ga0105249_10002037 Ga0105249_1000203710 432
491 3300009553 Ga0105249_10010023 Ga0105249_100100233 432
492 3300009553 Ga0105249_10056653 Ga0105249_100566531 432
493 3300009553 Ga0105249_10058903 Ga0105249_100589033 432
494 3300010375 Ga0105239_10000005 Ga0105239_10000005448 432
495 3300010375 Ga0105239_10001040 Ga0105239_100010403 432
496 3300010375 Ga0105239_10002120 Ga0105239_1000212022 432
497 3300010375 Ga0105239_10031256 Ga0105239_100312564 432
498 3300010375 Ga0105239_10038468 Ga0105239_100384684 432
499 3300010375 Ga0105239_10051224 Ga0105239_100512242 432
500 3300010375 Ga0105239_10060044 Ga0105239_100600442 432
501 3300010375 Ga0105239_10258127 Ga0105239_102581272 432
502 3300013104 Ga0157370_10005319 Ga0157370_1000531911 432
503 3300013104 Ga0157370_10010139 Ga0157370_100101392 432
504 3300013104 Ga0157370_10012521 Ga0157370_100125213 432
505 3300013104 Ga0157370_10040253 Ga0157370_100402532 432
506 3300013105 Ga0157369_10014216 Ga0157369_100142163 432
507 3300013105 Ga0157369_10024325 Ga0157369_100243255 432
508 3300013105 Ga0157369_10152866 Ga0157369_101528663 432
509 3300013296 Ga0157374_10000723 Ga0157374_1000072317 432
510 3300013296 Ga0157374_10242437 Ga0157374_102424372 432
511 3300013297 Ga0157378_10004726 Ga0157378_100047263 432
512 3300013297 Ga0157378_10073585 Ga0157378_100735851 432
513 3300013297 Ga0157378_10249580 Ga0157378_102495802 432
514 3300013306 Ga0163162_10000066 Ga0163162_1000006625 432
515 3300013306 Ga0163162_10000164 Ga0163162_1000016425 432
516 3300013306 Ga0163162_10000697 Ga0163162_100006979 432
517 3300013306 Ga0163162_10000856 Ga0163162_100008567 432
518 3300013306 Ga0163162_10001561 Ga0163162_100015614 432
519 3300013306 Ga0163162_10007340 Ga0163162_1000734011 432
520 3300013306 Ga0163162_10180640 Ga0163162_101806401 432
521 3300013306 Ga0163162_10346582 Ga0163162_103465821 432
522 3300013307 Ga0157372_10000676 Ga0157372_1000067639 432
523 3300013307 Ga0157372_10022840 Ga0157372_100228402 432
524 3300013307 Ga0157372_10359662 Ga0157372_103596621 432
525 3300013308 Ga0157375_10000383 Ga0157375_1000038312 432
526 3300013308 Ga0157375_10019253 Ga0157375_100192535 432
527 3300013308 Ga0157375_10127950 Ga0157375_101279503 432
528 3300014325 Ga0163163_10000560 Ga0163163_100005604 432
529 3300014325 Ga0163163_10144484 Ga0163163_101444842 432
530 3300014326 Ga0157380_10001590 Ga0157380_1000159013 432
531 3300014745 Ga0157377_10004008 Ga0157377_100040082 432
532 3300014745 Ga0157377_10057473 Ga0157377_100574731 432
533 3300014969 Ga0157376_10003607 Ga0157376_100036077 432
534 3300017792 Ga0163161_10001190 Ga0163161_100011908 432
535 3300017792 Ga0163161_10067587 Ga0163161_100675872 432
536 3300020077 Ga0206351_10002408 Ga0206351_100024081 432
537 3300020080 Ga0206350_10114900 Ga0206350_101149001 432
538 3300020610 Ga0154015_1295413 Ga0154015_12954132 432
539 3300025246 Ga0209646_1001361 Ga0209646_10013613 432
540 3300025298 Ga0209050_1008696 Ga0209050_10086961 432
541 3300025302 Ga0207426_1000040 Ga0207426_1000040131 432
542 3300025304 Ga0209257_1000299 Ga0209257_100029955 432
543 3300025900 Ga0207710_10002430 Ga0207710_100024307 432
544 3300025907 Ga0207645_10000544 Ga0207645_1000054421 432
545 3300025909 Ga0207705_10000015 Ga0207705_10000015223 432
546 3300025911 Ga0207654_10002706 Ga0207654_100027063 432
547 3300025911 Ga0207654_10038897 Ga0207654_100388972 432
548 3300025912 Ga0207707_10002565 Ga0207707_100025656 432
549 3300025912 Ga0207707_10072069 Ga0207707_100720692 432
550 3300025913 Ga0207695_10000170 Ga0207695_1000017016 432
551 3300025913 Ga0207695_10000425 Ga0207695_1000042568 432
552 3300025913 Ga0207695_10011968 Ga0207695_100119684 432
553 3300025913 Ga0207695_10016283 Ga0207695_100162835 432
554 3300025913 Ga0207695_10086253 Ga0207695_100862532 432
555 3300025913 Ga0207695_10238178 Ga0207695_102381781 432
556 3300025914 Ga0207671_10002376 Ga0207671_100023765 432
557 3300025914 Ga0207671_10007521 Ga0207671_100075211 432
558 3300025914 Ga0207671_10007560 Ga0207671_100075609 432
559 3300025914 Ga0207671_10007647 Ga0207671_100076478 432
560 3300025914 Ga0207671_10010890 Ga0207671_100108904 432
561 3300025914 Ga0207671_10019488 Ga0207671_100194883 432
562 3300025917 Ga0207660_10008582 Ga0207660_100085826 432
563 3300025917 Ga0207660_10042766 Ga0207660_100427663 432
564 3300025919 Ga0207657_10008447 Ga0207657_100084477 432
565 3300025919 Ga0207657_10057719 Ga0207657_100577193 432
566 3300025920 Ga0207649_10042136 Ga0207649_100421362 432
567 3300025924 Ga0207694_10038631 Ga0207694_100386312 432
568 3300025924 Ga0207694_10050652 Ga0207694_100506522 432
569 3300025924 Ga0207694_10092164 Ga0207694_100921642 432
570 3300025925 Ga0207650_10067551 Ga0207650_100675512 432
571 3300025926 Ga0207659_10023637 Ga0207659_100236371 432
572 3300025931 Ga0207644_10024181 Ga0207644_100241813 432
573 3300025931 Ga0207644_10068752 Ga0207644_100687522 432
574 3300025933 Ga0207706_10002738 Ga0207706_100027387 432
575 3300025933 Ga0207706_10036819 Ga0207706_100368194 432
576 3300025935 Ga0207709_10080165 Ga0207709_100801652 432
577 3300025938 Ga0207704_10000512 Ga0207704_100005129 432
578 3300025940 Ga0207691_10223802 Ga0207691_102238021 432
579 3300025941 Ga0207711_10066146 Ga0207711_100661462 432
580 3300025942 Ga0207689_10006819 Ga0207689_100068196 432
581 3300025942 Ga0207689_10018897 Ga0207689_100188973 432
582 3300025949 Ga0207667_10001127 Ga0207667_100011276 432
583 3300025949 Ga0207667_10001491 Ga0207667_100014916 432
584 3300025949 Ga0207667_10014074 Ga0207667_100140748 432
585 3300025949 Ga0207667_10060829 Ga0207667_100608294 432
586 3300025949 Ga0207667_10072509 Ga0207667_100725092 432
587 3300025949 Ga0207667_10139059 Ga0207667_101390592 432
588 3300025960 Ga0207651_10013175 Ga0207651_100131753 432
589 3300025960 Ga0207651_10052572 Ga0207651_100525722 432
590 3300025960 Ga0207651_10199908 Ga0207651_101999081 432
591 3300025961 Ga0207712_10089110 Ga0207712_100891102 432
592 3300025961 Ga0207712_10150765 Ga0207712_101507652 432
593 3300025961 Ga0207712_10186025 Ga0207712_101860251 432
594 3300025986 Ga0207658_10022335 Ga0207658_100223353 432
595 3300026023 Ga0207677_10012534 Ga0207677_100125344 432
596 3300026023 Ga0207677_10114976 Ga0207677_101149762 432
597 3300026041 Ga0207639_10020628 Ga0207639_100206285 432
598 3300026041 Ga0207639_10021022 Ga0207639_100210222 432
599 3300026041 Ga0207639_10034523 Ga0207639_100345232 432
600 3300026041 Ga0207639_10220561 Ga0207639_102205611 432
601 3300026078 Ga0207702_10036846 Ga0207702_100368463 432
602 3300026078 Ga0207702_10085244 Ga0207702_100852442 432
603 3300026078 Ga0207702_10122965 Ga0207702_101229652 432
604 3300026088 Ga0207641_10025863 Ga0207641_100258632 432
605 3300026089 Ga0207648_10003642 Ga0207648_1000364216 432
606 3300026089 Ga0207648_10004739 Ga0207648_100047397 432
607 3300026089 Ga0207648_10064738 Ga0207648_100647382 432
608 3300026089 Ga0207648_10073470 Ga0207648_100734702 432
609 3300026095 Ga0207676_10109544 Ga0207676_101095441 432
610 3300026116 Ga0207674_10004594 Ga0207674_100045943 432
611 3300026116 Ga0207674_10191636 Ga0207674_101916361 432
612 3300026116 Ga0207674_10209049 Ga0207674_102090492 432
613 3300026116 Ga0207674_10224157 Ga0207674_102241572 432
614 3300026118 Ga0207675_100000599 Ga0207675_10000059921 432
615 3300026118 Ga0207675_100022077 Ga0207675_1000220772 432
616 3300026142 Ga0207698_10002595 Ga0207698_1000259511 432
617 3300026142 Ga0207698_10024598 Ga0207698_100245983 432
618 3300026142 Ga0207698_10067134 Ga0207698_100671342 432
619 3300026142 Ga0207698_10294430 Ga0207698_102944301 432
620 3300027907 Ga0207428_10057977 Ga0207428_100579772 432
621 3300028379 Ga0268266_10000016 Ga0268266_10000016458 432
622 3300028379 Ga0268266_10000052 Ga0268266_1000005266 432
623 3300028379 Ga0268266_10157587 Ga0268266_101575871 432
624 3300028380 Ga0268265_10022155 Ga0268265_100221553 432
625 3300028380 Ga0268265_10068788 Ga0268265_100687882 432
626 3300028381 Ga0268264_10000015 Ga0268264_10000015409 432
627 3300028381 Ga0268264_10003253 Ga0268264_1000325315 432
628 3300028381 Ga0268264_10038610 Ga0268264_100386102 432
629 3300028786 Ga0307517_10008552 Ga0307517_100085528 432
630 3300028786 Ga0307517_10015597 Ga0307517_100155972 432
631 3300028794 Ga0307515_10000133 Ga0307515_10000133142 432
632 3300028794 Ga0307515_10000432 Ga0307515_1000043272 432
633 3300028794 Ga0307515_10001738 Ga0307515_1000173846 432
634 3300031251 Ga0265327_10008002 Ga0265327_100080028 432
635 3300031456 Ga0307513_10147438 Ga0307513_101474382 432
636 3300031507 Ga0307509_10010102 Ga0307509_1001010211 432
637 3300031595 Ga0265313_10012195 Ga0265313_100121952 432
638 3300031730 Ga0307516_10002738 Ga0307516_1000273813 432
639 3300031731 Ga0307405_10163947 Ga0307405_101639471 432
640 3300031995 Ga0307409_100051015 Ga0307409_1000510151 432
641 3300033179 Ga0307507_10000064 Ga0307507_10000064108 432
642 3300033180 Ga0307510_10005874 Ga0307510_100058746 432
643 3300033180 Ga0307510_10007411 Ga0307510_100074114 432
644 3300035086 Ga0373934_0001565 Ga0373934_0001565_6781_8190 432
645 3300035119 Ga0373956_0064778 Ga0373956_0064778_92_1501 432
646 3300035120 Ga0373957_0041473 Ga0373957_0041473_84_1493 432
647 3300035724 Ga0373933_0007494 Ga0373933_0007494_3266_4675 432
648 3300036712 Ga0316584_0043722 Ga0316584_0043722_1362_2690 432
649 3300037312 Ga0395899_0002054 Ga0395899_0002054_12720_14045 432
650 3300037418 Ga0395900_0007296 Ga0395900_0007296_2556_3881 432
651 3300037418 Ga0395900_0029586 Ga0395900_0029586_2530_3849 432
652 3300037418 Ga0395900_0277274 Ga0395900_0277274_92_1411 432
653 3300037466 Ga0395898_0039456 Ga0395898_0039456_1646_2971 432
654 3300037471 Ga0395905_0000516 Ga0395905_0000516_22605_23924 432
655 3300037471 Ga0395905_0001254 Ga0395905_0001254_2556_3881 432
656 3300038443 Ga0395901_0000861 Ga0395901_0000861_2540_3865 432
657 3300039447 Ga0436361_0539750 Ga0436361_0539750_9171_10496 432
658 3300041512 Ga0451853_2051003 Ga0451853_2051003_817_2142 432
659 3300042134 Ga0450898_003736 Ga0450898_003736_583_1908 432
660 3300042876 Ga0451577_0000072 Ga0451577_0000072_199145_200530 432
661 3300042876 Ga0451577_0000217 Ga0451577_0000217_14440_15792 432
662 3300044658 Ga0466972_0000946 Ga0466972_0000946_902_2239 432
663 3300044673 Ga0453683_0000178 Ga0453683_0000178_52318_53703 432
664 3300044673 Ga0453683_0005318 Ga0453683_0005318_3934_5319 432
665 3300044712 Ga0453684_0000186 Ga0453684_0000186_72773_74158 432
666 3300044712 Ga0453684_0002144 Ga0453684_0002144_39980_41302 432
667 3300044712 Ga0453684_0006234 Ga0453684_0006234_5156_6499 432
668 3300044712 Ga0453684_0009673 Ga0453684_0009673_9339_10646 432
669 3300044712 Ga0453684_0013156 Ga0453684_0013156_4500_5885 432
670 3300044712 Ga0453684_0017180 Ga0453684_0017180_7776_9161 432
671 3300044712 Ga0453684_0030202 Ga0453684_0030202_3166_4491 432
672 3300044712 Ga0453684_0139207 Ga0453684_0139207_966_2273 432
673 3300044712 Ga0453684_0255106 Ga0453684_0255106_335_1657 432
674 3300044735 Ga0466968_0016433 Ga0466968_0016433_901_2238 432
675 3300044842 Ga0466957_0001121 Ga0466957_0001121_203_1528 432
676 3300045051 Ga0451576_0000065 Ga0451576_0000065_73916_75301 432
677 3300045051 Ga0451576_0000729 Ga0451576_0000729_47344_48648 432
678 3300045051 Ga0451576_0007238 Ga0451576_0007238_3247_4569 432
679 3300045976 Ga0466967_0208069 Ga0466967_0208069_334_1659 432
680 3300046460 Ga0495638_0000001 Ga0495638_0000001_355412_356734 432
681 3300046460 Ga0495638_0028055 Ga0495638_0028055_857_2203 432
682 3300046462 Ga0495651_0052900 Ga0495651_0052900_1435_2754 432
683 3300046462 Ga0495651_0098879 Ga0495651_0098879_206_1615 432
684 3300046471 Ga0495650_0000003 Ga0495650_0000003_176327_177646 432
685 3300046492 Ga0495585_0000085 Ga0495585_0000085_85589_86908 432
686 3300046492 Ga0495585_0001006 Ga0495585_0001006_13122_14441 432
687 3300046507 Ga0495606_0000002 Ga0495606_0000002_540970_542289 432
688 3300046507 Ga0495606_0005474 Ga0495606_0005474_4090_5412 432
689 3300046512 Ga0495610_0023746 Ga0495610_0023746_238_1557 432
690 3300046513 Ga0495616_0006849 Ga0495616_0006849_4569_5888 432
691 3300046518 Ga0495631_0008059 Ga0495631_0008059_2749_4074 432
692 3300046524 Ga0495648_0002775 Ga0495648_0002775_12696_14042 432
693 3300046536 Ga0495587_0052965 Ga0495587_0052965_301_1710 432
694 3300046538 Ga0495609_0033790 Ga0495609_0033790_383_1702 432
695 3300046558 Ga0495633_0000014 Ga0495633_0000014_199714_201033 432
696 3300046616 Ga0495668_0000003 Ga0495668_0000003_582804_584123 432
697 3300046616 Ga0495668_0001784 Ga0495668_0001784_10474_11802 432
698 3300046648 Ga0495611_0000179 Ga0495611_0000179_9737_11065 432
699 3300046660 Ga0495625_0000005 Ga0495625_0000005_293321_294640 432
700 3300046660 Ga0495625_0000471 Ga0495625_0000471_19350_20669 432
701 3300046660 Ga0495625_0001258 Ga0495625_0001258_10473_11792 432
702 3300046665 Ga0495661_0088277 Ga0495661_0088277_229_1548 432
703 3300046675 Ga0495657_0078202 Ga0495657_0078202_477_1886 432
704 3300046678 Ga0495599_0077856 Ga0495599_0077856_65_1474 432
705 3300046694 Ga0495649_0000003 Ga0495649_0000003_293309_294628 432
706 3300047320 Ga0495672_0033988 Ga0495672_0033988_1277_2596 432
707 3300047323 Ga0495683_0028303 Ga0495683_0028303_679_2004 432
708 3300047443 Ga0495687_000004 Ga0495687_000004_617417_618754 432
709 3300047443 Ga0495687_000544 Ga0495687_000544_40160_41479 432
710 3300047443 Ga0495687_000762 Ga0495687_000762_961_2286 432
711 3300047444 Ga0495675_0010457 Ga0495675_0010457_2994_4403 432
712 3300047472 Ga0495686_0132507 Ga0495686_0132507_39_1358 432
713 3300048904 Ga0496101_0012235 Ga0496101_0012235_1518_2840 432
714 3300048905 Ga0496102_0176702 Ga0496102_0176702_618_1940 432
715 3300048907 Ga0496104_0261118 Ga0496104_0261118_290_1612 432
716 3300048927 Ga0496124_0042623 Ga0496124_0042623_2547_3872 432
717 3300049539 Ga0501323_000726 Ga0501323_000726_855_2177 432
718 3300049569 Ga0501032_0103951 Ga0501032_0103951_38_1345 432
719 3300049570 Ga0501033_0125458 Ga0501033_0125458_308_1609 432
720 3300049571 Ga0501034_0041867 Ga0501034_0041867_2503_3810 432
721 3300049579 Ga0501043_0055797 Ga0501043_0055797_1062_2390 432
722 3300049585 Ga0501069_0011303 Ga0501069_0011303_1907_3235 432
723 3300049586 Ga0501070_0119081 Ga0501070_0119081_292_1593 432
724 3300049589 Ga0501073_0046449 Ga0501073_0046449_1196_2524 432
725 3300049661 Ga0501217_005267 Ga0501217_005267_163_1485 432
726 3300049670 Ga0501236_000066 Ga0501236_000066_2934_4256 432
727 3300049671 Ga0501238_006873 Ga0501238_006873_62_1384 432
728 3300049675 Ga0501243_008676 Ga0501243_008676_168_1475 432
729 3300050493 nmdc:mga0k408_33017_c1 nmdc:mga0k408_33017_c1_642_1964 432
730 3300050493 nmdc:mga0k408_6399_c1 nmdc:mga0k408_6399_c1_4498_5817 432
731 3300050507 nmdc:mga05p37_20368_c1 nmdc:mga05p37_20368_c1_262_1584 432
732 3300050508 nmdc:mga09592_92181_c1 nmdc:mga09592_92181_c1_314_1636 432
733 3300050510 nmdc:mga06r32_49377_c1 nmdc:mga06r32_49377_c1_2617_3939 432
734 3300050511 nmdc:mga08y16_141376_c1 nmdc:mga08y16_141376_c1_1143_2465 432
735 3300050511 nmdc:mga08y16_3286_c1 nmdc:mga08y16_3286_c1_3235_4557 432
736 3300050511 nmdc:mga08y16_5732_c1 nmdc:mga08y16_5732_c1_8789_10123 432
737 3300050511 nmdc:mga08y16_60600_c1 nmdc:mga08y16_60600_c1_106_1428 432
738 3300053092 Ga0500583_0000077 Ga0500583_0000077_17679_19004 432
739 3300053092 Ga0500583_0005181 Ga0500583_0005181_2298_3644 432
740 3300053108 Ga0500562_002684 Ga0500562_002684_652_1974 432
741 3300053122 Ga0500608_001113 Ga0500608_001113_8021_9346 432
742 3300053123 Ga0500614_012003 Ga0500614_012003_154_1473 432
743 3300053125 Ga0500618_000666 Ga0500618_000666_10425_11744 432
744 3300053125 Ga0500618_008890 Ga0500618_008890_183_1502 432
745 3300053139 Ga0500568_0000641 Ga0500568_0000641_13428_14753 432
746 3300053153 Ga0500616_0000009 Ga0500616_0000009_370417_371739 432
747 3300053156 Ga0500622_0000009 Ga0500622_0000009_336549_337871 432
748 3300053156 Ga0500622_0000096 Ga0500622_0000096_87691_89013 432
749 3300053156 Ga0500622_0002927 Ga0500622_0002927_8583_9905 432
750 3300053156 Ga0500622_0003314 Ga0500622_0003314_6527_7873 432
751 3300053156 Ga0500622_0012934 Ga0500622_0012934_3019_4344 432
752 3300053158 Ga0500627_0036267 Ga0500627_0036267_291_1613 432
753 3300053727 Ga0500611_000020 Ga0500611_000020_5100_6422 432
754 3300002737 JGI25162J39368_1001888 JGI25162J39368_10018883 433
755 3300002772 JGI25164J39214_1002648 JGI25164J39214_10026482 433
756 3300003214 JGI25165J46597_1000898 JGI25165J46597_100089818 433
757 3300005289 Ga0065704_10001141 Ga0065704_100011414 433
758 3300005327 Ga0070658_10073847 Ga0070658_100738472 433
759 3300005327 Ga0070658_10088639 Ga0070658_100886392 433
760 3300005329 Ga0070683_100159915 Ga0070683_1001599151 433
761 3300005336 Ga0070680_100068002 Ga0070680_1000680023 433
762 3300005336 Ga0070680_100131695 Ga0070680_1001316952 433
763 3300005339 Ga0070660_100086977 Ga0070660_1000869772 433
764 3300005339 Ga0070660_100123237 Ga0070660_1001232372 433
765 3300005345 Ga0070692_10103083 Ga0070692_101030831 433
766 3300005366 Ga0070659_100021644 Ga0070659_1000216442 433
767 3300005366 Ga0070659_100042229 Ga0070659_1000422291 433
768 3300005455 Ga0070663_100028577 Ga0070663_1000285773 433
769 3300005458 Ga0070681_10142682 Ga0070681_101426822 433
770 3300005530 Ga0070679_100001254 Ga0070679_1000012541 433
771 3300005530 Ga0070679_100015447 Ga0070679_1000154473 433
772 3300005535 Ga0070684_100104674 Ga0070684_1001046742 433
773 3300005563 Ga0068855_100000727 Ga0068855_10000072727 433
774 3300005563 Ga0068855_100000998 Ga0068855_10000099826 433
775 3300005563 Ga0068855_100144948 Ga0068855_1001449481 433
776 3300005563 Ga0068855_100242163 Ga0068855_1002421632 433
777 3300005578 Ga0068854_100031522 Ga0068854_1000315223 433
778 3300005614 Ga0068856_100000259 Ga0068856_10000025956 433
779 3300005616 Ga0068852_100003639 Ga0068852_1000036398 433
780 3300005616 Ga0068852_100005665 Ga0068852_1000056657 433
781 3300009093 Ga0105240_10031042 Ga0105240_100310422 433
782 3300009093 Ga0105240_10171848 Ga0105240_101718482 433
783 3300009148 Ga0105243_10000012 Ga0105243_10000012208 433
784 3300009545 Ga0105237_10001907 Ga0105237_100019075 433
785 3300010375 Ga0105239_10000013 Ga0105239_1000001336 433
786 3300010375 Ga0105239_10002563 Ga0105239_1000256324 433
787 3300013100 Ga0157373_10004754 Ga0157373_100047546 433
788 3300013100 Ga0157373_10019227 Ga0157373_100192273 433
789 3300013102 Ga0157371_10000724 Ga0157371_1000072430 433
790 3300013102 Ga0157371_10001349 Ga0157371_1000134913 433
791 3300013102 Ga0157371_10001703 Ga0157371_1000170313 433
792 3300013102 Ga0157371_10003887 Ga0157371_100038872 433
793 3300013102 Ga0157371_10006631 Ga0157371_100066315 433
794 3300013102 Ga0157371_10010626 Ga0157371_100106266 433
795 3300013102 Ga0157371_10022883 Ga0157371_100228832 433
796 3300013102 Ga0157371_10025530 Ga0157371_100255302 433
797 3300013102 Ga0157371_10041765 Ga0157371_100417652 433
798 3300013102 Ga0157371_10111945 Ga0157371_101119451 433
799 3300013104 Ga0157370_10003763 Ga0157370_1000376316 433
800 3300013104 Ga0157370_10037184 Ga0157370_100371842 433
801 3300013105 Ga0157369_10033374 Ga0157369_100333745 433
802 3300013105 Ga0157369_10039532 Ga0157369_100395325 433
803 3300013105 Ga0157369_10188032 Ga0157369_101880322 433
804 3300013307 Ga0157372_10001143 Ga0157372_1000114314 433
805 3300013307 Ga0157372_10005956 Ga0157372_100059562 433
806 3300013307 Ga0157372_10022931 Ga0157372_100229312 433
807 3300013307 Ga0157372_10094460 Ga0157372_100944602 433
808 3300013307 Ga0157372_10100848 Ga0157372_101008483 433
809 3300013307 Ga0157372_10202863 Ga0157372_102028632 433
810 3300025230 Ga0209563_103756 Ga0209563_1037561 433
811 3300025231 Ga0207427_100785 Ga0207427_1007854 433
812 3300025233 Ga0209437_100101 Ga0209437_100101234 433
813 3300025250 Ga0209026_1000987 Ga0209026_10009873 433
814 3300025261 Ga0209233_1000124 Ga0209233_10001244 433
815 3300025272 Ga0209455_1004434 Ga0209455_10044344 433
816 3300025904 Ga0207647_10030716 Ga0207647_100307164 433
817 3300025909 Ga0207705_10002903 Ga0207705_1000290311 433
818 3300025909 Ga0207705_10007368 Ga0207705_100073686 433
819 3300025909 Ga0207705_10151766 Ga0207705_101517661 433
820 3300025913 Ga0207695_10070758 Ga0207695_100707583 433
821 3300025913 Ga0207695_10114967 Ga0207695_101149672 433
822 3300025914 Ga0207671_10001803 Ga0207671_100018035 433
823 3300025917 Ga0207660_10049766 Ga0207660_100497662 433
824 3300025919 Ga0207657_10172084 Ga0207657_101720841 433
825 3300025921 Ga0207652_10000337 Ga0207652_1000033722 433
826 3300025921 Ga0207652_10002860 Ga0207652_1000286011 433
827 3300025921 Ga0207652_10020852 Ga0207652_100208525 433
828 3300025921 Ga0207652_10032090 Ga0207652_100320904 433
829 3300025932 Ga0207690_10112169 Ga0207690_101121692 433
830 3300025935 Ga0207709_10000006 Ga0207709_10000006535 433
831 3300025949 Ga0207667_10000020 Ga0207667_10000020200 433
832 3300025949 Ga0207667_10002289 Ga0207667_1000228913 433
833 3300025949 Ga0207667_10020765 Ga0207667_100207656 433
834 3300025949 Ga0207667_10056182 Ga0207667_100561824 433
835 3300026067 Ga0207678_10008280 Ga0207678_100082807 433
836 3300026078 Ga0207702_10000820 Ga0207702_1000082027 433
837 3300030742 Ga0316183_1126735 Ga0316183_11267354 433
838 3300030744 Ga0316181_1118713 Ga0316181_11187132 433
839 3300037312 Ga0395899_0006794 Ga0395899_0006794_5895_7199 433
840 3300037312 Ga0395899_0017979 Ga0395899_0017979_777_2081 433
841 3300037312 Ga0395899_0061038 Ga0395899_0061038_450_1754 433
842 3300037312 Ga0395899_0088854 Ga0395899_0088854_48_1352 433
843 3300037418 Ga0395900_0005501 Ga0395900_0005501_3677_4981 433
844 3300037418 Ga0395900_0005682 Ga0395900_0005682_9661_10965 433
845 3300037418 Ga0395900_0124774 Ga0395900_0124774_643_1947 433
846 3300037418 Ga0395900_0153735 Ga0395900_0153735_972_2276 433
847 3300037466 Ga0395898_0009433 Ga0395898_0009433_7016_8320 433
848 3300037466 Ga0395898_0130890 Ga0395898_0130890_670_1974 433
849 3300037471 Ga0395905_0036571 Ga0395905_0036571_2477_3781 433
850 3300038443 Ga0395901_0003324 Ga0395901_0003324_13548_14852 433
851 3300038443 Ga0395901_0136614 Ga0395901_0136614_795_2099 433
852 3300047472 Ga0495686_0000004 Ga0495686_0000004_184104_185477 433
853 3300047472 Ga0495686_0051650 Ga0495686_0051650_363_1667 433
854 3300048919 Ga0496116_0004290 Ga0496116_0004290_3744_5054 433
855 3300048920 Ga0496117_0008979 Ga0496117_0008979_3334_4644 433
856 3300048926 Ga0496123_0013257 Ga0496123_0013257_421_1731 433
857 3300049571 Ga0501034_0109443 Ga0501034_0109443_573_1874 433
858 3300049822 Ga0501035_0063517 Ga0501035_0063517_1012_2313 433
859 2162886007 SwRhRL2b_contig_308077 SwRhRL2b_0565.00002640 434
860 3300002737 JGI25162J39368_1000020 JGI25162J39368_1000020192 434
861 3300003320 rootH2_10035181 rootH2_100351818 434
862 3300005288 Ga0065714_10002919 Ga0065714_100029197 434
863 3300005289 Ga0065704_10000238 Ga0065704_1000023827 434
864 3300005563 Ga0068855_100378740 Ga0068855_1003787401 434
865 3300005614 Ga0068856_100003419 Ga0068856_1000034195 434
866 3300009093 Ga0105240_10001584 Ga0105240_1000158432 434
867 3300009174 Ga0105241_10096885 Ga0105241_100968852 434
868 3300009545 Ga0105237_10001449 Ga0105237_1000144920 434
869 3300009545 Ga0105237_10006763 Ga0105237_100067638 434
870 3300009545 Ga0105237_10079069 Ga0105237_100790691 434
871 3300009545 Ga0105237_10135189 Ga0105237_101351891 434
872 3300010375 Ga0105239_10000081 Ga0105239_1000008159 434
873 3300010375 Ga0105239_10000259 Ga0105239_1000025965 434
874 3300010375 Ga0105239_10016008 Ga0105239_100160082 434
875 3300013100 Ga0157373_10000597 Ga0157373_1000059713 434
876 3300013100 Ga0157373_10062478 Ga0157373_100624782 434
877 3300013102 Ga0157371_10002487 Ga0157371_100024874 434
878 3300013102 Ga0157371_10008420 Ga0157371_100084206 434
879 3300013104 Ga0157370_10001989 Ga0157370_100019894 434
880 3300013105 Ga0157369_10067870 Ga0157369_100678703 434
881 3300014497 Ga0182008_10000010 Ga0182008_10000010155 434
882 3300014497 Ga0182008_10003765 Ga0182008_100037656 434
883 3300015261 Ga0182006_1026019 Ga0182006_10260192 434
884 3300015262 Ga0182007_10010906 Ga0182007_100109063 434
885 3300015682 Ga0183373_1010 Ga0183373_1010156 434
886 3300025233 Ga0209437_100085 Ga0209437_10008516 434
887 3300025250 Ga0209026_1001037 Ga0209026_10010374 434
888 3300025913 Ga0207695_10000916 Ga0207695_1000091656 434
889 3300025914 Ga0207671_10006717 Ga0207671_100067178 434
890 3300025914 Ga0207671_10011739 Ga0207671_100117392 434
891 3300025914 Ga0207671_10044618 Ga0207671_100446181 434
892 3300025949 Ga0207667_10085791 Ga0207667_100857912 434
893 3300025949 Ga0207667_10277008 Ga0207667_102770082 434
894 3300026078 Ga0207702_10078276 Ga0207702_100782762 434
895 3300028800 Ga0265338_10030132 Ga0265338_100301324 434
896 3300031548 Ga0307408_100001775 Ga0307408_1000017753 434
897 3300031911 Ga0307412_10000018 Ga0307412_10000018176 434
898 3300032004 Ga0307414_10000393 Ga0307414_1000039311 434
899 3300032004 Ga0307414_10022716 Ga0307414_100227161 434
900 3300032004 Ga0307414_10030980 Ga0307414_100309802 434
901 3300032004 Ga0307414_10051783 Ga0307414_100517831 434
902 3300032004 Ga0307414_10055507 Ga0307414_100555073 434
903 3300032004 Ga0307414_10221590 Ga0307414_102215901 434
904 3300046513 Ga0495616_0005113 Ga0495616_0005113_1604_2929 434
905 3300046660 Ga0495625_0010947 Ga0495625_0010947_3302_4627 434
906 3300046660 Ga0495625_0017844 Ga0495625_0017844_2790_4115 434
907 3300047472 Ga0495686_0003602 Ga0495686_0003602_6808_8133 434
908 3300048925 Ga0496122_0000789 Ga0496122_0000789_30105_31409 434
909 3300048926 Ga0496123_0006610 Ga0496123_0006610_8287_9591 434
910 3300053092 Ga0500583_0000164 Ga0500583_0000164_19545_20978 434
911 3300053157 Ga0500624_000970 Ga0500624_000970_1345_2670 434

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01053

Cys_Met_Meta_PP

Cys/Met metabolism PLP-dependent enzyme

44

468

0.98

PF01041

DegT_DnrJ_EryC1

DegT/DnrJ/EryC1/StrS aminotransferase family

89

228

0.86

PF00155

Aminotran_1_2

Aminotransferase class I and II

86

261

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
8eqw-assembly1.cif.gz_G crystal structure of fub7 0.9819 6 434
8sf5-assembly1.cif.gz_A-2 promiscuous amino acid gamma synthase from caldicellulosiruptor hydrothermalis in open conformation 0.9816 5 428
8eqw-assembly4.cif.gz_D crystal structure of fub7 0.9813 6 434
8eqw-assembly3.cif.gz_C crystal structure of fub7 0.9804 5 434
8eqw-assembly1.cif.gz_A crystal structure of fub7 0.9803 5 434
ID Description Score Start End Superfamily
af_O13326_295_429_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9851 299 431 3.90.1150.10
af_Q59US5_3_288_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9813 5 293 3.40.640.10
af_P32929_263_402_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9771 298 432 3.90.1150.10
3ri6B02 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9763 299 428 3.90.1150.10
af_Q59US5_3_288_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9745 5 293 3.40.640.10
ID Description Score Start End GO Terms
AF-A0A434AUQ5-F1-model_v4 O-acetylhomoserine aminocarboxypropyltransferase/cysteine synthase 0.9932 1 432 GO:0003961
GO:0004124
GO:0005737
GO:0006535
GO:0019346
GO:0030170
GO:0071269
AF-A0A7G8JLQ7-F1-model_v4 O-acetylhomoserine aminocarboxypropyltransferase 0.9919 47 430 GO:0003961
GO:0004124
GO:0005737
GO:0006535
GO:0019346
GO:0030170
GO:0071269
AF-A0A1F2PGI7-F1-model_v4 Methionine gamma-lyase (EC 4.4.1.11) 0.9904 5 432 GO:0003961
GO:0004124
GO:0005737
GO:0006535
GO:0018826
GO:0019346
GO:0030170
GO:0071269
AF-A0A382DB25-F1-model_v4 Aminotransferase class V domain-containing protein 0.9903 5 228 GO:0003961
GO:0004124
GO:0005737
GO:0006535
GO:0019346
GO:0030170
GO:0071269
AF-A0A430SEX8-F1-model_v4 O-acetylhomoserine aminocarboxypropyltransferase (EC 2.5.1.49) 0.989 5 211 GO:0003961
GO:0004124
GO:0005737
GO:0006535
GO:0019346
GO:0030170
GO:0071269

Feature Viewer

pLDDT pTM Quality
94.55 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map