F485455
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 911 | 330 | 899 | 239 |
Family's Representative Sequence
| Representative Sequence | 3300005355|Ga0070671_100873844|Ga0070671_1008738441 |
| Length | 221 |
| Sequence | MARVAVVTGGTRGIGEAISMGLKQAGFTVAANYAGNDERAKAFSDRTGIKSYKWDVASFDDCVAGVKKVEGELGPVEVIVNNAGITRDATMKKMNRSAWDEVIDTNLGGCYNIGSINGQAGQYGQVNYAAAKSGIHGFTKALAQEGARSGITVNAIAPGYIDTDMVAAVPADVLTKIVARIPVGRLGQASEIARGVLFLVADEGGFITGSTLSINGGQHMY |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2643221622 | Sphingomonas sp. Root241 | Isolate | Unclassified |
| 3 | 2738541275 | Novosphingobium sp. GV027 | Isolate | Unclassified |
| 4 | 2738541301 | Novosphingobium sp. GV079 | Isolate | Unclassified |
| 5 | 2738541304 | Novosphingobium sp. GV061 | Isolate | Unclassified |
| 6 | 2738543022 | Novosphingobium sp. GV055 | Isolate | Unclassified |
| 7 | 2738543033 | Novosphingobium sp. GV064 | Isolate | Unclassified |
| 8 | 2848297114 | Croceibacterium ferulae EGI 63111 | Isolate | Unclassified |
| 9 | 2896253425 | Aurantiacibacter rhizosphaerae GH3-10 | Isolate | Rhizosphere |
| 10 | 2896429255 | Sphingomonas rhizophila KACC 19189 | Isolate | Rhizosphere |
| 11 | 2928100450 | Novosphingobium sp. 1529 | Isolate | Rhizosphere |
| 12 | 2928959182 | Novosphingobium capsulatum 1057 | Isolate | Unclassified |
| 13 | 2937843397 | Mesorhizobium xinjiangense lm94 | Isolate | Rhizosphere |
| 14 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 15 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 16 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 17 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 18 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 19 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 20 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 21 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 22 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 23 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 24 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 25 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 26 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 34 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 44 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 54 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 56 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 58 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 66 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 68 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 69 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 70 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 71 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 72 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 73 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 74 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 75 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 76 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 77 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 78 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 79 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 80 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 81 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 83 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 84 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 85 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 86 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 88 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 111 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 115 | 3300016635 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 | Metagenome | Rhizosphere |
| 116 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 118 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 119 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 120 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 122 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 123 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 127 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 189 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 190 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 191 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 192 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 193 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 194 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 195 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 196 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 197 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 198 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 199 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 200 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 201 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 202 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 203 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 204 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 205 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 206 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 207 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 208 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 209 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 210 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 211 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 212 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 213 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 214 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 215 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 216 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 217 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 218 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 219 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 220 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 221 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 222 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 223 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 224 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 225 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 226 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 227 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 228 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 229 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 230 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 231 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 232 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 233 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 234 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 235 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 236 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 237 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 238 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 239 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 240 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 241 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 242 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 243 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 244 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 245 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 246 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 260 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 261 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 262 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 263 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 264 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 265 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 266 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 267 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 268 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 269 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 270 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 271 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 272 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 273 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 274 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 275 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 276 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 277 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 278 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 279 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 280 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 281 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 282 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 283 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 284 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 285 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 287 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 292 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 295 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 296 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 303 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 304 | 3300049677 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control | Metagenome | Rhizosphere |
| 305 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 306 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 312 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 313 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 314 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 315 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 316 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 317 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 318 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 319 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 320 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 321 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
| 322 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 323 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 324 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 325 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 326 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 327 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 328 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 329 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 330 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.46 |
| Metatranscriptomes | 0.22 |
| Isolates | 1.32 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.05 |
| Nodule | 0 |
| Rhizoplane | 8.34 |
| Rhizosphere | 83.64 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.96 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_2264840 | 2162886007 | Bacteria | 1458 |
| 2 | ARcpr5yngRDRAFT_c009745 | 3300000043 | Bacteria | 819 |
| 3 | JGI24740J21852_10073782 | 3300001979 | Bacteria | 908 |
| 4 | JGI24739J22299_10041723 | 3300001989 | Bacteria | 1524 |
| 5 | JGI24737J22298_10006549 | 3300001990 | Bacteria | 3971 |
| 6 | JGI24737J22298_10012841 | 3300001990 | Bacteria | 2731 |
| 7 | JGI25153J46596_10000126 | 3300003215 | Bacteria | 83750 |
| 8 | JGI25153J46596_10060671 | 3300003215 | Bacteria | 1029 |
| 9 | Ga0055537_1003751 | 3300003773 | Bacteria | 4578 |
| 10 | Ga0055524_1000245 | 3300003775 | Bacteria | 56692 |
| 11 | Ga0055530_10000064 | 3300003791 | Bacteria | 94475 |
| 12 | Ga0055531_10000073 | 3300003794 | Bacteria | 109510 |
| 13 | Ga0055531_10047592 | 3300003794 | Bacteria | 1165 |
| 14 | Ga0055531_10054580 | 3300003794 | Bacteria | 1023 |
| 15 | Ga0065165_1006490 | 3300005262 | Bacteria | 6115 |
| 16 | Ga0065165_1010172 | 3300005262 | Bacteria | 4105 |
| 17 | Ga0065712_10126381 | 3300005290 | Bacteria | 1602 |
| 18 | Ga0065712_10359175 | 3300005290 | Bacteria | 777 |
| 19 | Ga0065715_10095621 | 3300005293 | Bacteria | 4030 |
| 20 | Ga0070658_10005417 | 3300005327 | Bacteria | 10352 |
| 21 | Ga0070658_10034829 | 3300005327 | Bacteria | 4052 |
| 22 | Ga0070658_10074198 | 3300005327 | Bacteria | 2790 |
| 23 | Ga0070658_10095591 | 3300005327 | Bacteria | 2453 |
| 24 | Ga0070658_10112829 | 3300005327 | Bacteria | 2253 |
| 25 | Ga0070658_10117618 | 3300005327 | Bacteria | 2207 |
| 26 | Ga0070676_10096112 | 3300005328 | Bacteria | 1823 |
| 27 | Ga0070676_10151734 | 3300005328 | Bacteria | 1484 |
| 28 | Ga0070676_10309565 | 3300005328 | Bacteria | 1073 |
| 29 | Ga0070683_100145988 | 3300005329 | Bacteria | 2242 |
| 30 | Ga0070683_100146607 | 3300005329 | Bacteria | 2237 |
| 31 | Ga0070690_100011596 | 3300005330 | Bacteria | 5159 |
| 32 | Ga0070670_100028508 | 3300005331 | Bacteria | 4805 |
| 33 | Ga0070670_100031460 | 3300005331 | Bacteria | 4570 |
| 34 | Ga0070670_100063761 | 3300005331 | Bacteria | 3162 |
| 35 | Ga0070670_100082914 | 3300005331 | Bacteria | 2755 |
| 36 | Ga0070666_10005242 | 3300005335 | Bacteria | 7939 |
| 37 | Ga0070666_10023613 | 3300005335 | Bacteria | 4003 |
| 38 | Ga0070680_100098143 | 3300005336 | Bacteria | 2429 |
| 39 | Ga0070680_100126515 | 3300005336 | Bacteria | 2135 |
| 40 | Ga0068868_100001315 | 3300005338 | Bacteria | 17124 |
| 41 | Ga0068868_100019311 | 3300005338 | Bacteria | 5106 |
| 42 | Ga0068868_100028424 | 3300005338 | Bacteria | 4275 |
| 43 | Ga0068868_100149061 | 3300005338 | Bacteria | 1925 |
| 44 | Ga0070660_100006409 | 3300005339 | Bacteria | 8155 |
| 45 | Ga0070660_100016068 | 3300005339 | Bacteria | 5424 |
| 46 | Ga0070660_100028804 | 3300005339 | Bacteria | 4158 |
| 47 | Ga0070660_100032953 | 3300005339 | Bacteria | 3902 |
| 48 | Ga0070660_100099383 | 3300005339 | Bacteria | 2304 |
| 49 | Ga0070661_100016193 | 3300005344 | Bacteria | 5266 |
| 50 | Ga0070661_100025904 | 3300005344 | Bacteria | 4215 |
| 51 | Ga0070661_100047542 | 3300005344 | Bacteria | 3140 |
| 52 | Ga0070661_100056067 | 3300005344 | Bacteria | 2886 |
| 53 | Ga0070661_100252837 | 3300005344 | Bacteria | 1360 |
| 54 | Ga0070692_10011905 | 3300005345 | Bacteria | 4011 |
| 55 | Ga0070692_10224532 | 3300005345 | Bacteria | 1112 |
| 56 | Ga0070668_100002681 | 3300005347 | Bacteria | 13086 |
| 57 | Ga0070668_100252404 | 3300005347 | Bacteria | 1465 |
| 58 | Ga0070669_100000068 | 3300005353 | Bacteria | 103282 |
| 59 | Ga0070669_100020982 | 3300005353 | Bacteria | 4667 |
| 60 | Ga0070669_100081289 | 3300005353 | Bacteria | 2413 |
| 61 | Ga0070675_100081613 | 3300005354 | Bacteria | 2696 |
| 62 | Ga0070675_100085366 | 3300005354 | Bacteria | 2637 |
| 63 | Ga0070671_100000777 | 3300005355 | Bacteria | 22924 |
| 64 | Ga0070671_100007788 | 3300005355 | Bacteria | 8559 |
| 65 | Ga0070671_100011151 | 3300005355 | Bacteria | 7217 |
| 66 | Ga0070671_100012348 | 3300005355 | Bacteria | 6879 |
| 67 | Ga0070671_100025045 | 3300005355 | Bacteria | 4891 |
| 68 | Ga0070671_100092282 | 3300005355 | Bacteria | 2537 |
| 69 | Ga0070671_100106591 | 3300005355 | Bacteria | 2353 |
| 70 | Ga0070671_100186709 | 3300005355 | Bacteria | 1756 |
| 71 | Ga0070671_100545605 | 3300005355 | Bacteria | 999 |
| 72 | Ga0070671_100873844 | 3300005355 | Bacteria | 785 |
| 73 | Ga0070674_100020059 | 3300005356 | Bacteria | 4261 |
| 74 | Ga0070674_100159829 | 3300005356 | Bacteria | 1709 |
| 75 | Ga0070674_100264259 | 3300005356 | Bacteria | 1357 |
| 76 | Ga0070673_100026160 | 3300005364 | Bacteria | 4306 |
| 77 | Ga0070673_100059648 | 3300005364 | Bacteria | 3021 |
| 78 | Ga0070673_100063883 | 3300005364 | Bacteria | 2931 |
| 79 | Ga0070673_100168984 | 3300005364 | Bacteria | 1865 |
| 80 | Ga0070673_100197802 | 3300005364 | Bacteria | 1730 |
| 81 | Ga0070688_100166852 | 3300005365 | Bacteria | 1516 |
| 82 | Ga0070659_100002551 | 3300005366 | Bacteria | 12957 |
| 83 | Ga0070659_100010070 | 3300005366 | Bacteria | 6961 |
| 84 | Ga0070659_100020119 | 3300005366 | Bacteria | 5067 |
| 85 | Ga0070659_100029930 | 3300005366 | Bacteria | 4210 |
| 86 | Ga0070659_100042504 | 3300005366 | Bacteria | 3553 |
| 87 | Ga0070659_100059956 | 3300005366 | Bacteria | 3005 |
| 88 | Ga0070659_100068896 | 3300005366 | Bacteria | 2808 |
| 89 | Ga0070659_100194547 | 3300005366 | Bacteria | 1668 |
| 90 | Ga0070659_100309130 | 3300005366 | Bacteria | 1320 |
| 91 | Ga0070667_100000885 | 3300005367 | Bacteria | 27676 |
| 92 | Ga0070667_100006375 | 3300005367 | Bacteria | 9805 |
| 93 | Ga0070667_100010927 | 3300005367 | Bacteria | 7511 |
| 94 | Ga0070667_100018985 | 3300005367 | Bacteria | 5700 |
| 95 | Ga0070667_100048257 | 3300005367 | Bacteria | 3583 |
| 96 | Ga0070667_100113736 | 3300005367 | Bacteria | 2349 |
| 97 | Ga0070667_100217836 | 3300005367 | Bacteria | 1698 |
| 98 | Ga0070667_100334528 | 3300005367 | Bacteria | 1369 |
| 99 | Ga0070667_100363210 | 3300005367 | Bacteria | 1313 |
| 100 | Ga0070714_100092608 | 3300005435 | Bacteria | 2649 |
| 101 | Ga0070714_100575646 | 3300005435 | Bacteria | 1080 |
| 102 | Ga0070713_100310802 | 3300005436 | Bacteria | 1453 |
| 103 | Ga0070694_100009270 | 3300005444 | Bacteria | 6040 |
| 104 | Ga0070663_100000991 | 3300005455 | Bacteria | 15463 |
| 105 | Ga0070663_100036923 | 3300005455 | Bacteria | 3397 |
| 106 | Ga0070663_100061469 | 3300005455 | Bacteria | 2705 |
| 107 | Ga0070663_100066486 | 3300005455 | Bacteria | 2612 |
| 108 | Ga0070663_100093820 | 3300005455 | Bacteria | 2227 |
| 109 | Ga0070663_100132960 | 3300005455 | Bacteria | 1891 |
| 110 | Ga0070663_100156413 | 3300005455 | Bacteria | 1752 |
| 111 | Ga0070678_100023347 | 3300005456 | Bacteria | 4120 |
| 112 | Ga0070678_100111826 | 3300005456 | Bacteria | 2138 |
| 113 | Ga0070678_100175038 | 3300005456 | Bacteria | 1751 |
| 114 | Ga0070678_100318384 | 3300005456 | Bacteria | 1328 |
| 115 | Ga0070662_100006707 | 3300005457 | Bacteria | 7438 |
| 116 | Ga0070662_100027144 | 3300005457 | Bacteria | 3971 |
| 117 | Ga0070662_100167048 | 3300005457 | Bacteria | 1725 |
| 118 | Ga0070662_100215143 | 3300005457 | Bacteria | 1531 |
| 119 | Ga0070681_10259039 | 3300005458 | Bacteria | 1651 |
| 120 | Ga0068867_100002219 | 3300005459 | Bacteria | 13628 |
| 121 | Ga0068867_100121372 | 3300005459 | Bacteria | 2020 |
| 122 | Ga0068867_100126736 | 3300005459 | Bacteria | 1979 |
| 123 | Ga0068867_100170820 | 3300005459 | Bacteria | 1722 |
| 124 | Ga0068867_100428871 | 3300005459 | Bacteria | 1122 |
| 125 | Ga0070685_10474398 | 3300005466 | Bacteria | 881 |
| 126 | Ga0070679_100022822 | 3300005530 | Bacteria | 6120 |
| 127 | Ga0070679_100330461 | 3300005530 | Bacteria | 1473 |
| 128 | Ga0070684_100491043 | 3300005535 | Bacteria | 1137 |
| 129 | Ga0068853_100019988 | 3300005539 | Bacteria | 5563 |
| 130 | Ga0070672_100031263 | 3300005543 | Bacteria | 4006 |
| 131 | Ga0070672_100080366 | 3300005543 | Bacteria | 2612 |
| 132 | Ga0070672_100089713 | 3300005543 | Bacteria | 2477 |
| 133 | Ga0070672_100120228 | 3300005543 | Bacteria | 2149 |
| 134 | Ga0070686_100001063 | 3300005544 | Bacteria | 15834 |
| 135 | Ga0070695_100022680 | 3300005545 | Bacteria | 3853 |
| 136 | Ga0070696_100011198 | 3300005546 | Bacteria | 6003 |
| 137 | Ga0070693_100132503 | 3300005547 | Bacteria | 1560 |
| 138 | Ga0070665_100001845 | 3300005548 | Bacteria | 24057 |
| 139 | Ga0070665_100002264 | 3300005548 | Bacteria | 21390 |
| 140 | Ga0070665_100012623 | 3300005548 | Bacteria | 8506 |
| 141 | Ga0070665_100169147 | 3300005548 | Bacteria | 2187 |
| 142 | Ga0070665_100399278 | 3300005548 | Bacteria | 1383 |
| 143 | Ga0070704_100101393 | 3300005549 | Bacteria | 2170 |
| 144 | Ga0068855_100056364 | 3300005563 | Bacteria | 4612 |
| 145 | Ga0068855_100144320 | 3300005563 | Bacteria | 2711 |
| 146 | Ga0068855_100204060 | 3300005563 | Bacteria | 2224 |
| 147 | Ga0068855_101099922 | 3300005563 | Bacteria | 831 |
| 148 | Ga0070664_100003956 | 3300005564 | Bacteria | 11930 |
| 149 | Ga0070664_100005115 | 3300005564 | Bacteria | 10527 |
| 150 | Ga0070664_100008101 | 3300005564 | Bacteria | 8493 |
| 151 | Ga0070664_100026386 | 3300005564 | Bacteria | 4819 |
| 152 | Ga0070664_100039130 | 3300005564 | Bacteria | 3994 |
| 153 | Ga0070664_100075351 | 3300005564 | Bacteria | 2897 |
| 154 | Ga0070664_100084102 | 3300005564 | Bacteria | 2746 |
| 155 | Ga0070664_100111731 | 3300005564 | Bacteria | 2385 |
| 156 | Ga0070664_100151349 | 3300005564 | Bacteria | 2048 |
| 157 | Ga0070664_100316769 | 3300005564 | Bacteria | 1412 |
| 158 | Ga0068857_100003144 | 3300005577 | Bacteria | 13670 |
| 159 | Ga0068857_100064083 | 3300005577 | Bacteria | 3267 |
| 160 | Ga0068857_100291401 | 3300005577 | Bacteria | 1503 |
| 161 | Ga0068857_100400961 | 3300005577 | Bacteria | 1276 |
| 162 | Ga0068854_100160932 | 3300005578 | Bacteria | 1738 |
| 163 | Ga0068856_100006667 | 3300005614 | Bacteria | 11316 |
| 164 | Ga0068856_100094019 | 3300005614 | Bacteria | 2984 |
| 165 | Ga0068852_100000980 | 3300005616 | Bacteria | 18776 |
| 166 | Ga0068852_100018839 | 3300005616 | Bacteria | 5447 |
| 167 | Ga0068852_100046996 | 3300005616 | Bacteria | 3680 |
| 168 | Ga0068852_100063641 | 3300005616 | Bacteria | 3212 |
| 169 | Ga0068852_100110241 | 3300005616 | Bacteria | 2501 |
| 170 | Ga0068852_100174487 | 3300005616 | Bacteria | 2017 |
| 171 | Ga0068852_100270042 | 3300005616 | Bacteria | 1636 |
| 172 | Ga0068852_100339466 | 3300005616 | Bacteria | 1464 |
| 173 | Ga0068859_100003574 | 3300005617 | Bacteria | 15840 |
| 174 | Ga0068859_100014058 | 3300005617 | Bacteria | 8027 |
| 175 | Ga0068859_100027091 | 3300005617 | Bacteria | 5749 |
| 176 | Ga0068859_100197078 | 3300005617 | Bacteria | 2098 |
| 177 | Ga0068859_100249132 | 3300005617 | Bacteria | 1867 |
| 178 | Ga0068859_100370963 | 3300005617 | Bacteria | 1527 |
| 179 | Ga0068864_100000644 | 3300005618 | Bacteria | 29347 |
| 180 | Ga0068864_100000652 | 3300005618 | Bacteria | 28966 |
| 181 | Ga0068864_100007139 | 3300005618 | Bacteria | 9177 |
| 182 | Ga0068864_100007619 | 3300005618 | Bacteria | 8914 |
| 183 | Ga0068864_100017564 | 3300005618 | Bacteria | 5964 |
| 184 | Ga0068864_100033788 | 3300005618 | Bacteria | 4349 |
| 185 | Ga0068864_100237775 | 3300005618 | Bacteria | 1687 |
| 186 | Ga0068866_10005315 | 3300005718 | Bacteria | 5307 |
| 187 | Ga0068861_100105991 | 3300005719 | Bacteria | 2245 |
| 188 | Ga0068851_10003801 | 3300005834 | Bacteria | 6752 |
| 189 | Ga0068851_10006508 | 3300005834 | Bacteria | 5334 |
| 190 | Ga0068851_10017140 | 3300005834 | Bacteria | 3475 |
| 191 | Ga0068851_10185897 | 3300005834 | Bacteria | 1153 |
| 192 | Ga0068863_100005398 | 3300005841 | Bacteria | 12607 |
| 193 | Ga0068863_100005821 | 3300005841 | Bacteria | 12080 |
| 194 | Ga0068863_100006923 | 3300005841 | Bacteria | 11114 |
| 195 | Ga0068863_100007794 | 3300005841 | Bacteria | 10470 |
| 196 | Ga0068863_100022840 | 3300005841 | Bacteria | 5976 |
| 197 | Ga0068863_100151238 | 3300005841 | Bacteria | 2221 |
| 198 | Ga0068858_100000338 | 3300005842 | Bacteria | 49699 |
| 199 | Ga0068858_100001356 | 3300005842 | Bacteria | 25201 |
| 200 | Ga0068858_100011333 | 3300005842 | Bacteria | 8420 |
| 201 | Ga0068858_100015292 | 3300005842 | Bacteria | 7220 |
| 202 | Ga0068858_100089996 | 3300005842 | Bacteria | 2856 |
| 203 | Ga0068858_100145529 | 3300005842 | Bacteria | 2225 |
| 204 | Ga0068858_100228759 | 3300005842 | Bacteria | 1762 |
| 205 | Ga0068860_100000164 | 3300005843 | Bacteria | 108706 |
| 206 | Ga0068860_100010261 | 3300005843 | Bacteria | 9272 |
| 207 | Ga0068860_100014304 | 3300005843 | Bacteria | 7781 |
| 208 | Ga0068860_100031747 | 3300005843 | Bacteria | 5078 |
| 209 | Ga0068860_100094916 | 3300005843 | Bacteria | 2842 |
| 210 | Ga0068860_100097821 | 3300005843 | Bacteria | 2798 |
| 211 | Ga0068860_100148802 | 3300005843 | Bacteria | 2254 |
| 212 | Ga0068862_100013225 | 3300005844 | Bacteria | 6826 |
| 213 | Ga0068862_100027070 | 3300005844 | Bacteria | 4824 |
| 214 | Ga0068862_100145065 | 3300005844 | Bacteria | 2109 |
| 215 | Ga0068862_100211773 | 3300005844 | Bacteria | 1751 |
| 216 | Ga0068862_100400715 | 3300005844 | Bacteria | 1283 |
| 217 | Ga0068862_100535272 | 3300005844 | Bacteria | 1117 |
| 218 | Ga0075366_10164086 | 3300006195 | Bacteria | 1347 |
| 219 | Ga0097621_100030812 | 3300006237 | Bacteria | 4251 |
| 220 | Ga0097621_100035903 | 3300006237 | Bacteria | 3962 |
| 221 | Ga0097621_100095911 | 3300006237 | Bacteria | 2488 |
| 222 | Ga0097621_100611649 | 3300006237 | Bacteria | 997 |
| 223 | Ga0068871_100046466 | 3300006358 | Bacteria | 3497 |
| 224 | Ga0068871_100051763 | 3300006358 | Bacteria | 3324 |
| 225 | Ga0075428_100243409 | 3300006844 | Bacteria | 1940 |
| 226 | Ga0075433_10025912 | 3300006852 | Bacteria | 4959 |
| 227 | Ga0068865_100014709 | 3300006881 | Bacteria | 4979 |
| 228 | Ga0097620_100003574 | 3300006931 | Bacteria | 15840 |
| 229 | Ga0097620_100014058 | 3300006931 | Bacteria | 8027 |
| 230 | Ga0097620_100027091 | 3300006931 | Bacteria | 5749 |
| 231 | Ga0097620_100197052 | 3300006931 | Bacteria | 2098 |
| 232 | Ga0097620_100249122 | 3300006931 | Bacteria | 1867 |
| 233 | Ga0097620_100370975 | 3300006931 | Bacteria | 1527 |
| 234 | Ga0075435_100368170 | 3300007076 | Bacteria | 1233 |
| 235 | Ga0105251_10066085 | 3300009011 | Bacteria | 1691 |
| 236 | Ga0105251_10085531 | 3300009011 | Bacteria | 1453 |
| 237 | Ga0105240_10233002 | 3300009093 | Bacteria | 2139 |
| 238 | Ga0105240_10289998 | 3300009093 | Bacteria | 1876 |
| 239 | Ga0111539_10017289 | 3300009094 | Bacteria | 8926 |
| 240 | Ga0105245_10020016 | 3300009098 | Bacteria | 5866 |
| 241 | Ga0105245_10020409 | 3300009098 | Bacteria | 5811 |
| 242 | Ga0105243_10121505 | 3300009148 | Bacteria | 2203 |
| 243 | Ga0105243_10369708 | 3300009148 | Bacteria | 1322 |
| 244 | Ga0105241_10050172 | 3300009174 | Bacteria | 3180 |
| 245 | Ga0105242_10002830 | 3300009176 | Bacteria | 13594 |
| 246 | Ga0105242_10204338 | 3300009176 | Bacteria | 1756 |
| 247 | Ga0105248_10000898 | 3300009177 | Bacteria | 33299 |
| 248 | Ga0105248_10001310 | 3300009177 | Bacteria | 27712 |
| 249 | Ga0105248_10005770 | 3300009177 | Bacteria | 13602 |
| 250 | Ga0105248_10006692 | 3300009177 | Bacteria | 12643 |
| 251 | Ga0105248_10007974 | 3300009177 | Bacteria | 11638 |
| 252 | Ga0105248_10008536 | 3300009177 | Bacteria | 11247 |
| 253 | Ga0105248_10009978 | 3300009177 | Bacteria | 10454 |
| 254 | Ga0105248_10012217 | 3300009177 | Bacteria | 9469 |
| 255 | Ga0105248_10060856 | 3300009177 | Bacteria | 4239 |
| 256 | Ga0105248_10080506 | 3300009177 | Bacteria | 3661 |
| 257 | Ga0105248_10271396 | 3300009177 | Bacteria | 1910 |
| 258 | Ga0105237_10030373 | 3300009545 | Bacteria | 5489 |
| 259 | Ga0105237_10154785 | 3300009545 | Bacteria | 2289 |
| 260 | Ga0105237_10158213 | 3300009545 | Bacteria | 2263 |
| 261 | Ga0105238_10051207 | 3300009551 | Bacteria | 4154 |
| 262 | Ga0105238_10318030 | 3300009551 | Bacteria | 1542 |
| 263 | Ga0105249_10066447 | 3300009553 | Bacteria | 3320 |
| 264 | Ga0105249_10139116 | 3300009553 | Bacteria | 2326 |
| 265 | Ga0105249_10169322 | 3300009553 | Bacteria | 2117 |
| 266 | Ga0105249_10390789 | 3300009553 | Bacteria | 1419 |
| 267 | Ga0105249_10663919 | 3300009553 | Bacteria | 1101 |
| 268 | Ga0105246_10050934 | 3300011119 | Bacteria | 2842 |
| 269 | Ga0105246_10100023 | 3300011119 | Bacteria | 2109 |
| 270 | Ga0157373_10096111 | 3300013100 | Bacteria | 2086 |
| 271 | Ga0157373_10178975 | 3300013100 | Bacteria | 1493 |
| 272 | Ga0157373_10187832 | 3300013100 | Bacteria | 1456 |
| 273 | Ga0157373_10219312 | 3300013100 | Bacteria | 1342 |
| 274 | Ga0157371_10017846 | 3300013102 | Bacteria | 5261 |
| 275 | Ga0157371_10077134 | 3300013102 | Bacteria | 2360 |
| 276 | Ga0157370_10716494 | 3300013104 | Bacteria | 913 |
| 277 | Ga0157369_10035624 | 3300013105 | Bacteria | 5455 |
| 278 | Ga0157369_10426685 | 3300013105 | Bacteria | 1374 |
| 279 | Ga0157378_10030245 | 3300013297 | Bacteria | 4785 |
| 280 | Ga0157378_10094676 | 3300013297 | Bacteria | 2720 |
| 281 | Ga0157378_10144132 | 3300013297 | Bacteria | 2214 |
| 282 | Ga0157378_10426477 | 3300013297 | Bacteria | 1312 |
| 283 | Ga0163162_10006162 | 3300013306 | Bacteria | 11614 |
| 284 | Ga0163162_10006556 | 3300013306 | Bacteria | 11277 |
| 285 | Ga0163162_10063486 | 3300013306 | Bacteria | 3736 |
| 286 | Ga0163162_10136868 | 3300013306 | Bacteria | 2560 |
| 287 | Ga0163162_10358151 | 3300013306 | Bacteria | 1592 |
| 288 | Ga0157372_10360175 | 3300013307 | Bacteria | 1695 |
| 289 | Ga0157375_10157881 | 3300013308 | Bacteria | 2408 |
| 290 | Ga0157375_10338185 | 3300013308 | Bacteria | 1671 |
| 291 | Ga0163163_10003408 | 3300014325 | Bacteria | 13504 |
| 292 | Ga0163163_10009604 | 3300014325 | Bacteria | 8645 |
| 293 | Ga0163163_10032541 | 3300014325 | Bacteria | 5036 |
| 294 | Ga0157380_10000643 | 3300014326 | Bacteria | 21584 |
| 295 | Ga0182008_10015626 | 3300014497 | Bacteria | 3957 |
| 296 | Ga0182008_10251015 | 3300014497 | Bacteria | 912 |
| 297 | Ga0157377_10057529 | 3300014745 | Bacteria | 2211 |
| 298 | Ga0157379_10002639 | 3300014968 | Bacteria | 15087 |
| 299 | Ga0157379_10159058 | 3300014968 | Bacteria | 2039 |
| 300 | Ga0157379_10178292 | 3300014968 | Bacteria | 1919 |
| 301 | Ga0157379_10728826 | 3300014968 | Bacteria | 932 |
| 302 | Ga0157376_10306495 | 3300014969 | Bacteria | 1505 |
| 303 | Ga0183363_1003 | 3300015690 | Bacteria | 421263 |
| 304 | Ga0183361_11167 | 3300016635 | Bacteria | 1321 |
| 305 | Ga0163161_10003908 | 3300017792 | Bacteria | 10452 |
| 306 | Ga0206353_10503123 | 3300020082 | Bacteria | 3634 |
| 307 | Ga0213876_10087211 | 3300021384 | Bacteria | 1652 |
| 308 | Ga0209565_1000007 | 3300025263 | Bacteria | 784361 |
| 309 | Ga0207666_1012494 | 3300025271 | Bacteria | 1184 |
| 310 | Ga0209673_1001016 | 3300025273 | Bacteria | 33837 |
| 311 | Ga0209675_1007707 | 3300025291 | Bacteria | 4076 |
| 312 | Ga0209676_1016060 | 3300025292 | Bacteria | 2724 |
| 313 | Ga0209758_1000005 | 3300025297 | Bacteria | 1368918 |
| 314 | Ga0209758_1011190 | 3300025297 | Bacteria | 5235 |
| 315 | Ga0209050_1000010 | 3300025298 | Bacteria | 980454 |
| 316 | Ga0209050_1003636 | 3300025298 | Bacteria | 11148 |
| 317 | Ga0209050_1005965 | 3300025298 | Bacteria | 7405 |
| 318 | Ga0209256_1000008 | 3300025299 | Bacteria | 975723 |
| 319 | Ga0207426_1051382 | 3300025302 | Bacteria | 1225 |
| 320 | Ga0207426_1078811 | 3300025302 | Bacteria | 898 |
| 321 | Ga0209257_1000027 | 3300025304 | Bacteria | 703541 |
| 322 | Ga0209257_1002411 | 3300025304 | Bacteria | 18682 |
| 323 | Ga0207697_10017346 | 3300025315 | Bacteria | 2959 |
| 324 | Ga0207656_10002269 | 3300025321 | Bacteria | 6444 |
| 325 | Ga0207656_10023356 | 3300025321 | Bacteria | 2489 |
| 326 | Ga0207656_10096395 | 3300025321 | Bacteria | 1350 |
| 327 | Ga0207656_10144858 | 3300025321 | Bacteria | 1122 |
| 328 | Ga0207696_1027164 | 3300025711 | Bacteria | 1766 |
| 329 | Ga0207713_1009812 | 3300025735 | Bacteria | 5361 |
| 330 | Ga0207642_10198768 | 3300025899 | Bacteria | 1106 |
| 331 | Ga0207688_10187812 | 3300025901 | Bacteria | 1235 |
| 332 | Ga0207688_10244265 | 3300025901 | Bacteria | 1086 |
| 333 | Ga0207680_10007920 | 3300025903 | Bacteria | 5194 |
| 334 | Ga0207680_10011483 | 3300025903 | Bacteria | 4478 |
| 335 | Ga0207680_10031782 | 3300025903 | Bacteria | 2994 |
| 336 | Ga0207680_10058812 | 3300025903 | Bacteria | 2332 |
| 337 | Ga0207680_10063454 | 3300025903 | Bacteria | 2261 |
| 338 | Ga0207680_10089118 | 3300025903 | Bacteria | 1958 |
| 339 | Ga0207680_10134194 | 3300025903 | Bacteria | 1634 |
| 340 | Ga0207680_10240723 | 3300025903 | Bacteria | 1247 |
| 341 | Ga0207647_10009717 | 3300025904 | Bacteria | 6824 |
| 342 | Ga0207647_10017962 | 3300025904 | Bacteria | 4795 |
| 343 | Ga0207647_10056670 | 3300025904 | Bacteria | 2404 |
| 344 | Ga0207645_10011561 | 3300025907 | Bacteria | 6020 |
| 345 | Ga0207645_10019534 | 3300025907 | Bacteria | 4441 |
| 346 | Ga0207645_10109864 | 3300025907 | Bacteria | 1784 |
| 347 | Ga0207645_10289255 | 3300025907 | Bacteria | 1089 |
| 348 | Ga0207705_10003338 | 3300025909 | Bacteria | 12195 |
| 349 | Ga0207705_10004852 | 3300025909 | Bacteria | 10104 |
| 350 | Ga0207705_10013059 | 3300025909 | Bacteria | 5993 |
| 351 | Ga0207705_10026948 | 3300025909 | Bacteria | 4096 |
| 352 | Ga0207705_10041563 | 3300025909 | Bacteria | 3298 |
| 353 | Ga0207705_10044100 | 3300025909 | Bacteria | 3205 |
| 354 | Ga0207705_10046994 | 3300025909 | Bacteria | 3103 |
| 355 | Ga0207705_10056628 | 3300025909 | Bacteria | 2827 |
| 356 | Ga0207705_10204275 | 3300025909 | Bacteria | 1497 |
| 357 | Ga0207707_10052080 | 3300025912 | Bacteria | 3565 |
| 358 | Ga0207707_10079159 | 3300025912 | Bacteria | 2870 |
| 359 | Ga0207695_10248961 | 3300025913 | Bacteria | 1677 |
| 360 | Ga0207660_10013623 | 3300025917 | Bacteria | 5332 |
| 361 | Ga0207662_10097390 | 3300025918 | Bacteria | 1818 |
| 362 | Ga0207662_10124265 | 3300025918 | Bacteria | 1621 |
| 363 | Ga0207657_10000868 | 3300025919 | Bacteria | 31880 |
| 364 | Ga0207657_10002240 | 3300025919 | Bacteria | 20961 |
| 365 | Ga0207657_10005291 | 3300025919 | Bacteria | 13520 |
| 366 | Ga0207657_10005364 | 3300025919 | Bacteria | 13428 |
| 367 | Ga0207657_10020284 | 3300025919 | Bacteria | 6286 |
| 368 | Ga0207657_10058947 | 3300025919 | Bacteria | 3302 |
| 369 | Ga0207657_10079808 | 3300025919 | Bacteria | 2752 |
| 370 | Ga0207657_10098369 | 3300025919 | Bacteria | 2432 |
| 371 | Ga0207657_10103969 | 3300025919 | Bacteria | 2353 |
| 372 | Ga0207657_10243484 | 3300025919 | Bacteria | 1435 |
| 373 | Ga0207657_10318709 | 3300025919 | Bacteria | 1230 |
| 374 | Ga0207657_10525901 | 3300025919 | Bacteria | 925 |
| 375 | Ga0207649_10016567 | 3300025920 | Bacteria | 4160 |
| 376 | Ga0207649_10033073 | 3300025920 | Bacteria | 3087 |
| 377 | Ga0207649_10069766 | 3300025920 | Bacteria | 2239 |
| 378 | Ga0207649_10101659 | 3300025920 | Bacteria | 1904 |
| 379 | Ga0207649_10466915 | 3300025920 | Bacteria | 955 |
| 380 | Ga0207652_10079371 | 3300025921 | Bacteria | 2867 |
| 381 | Ga0207652_10112659 | 3300025921 | Bacteria | 2414 |
| 382 | Ga0207681_10000105 | 3300025923 | Bacteria | 71882 |
| 383 | Ga0207681_10014001 | 3300025923 | Bacteria | 4972 |
| 384 | Ga0207681_10077610 | 3300025923 | Bacteria | 2335 |
| 385 | Ga0207681_10193397 | 3300025923 | Bacteria | 1558 |
| 386 | Ga0207694_10181617 | 3300025924 | Bacteria | 1706 |
| 387 | Ga0207650_10066169 | 3300025925 | Bacteria | 2709 |
| 388 | Ga0207650_10319640 | 3300025925 | Bacteria | 1271 |
| 389 | Ga0207650_10424245 | 3300025925 | Bacteria | 1104 |
| 390 | Ga0207650_10574367 | 3300025925 | Bacteria | 946 |
| 391 | Ga0207650_10637631 | 3300025925 | Bacteria | 898 |
| 392 | Ga0207659_10056059 | 3300025926 | Bacteria | 2821 |
| 393 | Ga0207659_10115655 | 3300025926 | Bacteria | 2046 |
| 394 | Ga0207659_10230510 | 3300025926 | Bacteria | 1493 |
| 395 | Ga0207659_10331747 | 3300025926 | Bacteria | 1258 |
| 396 | Ga0207687_10021349 | 3300025927 | Bacteria | 4301 |
| 397 | Ga0207687_10517732 | 3300025927 | Bacteria | 997 |
| 398 | Ga0207664_10044911 | 3300025929 | Bacteria | 3462 |
| 399 | Ga0207664_10690286 | 3300025929 | Bacteria | 918 |
| 400 | Ga0207644_10000248 | 3300025931 | Bacteria | 36674 |
| 401 | Ga0207644_10001119 | 3300025931 | Bacteria | 17213 |
| 402 | Ga0207644_10001155 | 3300025931 | Bacteria | 16926 |
| 403 | Ga0207644_10008128 | 3300025931 | Bacteria | 6873 |
| 404 | Ga0207644_10013273 | 3300025931 | Bacteria | 5490 |
| 405 | Ga0207644_10019152 | 3300025931 | Bacteria | 4640 |
| 406 | Ga0207644_10052209 | 3300025931 | Bacteria | 2937 |
| 407 | Ga0207644_10053199 | 3300025931 | Bacteria | 2913 |
| 408 | Ga0207644_10086645 | 3300025931 | Bacteria | 2326 |
| 409 | Ga0207644_10810488 | 3300025931 | Bacteria | 783 |
| 410 | Ga0207690_10007784 | 3300025932 | Bacteria | 6359 |
| 411 | Ga0207690_10024336 | 3300025932 | Bacteria | 3792 |
| 412 | Ga0207690_10026180 | 3300025932 | Bacteria | 3671 |
| 413 | Ga0207690_10085900 | 3300025932 | Bacteria | 2210 |
| 414 | Ga0207690_10103557 | 3300025932 | Bacteria | 2037 |
| 415 | Ga0207690_10128617 | 3300025932 | Bacteria | 1850 |
| 416 | Ga0207690_10138886 | 3300025932 | Bacteria | 1788 |
| 417 | Ga0207690_10419996 | 3300025932 | Bacteria | 1070 |
| 418 | Ga0207706_10005564 | 3300025933 | Bacteria | 11747 |
| 419 | Ga0207706_10005806 | 3300025933 | Bacteria | 11480 |
| 420 | Ga0207706_10021528 | 3300025933 | Bacteria | 5788 |
| 421 | Ga0207706_10025644 | 3300025933 | Bacteria | 5281 |
| 422 | Ga0207706_10033942 | 3300025933 | Bacteria | 4542 |
| 423 | Ga0207706_10064793 | 3300025933 | Bacteria | 3218 |
| 424 | Ga0207706_10068398 | 3300025933 | Bacteria | 3125 |
| 425 | Ga0207706_10367177 | 3300025933 | Bacteria | 1250 |
| 426 | Ga0207706_10408131 | 3300025933 | Bacteria | 1177 |
| 427 | Ga0207706_10582101 | 3300025933 | Bacteria | 962 |
| 428 | Ga0207686_10188864 | 3300025934 | Bacteria | 1467 |
| 429 | Ga0207709_10064525 | 3300025935 | Bacteria | 2300 |
| 430 | Ga0207709_10260833 | 3300025935 | Bacteria | 1271 |
| 431 | Ga0207709_10410454 | 3300025935 | Bacteria | 1038 |
| 432 | Ga0207670_10152786 | 3300025936 | Bacteria | 1715 |
| 433 | Ga0207669_10022729 | 3300025937 | Bacteria | 3336 |
| 434 | Ga0207669_10109607 | 3300025937 | Bacteria | 1847 |
| 435 | Ga0207669_10218881 | 3300025937 | Bacteria | 1396 |
| 436 | Ga0207669_10259771 | 3300025937 | Bacteria | 1298 |
| 437 | Ga0207704_10006416 | 3300025938 | Bacteria | 5486 |
| 438 | Ga0207704_10621036 | 3300025938 | Bacteria | 887 |
| 439 | Ga0207691_10001810 | 3300025940 | Bacteria | 20910 |
| 440 | Ga0207691_10044375 | 3300025940 | Bacteria | 4093 |
| 441 | Ga0207691_10058755 | 3300025940 | Bacteria | 3497 |
| 442 | Ga0207691_10063146 | 3300025940 | Bacteria | 3360 |
| 443 | Ga0207691_10065315 | 3300025940 | Bacteria | 3294 |
| 444 | Ga0207691_10104915 | 3300025940 | Bacteria | 2518 |
| 445 | Ga0207711_10000724 | 3300025941 | Bacteria | 32484 |
| 446 | Ga0207711_10000748 | 3300025941 | Bacteria | 31824 |
| 447 | Ga0207711_10001383 | 3300025941 | Bacteria | 22840 |
| 448 | Ga0207711_10001795 | 3300025941 | Bacteria | 19646 |
| 449 | Ga0207711_10003381 | 3300025941 | Bacteria | 13827 |
| 450 | Ga0207711_10003474 | 3300025941 | Bacteria | 13639 |
| 451 | Ga0207711_10004333 | 3300025941 | Bacteria | 12119 |
| 452 | Ga0207711_10005686 | 3300025941 | Bacteria | 10530 |
| 453 | Ga0207711_10007344 | 3300025941 | Bacteria | 9225 |
| 454 | Ga0207711_10019139 | 3300025941 | Bacteria | 5698 |
| 455 | Ga0207711_10022062 | 3300025941 | Bacteria | 5321 |
| 456 | Ga0207711_10027834 | 3300025941 | Bacteria | 4751 |
| 457 | Ga0207711_10096422 | 3300025941 | Bacteria | 2610 |
| 458 | Ga0207711_10165843 | 3300025941 | Bacteria | 2002 |
| 459 | Ga0207689_10008558 | 3300025942 | Bacteria | 8918 |
| 460 | Ga0207689_10162968 | 3300025942 | Bacteria | 1837 |
| 461 | Ga0207661_10116626 | 3300025944 | Bacteria | 2267 |
| 462 | Ga0207661_10177565 | 3300025944 | Bacteria | 1858 |
| 463 | Ga0207679_10005861 | 3300025945 | Bacteria | 7716 |
| 464 | Ga0207679_10006949 | 3300025945 | Bacteria | 7171 |
| 465 | Ga0207679_10013276 | 3300025945 | Bacteria | 5399 |
| 466 | Ga0207679_10043087 | 3300025945 | Bacteria | 3247 |
| 467 | Ga0207679_10111111 | 3300025945 | Bacteria | 2163 |
| 468 | Ga0207679_10152578 | 3300025945 | Bacteria | 1882 |
| 469 | Ga0207679_10336950 | 3300025945 | Bacteria | 1311 |
| 470 | Ga0207667_10352161 | 3300025949 | Bacteria | 1502 |
| 471 | Ga0207667_10460739 | 3300025949 | Bacteria | 1291 |
| 472 | Ga0207667_10885579 | 3300025949 | Bacteria | 885 |
| 473 | Ga0207667_10906184 | 3300025949 | Bacteria | 873 |
| 474 | Ga0207651_10002259 | 3300025960 | Bacteria | 9149 |
| 475 | Ga0207651_10016439 | 3300025960 | Bacteria | 4334 |
| 476 | Ga0207651_10048109 | 3300025960 | Bacteria | 2880 |
| 477 | Ga0207651_10434334 | 3300025960 | Bacteria | 1123 |
| 478 | Ga0207712_10000629 | 3300025961 | Bacteria | 27931 |
| 479 | Ga0207712_10038449 | 3300025961 | Bacteria | 3273 |
| 480 | Ga0207712_10274154 | 3300025961 | Bacteria | 1374 |
| 481 | Ga0207668_10012745 | 3300025972 | Bacteria | 5155 |
| 482 | Ga0207640_10026004 | 3300025981 | Bacteria | 3550 |
| 483 | Ga0207658_10000205 | 3300025986 | Bacteria | 61647 |
| 484 | Ga0207658_10000359 | 3300025986 | Bacteria | 44920 |
| 485 | Ga0207658_10009870 | 3300025986 | Bacteria | 6486 |
| 486 | Ga0207658_10031774 | 3300025986 | Bacteria | 3752 |
| 487 | Ga0207658_10588678 | 3300025986 | Bacteria | 998 |
| 488 | Ga0207658_10605136 | 3300025986 | Bacteria | 985 |
| 489 | Ga0207677_10003777 | 3300026023 | Bacteria | 8043 |
| 490 | Ga0207677_10014749 | 3300026023 | Bacteria | 4575 |
| 491 | Ga0207677_10644426 | 3300026023 | Bacteria | 934 |
| 492 | Ga0207703_10000376 | 3300026035 | Bacteria | 47694 |
| 493 | Ga0207703_10001763 | 3300026035 | Bacteria | 19334 |
| 494 | Ga0207703_10012799 | 3300026035 | Bacteria | 6541 |
| 495 | Ga0207703_10024235 | 3300026035 | Bacteria | 4774 |
| 496 | Ga0207703_10027234 | 3300026035 | Bacteria | 4500 |
| 497 | Ga0207703_10035362 | 3300026035 | Bacteria | 3970 |
| 498 | Ga0207703_10039232 | 3300026035 | Bacteria | 3784 |
| 499 | Ga0207639_10046376 | 3300026041 | Bacteria | 3279 |
| 500 | Ga0207639_10111731 | 3300026041 | Bacteria | 2228 |
| 501 | Ga0207639_10127158 | 3300026041 | Bacteria | 2104 |
| 502 | Ga0207678_10000681 | 3300026067 | Bacteria | 31104 |
| 503 | Ga0207678_10009708 | 3300026067 | Bacteria | 8463 |
| 504 | Ga0207678_10011552 | 3300026067 | Bacteria | 7758 |
| 505 | Ga0207678_10012349 | 3300026067 | Bacteria | 7498 |
| 506 | Ga0207678_10056631 | 3300026067 | Bacteria | 3374 |
| 507 | Ga0207678_10222164 | 3300026067 | Bacteria | 1617 |
| 508 | Ga0207678_10289967 | 3300026067 | Bacteria | 1405 |
| 509 | Ga0207678_10330988 | 3300026067 | Bacteria | 1311 |
| 510 | Ga0207708_10506153 | 3300026075 | Bacteria | 1013 |
| 511 | Ga0207702_10014863 | 3300026078 | Bacteria | 6458 |
| 512 | Ga0207702_10190577 | 3300026078 | Bacteria | 1894 |
| 513 | Ga0207702_10352715 | 3300026078 | Bacteria | 1408 |
| 514 | Ga0207702_10454515 | 3300026078 | Bacteria | 1243 |
| 515 | Ga0207641_10000817 | 3300026088 | Bacteria | 33157 |
| 516 | Ga0207641_10003247 | 3300026088 | Bacteria | 14507 |
| 517 | Ga0207641_10008362 | 3300026088 | Bacteria | 8551 |
| 518 | Ga0207641_10030667 | 3300026088 | Bacteria | 4454 |
| 519 | Ga0207641_10172641 | 3300026088 | Bacteria | 1974 |
| 520 | Ga0207641_10189532 | 3300026088 | Bacteria | 1889 |
| 521 | Ga0207648_10001389 | 3300026089 | Bacteria | 26669 |
| 522 | Ga0207648_10011967 | 3300026089 | Bacteria | 8146 |
| 523 | Ga0207648_10076108 | 3300026089 | Bacteria | 2925 |
| 524 | Ga0207648_10109533 | 3300026089 | Bacteria | 2424 |
| 525 | Ga0207676_10003927 | 3300026095 | Bacteria | 10496 |
| 526 | Ga0207676_10004037 | 3300026095 | Bacteria | 10348 |
| 527 | Ga0207676_10019732 | 3300026095 | Bacteria | 4923 |
| 528 | Ga0207676_10030560 | 3300026095 | Bacteria | 4044 |
| 529 | Ga0207676_10034399 | 3300026095 | Bacteria | 3836 |
| 530 | Ga0207676_10050766 | 3300026095 | Bacteria | 3235 |
| 531 | Ga0207674_10002210 | 3300026116 | Bacteria | 24650 |
| 532 | Ga0207674_10023115 | 3300026116 | Bacteria | 6667 |
| 533 | Ga0207674_10328720 | 3300026116 | Bacteria | 1478 |
| 534 | Ga0207674_10375265 | 3300026116 | Bacteria | 1375 |
| 535 | Ga0207674_10961871 | 3300026116 | Bacteria | 823 |
| 536 | Ga0207675_100000568 | 3300026118 | Bacteria | 36188 |
| 537 | Ga0207675_100162641 | 3300026118 | Bacteria | 2130 |
| 538 | Ga0207675_100436963 | 3300026118 | Bacteria | 1295 |
| 539 | Ga0207675_100851292 | 3300026118 | Bacteria | 927 |
| 540 | Ga0207683_10001782 | 3300026121 | Bacteria | 19055 |
| 541 | Ga0207683_10005777 | 3300026121 | Bacteria | 10604 |
| 542 | Ga0207683_10123307 | 3300026121 | Bacteria | 2328 |
| 543 | Ga0207683_10270024 | 3300026121 | Bacteria | 1554 |
| 544 | Ga0207698_10014560 | 3300026142 | Bacteria | 5234 |
| 545 | Ga0207698_10030407 | 3300026142 | Bacteria | 3883 |
| 546 | Ga0207698_10170806 | 3300026142 | Bacteria | 1914 |
| 547 | Ga0207698_10246373 | 3300026142 | Bacteria | 1632 |
| 548 | Ga0207698_10258001 | 3300026142 | Bacteria | 1600 |
| 549 | Ga0209974_10004641 | 3300027876 | Bacteria | 4884 |
| 550 | Ga0268266_10001998 | 3300028379 | Bacteria | 22799 |
| 551 | Ga0268266_10002205 | 3300028379 | Bacteria | 21315 |
| 552 | Ga0268266_10028925 | 3300028379 | Bacteria | 4709 |
| 553 | Ga0268266_10031817 | 3300028379 | Bacteria | 4482 |
| 554 | Ga0268266_10042990 | 3300028379 | Bacteria | 3860 |
| 555 | Ga0268266_10332689 | 3300028379 | Bacteria | 1424 |
| 556 | Ga0268266_10585657 | 3300028379 | Bacteria | 1071 |
| 557 | Ga0268265_10005660 | 3300028380 | Bacteria | 8536 |
| 558 | Ga0268265_10010923 | 3300028380 | Bacteria | 6131 |
| 559 | Ga0268265_10020971 | 3300028380 | Bacteria | 4568 |
| 560 | Ga0268265_10027142 | 3300028380 | Bacteria | 4083 |
| 561 | Ga0268265_10087229 | 3300028380 | Bacteria | 2482 |
| 562 | Ga0268265_10125825 | 3300028380 | Bacteria | 2120 |
| 563 | Ga0268265_10141668 | 3300028380 | Bacteria | 2013 |
| 564 | Ga0268265_11022152 | 3300028380 | Bacteria | 817 |
| 565 | Ga0268264_10000228 | 3300028381 | Bacteria | 108722 |
| 566 | Ga0268264_10014583 | 3300028381 | Bacteria | 6455 |
| 567 | Ga0268264_10049833 | 3300028381 | Bacteria | 3486 |
| 568 | Ga0268264_10086834 | 3300028381 | Bacteria | 2689 |
| 569 | Ga0268264_10115006 | 3300028381 | Bacteria | 2363 |
| 570 | Ga0307515_10171424 | 3300028794 | Bacteria | 2161 |
| 571 | Ga0307513_10030747 | 3300031456 | Bacteria | 6096 |
| 572 | Ga0307408_100076794 | 3300031548 | Bacteria | 2486 |
| 573 | Ga0307408_100081523 | 3300031548 | Bacteria | 2419 |
| 574 | Ga0307508_10124618 | 3300031616 | Bacteria | 2179 |
| 575 | Ga0307516_10127761 | 3300031730 | Bacteria | 2325 |
| 576 | Ga0307405_10000893 | 3300031731 | Bacteria | 11834 |
| 577 | Ga0307405_10182310 | 3300031731 | Bacteria | 1509 |
| 578 | Ga0307405_10333445 | 3300031731 | Bacteria | 1163 |
| 579 | Ga0307413_10001276 | 3300031824 | Bacteria | 9393 |
| 580 | Ga0307410_10027516 | 3300031852 | Bacteria | 3594 |
| 581 | Ga0307410_10634418 | 3300031852 | Bacteria | 894 |
| 582 | Ga0307406_10002193 | 3300031901 | Bacteria | 10634 |
| 583 | Ga0307406_10035254 | 3300031901 | Bacteria | 3076 |
| 584 | Ga0307406_10169494 | 3300031901 | Bacteria | 1578 |
| 585 | Ga0307407_10096364 | 3300031903 | Bacteria | 1826 |
| 586 | Ga0307412_10002006 | 3300031911 | Bacteria | 11290 |
| 587 | Ga0307412_10142298 | 3300031911 | Bacteria | 1758 |
| 588 | Ga0307409_100736396 | 3300031995 | Bacteria | 988 |
| 589 | Ga0307416_100002373 | 3300032002 | Bacteria | 10776 |
| 590 | Ga0307416_100005106 | 3300032002 | Bacteria | 8012 |
| 591 | Ga0307416_100030495 | 3300032002 | Bacteria | 4047 |
| 592 | Ga0307416_100898989 | 3300032002 | Bacteria | 985 |
| 593 | Ga0307416_101042768 | 3300032002 | Bacteria | 921 |
| 594 | Ga0307414_10296222 | 3300032004 | Bacteria | 1366 |
| 595 | Ga0307414_10302055 | 3300032004 | Bacteria | 1354 |
| 596 | Ga0307414_10398595 | 3300032004 | Bacteria | 1194 |
| 597 | Ga0307414_10628947 | 3300032004 | Bacteria | 965 |
| 598 | Ga0307411_10003495 | 3300032005 | Bacteria | 7299 |
| 599 | Ga0307411_10020905 | 3300032005 | Bacteria | 3818 |
| 600 | Ga0307415_100000632 | 3300032126 | Bacteria | 15442 |
| 601 | Ga0307415_100004323 | 3300032126 | Bacteria | 7355 |
| 602 | Ga0307415_100010882 | 3300032126 | Bacteria | 5174 |
| 603 | Ga0307415_100040164 | 3300032126 | Bacteria | 3098 |
| 604 | Ga0307510_10017255 | 3300033180 | Bacteria | 8518 |
| 605 | Ga0307510_10052161 | 3300033180 | Bacteria | 4317 |
| 606 | Ga0316596_1045629 | 3300033541 | Bacteria | 1156 |
| 607 | Ga0373940_0040249 | 3300035088 | Bacteria | 1282 |
| 608 | Ga0373949_0085340 | 3300035090 | Bacteria | 847 |
| 609 | Ga0373952_0082453 | 3300035092 | Bacteria | 823 |
| 610 | Ga0373943_0011702 | 3300035170 | Bacteria | 3949 |
| 611 | Ga0373931_0192679 | 3300035691 | Bacteria | 1214 |
| 612 | Ga0373935_0179724 | 3300035692 | Bacteria | 1452 |
| 613 | Ga0373937_0073957 | 3300036401 | Bacteria | 3144 |
| 614 | Ga0395899_0000732 | 3300037312 | Bacteria | 32768 |
| 615 | Ga0395899_0003877 | 3300037312 | Bacteria | 11787 |
| 616 | Ga0395899_0007496 | 3300037312 | Bacteria | 8428 |
| 617 | Ga0395899_0016128 | 3300037312 | Bacteria | 5696 |
| 618 | Ga0395899_0191075 | 3300037312 | Bacteria | 1433 |
| 619 | Ga0395899_0193432 | 3300037312 | Bacteria | 1422 |
| 620 | Ga0395899_0289365 | 3300037312 | Bacteria | 1112 |
| 621 | Ga0395900_0001059 | 3300037418 | Bacteria | 35203 |
| 622 | Ga0395900_0002358 | 3300037418 | Bacteria | 20904 |
| 623 | Ga0395900_0011356 | 3300037418 | Bacteria | 9111 |
| 624 | Ga0395900_0041612 | 3300037418 | Bacteria | 4736 |
| 625 | Ga0395900_0053747 | 3300037418 | Bacteria | 4145 |
| 626 | Ga0395900_0064293 | 3300037418 | Bacteria | 3771 |
| 627 | Ga0395900_0101520 | 3300037418 | Bacteria | 2955 |
| 628 | Ga0395900_0121960 | 3300037418 | Bacteria | 2674 |
| 629 | Ga0395900_0149229 | 3300037418 | Bacteria | 2389 |
| 630 | Ga0395900_0215547 | 3300037418 | Bacteria | 1937 |
| 631 | Ga0395900_0445874 | 3300037418 | Bacteria | 1251 |
| 632 | Ga0395900_0607628 | 3300037418 | Bacteria | 1033 |
| 633 | Ga0395900_0741008 | 3300037418 | Bacteria | 913 |
| 634 | Ga0395900_0785197 | 3300037418 | Bacteria | 881 |
| 635 | Ga0395900_0795800 | 3300037418 | Bacteria | 874 |
| 636 | Ga0395898_0009587 | 3300037466 | Bacteria | 10169 |
| 637 | Ga0395898_0043547 | 3300037466 | Bacteria | 4422 |
| 638 | Ga0395898_0048764 | 3300037466 | Bacteria | 4152 |
| 639 | Ga0395898_0063110 | 3300037466 | Bacteria | 3596 |
| 640 | Ga0395898_0206310 | 3300037466 | Bacteria | 1875 |
| 641 | Ga0395898_0299874 | 3300037466 | Bacteria | 1533 |
| 642 | Ga0395898_0885097 | 3300037466 | Bacteria | 831 |
| 643 | Ga0395905_0000204 | 3300037471 | Bacteria | 92152 |
| 644 | Ga0395905_0002039 | 3300037471 | Bacteria | 23073 |
| 645 | Ga0395905_0003861 | 3300037471 | Bacteria | 15809 |
| 646 | Ga0395905_0006180 | 3300037471 | Bacteria | 12086 |
| 647 | Ga0395905_0016548 | 3300037471 | Bacteria | 7010 |
| 648 | Ga0395905_0017736 | 3300037471 | Bacteria | 6759 |
| 649 | Ga0395905_0017949 | 3300037471 | Bacteria | 6719 |
| 650 | Ga0395905_0035013 | 3300037471 | Bacteria | 4714 |
| 651 | Ga0395905_0045026 | 3300037471 | Bacteria | 4139 |
| 652 | Ga0395905_0062326 | 3300037471 | Bacteria | 3488 |
| 653 | Ga0395905_0080957 | 3300037471 | Bacteria | 3043 |
| 654 | Ga0395905_0089884 | 3300037471 | Bacteria | 2878 |
| 655 | Ga0395905_0110740 | 3300037471 | Bacteria | 2578 |
| 656 | Ga0395905_0124837 | 3300037471 | Bacteria | 2420 |
| 657 | Ga0395905_0132906 | 3300037471 | Bacteria | 2340 |
| 658 | Ga0395905_0137015 | 3300037471 | Bacteria | 2303 |
| 659 | Ga0395905_0149479 | 3300037471 | Bacteria | 2197 |
| 660 | Ga0395905_0153826 | 3300037471 | Bacteria | 2163 |
| 661 | Ga0395905_0304451 | 3300037471 | Bacteria | 1481 |
| 662 | Ga0395905_0354486 | 3300037471 | Bacteria | 1359 |
| 663 | Ga0395905_0507387 | 3300037471 | Bacteria | 1106 |
| 664 | Ga0395905_0509558 | 3300037471 | Bacteria | 1103 |
| 665 | Ga0395905_0552667 | 3300037471 | Bacteria | 1052 |
| 666 | Ga0395905_0661894 | 3300037471 | Bacteria | 946 |
| 667 | Ga0395901_0000208 | 3300038443 | Bacteria | 73874 |
| 668 | Ga0395901_0013604 | 3300038443 | Bacteria | 8273 |
| 669 | Ga0395901_0016571 | 3300038443 | Bacteria | 7510 |
| 670 | Ga0395901_0018771 | 3300038443 | Bacteria | 7065 |
| 671 | Ga0395901_0031581 | 3300038443 | Bacteria | 5460 |
| 672 | Ga0395901_0127530 | 3300038443 | Bacteria | 2674 |
| 673 | Ga0395901_0194349 | 3300038443 | Bacteria | 2128 |
| 674 | Ga0395901_0265419 | 3300038443 | Bacteria | 1786 |
| 675 | Ga0395901_0395067 | 3300038443 | Bacteria | 1421 |
| 676 | Ga0395901_0628663 | 3300038443 | Bacteria | 1079 |
| 677 | Ga0436365_0033000 | 3300039437 | Bacteria | 3591 |
| 678 | Ga0436361_0383568 | 3300039447 | Bacteria | 4247 |
| 679 | Ga0436361_0951343 | 3300039447 | Bacteria | 5426 |
| 680 | Ga0439439_0019853 | 3300041406 | Bacteria | 1669 |
| 681 | Ga0439447_057541 | 3300041407 | Bacteria | 919 |
| 682 | Ga0439461_0000083 | 3300041410 | Bacteria | 12407 |
| 683 | Ga0439461_0011296 | 3300041410 | Bacteria | 1654 |
| 684 | Ga0439465_0001274 | 3300041413 | Bacteria | 8105 |
| 685 | Ga0439465_0004929 | 3300041413 | Bacteria | 4289 |
| 686 | Ga0439465_0007637 | 3300041413 | Bacteria | 3430 |
| 687 | Ga0451793_1551258 | 3300041452 | Bacteria | 833 |
| 688 | Ga0451807_1694753 | 3300041486 | Bacteria | 2644 |
| 689 | Ga0439431_0001511 | 3300041997 | Bacteria | 5135 |
| 690 | Ga0439442_047808 | 3300042002 | Bacteria | 901 |
| 691 | Ga0439445_0007385 | 3300042004 | Bacteria | 2548 |
| 692 | Ga0439432_000391 | 3300042006 | Bacteria | 16191 |
| 693 | Ga0439432_031899 | 3300042006 | Bacteria | 1702 |
| 694 | Ga0439449_0020647 | 3300042007 | Bacteria | 2468 |
| 695 | Ga0439462_0000163 | 3300042015 | Bacteria | 11098 |
| 696 | Ga0450905_000685 | 3300042142 | Bacteria | 4150 |
| 697 | Ga0450889_000465 | 3300042144 | Bacteria | 4494 |
| 698 | Ga0439446_0104539 | 3300042156 | Bacteria | 898 |
| 699 | Ga0439458_0001726 | 3300042157 | Bacteria | 5465 |
| 700 | Ga0439434_0000796 | 3300042435 | Bacteria | 9092 |
| 701 | Ga0439434_0001302 | 3300042435 | Bacteria | 7193 |
| 702 | Ga0439464_0000541 | 3300042439 | Bacteria | 7823 |
| 703 | Ga0466972_0062664 | 3300044658 | Bacteria | 1782 |
| 704 | Ga0466966_0041833 | 3300044684 | Bacteria | 2943 |
| 705 | Ga0466961_0098474 | 3300044693 | Bacteria | 1843 |
| 706 | Ga0466963_0007297 | 3300044694 | Bacteria | 6591 |
| 707 | Ga0466970_0041736 | 3300044765 | Bacteria | 2439 |
| 708 | Ga0466970_0387417 | 3300044765 | Bacteria | 796 |
| 709 | Ga0466957_0119607 | 3300044842 | Bacteria | 1678 |
| 710 | Ga0466959_0070232 | 3300045049 | Bacteria | 2537 |
| 711 | Ga0466967_0027999 | 3300045976 | Bacteria | 4697 |
| 712 | Ga0466967_0044914 | 3300045976 | Bacteria | 3836 |
| 713 | Ga0466967_0199621 | 3300045976 | Bacteria | 1894 |
| 714 | Ga0495627_026097 | 3300046453 | Bacteria | 1888 |
| 715 | Ga0495583_0014859 | 3300046506 | Bacteria | 4264 |
| 716 | Ga0495663_0050595 | 3300046525 | Bacteria | 1285 |
| 717 | Ga0495642_0027977 | 3300046528 | Bacteria | 2244 |
| 718 | Ga0495642_0042081 | 3300046528 | Bacteria | 1860 |
| 719 | Ga0495598_0000438 | 3300046537 | Bacteria | 7557 |
| 720 | Ga0495668_0002859 | 3300046616 | Bacteria | 13693 |
| 721 | Ga0495668_0011174 | 3300046616 | Bacteria | 5389 |
| 722 | Ga0495668_0016910 | 3300046616 | Bacteria | 4236 |
| 723 | Ga0495668_0036933 | 3300046616 | Bacteria | 2736 |
| 724 | Ga0495668_0072129 | 3300046616 | Bacteria | 1897 |
| 725 | Ga0495668_0148019 | 3300046616 | Bacteria | 1286 |
| 726 | Ga0495625_0395067 | 3300046660 | Bacteria | 865 |
| 727 | Ga0495661_0096729 | 3300046665 | Bacteria | 1669 |
| 728 | Ga0495669_0000090 | 3300046684 | Bacteria | 60222 |
| 729 | Ga0495669_0007174 | 3300046684 | Bacteria | 4669 |
| 730 | Ga0495669_0027579 | 3300046684 | Bacteria | 2485 |
| 731 | Ga0495670_0000017 | 3300046691 | Bacteria | 120427 |
| 732 | Ga0495670_0009359 | 3300046691 | Bacteria | 4820 |
| 733 | Ga0495636_0280375 | 3300047318 | Bacteria | 776 |
| 734 | Ga0495677_0004345 | 3300047445 | Bacteria | 5445 |
| 735 | Ga0495677_0004406 | 3300047445 | Bacteria | 5408 |
| 736 | Ga0495686_0187873 | 3300047472 | Bacteria | 1193 |
| 737 | Ga0496100_0007641 | 3300048903 | Bacteria | 5979 |
| 738 | Ga0496100_0007971 | 3300048903 | Bacteria | 5884 |
| 739 | Ga0496100_0121979 | 3300048903 | Bacteria | 1824 |
| 740 | Ga0496100_0160190 | 3300048903 | Bacteria | 1613 |
| 741 | Ga0496100_0516656 | 3300048903 | Bacteria | 921 |
| 742 | Ga0496101_0007869 | 3300048904 | Bacteria | 6935 |
| 743 | Ga0496101_0018596 | 3300048904 | Bacteria | 4727 |
| 744 | Ga0496101_0024027 | 3300048904 | Bacteria | 4216 |
| 745 | Ga0496101_0191793 | 3300048904 | Bacteria | 1577 |
| 746 | Ga0496101_0307705 | 3300048904 | Bacteria | 1242 |
| 747 | Ga0496101_0329057 | 3300048904 | Bacteria | 1199 |
| 748 | Ga0496101_0382310 | 3300048904 | Bacteria | 1108 |
| 749 | Ga0496102_0063484 | 3300048905 | Bacteria | 3382 |
| 750 | Ga0496102_0267384 | 3300048905 | Bacteria | 1612 |
| 751 | Ga0496103_0000289 | 3300048906 | Bacteria | 47033 |
| 752 | Ga0496104_0000161 | 3300048907 | Bacteria | 60841 |
| 753 | Ga0496104_0000477 | 3300048907 | Bacteria | 34490 |
| 754 | Ga0496105_0013787 | 3300048908 | Bacteria | 6419 |
| 755 | Ga0496105_0018885 | 3300048908 | Bacteria | 5552 |
| 756 | Ga0496105_0148677 | 3300048908 | Bacteria | 1926 |
| 757 | Ga0496106_0019431 | 3300048909 | Bacteria | 5039 |
| 758 | Ga0496106_0113325 | 3300048909 | Bacteria | 2113 |
| 759 | Ga0496106_0155519 | 3300048909 | Bacteria | 1805 |
| 760 | Ga0496106_0336173 | 3300048909 | Bacteria | 1213 |
| 761 | Ga0496106_0590673 | 3300048909 | Bacteria | 890 |
| 762 | Ga0496107_0008078 | 3300048910 | Bacteria | 7266 |
| 763 | Ga0496107_0020708 | 3300048910 | Bacteria | 4647 |
| 764 | Ga0496107_0038934 | 3300048910 | Bacteria | 3410 |
| 765 | Ga0496107_0047833 | 3300048910 | Bacteria | 3080 |
| 766 | Ga0496107_0099796 | 3300048910 | Bacteria | 2128 |
| 767 | Ga0496107_0206471 | 3300048910 | Bacteria | 1460 |
| 768 | Ga0496107_0284903 | 3300048910 | Bacteria | 1230 |
| 769 | Ga0496108_0000483 | 3300048911 | Bacteria | 31924 |
| 770 | Ga0496108_0007321 | 3300048911 | Bacteria | 8947 |
| 771 | Ga0496108_0015856 | 3300048911 | Bacteria | 6143 |
| 772 | Ga0496108_0088830 | 3300048911 | Bacteria | 2626 |
| 773 | Ga0496108_0100530 | 3300048911 | Bacteria | 2466 |
| 774 | Ga0496108_0328000 | 3300048911 | Bacteria | 1334 |
| 775 | Ga0496108_0931928 | 3300048911 | Bacteria | 744 |
| 776 | Ga0496109_0000765 | 3300048912 | Bacteria | 26746 |
| 777 | Ga0496109_0001630 | 3300048912 | Bacteria | 18749 |
| 778 | Ga0496109_0006413 | 3300048912 | Bacteria | 9904 |
| 779 | Ga0496109_0048037 | 3300048912 | Bacteria | 3882 |
| 780 | Ga0496109_0060928 | 3300048912 | Bacteria | 3449 |
| 781 | Ga0496109_0150138 | 3300048912 | Bacteria | 2182 |
| 782 | Ga0496109_0233201 | 3300048912 | Bacteria | 1732 |
| 783 | Ga0496109_0487740 | 3300048912 | Bacteria | 1163 |
| 784 | Ga0496109_0806290 | 3300048912 | Bacteria | 877 |
| 785 | Ga0496110_0001524 | 3300048913 | Bacteria | 16817 |
| 786 | Ga0496110_0008357 | 3300048913 | Bacteria | 8327 |
| 787 | Ga0496110_0021450 | 3300048913 | Bacteria | 5470 |
| 788 | Ga0496110_0027620 | 3300048913 | Bacteria | 4866 |
| 789 | Ga0496111_0002167 | 3300048914 | Bacteria | 11754 |
| 790 | Ga0496111_0012076 | 3300048914 | Bacteria | 5840 |
| 791 | Ga0496111_0133133 | 3300048914 | Bacteria | 1840 |
| 792 | Ga0496111_0143151 | 3300048914 | Bacteria | 1772 |
| 793 | Ga0496111_0149052 | 3300048914 | Bacteria | 1735 |
| 794 | Ga0496111_0163715 | 3300048914 | Bacteria | 1652 |
| 795 | Ga0496112_0001631 | 3300048915 | Bacteria | 17374 |
| 796 | Ga0496112_0024451 | 3300048915 | Bacteria | 5784 |
| 797 | Ga0496112_0034069 | 3300048915 | Bacteria | 4955 |
| 798 | Ga0496112_0034997 | 3300048915 | Bacteria | 4888 |
| 799 | Ga0496112_0102728 | 3300048915 | Bacteria | 2828 |
| 800 | Ga0496112_0104835 | 3300048915 | Bacteria | 2797 |
| 801 | Ga0496112_0165479 | 3300048915 | Bacteria | 2178 |
| 802 | Ga0496112_0172328 | 3300048915 | Bacteria | 2129 |
| 803 | Ga0496113_0003331 | 3300048916 | Bacteria | 9596 |
| 804 | Ga0496113_0011729 | 3300048916 | Bacteria | 5864 |
| 805 | Ga0496113_0163528 | 3300048916 | Bacteria | 1760 |
| 806 | Ga0496114_0000162 | 3300048917 | Bacteria | 47188 |
| 807 | Ga0496114_0028375 | 3300048917 | Bacteria | 4592 |
| 808 | Ga0496114_0623103 | 3300048917 | Bacteria | 950 |
| 809 | Ga0496115_0026907 | 3300048918 | Bacteria | 4494 |
| 810 | Ga0496115_0041325 | 3300048918 | Bacteria | 3669 |
| 811 | Ga0496117_0014969 | 3300048920 | Bacteria | 6646 |
| 812 | Ga0496118_0034873 | 3300048921 | Bacteria | 4097 |
| 813 | Ga0496119_0000734 | 3300048922 | Bacteria | 44175 |
| 814 | Ga0496120_0028258 | 3300048923 | Bacteria | 3438 |
| 815 | Ga0496121_0009641 | 3300048924 | Bacteria | 11060 |
| 816 | Ga0496121_0016344 | 3300048924 | Bacteria | 7668 |
| 817 | Ga0496122_0016591 | 3300048925 | Bacteria | 6953 |
| 818 | Ga0496123_0006076 | 3300048926 | Bacteria | 11848 |
| 819 | Ga0496124_0006526 | 3300048927 | Bacteria | 12690 |
| 820 | Ga0496125_0072756 | 3300048928 | Bacteria | 2676 |
| 821 | Ga0496126_0000661 | 3300048929 | Bacteria | 63847 |
| 822 | Ga0501032_0008370 | 3300049569 | Bacteria | 7540 |
| 823 | Ga0501033_0009316 | 3300049570 | Bacteria | 7562 |
| 824 | Ga0501033_0166772 | 3300049570 | Bacteria | 1583 |
| 825 | Ga0501034_0024565 | 3300049571 | Bacteria | 6129 |
| 826 | Ga0501034_0211173 | 3300049571 | Bacteria | 1896 |
| 827 | Ga0501036_0026215 | 3300049572 | Bacteria | 4920 |
| 828 | Ga0501037_0019877 | 3300049573 | Bacteria | 4956 |
| 829 | Ga0501037_0175535 | 3300049573 | Bacteria | 1522 |
| 830 | Ga0501038_0014173 | 3300049574 | Bacteria | 7262 |
| 831 | Ga0501039_0035822 | 3300049575 | Bacteria | 3830 |
| 832 | Ga0501039_0224852 | 3300049575 | Bacteria | 1475 |
| 833 | Ga0501043_0061572 | 3300049579 | Bacteria | 2947 |
| 834 | Ga0501043_0090184 | 3300049579 | Bacteria | 2410 |
| 835 | Ga0501043_0749040 | 3300049579 | Bacteria | 710 |
| 836 | Ga0501046_0004038 | 3300049580 | Bacteria | 13394 |
| 837 | Ga0501047_0013850 | 3300049581 | Bacteria | 7657 |
| 838 | Ga0501047_0041687 | 3300049581 | Bacteria | 4435 |
| 839 | Ga0501048_0004818 | 3300049582 | Bacteria | 10285 |
| 840 | Ga0501048_0059226 | 3300049582 | Bacteria | 2714 |
| 841 | Ga0501067_0022576 | 3300049583 | Bacteria | 3482 |
| 842 | Ga0501067_0046122 | 3300049583 | Bacteria | 2419 |
| 843 | Ga0501068_0002828 | 3300049584 | Bacteria | 9230 |
| 844 | Ga0501068_0011189 | 3300049584 | Bacteria | 5057 |
| 845 | Ga0501069_0005584 | 3300049585 | Bacteria | 6545 |
| 846 | Ga0501070_0011936 | 3300049586 | Bacteria | 7337 |
| 847 | Ga0501070_0128619 | 3300049586 | Bacteria | 2093 |
| 848 | Ga0501070_0147657 | 3300049586 | Bacteria | 1940 |
| 849 | Ga0501073_0006565 | 3300049589 | Bacteria | 8656 |
| 850 | Ga0501073_0011449 | 3300049589 | Bacteria | 6489 |
| 851 | Ga0501073_0017094 | 3300049589 | Bacteria | 5253 |
| 852 | Ga0501073_0243637 | 3300049589 | Bacteria | 1241 |
| 853 | Ga0501074_0027284 | 3300049590 | Bacteria | 4140 |
| 854 | Ga0501074_0446870 | 3300049590 | Bacteria | 917 |
| 855 | Ga0501207_012688 | 3300049654 | Bacteria | 1269 |
| 856 | Ga0501242_020514 | 3300049674 | Bacteria | 850 |
| 857 | Ga0501247_013884 | 3300049677 | Bacteria | 995 |
| 858 | Ga0501225_0005489 | 3300049705 | Bacteria | 3720 |
| 859 | Ga0501079_0130445 | 3300049741 | Bacteria | 1956 |
| 860 | Ga0501080_0005541 | 3300049742 | Bacteria | 11273 |
| 861 | Ga0501080_0047371 | 3300049742 | Bacteria | 4001 |
| 862 | Ga0501080_0125486 | 3300049742 | Bacteria | 2377 |
| 863 | Ga0501080_0660514 | 3300049742 | Bacteria | 924 |
| 864 | Ga0501083_0003134 | 3300049744 | Bacteria | 11501 |
| 865 | Ga0501083_0037678 | 3300049744 | Bacteria | 3292 |
| 866 | Ga0501083_0167809 | 3300049744 | Bacteria | 1435 |
| 867 | Ga0501035_0200080 | 3300049822 | Bacteria | 1714 |
| 868 | Ga0501035_0377184 | 3300049822 | Bacteria | 1183 |
| 869 | Ga0501044_0018457 | 3300049823 | Bacteria | 7473 |
| 870 | Ga0501044_0022969 | 3300049823 | Bacteria | 6639 |
| 871 | Ga0501044_0064259 | 3300049823 | Bacteria | 3747 |
| 872 | Ga0501044_0087644 | 3300049823 | Bacteria | 3144 |
| 873 | nmdc:mga0k408_158065_c1 | 3300050493 | Bacteria | 1350 |
| 874 | nmdc:mga08y16_13971_c1 | 3300050511 | Bacteria | 8452 |
| 875 | nmdc:mga0rr50_292575_c1 | 3300050513 | Bacteria | 1361 |
| 876 | nmdc:mga0a205_1895_c1 | 3300050515 | Bacteria | 18155 |
| 877 | Ga0500578_0023188 | 3300053086 | Bacteria | 3986 |
| 878 | Ga0500643_033993 | 3300053087 | Bacteria | 1538 |
| 879 | Ga0500644_0036283 | 3300053088 | Bacteria | 1604 |
| 880 | Ga0500651_0214031 | 3300053093 | Bacteria | 1132 |
| 881 | Ga0500566_0031285 | 3300053094 | Bacteria | 3103 |
| 882 | Ga0500641_0007151 | 3300053096 | Bacteria | 3975 |
| 883 | Ga0500641_0023402 | 3300053096 | Bacteria | 2375 |
| 884 | Ga0500654_116217 | 3300053099 | Bacteria | 1073 |
| 885 | Ga0500595_000514 | 3300053119 | Bacteria | 23372 |
| 886 | Ga0500595_050930 | 3300053119 | Bacteria | 1284 |
| 887 | Ga0500652_137751 | 3300053131 | Bacteria | 1017 |
| 888 | Ga0500658_0000049 | 3300053134 | Bacteria | 65535 |
| 889 | Ga0500658_0004102 | 3300053134 | Bacteria | 5480 |
| 890 | Ga0500658_0017152 | 3300053134 | Bacteria | 2702 |
| 891 | Ga0500573_0167193 | 3300053140 | Bacteria | 1192 |
| 892 | Ga0500604_0002130 | 3300053151 | Bacteria | 5441 |
| 893 | Ga0500604_0045917 | 3300053151 | Bacteria | 1334 |
| 894 | Ga0500616_0002088 | 3300053153 | Bacteria | 17465 |
| 895 | Ga0500609_007986 | 3300053731 | Bacteria | 1427 |
| 896 | Ga0500587_000297 | 3300053739 | Bacteria | 5556 |
| 897 | Ga0501082_0012990 | 3300060353 | Bacteria | 7158 |
| 898 | Ga0501082_0039019 | 3300060353 | Bacteria | 4096 |
| 899 | Ga0501082_0129034 | 3300060353 | Bacteria | 2194 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049654 | Ga0501207_012688 | Ga0501207_012688_195_851 | 201 |
| 2 | 3300035092 | Ga0373952_0082453 | Ga0373952_0082453_15_653 | 212 |
| 3 | 3300045976 | Ga0466967_0199621 | Ga0466967_0199621_1193_1837 | 214 |
| 4 | 3300053088 | Ga0500644_0036283 | Ga0500644_0036283_64_786 | 214 |
| 5 | 3300037312 | Ga0395899_0193432 | Ga0395899_0193432_46_696 | 216 |
| 6 | 3300044693 | Ga0466961_0098474 | Ga0466961_0098474_21_671 | 216 |
| 7 | 3300044765 | Ga0466970_0387417 | Ga0466970_0387417_133_783 | 216 |
| 8 | 3300046616 | Ga0495668_0002859 | Ga0495668_0002859_11701_12351 | 216 |
| 9 | 3300048904 | Ga0496101_0307705 | Ga0496101_0307705_522_1172 | 216 |
| 10 | 3300048909 | Ga0496106_0590673 | Ga0496106_0590673_215_865 | 216 |
| 11 | 3300048911 | Ga0496108_0931928 | Ga0496108_0931928_50_700 | 216 |
| 12 | 3300048915 | Ga0496112_0102728 | Ga0496112_0102728_2107_2757 | 216 |
| 13 | 3300049579 | Ga0501043_0749040 | Ga0501043_0749040_20_670 | 216 |
| 14 | 3300009545 | Ga0105237_10158213 | Ga0105237_101582133 | 217 |
| 15 | 3300009551 | Ga0105238_10051207 | Ga0105238_100512073 | 217 |
| 16 | 3300009098 | Ga0105245_10020016 | Ga0105245_100200165 | 218 |
| 17 | 3300011119 | Ga0105246_10100023 | Ga0105246_101000232 | 218 |
| 18 | 3300005355 | Ga0070671_100873844 | Ga0070671_1008738441 | 221 |
| 19 | 3300005364 | Ga0070673_100197802 | Ga0070673_1001978023 | 221 |
| 20 | 3300005459 | Ga0068867_100428871 | Ga0068867_1004288711 | 221 |
| 21 | 3300005543 | Ga0070672_100080366 | Ga0070672_1000803663 | 221 |
| 22 | 3300006237 | Ga0097621_100030812 | Ga0097621_1000308125 | 221 |
| 23 | 3300006358 | Ga0068871_100051763 | Ga0068871_1000517633 | 221 |
| 24 | 3300025931 | Ga0207644_10810488 | Ga0207644_108104881 | 221 |
| 25 | 3300025940 | Ga0207691_10104915 | Ga0207691_101049152 | 221 |
| 26 | 3300025960 | Ga0207651_10434334 | Ga0207651_104343342 | 221 |
| 27 | 3300026121 | Ga0207683_10123307 | Ga0207683_101233071 | 221 |
| 28 | 3300032004 | Ga0307414_10296222 | Ga0307414_102962222 | 227 |
| 29 | 3300006844 | Ga0075428_100243409 | Ga0075428_1002434092 | 228 |
| 30 | 3300005290 | Ga0065712_10126381 | Ga0065712_101263812 | 230 |
| 31 | 3300005354 | Ga0070675_100081613 | Ga0070675_1000816133 | 230 |
| 32 | 3300005455 | Ga0070663_100061469 | Ga0070663_1000614694 | 230 |
| 33 | 3300005564 | Ga0070664_100084102 | Ga0070664_1000841023 | 230 |
| 34 | 3300005617 | Ga0068859_100014058 | Ga0068859_1000140583 | 230 |
| 35 | 3300005841 | Ga0068863_100005398 | Ga0068863_10000539812 | 230 |
| 36 | 3300005842 | Ga0068858_100145529 | Ga0068858_1001455294 | 230 |
| 37 | 3300005844 | Ga0068862_100211773 | Ga0068862_1002117733 | 230 |
| 38 | 3300006931 | Ga0097620_100014058 | Ga0097620_1000140583 | 230 |
| 39 | 3300009174 | Ga0105241_10050172 | Ga0105241_100501723 | 230 |
| 40 | 3300009176 | Ga0105242_10204338 | Ga0105242_102043382 | 230 |
| 41 | 3300025925 | Ga0207650_10424245 | Ga0207650_104242452 | 230 |
| 42 | 3300025926 | Ga0207659_10115655 | Ga0207659_101156553 | 230 |
| 43 | 3300025933 | Ga0207706_10408131 | Ga0207706_104081313 | 230 |
| 44 | 3300025938 | Ga0207704_10621036 | Ga0207704_106210361 | 230 |
| 45 | 3300025945 | Ga0207679_10111111 | Ga0207679_101111113 | 230 |
| 46 | 3300026035 | Ga0207703_10027234 | Ga0207703_100272343 | 230 |
| 47 | 3300026067 | Ga0207678_10009708 | Ga0207678_100097084 | 230 |
| 48 | 3300026088 | Ga0207641_10008362 | Ga0207641_100083625 | 230 |
| 49 | 3300026095 | Ga0207676_10004037 | Ga0207676_100040374 | 230 |
| 50 | 3300028380 | Ga0268265_10125825 | Ga0268265_101258253 | 230 |
| 51 | 3300035088 | Ga0373940_0040249 | Ga0373940_0040249_415_1137 | 230 |
| 52 | 3300005617 | Ga0068859_100249132 | Ga0068859_1002491321 | 232 |
| 53 | 3300005718 | Ga0068866_10005315 | Ga0068866_100053153 | 232 |
| 54 | 3300006931 | Ga0097620_100249122 | Ga0097620_1002491221 | 232 |
| 55 | 3300028380 | Ga0268265_10010923 | Ga0268265_100109234 | 232 |
| 56 | 3300025933 | Ga0207706_10367177 | Ga0207706_103671771 | 235 |
| 57 | 3300048910 | Ga0496107_0206471 | Ga0496107_0206471_302_1009 | 235 |
| 58 | 3300053099 | Ga0500654_116217 | Ga0500654_116217_352_1059 | 235 |
| 59 | iso_pu_bacteria | 2643221622 | 2644125557 | 236 |
| 60 | iso_pu_bacteria | 2738541275 | 2738711222 | 236 |
| 61 | iso_pu_bacteria | 2738541301 | 2738849647 | 236 |
| 62 | iso_pu_bacteria | 2738541304 | 2738865376 | 236 |
| 63 | iso_pu_bacteria | 2738543022 | 2739297894 | 236 |
| 64 | iso_pu_bacteria | 2738543033 | 2739359572 | 236 |
| 65 | iso_pu_bacteria | 2848297114 | 2848300448 | 236 |
| 66 | iso_pu_bacteria | 2896253425 | 2896253677 | 236 |
| 67 | iso_pu_bacteria | 2928100450 | 2928103966 | 236 |
| 68 | iso_pu_bacteria | 2928959182 | 2928961490 | 236 |
| 69 | iso_pu_bacteria | 2937843397 | 2937848574 | 236 |
| 70 | 3300038443 | Ga0395901_0395067 | Ga0395901_0395067_69_782 | 237 |
| 71 | 3300045976 | Ga0466967_0027999 | Ga0466967_0027999_1813_2526 | 237 |
| 72 | iso_pu_bacteria | 2896429255 | 2896431442 | 237 |
| 73 | 2162886007 | SwRhRL2b_contig_2264840 | SwRhRL2b_0608.00000020 | 240 |
| 74 | 3300000043 | ARcpr5yngRDRAFT_c009745 | ARcpr5yngRDRAFT_0097451 | 240 |
| 75 | 3300001979 | JGI24740J21852_10073782 | JGI24740J21852_100737821 | 240 |
| 76 | 3300001989 | JGI24739J22299_10041723 | JGI24739J22299_100417232 | 240 |
| 77 | 3300001990 | JGI24737J22298_10006549 | JGI24737J22298_100065494 | 240 |
| 78 | 3300001990 | JGI24737J22298_10012841 | JGI24737J22298_100128413 | 240 |
| 79 | 3300003215 | JGI25153J46596_10000126 | JGI25153J46596_1000012612 | 240 |
| 80 | 3300003215 | JGI25153J46596_10060671 | JGI25153J46596_100606712 | 240 |
| 81 | 3300003773 | Ga0055537_1003751 | Ga0055537_10037513 | 240 |
| 82 | 3300003775 | Ga0055524_1000245 | Ga0055524_100024555 | 240 |
| 83 | 3300003791 | Ga0055530_10000064 | Ga0055530_1000006413 | 240 |
| 84 | 3300003794 | Ga0055531_10000073 | Ga0055531_1000007313 | 240 |
| 85 | 3300003794 | Ga0055531_10047592 | Ga0055531_100475921 | 240 |
| 86 | 3300003794 | Ga0055531_10054580 | Ga0055531_100545802 | 240 |
| 87 | 3300005262 | Ga0065165_1006490 | Ga0065165_10064904 | 240 |
| 88 | 3300005262 | Ga0065165_1010172 | Ga0065165_10101723 | 240 |
| 89 | 3300005290 | Ga0065712_10359175 | Ga0065712_103591751 | 240 |
| 90 | 3300005293 | Ga0065715_10095621 | Ga0065715_100956214 | 240 |
| 91 | 3300005327 | Ga0070658_10005417 | Ga0070658_100054174 | 240 |
| 92 | 3300005327 | Ga0070658_10034829 | Ga0070658_100348294 | 240 |
| 93 | 3300005327 | Ga0070658_10074198 | Ga0070658_100741984 | 240 |
| 94 | 3300005327 | Ga0070658_10095591 | Ga0070658_100955912 | 240 |
| 95 | 3300005327 | Ga0070658_10112829 | Ga0070658_101128292 | 240 |
| 96 | 3300005327 | Ga0070658_10117618 | Ga0070658_101176183 | 240 |
| 97 | 3300005328 | Ga0070676_10096112 | Ga0070676_100961121 | 240 |
| 98 | 3300005328 | Ga0070676_10151734 | Ga0070676_101517342 | 240 |
| 99 | 3300005328 | Ga0070676_10309565 | Ga0070676_103095652 | 240 |
| 100 | 3300005329 | Ga0070683_100145988 | Ga0070683_1001459884 | 240 |
| 101 | 3300005329 | Ga0070683_100146607 | Ga0070683_1001466072 | 240 |
| 102 | 3300005330 | Ga0070690_100011596 | Ga0070690_1000115964 | 240 |
| 103 | 3300005331 | Ga0070670_100028508 | Ga0070670_1000285083 | 240 |
| 104 | 3300005331 | Ga0070670_100031460 | Ga0070670_1000314603 | 240 |
| 105 | 3300005331 | Ga0070670_100063761 | Ga0070670_1000637614 | 240 |
| 106 | 3300005331 | Ga0070670_100082914 | Ga0070670_1000829143 | 240 |
| 107 | 3300005335 | Ga0070666_10005242 | Ga0070666_100052424 | 240 |
| 108 | 3300005335 | Ga0070666_10023613 | Ga0070666_100236132 | 240 |
| 109 | 3300005336 | Ga0070680_100098143 | Ga0070680_1000981433 | 240 |
| 110 | 3300005336 | Ga0070680_100126515 | Ga0070680_1001265152 | 240 |
| 111 | 3300005338 | Ga0068868_100001315 | Ga0068868_10000131516 | 240 |
| 112 | 3300005338 | Ga0068868_100019311 | Ga0068868_1000193114 | 240 |
| 113 | 3300005338 | Ga0068868_100028424 | Ga0068868_1000284243 | 240 |
| 114 | 3300005338 | Ga0068868_100149061 | Ga0068868_1001490611 | 240 |
| 115 | 3300005339 | Ga0070660_100006409 | Ga0070660_1000064097 | 240 |
| 116 | 3300005339 | Ga0070660_100016068 | Ga0070660_1000160683 | 240 |
| 117 | 3300005339 | Ga0070660_100028804 | Ga0070660_1000288042 | 240 |
| 118 | 3300005339 | Ga0070660_100032953 | Ga0070660_1000329534 | 240 |
| 119 | 3300005339 | Ga0070660_100099383 | Ga0070660_1000993833 | 240 |
| 120 | 3300005344 | Ga0070661_100016193 | Ga0070661_1000161934 | 240 |
| 121 | 3300005344 | Ga0070661_100025904 | Ga0070661_1000259042 | 240 |
| 122 | 3300005344 | Ga0070661_100047542 | Ga0070661_1000475422 | 240 |
| 123 | 3300005344 | Ga0070661_100056067 | Ga0070661_1000560673 | 240 |
| 124 | 3300005344 | Ga0070661_100252837 | Ga0070661_1002528372 | 240 |
| 125 | 3300005345 | Ga0070692_10011905 | Ga0070692_100119054 | 240 |
| 126 | 3300005345 | Ga0070692_10224532 | Ga0070692_102245321 | 240 |
| 127 | 3300005347 | Ga0070668_100002681 | Ga0070668_1000026815 | 240 |
| 128 | 3300005347 | Ga0070668_100252404 | Ga0070668_1002524042 | 240 |
| 129 | 3300005353 | Ga0070669_100000068 | Ga0070669_10000006878 | 240 |
| 130 | 3300005353 | Ga0070669_100020982 | Ga0070669_1000209823 | 240 |
| 131 | 3300005353 | Ga0070669_100081289 | Ga0070669_1000812893 | 240 |
| 132 | 3300005354 | Ga0070675_100085366 | Ga0070675_1000853662 | 240 |
| 133 | 3300005355 | Ga0070671_100000777 | Ga0070671_1000007772 | 240 |
| 134 | 3300005355 | Ga0070671_100007788 | Ga0070671_1000077884 | 240 |
| 135 | 3300005355 | Ga0070671_100011151 | Ga0070671_1000111513 | 240 |
| 136 | 3300005355 | Ga0070671_100012348 | Ga0070671_1000123482 | 240 |
| 137 | 3300005355 | Ga0070671_100025045 | Ga0070671_1000250454 | 240 |
| 138 | 3300005355 | Ga0070671_100092282 | Ga0070671_1000922822 | 240 |
| 139 | 3300005355 | Ga0070671_100106591 | Ga0070671_1001065913 | 240 |
| 140 | 3300005355 | Ga0070671_100186709 | Ga0070671_1001867092 | 240 |
| 141 | 3300005355 | Ga0070671_100545605 | Ga0070671_1005456051 | 240 |
| 142 | 3300005356 | Ga0070674_100020059 | Ga0070674_1000200592 | 240 |
| 143 | 3300005356 | Ga0070674_100159829 | Ga0070674_1001598292 | 240 |
| 144 | 3300005356 | Ga0070674_100264259 | Ga0070674_1002642592 | 240 |
| 145 | 3300005364 | Ga0070673_100026160 | Ga0070673_1000261604 | 240 |
| 146 | 3300005364 | Ga0070673_100059648 | Ga0070673_1000596482 | 240 |
| 147 | 3300005364 | Ga0070673_100063883 | Ga0070673_1000638833 | 240 |
| 148 | 3300005364 | Ga0070673_100168984 | Ga0070673_1001689842 | 240 |
| 149 | 3300005365 | Ga0070688_100166852 | Ga0070688_1001668522 | 240 |
| 150 | 3300005366 | Ga0070659_100002551 | Ga0070659_1000025518 | 240 |
| 151 | 3300005366 | Ga0070659_100010070 | Ga0070659_1000100704 | 240 |
| 152 | 3300005366 | Ga0070659_100020119 | Ga0070659_1000201193 | 240 |
| 153 | 3300005366 | Ga0070659_100029930 | Ga0070659_1000299304 | 240 |
| 154 | 3300005366 | Ga0070659_100042504 | Ga0070659_1000425043 | 240 |
| 155 | 3300005366 | Ga0070659_100059956 | Ga0070659_1000599563 | 240 |
| 156 | 3300005366 | Ga0070659_100068896 | Ga0070659_1000688964 | 240 |
| 157 | 3300005366 | Ga0070659_100194547 | Ga0070659_1001945472 | 240 |
| 158 | 3300005366 | Ga0070659_100309130 | Ga0070659_1003091302 | 240 |
| 159 | 3300005367 | Ga0070667_100000885 | Ga0070667_1000008852 | 240 |
| 160 | 3300005367 | Ga0070667_100006375 | Ga0070667_1000063754 | 240 |
| 161 | 3300005367 | Ga0070667_100010927 | Ga0070667_1000109273 | 240 |
| 162 | 3300005367 | Ga0070667_100018985 | Ga0070667_1000189853 | 240 |
| 163 | 3300005367 | Ga0070667_100048257 | Ga0070667_1000482573 | 240 |
| 164 | 3300005367 | Ga0070667_100113736 | Ga0070667_1001137363 | 240 |
| 165 | 3300005367 | Ga0070667_100217836 | Ga0070667_1002178363 | 240 |
| 166 | 3300005367 | Ga0070667_100334528 | Ga0070667_1003345282 | 240 |
| 167 | 3300005367 | Ga0070667_100363210 | Ga0070667_1003632102 | 240 |
| 168 | 3300005435 | Ga0070714_100092608 | Ga0070714_1000926081 | 240 |
| 169 | 3300005435 | Ga0070714_100575646 | Ga0070714_1005756462 | 240 |
| 170 | 3300005436 | Ga0070713_100310802 | Ga0070713_1003108022 | 240 |
| 171 | 3300005444 | Ga0070694_100009270 | Ga0070694_1000092703 | 240 |
| 172 | 3300005455 | Ga0070663_100000991 | Ga0070663_1000009913 | 240 |
| 173 | 3300005455 | Ga0070663_100036923 | Ga0070663_1000369233 | 240 |
| 174 | 3300005455 | Ga0070663_100066486 | Ga0070663_1000664863 | 240 |
| 175 | 3300005455 | Ga0070663_100093820 | Ga0070663_1000938202 | 240 |
| 176 | 3300005455 | Ga0070663_100132960 | Ga0070663_1001329602 | 240 |
| 177 | 3300005455 | Ga0070663_100156413 | Ga0070663_1001564133 | 240 |
| 178 | 3300005456 | Ga0070678_100023347 | Ga0070678_1000233473 | 240 |
| 179 | 3300005456 | Ga0070678_100111826 | Ga0070678_1001118261 | 240 |
| 180 | 3300005456 | Ga0070678_100175038 | Ga0070678_1001750382 | 240 |
| 181 | 3300005456 | Ga0070678_100318384 | Ga0070678_1003183842 | 240 |
| 182 | 3300005457 | Ga0070662_100006707 | Ga0070662_1000067074 | 240 |
| 183 | 3300005457 | Ga0070662_100027144 | Ga0070662_1000271443 | 240 |
| 184 | 3300005457 | Ga0070662_100167048 | Ga0070662_1001670482 | 240 |
| 185 | 3300005457 | Ga0070662_100215143 | Ga0070662_1002151432 | 240 |
| 186 | 3300005458 | Ga0070681_10259039 | Ga0070681_102590393 | 240 |
| 187 | 3300005459 | Ga0068867_100002219 | Ga0068867_1000022197 | 240 |
| 188 | 3300005459 | Ga0068867_100121372 | Ga0068867_1001213723 | 240 |
| 189 | 3300005459 | Ga0068867_100126736 | Ga0068867_1001267364 | 240 |
| 190 | 3300005459 | Ga0068867_100170820 | Ga0068867_1001708204 | 240 |
| 191 | 3300005466 | Ga0070685_10474398 | Ga0070685_104743981 | 240 |
| 192 | 3300005530 | Ga0070679_100022822 | Ga0070679_1000228224 | 240 |
| 193 | 3300005530 | Ga0070679_100330461 | Ga0070679_1003304612 | 240 |
| 194 | 3300005535 | Ga0070684_100491043 | Ga0070684_1004910432 | 240 |
| 195 | 3300005539 | Ga0068853_100019988 | Ga0068853_1000199883 | 240 |
| 196 | 3300005543 | Ga0070672_100031263 | Ga0070672_1000312634 | 240 |
| 197 | 3300005543 | Ga0070672_100089713 | Ga0070672_1000897133 | 240 |
| 198 | 3300005543 | Ga0070672_100120228 | Ga0070672_1001202282 | 240 |
| 199 | 3300005544 | Ga0070686_100001063 | Ga0070686_1000010638 | 240 |
| 200 | 3300005545 | Ga0070695_100022680 | Ga0070695_1000226802 | 240 |
| 201 | 3300005546 | Ga0070696_100011198 | Ga0070696_1000111984 | 240 |
| 202 | 3300005547 | Ga0070693_100132503 | Ga0070693_1001325032 | 240 |
| 203 | 3300005548 | Ga0070665_100001845 | Ga0070665_1000018457 | 240 |
| 204 | 3300005548 | Ga0070665_100002264 | Ga0070665_1000022645 | 240 |
| 205 | 3300005548 | Ga0070665_100012623 | Ga0070665_1000126234 | 240 |
| 206 | 3300005548 | Ga0070665_100169147 | Ga0070665_1001691472 | 240 |
| 207 | 3300005548 | Ga0070665_100399278 | Ga0070665_1003992782 | 240 |
| 208 | 3300005549 | Ga0070704_100101393 | Ga0070704_1001013932 | 240 |
| 209 | 3300005563 | Ga0068855_100056364 | Ga0068855_1000563644 | 240 |
| 210 | 3300005563 | Ga0068855_100144320 | Ga0068855_1001443203 | 240 |
| 211 | 3300005563 | Ga0068855_100204060 | Ga0068855_1002040603 | 240 |
| 212 | 3300005563 | Ga0068855_101099922 | Ga0068855_1010999221 | 240 |
| 213 | 3300005564 | Ga0070664_100003956 | Ga0070664_1000039569 | 240 |
| 214 | 3300005564 | Ga0070664_100005115 | Ga0070664_1000051154 | 240 |
| 215 | 3300005564 | Ga0070664_100008101 | Ga0070664_1000081013 | 240 |
| 216 | 3300005564 | Ga0070664_100026386 | Ga0070664_1000263864 | 240 |
| 217 | 3300005564 | Ga0070664_100039130 | Ga0070664_1000391302 | 240 |
| 218 | 3300005564 | Ga0070664_100075351 | Ga0070664_1000753512 | 240 |
| 219 | 3300005564 | Ga0070664_100111731 | Ga0070664_1001117312 | 240 |
| 220 | 3300005564 | Ga0070664_100151349 | Ga0070664_1001513492 | 240 |
| 221 | 3300005564 | Ga0070664_100316769 | Ga0070664_1003167691 | 240 |
| 222 | 3300005577 | Ga0068857_100003144 | Ga0068857_1000031446 | 240 |
| 223 | 3300005577 | Ga0068857_100064083 | Ga0068857_1000640834 | 240 |
| 224 | 3300005577 | Ga0068857_100291401 | Ga0068857_1002914012 | 240 |
| 225 | 3300005577 | Ga0068857_100400961 | Ga0068857_1004009611 | 240 |
| 226 | 3300005578 | Ga0068854_100160932 | Ga0068854_1001609322 | 240 |
| 227 | 3300005614 | Ga0068856_100006667 | Ga0068856_1000066677 | 240 |
| 228 | 3300005614 | Ga0068856_100094019 | Ga0068856_1000940193 | 240 |
| 229 | 3300005616 | Ga0068852_100000980 | Ga0068852_1000009809 | 240 |
| 230 | 3300005616 | Ga0068852_100018839 | Ga0068852_1000188394 | 240 |
| 231 | 3300005616 | Ga0068852_100046996 | Ga0068852_1000469964 | 240 |
| 232 | 3300005616 | Ga0068852_100063641 | Ga0068852_1000636414 | 240 |
| 233 | 3300005616 | Ga0068852_100110241 | Ga0068852_1001102412 | 240 |
| 234 | 3300005616 | Ga0068852_100174487 | Ga0068852_1001744871 | 240 |
| 235 | 3300005616 | Ga0068852_100270042 | Ga0068852_1002700421 | 240 |
| 236 | 3300005616 | Ga0068852_100339466 | Ga0068852_1003394662 | 240 |
| 237 | 3300005617 | Ga0068859_100003574 | Ga0068859_10000357412 | 240 |
| 238 | 3300005617 | Ga0068859_100027091 | Ga0068859_1000270914 | 240 |
| 239 | 3300005617 | Ga0068859_100197078 | Ga0068859_1001970782 | 240 |
| 240 | 3300005617 | Ga0068859_100370963 | Ga0068859_1003709632 | 240 |
| 241 | 3300005618 | Ga0068864_100000644 | Ga0068864_10000064423 | 240 |
| 242 | 3300005618 | Ga0068864_100000652 | Ga0068864_10000065221 | 240 |
| 243 | 3300005618 | Ga0068864_100007139 | Ga0068864_1000071393 | 240 |
| 244 | 3300005618 | Ga0068864_100007619 | Ga0068864_1000076193 | 240 |
| 245 | 3300005618 | Ga0068864_100017564 | Ga0068864_1000175643 | 240 |
| 246 | 3300005618 | Ga0068864_100033788 | Ga0068864_1000337884 | 240 |
| 247 | 3300005618 | Ga0068864_100237775 | Ga0068864_1002377752 | 240 |
| 248 | 3300005719 | Ga0068861_100105991 | Ga0068861_1001059912 | 240 |
| 249 | 3300005834 | Ga0068851_10003801 | Ga0068851_100038013 | 240 |
| 250 | 3300005834 | Ga0068851_10006508 | Ga0068851_100065083 | 240 |
| 251 | 3300005834 | Ga0068851_10017140 | Ga0068851_100171403 | 240 |
| 252 | 3300005834 | Ga0068851_10185897 | Ga0068851_101858972 | 240 |
| 253 | 3300005841 | Ga0068863_100005821 | Ga0068863_1000058219 | 240 |
| 254 | 3300005841 | Ga0068863_100006923 | Ga0068863_1000069237 | 240 |
| 255 | 3300005841 | Ga0068863_100007794 | Ga0068863_1000077943 | 240 |
| 256 | 3300005841 | Ga0068863_100022840 | Ga0068863_1000228404 | 240 |
| 257 | 3300005841 | Ga0068863_100151238 | Ga0068863_1001512382 | 240 |
| 258 | 3300005842 | Ga0068858_100000338 | Ga0068858_10000033833 | 240 |
| 259 | 3300005842 | Ga0068858_100001356 | Ga0068858_10000135610 | 240 |
| 260 | 3300005842 | Ga0068858_100011333 | Ga0068858_1000113334 | 240 |
| 261 | 3300005842 | Ga0068858_100015292 | Ga0068858_1000152923 | 240 |
| 262 | 3300005842 | Ga0068858_100089996 | Ga0068858_1000899962 | 240 |
| 263 | 3300005842 | Ga0068858_100228759 | Ga0068858_1002287592 | 240 |
| 264 | 3300005843 | Ga0068860_100000164 | Ga0068860_10000016496 | 240 |
| 265 | 3300005843 | Ga0068860_100010261 | Ga0068860_1000102613 | 240 |
| 266 | 3300005843 | Ga0068860_100014304 | Ga0068860_1000143042 | 240 |
| 267 | 3300005843 | Ga0068860_100031747 | Ga0068860_1000317473 | 240 |
| 268 | 3300005843 | Ga0068860_100094916 | Ga0068860_1000949162 | 240 |
| 269 | 3300005843 | Ga0068860_100097821 | Ga0068860_1000978212 | 240 |
| 270 | 3300005843 | Ga0068860_100148802 | Ga0068860_1001488023 | 240 |
| 271 | 3300005844 | Ga0068862_100013225 | Ga0068862_1000132257 | 240 |
| 272 | 3300005844 | Ga0068862_100027070 | Ga0068862_1000270704 | 240 |
| 273 | 3300005844 | Ga0068862_100145065 | Ga0068862_1001450652 | 240 |
| 274 | 3300005844 | Ga0068862_100400715 | Ga0068862_1004007152 | 240 |
| 275 | 3300005844 | Ga0068862_100535272 | Ga0068862_1005352723 | 240 |
| 276 | 3300006195 | Ga0075366_10164086 | Ga0075366_101640862 | 240 |
| 277 | 3300006237 | Ga0097621_100035903 | Ga0097621_1000359033 | 240 |
| 278 | 3300006237 | Ga0097621_100095911 | Ga0097621_1000959113 | 240 |
| 279 | 3300006237 | Ga0097621_100611649 | Ga0097621_1006116492 | 240 |
| 280 | 3300006358 | Ga0068871_100046466 | Ga0068871_1000464663 | 240 |
| 281 | 3300006852 | Ga0075433_10025912 | Ga0075433_100259123 | 240 |
| 282 | 3300006881 | Ga0068865_100014709 | Ga0068865_1000147094 | 240 |
| 283 | 3300006931 | Ga0097620_100003574 | Ga0097620_1000035743 | 240 |
| 284 | 3300006931 | Ga0097620_100027091 | Ga0097620_1000270913 | 240 |
| 285 | 3300006931 | Ga0097620_100197052 | Ga0097620_1001970522 | 240 |
| 286 | 3300006931 | Ga0097620_100370975 | Ga0097620_1003709752 | 240 |
| 287 | 3300007076 | Ga0075435_100368170 | Ga0075435_1003681702 | 240 |
| 288 | 3300009011 | Ga0105251_10066085 | Ga0105251_100660852 | 240 |
| 289 | 3300009011 | Ga0105251_10085531 | Ga0105251_100855312 | 240 |
| 290 | 3300009093 | Ga0105240_10233002 | Ga0105240_102330022 | 240 |
| 291 | 3300009093 | Ga0105240_10289998 | Ga0105240_102899983 | 240 |
| 292 | 3300009094 | Ga0111539_10017289 | Ga0111539_100172895 | 240 |
| 293 | 3300009098 | Ga0105245_10020409 | Ga0105245_100204094 | 240 |
| 294 | 3300009148 | Ga0105243_10121505 | Ga0105243_101215052 | 240 |
| 295 | 3300009148 | Ga0105243_10369708 | Ga0105243_103697082 | 240 |
| 296 | 3300009176 | Ga0105242_10002830 | Ga0105242_100028304 | 240 |
| 297 | 3300009177 | Ga0105248_10000898 | Ga0105248_1000089839 | 240 |
| 298 | 3300009177 | Ga0105248_10001310 | Ga0105248_1000131012 | 240 |
| 299 | 3300009177 | Ga0105248_10005770 | Ga0105248_100057708 | 240 |
| 300 | 3300009177 | Ga0105248_10006692 | Ga0105248_100066925 | 240 |
| 301 | 3300009177 | Ga0105248_10007974 | Ga0105248_100079743 | 240 |
| 302 | 3300009177 | Ga0105248_10008536 | Ga0105248_100085364 | 240 |
| 303 | 3300009177 | Ga0105248_10009978 | Ga0105248_100099782 | 240 |
| 304 | 3300009177 | Ga0105248_10012217 | Ga0105248_100122179 | 240 |
| 305 | 3300009177 | Ga0105248_10060856 | Ga0105248_100608562 | 240 |
| 306 | 3300009177 | Ga0105248_10080506 | Ga0105248_100805063 | 240 |
| 307 | 3300009177 | Ga0105248_10271396 | Ga0105248_102713963 | 240 |
| 308 | 3300009545 | Ga0105237_10030373 | Ga0105237_100303733 | 240 |
| 309 | 3300009545 | Ga0105237_10154785 | Ga0105237_101547852 | 240 |
| 310 | 3300009551 | Ga0105238_10318030 | Ga0105238_103180302 | 240 |
| 311 | 3300009553 | Ga0105249_10066447 | Ga0105249_100664474 | 240 |
| 312 | 3300009553 | Ga0105249_10139116 | Ga0105249_101391162 | 240 |
| 313 | 3300009553 | Ga0105249_10169322 | Ga0105249_101693224 | 240 |
| 314 | 3300009553 | Ga0105249_10390789 | Ga0105249_103907892 | 240 |
| 315 | 3300009553 | Ga0105249_10663919 | Ga0105249_106639191 | 240 |
| 316 | 3300011119 | Ga0105246_10050934 | Ga0105246_100509344 | 240 |
| 317 | 3300013100 | Ga0157373_10096111 | Ga0157373_100961114 | 240 |
| 318 | 3300013100 | Ga0157373_10178975 | Ga0157373_101789751 | 240 |
| 319 | 3300013100 | Ga0157373_10187832 | Ga0157373_101878322 | 240 |
| 320 | 3300013100 | Ga0157373_10219312 | Ga0157373_102193122 | 240 |
| 321 | 3300013102 | Ga0157371_10017846 | Ga0157371_100178464 | 240 |
| 322 | 3300013102 | Ga0157371_10077134 | Ga0157371_100771344 | 240 |
| 323 | 3300013104 | Ga0157370_10716494 | Ga0157370_107164942 | 240 |
| 324 | 3300013105 | Ga0157369_10035624 | Ga0157369_100356243 | 240 |
| 325 | 3300013105 | Ga0157369_10426685 | Ga0157369_104266852 | 240 |
| 326 | 3300013297 | Ga0157378_10030245 | Ga0157378_100302451 | 240 |
| 327 | 3300013297 | Ga0157378_10094676 | Ga0157378_100946762 | 240 |
| 328 | 3300013297 | Ga0157378_10144132 | Ga0157378_101441322 | 240 |
| 329 | 3300013297 | Ga0157378_10426477 | Ga0157378_104264771 | 240 |
| 330 | 3300013306 | Ga0163162_10006162 | Ga0163162_100061624 | 240 |
| 331 | 3300013306 | Ga0163162_10006556 | Ga0163162_1000655613 | 240 |
| 332 | 3300013306 | Ga0163162_10063486 | Ga0163162_100634863 | 240 |
| 333 | 3300013306 | Ga0163162_10136868 | Ga0163162_101368683 | 240 |
| 334 | 3300013306 | Ga0163162_10358151 | Ga0163162_103581512 | 240 |
| 335 | 3300013307 | Ga0157372_10360175 | Ga0157372_103601753 | 240 |
| 336 | 3300013308 | Ga0157375_10157881 | Ga0157375_101578812 | 240 |
| 337 | 3300013308 | Ga0157375_10338185 | Ga0157375_103381852 | 240 |
| 338 | 3300014325 | Ga0163163_10003408 | Ga0163163_100034084 | 240 |
| 339 | 3300014325 | Ga0163163_10009604 | Ga0163163_100096043 | 240 |
| 340 | 3300014325 | Ga0163163_10032541 | Ga0163163_100325414 | 240 |
| 341 | 3300014326 | Ga0157380_10000643 | Ga0157380_1000064317 | 240 |
| 342 | 3300014497 | Ga0182008_10015626 | Ga0182008_100156263 | 240 |
| 343 | 3300014497 | Ga0182008_10251015 | Ga0182008_102510151 | 240 |
| 344 | 3300014745 | Ga0157377_10057529 | Ga0157377_100575293 | 240 |
| 345 | 3300014968 | Ga0157379_10002639 | Ga0157379_1000263911 | 240 |
| 346 | 3300014968 | Ga0157379_10159058 | Ga0157379_101590582 | 240 |
| 347 | 3300014968 | Ga0157379_10178292 | Ga0157379_101782922 | 240 |
| 348 | 3300014968 | Ga0157379_10728826 | Ga0157379_107288262 | 240 |
| 349 | 3300014969 | Ga0157376_10306495 | Ga0157376_103064952 | 240 |
| 350 | 3300015690 | Ga0183363_1003 | Ga0183363_1003294 | 240 |
| 351 | 3300016635 | Ga0183361_11167 | Ga0183361_111671 | 240 |
| 352 | 3300017792 | Ga0163161_10003908 | Ga0163161_100039084 | 240 |
| 353 | 3300020082 | Ga0206353_10503123 | Ga0206353_105031233 | 240 |
| 354 | 3300021384 | Ga0213876_10087211 | Ga0213876_100872113 | 240 |
| 355 | 3300025263 | Ga0209565_1000007 | Ga0209565_1000007339 | 240 |
| 356 | 3300025271 | Ga0207666_1012494 | Ga0207666_10124942 | 240 |
| 357 | 3300025273 | Ga0209673_1001016 | Ga0209673_100101626 | 240 |
| 358 | 3300025291 | Ga0209675_1007707 | Ga0209675_10077072 | 240 |
| 359 | 3300025292 | Ga0209676_1016060 | Ga0209676_10160603 | 240 |
| 360 | 3300025297 | Ga0209758_1000005 | Ga0209758_1000005701 | 240 |
| 361 | 3300025297 | Ga0209758_1011190 | Ga0209758_10111905 | 240 |
| 362 | 3300025298 | Ga0209050_1000010 | Ga0209050_1000010833 | 240 |
| 363 | 3300025298 | Ga0209050_1003636 | Ga0209050_100363610 | 240 |
| 364 | 3300025298 | Ga0209050_1005965 | Ga0209050_10059652 | 240 |
| 365 | 3300025299 | Ga0209256_1000008 | Ga0209256_1000008181 | 240 |
| 366 | 3300025302 | Ga0207426_1051382 | Ga0207426_10513822 | 240 |
| 367 | 3300025302 | Ga0207426_1078811 | Ga0207426_10788111 | 240 |
| 368 | 3300025304 | Ga0209257_1000027 | Ga0209257_1000027475 | 240 |
| 369 | 3300025304 | Ga0209257_1002411 | Ga0209257_10024117 | 240 |
| 370 | 3300025315 | Ga0207697_10017346 | Ga0207697_100173462 | 240 |
| 371 | 3300025321 | Ga0207656_10002269 | Ga0207656_100022694 | 240 |
| 372 | 3300025321 | Ga0207656_10023356 | Ga0207656_100233563 | 240 |
| 373 | 3300025321 | Ga0207656_10096395 | Ga0207656_100963953 | 240 |
| 374 | 3300025321 | Ga0207656_10144858 | Ga0207656_101448582 | 240 |
| 375 | 3300025711 | Ga0207696_1027164 | Ga0207696_10271642 | 240 |
| 376 | 3300025735 | Ga0207713_1009812 | Ga0207713_10098123 | 240 |
| 377 | 3300025899 | Ga0207642_10198768 | Ga0207642_101987682 | 240 |
| 378 | 3300025901 | Ga0207688_10187812 | Ga0207688_101878122 | 240 |
| 379 | 3300025901 | Ga0207688_10244265 | Ga0207688_102442652 | 240 |
| 380 | 3300025903 | Ga0207680_10007920 | Ga0207680_100079203 | 240 |
| 381 | 3300025903 | Ga0207680_10011483 | Ga0207680_100114834 | 240 |
| 382 | 3300025903 | Ga0207680_10031782 | Ga0207680_100317824 | 240 |
| 383 | 3300025903 | Ga0207680_10058812 | Ga0207680_100588123 | 240 |
| 384 | 3300025903 | Ga0207680_10063454 | Ga0207680_100634542 | 240 |
| 385 | 3300025903 | Ga0207680_10089118 | Ga0207680_100891182 | 240 |
| 386 | 3300025903 | Ga0207680_10134194 | Ga0207680_101341942 | 240 |
| 387 | 3300025903 | Ga0207680_10240723 | Ga0207680_102407233 | 240 |
| 388 | 3300025904 | Ga0207647_10009717 | Ga0207647_100097174 | 240 |
| 389 | 3300025904 | Ga0207647_10017962 | Ga0207647_100179624 | 240 |
| 390 | 3300025904 | Ga0207647_10056670 | Ga0207647_100566703 | 240 |
| 391 | 3300025907 | Ga0207645_10011561 | Ga0207645_100115612 | 240 |
| 392 | 3300025907 | Ga0207645_10019534 | Ga0207645_100195342 | 240 |
| 393 | 3300025907 | Ga0207645_10109864 | Ga0207645_101098642 | 240 |
| 394 | 3300025907 | Ga0207645_10289255 | Ga0207645_102892553 | 240 |
| 395 | 3300025909 | Ga0207705_10003338 | Ga0207705_100033384 | 240 |
| 396 | 3300025909 | Ga0207705_10004852 | Ga0207705_100048523 | 240 |
| 397 | 3300025909 | Ga0207705_10013059 | Ga0207705_100130594 | 240 |
| 398 | 3300025909 | Ga0207705_10026948 | Ga0207705_100269483 | 240 |
| 399 | 3300025909 | Ga0207705_10041563 | Ga0207705_100415633 | 240 |
| 400 | 3300025909 | Ga0207705_10044100 | Ga0207705_100441004 | 240 |
| 401 | 3300025909 | Ga0207705_10046994 | Ga0207705_100469942 | 240 |
| 402 | 3300025909 | Ga0207705_10056628 | Ga0207705_100566281 | 240 |
| 403 | 3300025909 | Ga0207705_10204275 | Ga0207705_102042751 | 240 |
| 404 | 3300025912 | Ga0207707_10052080 | Ga0207707_100520803 | 240 |
| 405 | 3300025912 | Ga0207707_10079159 | Ga0207707_100791594 | 240 |
| 406 | 3300025913 | Ga0207695_10248961 | Ga0207695_102489611 | 240 |
| 407 | 3300025917 | Ga0207660_10013623 | Ga0207660_100136234 | 240 |
| 408 | 3300025918 | Ga0207662_10097390 | Ga0207662_100973902 | 240 |
| 409 | 3300025918 | Ga0207662_10124265 | Ga0207662_101242653 | 240 |
| 410 | 3300025919 | Ga0207657_10000868 | Ga0207657_100008683 | 240 |
| 411 | 3300025919 | Ga0207657_10002240 | Ga0207657_1000224013 | 240 |
| 412 | 3300025919 | Ga0207657_10005291 | Ga0207657_100052913 | 240 |
| 413 | 3300025919 | Ga0207657_10005364 | Ga0207657_100053649 | 240 |
| 414 | 3300025919 | Ga0207657_10020284 | Ga0207657_100202843 | 240 |
| 415 | 3300025919 | Ga0207657_10058947 | Ga0207657_100589473 | 240 |
| 416 | 3300025919 | Ga0207657_10079808 | Ga0207657_100798083 | 240 |
| 417 | 3300025919 | Ga0207657_10098369 | Ga0207657_100983692 | 240 |
| 418 | 3300025919 | Ga0207657_10103969 | Ga0207657_101039692 | 240 |
| 419 | 3300025919 | Ga0207657_10243484 | Ga0207657_102434841 | 240 |
| 420 | 3300025919 | Ga0207657_10318709 | Ga0207657_103187092 | 240 |
| 421 | 3300025919 | Ga0207657_10525901 | Ga0207657_105259011 | 240 |
| 422 | 3300025920 | Ga0207649_10016567 | Ga0207649_100165674 | 240 |
| 423 | 3300025920 | Ga0207649_10033073 | Ga0207649_100330732 | 240 |
| 424 | 3300025920 | Ga0207649_10069766 | Ga0207649_100697663 | 240 |
| 425 | 3300025920 | Ga0207649_10101659 | Ga0207649_101016592 | 240 |
| 426 | 3300025920 | Ga0207649_10466915 | Ga0207649_104669151 | 240 |
| 427 | 3300025921 | Ga0207652_10079371 | Ga0207652_100793713 | 240 |
| 428 | 3300025921 | Ga0207652_10112659 | Ga0207652_101126593 | 240 |
| 429 | 3300025923 | Ga0207681_10000105 | Ga0207681_1000010525 | 240 |
| 430 | 3300025923 | Ga0207681_10014001 | Ga0207681_100140013 | 240 |
| 431 | 3300025923 | Ga0207681_10077610 | Ga0207681_100776102 | 240 |
| 432 | 3300025923 | Ga0207681_10193397 | Ga0207681_101933973 | 240 |
| 433 | 3300025924 | Ga0207694_10181617 | Ga0207694_101816173 | 240 |
| 434 | 3300025925 | Ga0207650_10066169 | Ga0207650_100661692 | 240 |
| 435 | 3300025925 | Ga0207650_10319640 | Ga0207650_103196403 | 240 |
| 436 | 3300025925 | Ga0207650_10574367 | Ga0207650_105743672 | 240 |
| 437 | 3300025925 | Ga0207650_10637631 | Ga0207650_106376311 | 240 |
| 438 | 3300025926 | Ga0207659_10056059 | Ga0207659_100560593 | 240 |
| 439 | 3300025926 | Ga0207659_10230510 | Ga0207659_102305101 | 240 |
| 440 | 3300025926 | Ga0207659_10331747 | Ga0207659_103317472 | 240 |
| 441 | 3300025927 | Ga0207687_10021349 | Ga0207687_100213494 | 240 |
| 442 | 3300025927 | Ga0207687_10517732 | Ga0207687_105177321 | 240 |
| 443 | 3300025929 | Ga0207664_10044911 | Ga0207664_100449113 | 240 |
| 444 | 3300025929 | Ga0207664_10690286 | Ga0207664_106902862 | 240 |
| 445 | 3300025931 | Ga0207644_10000248 | Ga0207644_100002483 | 240 |
| 446 | 3300025931 | Ga0207644_10001119 | Ga0207644_100011195 | 240 |
| 447 | 3300025931 | Ga0207644_10001155 | Ga0207644_100011554 | 240 |
| 448 | 3300025931 | Ga0207644_10008128 | Ga0207644_100081285 | 240 |
| 449 | 3300025931 | Ga0207644_10013273 | Ga0207644_100132733 | 240 |
| 450 | 3300025931 | Ga0207644_10019152 | Ga0207644_100191524 | 240 |
| 451 | 3300025931 | Ga0207644_10052209 | Ga0207644_100522092 | 240 |
| 452 | 3300025931 | Ga0207644_10053199 | Ga0207644_100531993 | 240 |
| 453 | 3300025931 | Ga0207644_10086645 | Ga0207644_100866452 | 240 |
| 454 | 3300025932 | Ga0207690_10007784 | Ga0207690_100077844 | 240 |
| 455 | 3300025932 | Ga0207690_10024336 | Ga0207690_100243364 | 240 |
| 456 | 3300025932 | Ga0207690_10026180 | Ga0207690_100261804 | 240 |
| 457 | 3300025932 | Ga0207690_10085900 | Ga0207690_100859003 | 240 |
| 458 | 3300025932 | Ga0207690_10103557 | Ga0207690_101035572 | 240 |
| 459 | 3300025932 | Ga0207690_10128617 | Ga0207690_101286173 | 240 |
| 460 | 3300025932 | Ga0207690_10138886 | Ga0207690_101388862 | 240 |
| 461 | 3300025932 | Ga0207690_10419996 | Ga0207690_104199962 | 240 |
| 462 | 3300025933 | Ga0207706_10005564 | Ga0207706_100055646 | 240 |
| 463 | 3300025933 | Ga0207706_10005806 | Ga0207706_100058065 | 240 |
| 464 | 3300025933 | Ga0207706_10021528 | Ga0207706_100215284 | 240 |
| 465 | 3300025933 | Ga0207706_10025644 | Ga0207706_100256443 | 240 |
| 466 | 3300025933 | Ga0207706_10033942 | Ga0207706_100339423 | 240 |
| 467 | 3300025933 | Ga0207706_10064793 | Ga0207706_100647932 | 240 |
| 468 | 3300025933 | Ga0207706_10068398 | Ga0207706_100683984 | 240 |
| 469 | 3300025933 | Ga0207706_10582101 | Ga0207706_105821011 | 240 |
| 470 | 3300025934 | Ga0207686_10188864 | Ga0207686_101888641 | 240 |
| 471 | 3300025935 | Ga0207709_10064525 | Ga0207709_100645253 | 240 |
| 472 | 3300025935 | Ga0207709_10260833 | Ga0207709_102608332 | 240 |
| 473 | 3300025935 | Ga0207709_10410454 | Ga0207709_104104542 | 240 |
| 474 | 3300025936 | Ga0207670_10152786 | Ga0207670_101527862 | 240 |
| 475 | 3300025937 | Ga0207669_10022729 | Ga0207669_100227294 | 240 |
| 476 | 3300025937 | Ga0207669_10109607 | Ga0207669_101096072 | 240 |
| 477 | 3300025937 | Ga0207669_10218881 | Ga0207669_102188811 | 240 |
| 478 | 3300025937 | Ga0207669_10259771 | Ga0207669_102597712 | 240 |
| 479 | 3300025938 | Ga0207704_10006416 | Ga0207704_100064163 | 240 |
| 480 | 3300025940 | Ga0207691_10001810 | Ga0207691_100018104 | 240 |
| 481 | 3300025940 | Ga0207691_10044375 | Ga0207691_100443753 | 240 |
| 482 | 3300025940 | Ga0207691_10058755 | Ga0207691_100587552 | 240 |
| 483 | 3300025940 | Ga0207691_10063146 | Ga0207691_100631462 | 240 |
| 484 | 3300025940 | Ga0207691_10065315 | Ga0207691_100653153 | 240 |
| 485 | 3300025941 | Ga0207711_10000724 | Ga0207711_1000072410 | 240 |
| 486 | 3300025941 | Ga0207711_10000748 | Ga0207711_1000074818 | 240 |
| 487 | 3300025941 | Ga0207711_10001383 | Ga0207711_100013838 | 240 |
| 488 | 3300025941 | Ga0207711_10001795 | Ga0207711_100017955 | 240 |
| 489 | 3300025941 | Ga0207711_10003381 | Ga0207711_1000338113 | 240 |
| 490 | 3300025941 | Ga0207711_10003474 | Ga0207711_1000347410 | 240 |
| 491 | 3300025941 | Ga0207711_10004333 | Ga0207711_100043339 | 240 |
| 492 | 3300025941 | Ga0207711_10005686 | Ga0207711_100056862 | 240 |
| 493 | 3300025941 | Ga0207711_10007344 | Ga0207711_100073449 | 240 |
| 494 | 3300025941 | Ga0207711_10019139 | Ga0207711_100191392 | 240 |
| 495 | 3300025941 | Ga0207711_10022062 | Ga0207711_100220623 | 240 |
| 496 | 3300025941 | Ga0207711_10027834 | Ga0207711_100278343 | 240 |
| 497 | 3300025941 | Ga0207711_10096422 | Ga0207711_100964222 | 240 |
| 498 | 3300025941 | Ga0207711_10165843 | Ga0207711_101658431 | 240 |
| 499 | 3300025942 | Ga0207689_10008558 | Ga0207689_100085583 | 240 |
| 500 | 3300025942 | Ga0207689_10162968 | Ga0207689_101629681 | 240 |
| 501 | 3300025944 | Ga0207661_10116626 | Ga0207661_101166262 | 240 |
| 502 | 3300025944 | Ga0207661_10177565 | Ga0207661_101775652 | 240 |
| 503 | 3300025945 | Ga0207679_10005861 | Ga0207679_100058615 | 240 |
| 504 | 3300025945 | Ga0207679_10006949 | Ga0207679_100069492 | 240 |
| 505 | 3300025945 | Ga0207679_10013276 | Ga0207679_100132763 | 240 |
| 506 | 3300025945 | Ga0207679_10043087 | Ga0207679_100430873 | 240 |
| 507 | 3300025945 | Ga0207679_10152578 | Ga0207679_101525783 | 240 |
| 508 | 3300025945 | Ga0207679_10336950 | Ga0207679_103369502 | 240 |
| 509 | 3300025949 | Ga0207667_10352161 | Ga0207667_103521611 | 240 |
| 510 | 3300025949 | Ga0207667_10460739 | Ga0207667_104607391 | 240 |
| 511 | 3300025949 | Ga0207667_10885579 | Ga0207667_108855792 | 240 |
| 512 | 3300025949 | Ga0207667_10906184 | Ga0207667_109061841 | 240 |
| 513 | 3300025960 | Ga0207651_10002259 | Ga0207651_100022594 | 240 |
| 514 | 3300025960 | Ga0207651_10016439 | Ga0207651_100164394 | 240 |
| 515 | 3300025960 | Ga0207651_10048109 | Ga0207651_100481093 | 240 |
| 516 | 3300025961 | Ga0207712_10000629 | Ga0207712_1000062929 | 240 |
| 517 | 3300025961 | Ga0207712_10038449 | Ga0207712_100384494 | 240 |
| 518 | 3300025961 | Ga0207712_10274154 | Ga0207712_102741542 | 240 |
| 519 | 3300025972 | Ga0207668_10012745 | Ga0207668_100127454 | 240 |
| 520 | 3300025981 | Ga0207640_10026004 | Ga0207640_100260042 | 240 |
| 521 | 3300025986 | Ga0207658_10000205 | Ga0207658_100002053 | 240 |
| 522 | 3300025986 | Ga0207658_10000359 | Ga0207658_1000035922 | 240 |
| 523 | 3300025986 | Ga0207658_10009870 | Ga0207658_100098706 | 240 |
| 524 | 3300025986 | Ga0207658_10031774 | Ga0207658_100317743 | 240 |
| 525 | 3300025986 | Ga0207658_10588678 | Ga0207658_105886782 | 240 |
| 526 | 3300025986 | Ga0207658_10605136 | Ga0207658_106051362 | 240 |
| 527 | 3300026023 | Ga0207677_10003777 | Ga0207677_100037771 | 240 |
| 528 | 3300026023 | Ga0207677_10014749 | Ga0207677_100147494 | 240 |
| 529 | 3300026023 | Ga0207677_10644426 | Ga0207677_106444262 | 240 |
| 530 | 3300026035 | Ga0207703_10000376 | Ga0207703_1000037630 | 240 |
| 531 | 3300026035 | Ga0207703_10001763 | Ga0207703_1000176316 | 240 |
| 532 | 3300026035 | Ga0207703_10012799 | Ga0207703_100127993 | 240 |
| 533 | 3300026035 | Ga0207703_10024235 | Ga0207703_100242353 | 240 |
| 534 | 3300026035 | Ga0207703_10035362 | Ga0207703_100353623 | 240 |
| 535 | 3300026035 | Ga0207703_10039232 | Ga0207703_100392323 | 240 |
| 536 | 3300026041 | Ga0207639_10046376 | Ga0207639_100463763 | 240 |
| 537 | 3300026041 | Ga0207639_10111731 | Ga0207639_101117313 | 240 |
| 538 | 3300026041 | Ga0207639_10127158 | Ga0207639_101271581 | 240 |
| 539 | 3300026067 | Ga0207678_10000681 | Ga0207678_1000068121 | 240 |
| 540 | 3300026067 | Ga0207678_10011552 | Ga0207678_100115524 | 240 |
| 541 | 3300026067 | Ga0207678_10012349 | Ga0207678_100123493 | 240 |
| 542 | 3300026067 | Ga0207678_10056631 | Ga0207678_100566312 | 240 |
| 543 | 3300026067 | Ga0207678_10222164 | Ga0207678_102221641 | 240 |
| 544 | 3300026067 | Ga0207678_10289967 | Ga0207678_102899672 | 240 |
| 545 | 3300026067 | Ga0207678_10330988 | Ga0207678_103309881 | 240 |
| 546 | 3300026075 | Ga0207708_10506153 | Ga0207708_105061532 | 240 |
| 547 | 3300026078 | Ga0207702_10014863 | Ga0207702_100148633 | 240 |
| 548 | 3300026078 | Ga0207702_10190577 | Ga0207702_101905772 | 240 |
| 549 | 3300026078 | Ga0207702_10352715 | Ga0207702_103527153 | 240 |
| 550 | 3300026078 | Ga0207702_10454515 | Ga0207702_104545151 | 240 |
| 551 | 3300026088 | Ga0207641_10000817 | Ga0207641_1000081732 | 240 |
| 552 | 3300026088 | Ga0207641_10003247 | Ga0207641_100032476 | 240 |
| 553 | 3300026088 | Ga0207641_10030667 | Ga0207641_100306671 | 240 |
| 554 | 3300026088 | Ga0207641_10172641 | Ga0207641_101726413 | 240 |
| 555 | 3300026088 | Ga0207641_10189532 | Ga0207641_101895323 | 240 |
| 556 | 3300026089 | Ga0207648_10001389 | Ga0207648_1000138925 | 240 |
| 557 | 3300026089 | Ga0207648_10011967 | Ga0207648_100119674 | 240 |
| 558 | 3300026089 | Ga0207648_10076108 | Ga0207648_100761084 | 240 |
| 559 | 3300026089 | Ga0207648_10109533 | Ga0207648_101095332 | 240 |
| 560 | 3300026095 | Ga0207676_10003927 | Ga0207676_1000392711 | 240 |
| 561 | 3300026095 | Ga0207676_10019732 | Ga0207676_100197325 | 240 |
| 562 | 3300026095 | Ga0207676_10030560 | Ga0207676_100305603 | 240 |
| 563 | 3300026095 | Ga0207676_10034399 | Ga0207676_100343991 | 240 |
| 564 | 3300026095 | Ga0207676_10050766 | Ga0207676_100507662 | 240 |
| 565 | 3300026116 | Ga0207674_10002210 | Ga0207674_100022104 | 240 |
| 566 | 3300026116 | Ga0207674_10023115 | Ga0207674_100231154 | 240 |
| 567 | 3300026116 | Ga0207674_10328720 | Ga0207674_103287201 | 240 |
| 568 | 3300026116 | Ga0207674_10375265 | Ga0207674_103752653 | 240 |
| 569 | 3300026116 | Ga0207674_10961871 | Ga0207674_109618711 | 240 |
| 570 | 3300026118 | Ga0207675_100000568 | Ga0207675_1000005683 | 240 |
| 571 | 3300026118 | Ga0207675_100162641 | Ga0207675_1001626412 | 240 |
| 572 | 3300026118 | Ga0207675_100436963 | Ga0207675_1004369632 | 240 |
| 573 | 3300026118 | Ga0207675_100851292 | Ga0207675_1008512922 | 240 |
| 574 | 3300026121 | Ga0207683_10001782 | Ga0207683_100017823 | 240 |
| 575 | 3300026121 | Ga0207683_10005777 | Ga0207683_100057774 | 240 |
| 576 | 3300026121 | Ga0207683_10270024 | Ga0207683_102700242 | 240 |
| 577 | 3300026142 | Ga0207698_10014560 | Ga0207698_100145602 | 240 |
| 578 | 3300026142 | Ga0207698_10030407 | Ga0207698_100304074 | 240 |
| 579 | 3300026142 | Ga0207698_10170806 | Ga0207698_101708062 | 240 |
| 580 | 3300026142 | Ga0207698_10246373 | Ga0207698_102463732 | 240 |
| 581 | 3300026142 | Ga0207698_10258001 | Ga0207698_102580012 | 240 |
| 582 | 3300027876 | Ga0209974_10004641 | Ga0209974_100046413 | 240 |
| 583 | 3300028379 | Ga0268266_10001998 | Ga0268266_1000199817 | 240 |
| 584 | 3300028379 | Ga0268266_10002205 | Ga0268266_100022057 | 240 |
| 585 | 3300028379 | Ga0268266_10028925 | Ga0268266_100289254 | 240 |
| 586 | 3300028379 | Ga0268266_10031817 | Ga0268266_100318174 | 240 |
| 587 | 3300028379 | Ga0268266_10042990 | Ga0268266_100429903 | 240 |
| 588 | 3300028379 | Ga0268266_10332689 | Ga0268266_103326892 | 240 |
| 589 | 3300028379 | Ga0268266_10585657 | Ga0268266_105856571 | 240 |
| 590 | 3300028380 | Ga0268265_10005660 | Ga0268265_100056606 | 240 |
| 591 | 3300028380 | Ga0268265_10020971 | Ga0268265_100209713 | 240 |
| 592 | 3300028380 | Ga0268265_10027142 | Ga0268265_100271423 | 240 |
| 593 | 3300028380 | Ga0268265_10087229 | Ga0268265_100872294 | 240 |
| 594 | 3300028380 | Ga0268265_10141668 | Ga0268265_101416683 | 240 |
| 595 | 3300028380 | Ga0268265_11022152 | Ga0268265_110221521 | 240 |
| 596 | 3300028381 | Ga0268264_10000228 | Ga0268264_1000022822 | 240 |
| 597 | 3300028381 | Ga0268264_10014583 | Ga0268264_100145832 | 240 |
| 598 | 3300028381 | Ga0268264_10049833 | Ga0268264_100498332 | 240 |
| 599 | 3300028381 | Ga0268264_10086834 | Ga0268264_100868343 | 240 |
| 600 | 3300028381 | Ga0268264_10115006 | Ga0268264_101150062 | 240 |
| 601 | 3300028794 | Ga0307515_10171424 | Ga0307515_101714242 | 240 |
| 602 | 3300031456 | Ga0307513_10030747 | Ga0307513_100307473 | 240 |
| 603 | 3300031548 | Ga0307408_100076794 | Ga0307408_1000767942 | 240 |
| 604 | 3300031548 | Ga0307408_100081523 | Ga0307408_1000815233 | 240 |
| 605 | 3300031616 | Ga0307508_10124618 | Ga0307508_101246182 | 240 |
| 606 | 3300031730 | Ga0307516_10127761 | Ga0307516_101277611 | 240 |
| 607 | 3300031731 | Ga0307405_10000893 | Ga0307405_1000089313 | 240 |
| 608 | 3300031731 | Ga0307405_10182310 | Ga0307405_101823101 | 240 |
| 609 | 3300031731 | Ga0307405_10333445 | Ga0307405_103334452 | 240 |
| 610 | 3300031824 | Ga0307413_10001276 | Ga0307413_100012763 | 240 |
| 611 | 3300031852 | Ga0307410_10027516 | Ga0307410_100275161 | 240 |
| 612 | 3300031852 | Ga0307410_10634418 | Ga0307410_106344182 | 240 |
| 613 | 3300031901 | Ga0307406_10002193 | Ga0307406_1000219311 | 240 |
| 614 | 3300031901 | Ga0307406_10035254 | Ga0307406_100352544 | 240 |
| 615 | 3300031901 | Ga0307406_10169494 | Ga0307406_101694942 | 240 |
| 616 | 3300031903 | Ga0307407_10096364 | Ga0307407_100963643 | 240 |
| 617 | 3300031911 | Ga0307412_10002006 | Ga0307412_1000200612 | 240 |
| 618 | 3300031911 | Ga0307412_10142298 | Ga0307412_101422981 | 240 |
| 619 | 3300031995 | Ga0307409_100736396 | Ga0307409_1007363961 | 240 |
| 620 | 3300032002 | Ga0307416_100002373 | Ga0307416_10000237310 | 240 |
| 621 | 3300032002 | Ga0307416_100005106 | Ga0307416_1000051064 | 240 |
| 622 | 3300032002 | Ga0307416_100030495 | Ga0307416_1000304952 | 240 |
| 623 | 3300032002 | Ga0307416_100898989 | Ga0307416_1008989891 | 240 |
| 624 | 3300032002 | Ga0307416_101042768 | Ga0307416_1010427682 | 240 |
| 625 | 3300032004 | Ga0307414_10302055 | Ga0307414_103020553 | 240 |
| 626 | 3300032004 | Ga0307414_10398595 | Ga0307414_103985951 | 240 |
| 627 | 3300032004 | Ga0307414_10628947 | Ga0307414_106289472 | 240 |
| 628 | 3300032005 | Ga0307411_10003495 | Ga0307411_100034957 | 240 |
| 629 | 3300032005 | Ga0307411_10020905 | Ga0307411_100209054 | 240 |
| 630 | 3300032126 | Ga0307415_100000632 | Ga0307415_1000006323 | 240 |
| 631 | 3300032126 | Ga0307415_100004323 | Ga0307415_1000043234 | 240 |
| 632 | 3300032126 | Ga0307415_100010882 | Ga0307415_1000108824 | 240 |
| 633 | 3300032126 | Ga0307415_100040164 | Ga0307415_1000401642 | 240 |
| 634 | 3300033180 | Ga0307510_10017255 | Ga0307510_100172551 | 240 |
| 635 | 3300033180 | Ga0307510_10052161 | Ga0307510_100521613 | 240 |
| 636 | 3300033541 | Ga0316596_1045629 | Ga0316596_10456291 | 240 |
| 637 | 3300035090 | Ga0373949_0085340 | Ga0373949_0085340_54_776 | 240 |
| 638 | 3300035170 | Ga0373943_0011702 | Ga0373943_0011702_2706_3428 | 240 |
| 639 | 3300035691 | Ga0373931_0192679 | Ga0373931_0192679_120_842 | 240 |
| 640 | 3300035692 | Ga0373935_0179724 | Ga0373935_0179724_620_1342 | 240 |
| 641 | 3300036401 | Ga0373937_0073957 | Ga0373937_0073957_1908_2630 | 240 |
| 642 | 3300037312 | Ga0395899_0000732 | Ga0395899_0000732_27720_28442 | 240 |
| 643 | 3300037312 | Ga0395899_0003877 | Ga0395899_0003877_8678_9400 | 240 |
| 644 | 3300037312 | Ga0395899_0007496 | Ga0395899_0007496_2319_3041 | 240 |
| 645 | 3300037312 | Ga0395899_0016128 | Ga0395899_0016128_577_1302 | 240 |
| 646 | 3300037312 | Ga0395899_0191075 | Ga0395899_0191075_236_958 | 240 |
| 647 | 3300037312 | Ga0395899_0289365 | Ga0395899_0289365_141_863 | 240 |
| 648 | 3300037418 | Ga0395900_0001059 | Ga0395900_0001059_19162_19884 | 240 |
| 649 | 3300037418 | Ga0395900_0002358 | Ga0395900_0002358_12590_13312 | 240 |
| 650 | 3300037418 | Ga0395900_0011356 | Ga0395900_0011356_3262_3984 | 240 |
| 651 | 3300037418 | Ga0395900_0041612 | Ga0395900_0041612_1580_2302 | 240 |
| 652 | 3300037418 | Ga0395900_0053747 | Ga0395900_0053747_1235_1957 | 240 |
| 653 | 3300037418 | Ga0395900_0064293 | Ga0395900_0064293_1069_1791 | 240 |
| 654 | 3300037418 | Ga0395900_0101520 | Ga0395900_0101520_393_1115 | 240 |
| 655 | 3300037418 | Ga0395900_0121960 | Ga0395900_0121960_623_1345 | 240 |
| 656 | 3300037418 | Ga0395900_0149229 | Ga0395900_0149229_1016_1738 | 240 |
| 657 | 3300037418 | Ga0395900_0215547 | Ga0395900_0215547_1013_1735 | 240 |
| 658 | 3300037418 | Ga0395900_0445874 | Ga0395900_0445874_511_1233 | 240 |
| 659 | 3300037418 | Ga0395900_0607628 | Ga0395900_0607628_150_872 | 240 |
| 660 | 3300037418 | Ga0395900_0741008 | Ga0395900_0741008_49_771 | 240 |
| 661 | 3300037418 | Ga0395900_0785197 | Ga0395900_0785197_108_830 | 240 |
| 662 | 3300037418 | Ga0395900_0795800 | Ga0395900_0795800_70_792 | 240 |
| 663 | 3300037466 | Ga0395898_0009587 | Ga0395898_0009587_6323_7045 | 240 |
| 664 | 3300037466 | Ga0395898_0043547 | Ga0395898_0043547_1927_2649 | 240 |
| 665 | 3300037466 | Ga0395898_0048764 | Ga0395898_0048764_3086_3808 | 240 |
| 666 | 3300037466 | Ga0395898_0063110 | Ga0395898_0063110_2472_3194 | 240 |
| 667 | 3300037466 | Ga0395898_0206310 | Ga0395898_0206310_755_1477 | 240 |
| 668 | 3300037466 | Ga0395898_0299874 | Ga0395898_0299874_736_1458 | 240 |
| 669 | 3300037466 | Ga0395898_0885097 | Ga0395898_0885097_77_799 | 240 |
| 670 | 3300037471 | Ga0395905_0000204 | Ga0395905_0000204_47404_48126 | 240 |
| 671 | 3300037471 | Ga0395905_0002039 | Ga0395905_0002039_4758_5480 | 240 |
| 672 | 3300037471 | Ga0395905_0003861 | Ga0395905_0003861_14206_14928 | 240 |
| 673 | 3300037471 | Ga0395905_0006180 | Ga0395905_0006180_2346_3068 | 240 |
| 674 | 3300037471 | Ga0395905_0016548 | Ga0395905_0016548_4961_5683 | 240 |
| 675 | 3300037471 | Ga0395905_0017736 | Ga0395905_0017736_2585_3307 | 240 |
| 676 | 3300037471 | Ga0395905_0017949 | Ga0395905_0017949_1496_2218 | 240 |
| 677 | 3300037471 | Ga0395905_0035013 | Ga0395905_0035013_2586_3359 | 240 |
| 678 | 3300037471 | Ga0395905_0045026 | Ga0395905_0045026_2312_3034 | 240 |
| 679 | 3300037471 | Ga0395905_0062326 | Ga0395905_0062326_56_778 | 240 |
| 680 | 3300037471 | Ga0395905_0080957 | Ga0395905_0080957_747_1469 | 240 |
| 681 | 3300037471 | Ga0395905_0089884 | Ga0395905_0089884_1987_2709 | 240 |
| 682 | 3300037471 | Ga0395905_0110740 | Ga0395905_0110740_1041_1763 | 240 |
| 683 | 3300037471 | Ga0395905_0124837 | Ga0395905_0124837_1459_2181 | 240 |
| 684 | 3300037471 | Ga0395905_0132906 | Ga0395905_0132906_1190_1912 | 240 |
| 685 | 3300037471 | Ga0395905_0137015 | Ga0395905_0137015_45_767 | 240 |
| 686 | 3300037471 | Ga0395905_0149479 | Ga0395905_0149479_1235_1957 | 240 |
| 687 | 3300037471 | Ga0395905_0153826 | Ga0395905_0153826_250_972 | 240 |
| 688 | 3300037471 | Ga0395905_0304451 | Ga0395905_0304451_66_788 | 240 |
| 689 | 3300037471 | Ga0395905_0354486 | Ga0395905_0354486_598_1320 | 240 |
| 690 | 3300037471 | Ga0395905_0507387 | Ga0395905_0507387_255_977 | 240 |
| 691 | 3300037471 | Ga0395905_0509558 | Ga0395905_0509558_175_900 | 240 |
| 692 | 3300037471 | Ga0395905_0552667 | Ga0395905_0552667_45_767 | 240 |
| 693 | 3300037471 | Ga0395905_0661894 | Ga0395905_0661894_79_801 | 240 |
| 694 | 3300038443 | Ga0395901_0000208 | Ga0395901_0000208_52965_53687 | 240 |
| 695 | 3300038443 | Ga0395901_0013604 | Ga0395901_0013604_5969_6691 | 240 |
| 696 | 3300038443 | Ga0395901_0016571 | Ga0395901_0016571_4798_5520 | 240 |
| 697 | 3300038443 | Ga0395901_0018771 | Ga0395901_0018771_5548_6270 | 240 |
| 698 | 3300038443 | Ga0395901_0031581 | Ga0395901_0031581_3108_3845 | 240 |
| 699 | 3300038443 | Ga0395901_0127530 | Ga0395901_0127530_1913_2635 | 240 |
| 700 | 3300038443 | Ga0395901_0194349 | Ga0395901_0194349_690_1412 | 240 |
| 701 | 3300038443 | Ga0395901_0265419 | Ga0395901_0265419_901_1623 | 240 |
| 702 | 3300038443 | Ga0395901_0628663 | Ga0395901_0628663_89_811 | 240 |
| 703 | 3300039437 | Ga0436365_0033000 | Ga0436365_0033000_1181_1903 | 240 |
| 704 | 3300039447 | Ga0436361_0383568 | Ga0436361_0383568_1761_2483 | 240 |
| 705 | 3300039447 | Ga0436361_0951343 | Ga0436361_0951343_792_1514 | 240 |
| 706 | 3300041406 | Ga0439439_0019853 | Ga0439439_0019853_765_1487 | 240 |
| 707 | 3300041407 | Ga0439447_057541 | Ga0439447_057541_137_859 | 240 |
| 708 | 3300041410 | Ga0439461_0000083 | Ga0439461_0000083_6431_7153 | 240 |
| 709 | 3300041410 | Ga0439461_0011296 | Ga0439461_0011296_34_756 | 240 |
| 710 | 3300041413 | Ga0439465_0001274 | Ga0439465_0001274_5513_6235 | 240 |
| 711 | 3300041413 | Ga0439465_0004929 | Ga0439465_0004929_1509_2231 | 240 |
| 712 | 3300041413 | Ga0439465_0007637 | Ga0439465_0007637_2698_3420 | 240 |
| 713 | 3300041452 | Ga0451793_1551258 | Ga0451793_1551258_72_794 | 240 |
| 714 | 3300041486 | Ga0451807_1694753 | Ga0451807_1694753_1231_1953 | 240 |
| 715 | 3300041997 | Ga0439431_0001511 | Ga0439431_0001511_616_1338 | 240 |
| 716 | 3300042002 | Ga0439442_047808 | Ga0439442_047808_157_879 | 240 |
| 717 | 3300042004 | Ga0439445_0007385 | Ga0439445_0007385_1398_2120 | 240 |
| 718 | 3300042006 | Ga0439432_000391 | Ga0439432_000391_8371_9093 | 240 |
| 719 | 3300042006 | Ga0439432_031899 | Ga0439432_031899_400_1122 | 240 |
| 720 | 3300042007 | Ga0439449_0020647 | Ga0439449_0020647_752_1474 | 240 |
| 721 | 3300042015 | Ga0439462_0000163 | Ga0439462_0000163_4169_4891 | 240 |
| 722 | 3300042142 | Ga0450905_000685 | Ga0450905_000685_2229_2957 | 240 |
| 723 | 3300042144 | Ga0450889_000465 | Ga0450889_000465_3270_3998 | 240 |
| 724 | 3300042156 | Ga0439446_0104539 | Ga0439446_0104539_156_878 | 240 |
| 725 | 3300042157 | Ga0439458_0001726 | Ga0439458_0001726_1898_2620 | 240 |
| 726 | 3300042435 | Ga0439434_0000796 | Ga0439434_0000796_5521_6243 | 240 |
| 727 | 3300042435 | Ga0439434_0001302 | Ga0439434_0001302_5609_6331 | 240 |
| 728 | 3300042439 | Ga0439464_0000541 | Ga0439464_0000541_3380_4102 | 240 |
| 729 | 3300044658 | Ga0466972_0062664 | Ga0466972_0062664_798_1520 | 240 |
| 730 | 3300044684 | Ga0466966_0041833 | Ga0466966_0041833_2052_2774 | 240 |
| 731 | 3300044694 | Ga0466963_0007297 | Ga0466963_0007297_3682_4404 | 240 |
| 732 | 3300044765 | Ga0466970_0041736 | Ga0466970_0041736_507_1229 | 240 |
| 733 | 3300044842 | Ga0466957_0119607 | Ga0466957_0119607_575_1297 | 240 |
| 734 | 3300045049 | Ga0466959_0070232 | Ga0466959_0070232_1350_2072 | 240 |
| 735 | 3300045976 | Ga0466967_0044914 | Ga0466967_0044914_2821_3543 | 240 |
| 736 | 3300046453 | Ga0495627_026097 | Ga0495627_026097_98_820 | 240 |
| 737 | 3300046506 | Ga0495583_0014859 | Ga0495583_0014859_3482_4204 | 240 |
| 738 | 3300046525 | Ga0495663_0050595 | Ga0495663_0050595_41_763 | 240 |
| 739 | 3300046528 | Ga0495642_0027977 | Ga0495642_0027977_437_1159 | 240 |
| 740 | 3300046528 | Ga0495642_0042081 | Ga0495642_0042081_257_979 | 240 |
| 741 | 3300046537 | Ga0495598_0000438 | Ga0495598_0000438_4400_5122 | 240 |
| 742 | 3300046616 | Ga0495668_0011174 | Ga0495668_0011174_3965_4687 | 240 |
| 743 | 3300046616 | Ga0495668_0016910 | Ga0495668_0016910_179_901 | 240 |
| 744 | 3300046616 | Ga0495668_0036933 | Ga0495668_0036933_343_1065 | 240 |
| 745 | 3300046616 | Ga0495668_0072129 | Ga0495668_0072129_609_1331 | 240 |
| 746 | 3300046616 | Ga0495668_0148019 | Ga0495668_0148019_280_1002 | 240 |
| 747 | 3300046660 | Ga0495625_0395067 | Ga0495625_0395067_10_732 | 240 |
| 748 | 3300046665 | Ga0495661_0096729 | Ga0495661_0096729_30_752 | 240 |
| 749 | 3300046684 | Ga0495669_0000090 | Ga0495669_0000090_15019_15741 | 240 |
| 750 | 3300046684 | Ga0495669_0007174 | Ga0495669_0007174_3389_4111 | 240 |
| 751 | 3300046684 | Ga0495669_0027579 | Ga0495669_0027579_580_1302 | 240 |
| 752 | 3300046691 | Ga0495670_0000017 | Ga0495670_0000017_86008_86730 | 240 |
| 753 | 3300046691 | Ga0495670_0009359 | Ga0495670_0009359_2606_3328 | 240 |
| 754 | 3300047318 | Ga0495636_0280375 | Ga0495636_0280375_13_735 | 240 |
| 755 | 3300047445 | Ga0495677_0004345 | Ga0495677_0004345_2911_3633 | 240 |
| 756 | 3300047445 | Ga0495677_0004406 | Ga0495677_0004406_4284_5006 | 240 |
| 757 | 3300047472 | Ga0495686_0187873 | Ga0495686_0187873_362_1084 | 240 |
| 758 | 3300048903 | Ga0496100_0007641 | Ga0496100_0007641_2720_3442 | 240 |
| 759 | 3300048903 | Ga0496100_0007971 | Ga0496100_0007971_4732_5454 | 240 |
| 760 | 3300048903 | Ga0496100_0121979 | Ga0496100_0121979_723_1445 | 240 |
| 761 | 3300048903 | Ga0496100_0160190 | Ga0496100_0160190_848_1570 | 240 |
| 762 | 3300048903 | Ga0496100_0516656 | Ga0496100_0516656_95_820 | 240 |
| 763 | 3300048904 | Ga0496101_0007869 | Ga0496101_0007869_1170_1892 | 240 |
| 764 | 3300048904 | Ga0496101_0018596 | Ga0496101_0018596_3575_4297 | 240 |
| 765 | 3300048904 | Ga0496101_0024027 | Ga0496101_0024027_2344_3066 | 240 |
| 766 | 3300048904 | Ga0496101_0191793 | Ga0496101_0191793_132_854 | 240 |
| 767 | 3300048904 | Ga0496101_0329057 | Ga0496101_0329057_244_1017 | 240 |
| 768 | 3300048904 | Ga0496101_0382310 | Ga0496101_0382310_92_814 | 240 |
| 769 | 3300048905 | Ga0496102_0063484 | Ga0496102_0063484_2267_2989 | 240 |
| 770 | 3300048905 | Ga0496102_0267384 | Ga0496102_0267384_499_1221 | 240 |
| 771 | 3300048906 | Ga0496103_0000289 | Ga0496103_0000289_34231_34953 | 240 |
| 772 | 3300048907 | Ga0496104_0000161 | Ga0496104_0000161_52343_53065 | 240 |
| 773 | 3300048907 | Ga0496104_0000477 | Ga0496104_0000477_27364_28089 | 240 |
| 774 | 3300048908 | Ga0496105_0013787 | Ga0496105_0013787_5646_6368 | 240 |
| 775 | 3300048908 | Ga0496105_0018885 | Ga0496105_0018885_723_1445 | 240 |
| 776 | 3300048908 | Ga0496105_0148677 | Ga0496105_0148677_326_1099 | 240 |
| 777 | 3300048909 | Ga0496106_0019431 | Ga0496106_0019431_1898_2620 | 240 |
| 778 | 3300048909 | Ga0496106_0113325 | Ga0496106_0113325_704_1426 | 240 |
| 779 | 3300048909 | Ga0496106_0155519 | Ga0496106_0155519_164_886 | 240 |
| 780 | 3300048909 | Ga0496106_0336173 | Ga0496106_0336173_85_807 | 240 |
| 781 | 3300048910 | Ga0496107_0008078 | Ga0496107_0008078_4551_5273 | 240 |
| 782 | 3300048910 | Ga0496107_0020708 | Ga0496107_0020708_849_1571 | 240 |
| 783 | 3300048910 | Ga0496107_0038934 | Ga0496107_0038934_2546_3268 | 240 |
| 784 | 3300048910 | Ga0496107_0047833 | Ga0496107_0047833_949_1671 | 240 |
| 785 | 3300048910 | Ga0496107_0099796 | Ga0496107_0099796_1246_1968 | 240 |
| 786 | 3300048910 | Ga0496107_0284903 | Ga0496107_0284903_397_1119 | 240 |
| 787 | 3300048911 | Ga0496108_0000483 | Ga0496108_0000483_3312_4034 | 240 |
| 788 | 3300048911 | Ga0496108_0007321 | Ga0496108_0007321_4558_5280 | 240 |
| 789 | 3300048911 | Ga0496108_0015856 | Ga0496108_0015856_2752_3474 | 240 |
| 790 | 3300048911 | Ga0496108_0088830 | Ga0496108_0088830_1545_2267 | 240 |
| 791 | 3300048911 | Ga0496108_0100530 | Ga0496108_0100530_1224_1946 | 240 |
| 792 | 3300048911 | Ga0496108_0328000 | Ga0496108_0328000_512_1234 | 240 |
| 793 | 3300048912 | Ga0496109_0000765 | Ga0496109_0000765_21617_22339 | 240 |
| 794 | 3300048912 | Ga0496109_0001630 | Ga0496109_0001630_10568_11290 | 240 |
| 795 | 3300048912 | Ga0496109_0006413 | Ga0496109_0006413_6156_6878 | 240 |
| 796 | 3300048912 | Ga0496109_0048037 | Ga0496109_0048037_2377_3150 | 240 |
| 797 | 3300048912 | Ga0496109_0060928 | Ga0496109_0060928_783_1508 | 240 |
| 798 | 3300048912 | Ga0496109_0150138 | Ga0496109_0150138_1435_2157 | 240 |
| 799 | 3300048912 | Ga0496109_0233201 | Ga0496109_0233201_113_835 | 240 |
| 800 | 3300048912 | Ga0496109_0487740 | Ga0496109_0487740_348_1070 | 240 |
| 801 | 3300048912 | Ga0496109_0806290 | Ga0496109_0806290_94_816 | 240 |
| 802 | 3300048913 | Ga0496110_0001524 | Ga0496110_0001524_11423_12145 | 240 |
| 803 | 3300048913 | Ga0496110_0008357 | Ga0496110_0008357_183_956 | 240 |
| 804 | 3300048913 | Ga0496110_0021450 | Ga0496110_0021450_1879_2601 | 240 |
| 805 | 3300048913 | Ga0496110_0027620 | Ga0496110_0027620_1927_2649 | 240 |
| 806 | 3300048914 | Ga0496111_0002167 | Ga0496111_0002167_7172_7894 | 240 |
| 807 | 3300048914 | Ga0496111_0012076 | Ga0496111_0012076_1322_2044 | 240 |
| 808 | 3300048914 | Ga0496111_0133133 | Ga0496111_0133133_276_1049 | 240 |
| 809 | 3300048914 | Ga0496111_0143151 | Ga0496111_0143151_820_1542 | 240 |
| 810 | 3300048914 | Ga0496111_0149052 | Ga0496111_0149052_817_1539 | 240 |
| 811 | 3300048914 | Ga0496111_0163715 | Ga0496111_0163715_511_1233 | 240 |
| 812 | 3300048915 | Ga0496112_0001631 | Ga0496112_0001631_2862_3584 | 240 |
| 813 | 3300048915 | Ga0496112_0024451 | Ga0496112_0024451_4945_5667 | 240 |
| 814 | 3300048915 | Ga0496112_0034069 | Ga0496112_0034069_4041_4763 | 240 |
| 815 | 3300048915 | Ga0496112_0034997 | Ga0496112_0034997_1644_2417 | 240 |
| 816 | 3300048915 | Ga0496112_0104835 | Ga0496112_0104835_2059_2781 | 240 |
| 817 | 3300048915 | Ga0496112_0165479 | Ga0496112_0165479_455_1177 | 240 |
| 818 | 3300048915 | Ga0496112_0172328 | Ga0496112_0172328_805_1527 | 240 |
| 819 | 3300048916 | Ga0496113_0003331 | Ga0496113_0003331_5637_6359 | 240 |
| 820 | 3300048916 | Ga0496113_0011729 | Ga0496113_0011729_2619_3392 | 240 |
| 821 | 3300048916 | Ga0496113_0163528 | Ga0496113_0163528_432_1154 | 240 |
| 822 | 3300048917 | Ga0496114_0000162 | Ga0496114_0000162_8631_9353 | 240 |
| 823 | 3300048917 | Ga0496114_0028375 | Ga0496114_0028375_3070_3792 | 240 |
| 824 | 3300048917 | Ga0496114_0623103 | Ga0496114_0623103_26_751 | 240 |
| 825 | 3300048918 | Ga0496115_0026907 | Ga0496115_0026907_2327_3052 | 240 |
| 826 | 3300048918 | Ga0496115_0041325 | Ga0496115_0041325_1417_2139 | 240 |
| 827 | 3300048920 | Ga0496117_0014969 | Ga0496117_0014969_5874_6596 | 240 |
| 828 | 3300048921 | Ga0496118_0034873 | Ga0496118_0034873_3186_3908 | 240 |
| 829 | 3300048922 | Ga0496119_0000734 | Ga0496119_0000734_5734_6456 | 240 |
| 830 | 3300048923 | Ga0496120_0028258 | Ga0496120_0028258_139_861 | 240 |
| 831 | 3300048924 | Ga0496121_0009641 | Ga0496121_0009641_62_784 | 240 |
| 832 | 3300048924 | Ga0496121_0016344 | Ga0496121_0016344_82_804 | 240 |
| 833 | 3300048925 | Ga0496122_0016591 | Ga0496122_0016591_595_1317 | 240 |
| 834 | 3300048926 | Ga0496123_0006076 | Ga0496123_0006076_6853_7575 | 240 |
| 835 | 3300048927 | Ga0496124_0006526 | Ga0496124_0006526_6302_7024 | 240 |
| 836 | 3300048928 | Ga0496125_0072756 | Ga0496125_0072756_1869_2591 | 240 |
| 837 | 3300048929 | Ga0496126_0000661 | Ga0496126_0000661_14696_15418 | 240 |
| 838 | 3300049569 | Ga0501032_0008370 | Ga0501032_0008370_4023_4745 | 240 |
| 839 | 3300049570 | Ga0501033_0009316 | Ga0501033_0009316_1103_1825 | 240 |
| 840 | 3300049570 | Ga0501033_0166772 | Ga0501033_0166772_806_1528 | 240 |
| 841 | 3300049571 | Ga0501034_0024565 | Ga0501034_0024565_3806_4528 | 240 |
| 842 | 3300049571 | Ga0501034_0211173 | Ga0501034_0211173_906_1628 | 240 |
| 843 | 3300049572 | Ga0501036_0026215 | Ga0501036_0026215_1191_1913 | 240 |
| 844 | 3300049573 | Ga0501037_0019877 | Ga0501037_0019877_1007_1729 | 240 |
| 845 | 3300049573 | Ga0501037_0175535 | Ga0501037_0175535_475_1197 | 240 |
| 846 | 3300049574 | Ga0501038_0014173 | Ga0501038_0014173_2749_3471 | 240 |
| 847 | 3300049575 | Ga0501039_0035822 | Ga0501039_0035822_260_982 | 240 |
| 848 | 3300049575 | Ga0501039_0224852 | Ga0501039_0224852_368_1090 | 240 |
| 849 | 3300049579 | Ga0501043_0061572 | Ga0501043_0061572_1299_2021 | 240 |
| 850 | 3300049579 | Ga0501043_0090184 | Ga0501043_0090184_540_1262 | 240 |
| 851 | 3300049580 | Ga0501046_0004038 | Ga0501046_0004038_2787_3509 | 240 |
| 852 | 3300049581 | Ga0501047_0013850 | Ga0501047_0013850_4554_5276 | 240 |
| 853 | 3300049581 | Ga0501047_0041687 | Ga0501047_0041687_2285_3007 | 240 |
| 854 | 3300049582 | Ga0501048_0004818 | Ga0501048_0004818_4011_4733 | 240 |
| 855 | 3300049582 | Ga0501048_0059226 | Ga0501048_0059226_135_857 | 240 |
| 856 | 3300049583 | Ga0501067_0022576 | Ga0501067_0022576_2733_3455 | 240 |
| 857 | 3300049583 | Ga0501067_0046122 | Ga0501067_0046122_1168_1890 | 240 |
| 858 | 3300049584 | Ga0501068_0002828 | Ga0501068_0002828_7324_8046 | 240 |
| 859 | 3300049584 | Ga0501068_0011189 | Ga0501068_0011189_1491_2213 | 240 |
| 860 | 3300049585 | Ga0501069_0005584 | Ga0501069_0005584_4767_5489 | 240 |
| 861 | 3300049586 | Ga0501070_0011936 | Ga0501070_0011936_1176_1898 | 240 |
| 862 | 3300049586 | Ga0501070_0128619 | Ga0501070_0128619_1069_1791 | 240 |
| 863 | 3300049586 | Ga0501070_0147657 | Ga0501070_0147657_847_1569 | 240 |
| 864 | 3300049589 | Ga0501073_0006565 | Ga0501073_0006565_6753_7475 | 240 |
| 865 | 3300049589 | Ga0501073_0011449 | Ga0501073_0011449_1990_2712 | 240 |
| 866 | 3300049589 | Ga0501073_0017094 | Ga0501073_0017094_1692_2414 | 240 |
| 867 | 3300049589 | Ga0501073_0243637 | Ga0501073_0243637_371_1093 | 240 |
| 868 | 3300049590 | Ga0501074_0027284 | Ga0501074_0027284_910_1632 | 240 |
| 869 | 3300049590 | Ga0501074_0446870 | Ga0501074_0446870_88_810 | 240 |
| 870 | 3300049674 | Ga0501242_020514 | Ga0501242_020514_11_733 | 240 |
| 871 | 3300049677 | Ga0501247_013884 | Ga0501247_013884_130_852 | 240 |
| 872 | 3300049705 | Ga0501225_0005489 | Ga0501225_0005489_2844_3617 | 240 |
| 873 | 3300049741 | Ga0501079_0130445 | Ga0501079_0130445_48_770 | 240 |
| 874 | 3300049742 | Ga0501080_0005541 | Ga0501080_0005541_9253_9975 | 240 |
| 875 | 3300049742 | Ga0501080_0047371 | Ga0501080_0047371_578_1300 | 240 |
| 876 | 3300049742 | Ga0501080_0125486 | Ga0501080_0125486_595_1317 | 240 |
| 877 | 3300049742 | Ga0501080_0660514 | Ga0501080_0660514_66_788 | 240 |
| 878 | 3300049744 | Ga0501083_0003134 | Ga0501083_0003134_6986_7708 | 240 |
| 879 | 3300049744 | Ga0501083_0037678 | Ga0501083_0037678_1879_2601 | 240 |
| 880 | 3300049744 | Ga0501083_0167809 | Ga0501083_0167809_638_1360 | 240 |
| 881 | 3300049822 | Ga0501035_0200080 | Ga0501035_0200080_326_1048 | 240 |
| 882 | 3300049822 | Ga0501035_0377184 | Ga0501035_0377184_229_951 | 240 |
| 883 | 3300049823 | Ga0501044_0018457 | Ga0501044_0018457_2613_3335 | 240 |
| 884 | 3300049823 | Ga0501044_0022969 | Ga0501044_0022969_3806_4528 | 240 |
| 885 | 3300049823 | Ga0501044_0064259 | Ga0501044_0064259_656_1378 | 240 |
| 886 | 3300049823 | Ga0501044_0087644 | Ga0501044_0087644_2119_2841 | 240 |
| 887 | 3300050493 | nmdc:mga0k408_158065_c1 | nmdc:mga0k408_158065_c1_392_1114 | 240 |
| 888 | 3300050511 | nmdc:mga08y16_13971_c1 | nmdc:mga08y16_13971_c1_1062_1790 | 240 |
| 889 | 3300050513 | nmdc:mga0rr50_292575_c1 | nmdc:mga0rr50_292575_c1_373_1095 | 240 |
| 890 | 3300050515 | nmdc:mga0a205_1895_c1 | nmdc:mga0a205_1895_c1_5469_6191 | 240 |
| 891 | 3300053086 | Ga0500578_0023188 | Ga0500578_0023188_28_750 | 240 |
| 892 | 3300053087 | Ga0500643_033993 | Ga0500643_033993_182_904 | 240 |
| 893 | 3300053093 | Ga0500651_0214031 | Ga0500651_0214031_258_980 | 240 |
| 894 | 3300053094 | Ga0500566_0031285 | Ga0500566_0031285_302_1024 | 240 |
| 895 | 3300053096 | Ga0500641_0007151 | Ga0500641_0007151_1328_2050 | 240 |
| 896 | 3300053096 | Ga0500641_0023402 | Ga0500641_0023402_330_1052 | 240 |
| 897 | 3300053119 | Ga0500595_000514 | Ga0500595_000514_18065_18787 | 240 |
| 898 | 3300053119 | Ga0500595_050930 | Ga0500595_050930_534_1256 | 240 |
| 899 | 3300053131 | Ga0500652_137751 | Ga0500652_137751_147_869 | 240 |
| 900 | 3300053134 | Ga0500658_0000049 | Ga0500658_0000049_54005_54727 | 240 |
| 901 | 3300053134 | Ga0500658_0004102 | Ga0500658_0004102_2085_2807 | 240 |
| 902 | 3300053134 | Ga0500658_0017152 | Ga0500658_0017152_1953_2675 | 240 |
| 903 | 3300053140 | Ga0500573_0167193 | Ga0500573_0167193_419_1141 | 240 |
| 904 | 3300053151 | Ga0500604_0002130 | Ga0500604_0002130_2073_2795 | 240 |
| 905 | 3300053151 | Ga0500604_0045917 | Ga0500604_0045917_454_1176 | 240 |
| 906 | 3300053153 | Ga0500616_0002088 | Ga0500616_0002088_7938_8660 | 240 |
| 907 | 3300053731 | Ga0500609_007986 | Ga0500609_007986_101_823 | 240 |
| 908 | 3300053739 | Ga0500587_000297 | Ga0500587_000297_1423_2145 | 240 |
| 909 | 3300060353 | Ga0501082_0012990 | Ga0501082_0012990_3559_4281 | 240 |
| 910 | 3300060353 | Ga0501082_0039019 | Ga0501082_0039019_2162_2884 | 240 |
| 911 | 3300060353 | Ga0501082_0129034 | Ga0501082_0129034_366_1088 | 240 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4kms-assembly1.cif.gz_A-2 | crystal structure of acetoacetyl-coa reductase from rickettsia felis | 0.959 | 1 | 236 |
| 4wk6-assembly1.cif.gz_D | crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg) (g141a) from vibrio cholerae in complex with nadph | 0.9565 | 3 | 240 |
| 4kms-assembly1.cif.gz_B-2 | crystal structure of acetoacetyl-coa reductase from rickettsia felis | 0.9564 | 1 | 236 |
| 4k6c-assembly1.cif.gz_A | x-ray crystal structure of a putative acetoacyl-coa reductase from burkholderia cenocepacia | 0.9542 | 2 | 240 |
| 4n5l-assembly1.cif.gz_A | crystal structure of (r)-3-hydroxybutyryl-coa dehydrogenase from ralstonia eutropha | 0.9495 | 2 | 240 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4kmsB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9564 | 1 | 236 | 3.40.50.720 |
| 4kmsB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9357 | 1 | 236 | 3.40.50.720 |
| af_Q0JDU3_1_168_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9308 | 74 | 239 | 3.40.50.720 |
| 4ni5A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9306 | 2 | 240 | 3.40.50.720 |
| 4rziB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9288 | 3 | 239 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7R8W4L7-F1-model_v4 | 3-oxoacyl-[acyl-carrier-protein] reductase (EC 1.1.1.100) | 0.9676 | 1 | 235 |
GO:0005737
GO:0018454 GO:0042619 |
| AF-A0A526RE03-F1-model_v4 | SDR family NAD(P)-dependent oxidoreductase | 0.9597 | 1 | 174 |
GO:0016491
|
| AF-N0B6H7-F1-model_v4 | Acetoacetyl-CoA reductase | 0.9573 | 1 | 240 |
GO:0005737
GO:0018454 GO:0042619 |
| AF-A0A6A5LF29-F1-model_v4 | deleted | 0.957 | 1 | 227 |
|
| AF-A0A2S6R0W4-F1-model_v4 | Acetoacetyl-CoA reductase (EC 1.1.1.36) | 0.9569 | 1 | 240 |
GO:0005737
GO:0018454 GO:0042619 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar