F485455

General Info

Members Datasets Scaffolds Average Seq Length
911 330 899 239

Family's Representative Sequence

Representative Sequence 3300005355|Ga0070671_100873844|Ga0070671_1008738441
Length 221
Sequence MARVAVVTGGTRGIGEAISMGLKQAGFTVAANYAGNDERAKAFSDRTGIKSYKWDVASFDDCVAGVKKVEGELGPVEVIVNNAGITRDATMKKMNRSAWDEVIDTNLGGCYNIGSINGQAGQYGQVNYAAAKSGIHGFTKALAQEGARSGITVNAIAPGYIDTDMVAAVPADVLTKIVARIPVGRLGQASEIARGVLFLVADEGGFITGSTLSINGGQHMY

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
3 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
4 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
5 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
6 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
7 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
8 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified
9 2896253425 Aurantiacibacter rhizosphaerae GH3-10 Isolate Rhizosphere
10 2896429255 Sphingomonas rhizophila KACC 19189 Isolate Rhizosphere
11 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
12 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
13 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
14 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
15 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
16 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
17 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
18 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
19 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
20 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
21 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
22 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
23 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
24 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
25 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
26 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
27 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
28 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
29 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
30 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
31 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
32 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
33 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
34 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
35 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
36 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
37 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
38 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
39 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
40 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
41 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
42 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
43 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
44 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
45 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
46 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
47 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
48 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
49 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
50 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
51 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
52 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
53 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
54 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
55 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
56 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
57 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
58 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
59 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
60 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
61 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
62 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
63 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
64 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
65 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
66 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
67 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
68 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
69 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
70 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
71 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
72 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
73 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
74 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
75 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
76 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
77 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
78 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
79 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
80 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
81 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
84 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
88 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
100 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
101 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
102 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
103 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
104 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
105 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
106 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
107 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
108 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
109 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
110 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
111 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
112 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
113 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
114 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
115 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
116 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
117 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
119 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
120 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
122 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
123 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
125 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
127 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
128 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
189 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
190 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
191 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
192 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
193 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
194 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
195 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
196 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
197 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
198 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
199 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
200 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
201 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
202 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
203 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
204 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
205 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
206 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
207 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
208 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
209 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
210 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
211 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
212 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
213 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
214 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
215 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
216 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
217 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
218 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
219 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
220 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
221 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
222 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
223 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
224 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
225 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
226 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
227 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
228 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
229 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
230 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
231 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
232 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
233 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
234 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
235 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
236 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
237 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
238 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
239 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
240 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
241 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
242 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
243 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
244 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
245 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
246 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
247 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
248 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
249 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
250 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
251 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
252 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
253 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
254 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
255 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
256 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
257 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
258 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
259 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
260 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
261 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
262 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
263 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
264 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
265 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
266 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
267 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
268 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
269 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
270 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
271 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
272 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
273 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
274 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
275 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
276 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
277 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
278 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
279 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
280 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
281 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
282 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
283 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
284 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
285 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
286 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
287 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
288 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
289 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
291 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
292 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
293 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
295 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
296 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
297 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
298 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
299 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
300 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
301 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
302 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
303 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
304 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
305 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
306 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
307 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
308 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
309 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
310 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
311 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
312 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
313 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
314 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
315 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
316 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
317 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
318 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
319 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
320 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
321 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
322 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
323 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
324 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
325 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
326 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
327 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
328 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
329 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
330 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.46
Metatranscriptomes 0.22
Isolates 1.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.05
Nodule 0
Rhizoplane 8.34
Rhizosphere 83.64
Stem 0
Stem Tuber 0
Unclassified 2.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2264840 2162886007 Bacteria 1458
2 ARcpr5yngRDRAFT_c009745 3300000043 Bacteria 819
3 JGI24740J21852_10073782 3300001979 Bacteria 908
4 JGI24739J22299_10041723 3300001989 Bacteria 1524
5 JGI24737J22298_10006549 3300001990 Bacteria 3971
6 JGI24737J22298_10012841 3300001990 Bacteria 2731
7 JGI25153J46596_10000126 3300003215 Bacteria 83750
8 JGI25153J46596_10060671 3300003215 Bacteria 1029
9 Ga0055537_1003751 3300003773 Bacteria 4578
10 Ga0055524_1000245 3300003775 Bacteria 56692
11 Ga0055530_10000064 3300003791 Bacteria 94475
12 Ga0055531_10000073 3300003794 Bacteria 109510
13 Ga0055531_10047592 3300003794 Bacteria 1165
14 Ga0055531_10054580 3300003794 Bacteria 1023
15 Ga0065165_1006490 3300005262 Bacteria 6115
16 Ga0065165_1010172 3300005262 Bacteria 4105
17 Ga0065712_10126381 3300005290 Bacteria 1602
18 Ga0065712_10359175 3300005290 Bacteria 777
19 Ga0065715_10095621 3300005293 Bacteria 4030
20 Ga0070658_10005417 3300005327 Bacteria 10352
21 Ga0070658_10034829 3300005327 Bacteria 4052
22 Ga0070658_10074198 3300005327 Bacteria 2790
23 Ga0070658_10095591 3300005327 Bacteria 2453
24 Ga0070658_10112829 3300005327 Bacteria 2253
25 Ga0070658_10117618 3300005327 Bacteria 2207
26 Ga0070676_10096112 3300005328 Bacteria 1823
27 Ga0070676_10151734 3300005328 Bacteria 1484
28 Ga0070676_10309565 3300005328 Bacteria 1073
29 Ga0070683_100145988 3300005329 Bacteria 2242
30 Ga0070683_100146607 3300005329 Bacteria 2237
31 Ga0070690_100011596 3300005330 Bacteria 5159
32 Ga0070670_100028508 3300005331 Bacteria 4805
33 Ga0070670_100031460 3300005331 Bacteria 4570
34 Ga0070670_100063761 3300005331 Bacteria 3162
35 Ga0070670_100082914 3300005331 Bacteria 2755
36 Ga0070666_10005242 3300005335 Bacteria 7939
37 Ga0070666_10023613 3300005335 Bacteria 4003
38 Ga0070680_100098143 3300005336 Bacteria 2429
39 Ga0070680_100126515 3300005336 Bacteria 2135
40 Ga0068868_100001315 3300005338 Bacteria 17124
41 Ga0068868_100019311 3300005338 Bacteria 5106
42 Ga0068868_100028424 3300005338 Bacteria 4275
43 Ga0068868_100149061 3300005338 Bacteria 1925
44 Ga0070660_100006409 3300005339 Bacteria 8155
45 Ga0070660_100016068 3300005339 Bacteria 5424
46 Ga0070660_100028804 3300005339 Bacteria 4158
47 Ga0070660_100032953 3300005339 Bacteria 3902
48 Ga0070660_100099383 3300005339 Bacteria 2304
49 Ga0070661_100016193 3300005344 Bacteria 5266
50 Ga0070661_100025904 3300005344 Bacteria 4215
51 Ga0070661_100047542 3300005344 Bacteria 3140
52 Ga0070661_100056067 3300005344 Bacteria 2886
53 Ga0070661_100252837 3300005344 Bacteria 1360
54 Ga0070692_10011905 3300005345 Bacteria 4011
55 Ga0070692_10224532 3300005345 Bacteria 1112
56 Ga0070668_100002681 3300005347 Bacteria 13086
57 Ga0070668_100252404 3300005347 Bacteria 1465
58 Ga0070669_100000068 3300005353 Bacteria 103282
59 Ga0070669_100020982 3300005353 Bacteria 4667
60 Ga0070669_100081289 3300005353 Bacteria 2413
61 Ga0070675_100081613 3300005354 Bacteria 2696
62 Ga0070675_100085366 3300005354 Bacteria 2637
63 Ga0070671_100000777 3300005355 Bacteria 22924
64 Ga0070671_100007788 3300005355 Bacteria 8559
65 Ga0070671_100011151 3300005355 Bacteria 7217
66 Ga0070671_100012348 3300005355 Bacteria 6879
67 Ga0070671_100025045 3300005355 Bacteria 4891
68 Ga0070671_100092282 3300005355 Bacteria 2537
69 Ga0070671_100106591 3300005355 Bacteria 2353
70 Ga0070671_100186709 3300005355 Bacteria 1756
71 Ga0070671_100545605 3300005355 Bacteria 999
72 Ga0070671_100873844 3300005355 Bacteria 785
73 Ga0070674_100020059 3300005356 Bacteria 4261
74 Ga0070674_100159829 3300005356 Bacteria 1709
75 Ga0070674_100264259 3300005356 Bacteria 1357
76 Ga0070673_100026160 3300005364 Bacteria 4306
77 Ga0070673_100059648 3300005364 Bacteria 3021
78 Ga0070673_100063883 3300005364 Bacteria 2931
79 Ga0070673_100168984 3300005364 Bacteria 1865
80 Ga0070673_100197802 3300005364 Bacteria 1730
81 Ga0070688_100166852 3300005365 Bacteria 1516
82 Ga0070659_100002551 3300005366 Bacteria 12957
83 Ga0070659_100010070 3300005366 Bacteria 6961
84 Ga0070659_100020119 3300005366 Bacteria 5067
85 Ga0070659_100029930 3300005366 Bacteria 4210
86 Ga0070659_100042504 3300005366 Bacteria 3553
87 Ga0070659_100059956 3300005366 Bacteria 3005
88 Ga0070659_100068896 3300005366 Bacteria 2808
89 Ga0070659_100194547 3300005366 Bacteria 1668
90 Ga0070659_100309130 3300005366 Bacteria 1320
91 Ga0070667_100000885 3300005367 Bacteria 27676
92 Ga0070667_100006375 3300005367 Bacteria 9805
93 Ga0070667_100010927 3300005367 Bacteria 7511
94 Ga0070667_100018985 3300005367 Bacteria 5700
95 Ga0070667_100048257 3300005367 Bacteria 3583
96 Ga0070667_100113736 3300005367 Bacteria 2349
97 Ga0070667_100217836 3300005367 Bacteria 1698
98 Ga0070667_100334528 3300005367 Bacteria 1369
99 Ga0070667_100363210 3300005367 Bacteria 1313
100 Ga0070714_100092608 3300005435 Bacteria 2649
101 Ga0070714_100575646 3300005435 Bacteria 1080
102 Ga0070713_100310802 3300005436 Bacteria 1453
103 Ga0070694_100009270 3300005444 Bacteria 6040
104 Ga0070663_100000991 3300005455 Bacteria 15463
105 Ga0070663_100036923 3300005455 Bacteria 3397
106 Ga0070663_100061469 3300005455 Bacteria 2705
107 Ga0070663_100066486 3300005455 Bacteria 2612
108 Ga0070663_100093820 3300005455 Bacteria 2227
109 Ga0070663_100132960 3300005455 Bacteria 1891
110 Ga0070663_100156413 3300005455 Bacteria 1752
111 Ga0070678_100023347 3300005456 Bacteria 4120
112 Ga0070678_100111826 3300005456 Bacteria 2138
113 Ga0070678_100175038 3300005456 Bacteria 1751
114 Ga0070678_100318384 3300005456 Bacteria 1328
115 Ga0070662_100006707 3300005457 Bacteria 7438
116 Ga0070662_100027144 3300005457 Bacteria 3971
117 Ga0070662_100167048 3300005457 Bacteria 1725
118 Ga0070662_100215143 3300005457 Bacteria 1531
119 Ga0070681_10259039 3300005458 Bacteria 1651
120 Ga0068867_100002219 3300005459 Bacteria 13628
121 Ga0068867_100121372 3300005459 Bacteria 2020
122 Ga0068867_100126736 3300005459 Bacteria 1979
123 Ga0068867_100170820 3300005459 Bacteria 1722
124 Ga0068867_100428871 3300005459 Bacteria 1122
125 Ga0070685_10474398 3300005466 Bacteria 881
126 Ga0070679_100022822 3300005530 Bacteria 6120
127 Ga0070679_100330461 3300005530 Bacteria 1473
128 Ga0070684_100491043 3300005535 Bacteria 1137
129 Ga0068853_100019988 3300005539 Bacteria 5563
130 Ga0070672_100031263 3300005543 Bacteria 4006
131 Ga0070672_100080366 3300005543 Bacteria 2612
132 Ga0070672_100089713 3300005543 Bacteria 2477
133 Ga0070672_100120228 3300005543 Bacteria 2149
134 Ga0070686_100001063 3300005544 Bacteria 15834
135 Ga0070695_100022680 3300005545 Bacteria 3853
136 Ga0070696_100011198 3300005546 Bacteria 6003
137 Ga0070693_100132503 3300005547 Bacteria 1560
138 Ga0070665_100001845 3300005548 Bacteria 24057
139 Ga0070665_100002264 3300005548 Bacteria 21390
140 Ga0070665_100012623 3300005548 Bacteria 8506
141 Ga0070665_100169147 3300005548 Bacteria 2187
142 Ga0070665_100399278 3300005548 Bacteria 1383
143 Ga0070704_100101393 3300005549 Bacteria 2170
144 Ga0068855_100056364 3300005563 Bacteria 4612
145 Ga0068855_100144320 3300005563 Bacteria 2711
146 Ga0068855_100204060 3300005563 Bacteria 2224
147 Ga0068855_101099922 3300005563 Bacteria 831
148 Ga0070664_100003956 3300005564 Bacteria 11930
149 Ga0070664_100005115 3300005564 Bacteria 10527
150 Ga0070664_100008101 3300005564 Bacteria 8493
151 Ga0070664_100026386 3300005564 Bacteria 4819
152 Ga0070664_100039130 3300005564 Bacteria 3994
153 Ga0070664_100075351 3300005564 Bacteria 2897
154 Ga0070664_100084102 3300005564 Bacteria 2746
155 Ga0070664_100111731 3300005564 Bacteria 2385
156 Ga0070664_100151349 3300005564 Bacteria 2048
157 Ga0070664_100316769 3300005564 Bacteria 1412
158 Ga0068857_100003144 3300005577 Bacteria 13670
159 Ga0068857_100064083 3300005577 Bacteria 3267
160 Ga0068857_100291401 3300005577 Bacteria 1503
161 Ga0068857_100400961 3300005577 Bacteria 1276
162 Ga0068854_100160932 3300005578 Bacteria 1738
163 Ga0068856_100006667 3300005614 Bacteria 11316
164 Ga0068856_100094019 3300005614 Bacteria 2984
165 Ga0068852_100000980 3300005616 Bacteria 18776
166 Ga0068852_100018839 3300005616 Bacteria 5447
167 Ga0068852_100046996 3300005616 Bacteria 3680
168 Ga0068852_100063641 3300005616 Bacteria 3212
169 Ga0068852_100110241 3300005616 Bacteria 2501
170 Ga0068852_100174487 3300005616 Bacteria 2017
171 Ga0068852_100270042 3300005616 Bacteria 1636
172 Ga0068852_100339466 3300005616 Bacteria 1464
173 Ga0068859_100003574 3300005617 Bacteria 15840
174 Ga0068859_100014058 3300005617 Bacteria 8027
175 Ga0068859_100027091 3300005617 Bacteria 5749
176 Ga0068859_100197078 3300005617 Bacteria 2098
177 Ga0068859_100249132 3300005617 Bacteria 1867
178 Ga0068859_100370963 3300005617 Bacteria 1527
179 Ga0068864_100000644 3300005618 Bacteria 29347
180 Ga0068864_100000652 3300005618 Bacteria 28966
181 Ga0068864_100007139 3300005618 Bacteria 9177
182 Ga0068864_100007619 3300005618 Bacteria 8914
183 Ga0068864_100017564 3300005618 Bacteria 5964
184 Ga0068864_100033788 3300005618 Bacteria 4349
185 Ga0068864_100237775 3300005618 Bacteria 1687
186 Ga0068866_10005315 3300005718 Bacteria 5307
187 Ga0068861_100105991 3300005719 Bacteria 2245
188 Ga0068851_10003801 3300005834 Bacteria 6752
189 Ga0068851_10006508 3300005834 Bacteria 5334
190 Ga0068851_10017140 3300005834 Bacteria 3475
191 Ga0068851_10185897 3300005834 Bacteria 1153
192 Ga0068863_100005398 3300005841 Bacteria 12607
193 Ga0068863_100005821 3300005841 Bacteria 12080
194 Ga0068863_100006923 3300005841 Bacteria 11114
195 Ga0068863_100007794 3300005841 Bacteria 10470
196 Ga0068863_100022840 3300005841 Bacteria 5976
197 Ga0068863_100151238 3300005841 Bacteria 2221
198 Ga0068858_100000338 3300005842 Bacteria 49699
199 Ga0068858_100001356 3300005842 Bacteria 25201
200 Ga0068858_100011333 3300005842 Bacteria 8420
201 Ga0068858_100015292 3300005842 Bacteria 7220
202 Ga0068858_100089996 3300005842 Bacteria 2856
203 Ga0068858_100145529 3300005842 Bacteria 2225
204 Ga0068858_100228759 3300005842 Bacteria 1762
205 Ga0068860_100000164 3300005843 Bacteria 108706
206 Ga0068860_100010261 3300005843 Bacteria 9272
207 Ga0068860_100014304 3300005843 Bacteria 7781
208 Ga0068860_100031747 3300005843 Bacteria 5078
209 Ga0068860_100094916 3300005843 Bacteria 2842
210 Ga0068860_100097821 3300005843 Bacteria 2798
211 Ga0068860_100148802 3300005843 Bacteria 2254
212 Ga0068862_100013225 3300005844 Bacteria 6826
213 Ga0068862_100027070 3300005844 Bacteria 4824
214 Ga0068862_100145065 3300005844 Bacteria 2109
215 Ga0068862_100211773 3300005844 Bacteria 1751
216 Ga0068862_100400715 3300005844 Bacteria 1283
217 Ga0068862_100535272 3300005844 Bacteria 1117
218 Ga0075366_10164086 3300006195 Bacteria 1347
219 Ga0097621_100030812 3300006237 Bacteria 4251
220 Ga0097621_100035903 3300006237 Bacteria 3962
221 Ga0097621_100095911 3300006237 Bacteria 2488
222 Ga0097621_100611649 3300006237 Bacteria 997
223 Ga0068871_100046466 3300006358 Bacteria 3497
224 Ga0068871_100051763 3300006358 Bacteria 3324
225 Ga0075428_100243409 3300006844 Bacteria 1940
226 Ga0075433_10025912 3300006852 Bacteria 4959
227 Ga0068865_100014709 3300006881 Bacteria 4979
228 Ga0097620_100003574 3300006931 Bacteria 15840
229 Ga0097620_100014058 3300006931 Bacteria 8027
230 Ga0097620_100027091 3300006931 Bacteria 5749
231 Ga0097620_100197052 3300006931 Bacteria 2098
232 Ga0097620_100249122 3300006931 Bacteria 1867
233 Ga0097620_100370975 3300006931 Bacteria 1527
234 Ga0075435_100368170 3300007076 Bacteria 1233
235 Ga0105251_10066085 3300009011 Bacteria 1691
236 Ga0105251_10085531 3300009011 Bacteria 1453
237 Ga0105240_10233002 3300009093 Bacteria 2139
238 Ga0105240_10289998 3300009093 Bacteria 1876
239 Ga0111539_10017289 3300009094 Bacteria 8926
240 Ga0105245_10020016 3300009098 Bacteria 5866
241 Ga0105245_10020409 3300009098 Bacteria 5811
242 Ga0105243_10121505 3300009148 Bacteria 2203
243 Ga0105243_10369708 3300009148 Bacteria 1322
244 Ga0105241_10050172 3300009174 Bacteria 3180
245 Ga0105242_10002830 3300009176 Bacteria 13594
246 Ga0105242_10204338 3300009176 Bacteria 1756
247 Ga0105248_10000898 3300009177 Bacteria 33299
248 Ga0105248_10001310 3300009177 Bacteria 27712
249 Ga0105248_10005770 3300009177 Bacteria 13602
250 Ga0105248_10006692 3300009177 Bacteria 12643
251 Ga0105248_10007974 3300009177 Bacteria 11638
252 Ga0105248_10008536 3300009177 Bacteria 11247
253 Ga0105248_10009978 3300009177 Bacteria 10454
254 Ga0105248_10012217 3300009177 Bacteria 9469
255 Ga0105248_10060856 3300009177 Bacteria 4239
256 Ga0105248_10080506 3300009177 Bacteria 3661
257 Ga0105248_10271396 3300009177 Bacteria 1910
258 Ga0105237_10030373 3300009545 Bacteria 5489
259 Ga0105237_10154785 3300009545 Bacteria 2289
260 Ga0105237_10158213 3300009545 Bacteria 2263
261 Ga0105238_10051207 3300009551 Bacteria 4154
262 Ga0105238_10318030 3300009551 Bacteria 1542
263 Ga0105249_10066447 3300009553 Bacteria 3320
264 Ga0105249_10139116 3300009553 Bacteria 2326
265 Ga0105249_10169322 3300009553 Bacteria 2117
266 Ga0105249_10390789 3300009553 Bacteria 1419
267 Ga0105249_10663919 3300009553 Bacteria 1101
268 Ga0105246_10050934 3300011119 Bacteria 2842
269 Ga0105246_10100023 3300011119 Bacteria 2109
270 Ga0157373_10096111 3300013100 Bacteria 2086
271 Ga0157373_10178975 3300013100 Bacteria 1493
272 Ga0157373_10187832 3300013100 Bacteria 1456
273 Ga0157373_10219312 3300013100 Bacteria 1342
274 Ga0157371_10017846 3300013102 Bacteria 5261
275 Ga0157371_10077134 3300013102 Bacteria 2360
276 Ga0157370_10716494 3300013104 Bacteria 913
277 Ga0157369_10035624 3300013105 Bacteria 5455
278 Ga0157369_10426685 3300013105 Bacteria 1374
279 Ga0157378_10030245 3300013297 Bacteria 4785
280 Ga0157378_10094676 3300013297 Bacteria 2720
281 Ga0157378_10144132 3300013297 Bacteria 2214
282 Ga0157378_10426477 3300013297 Bacteria 1312
283 Ga0163162_10006162 3300013306 Bacteria 11614
284 Ga0163162_10006556 3300013306 Bacteria 11277
285 Ga0163162_10063486 3300013306 Bacteria 3736
286 Ga0163162_10136868 3300013306 Bacteria 2560
287 Ga0163162_10358151 3300013306 Bacteria 1592
288 Ga0157372_10360175 3300013307 Bacteria 1695
289 Ga0157375_10157881 3300013308 Bacteria 2408
290 Ga0157375_10338185 3300013308 Bacteria 1671
291 Ga0163163_10003408 3300014325 Bacteria 13504
292 Ga0163163_10009604 3300014325 Bacteria 8645
293 Ga0163163_10032541 3300014325 Bacteria 5036
294 Ga0157380_10000643 3300014326 Bacteria 21584
295 Ga0182008_10015626 3300014497 Bacteria 3957
296 Ga0182008_10251015 3300014497 Bacteria 912
297 Ga0157377_10057529 3300014745 Bacteria 2211
298 Ga0157379_10002639 3300014968 Bacteria 15087
299 Ga0157379_10159058 3300014968 Bacteria 2039
300 Ga0157379_10178292 3300014968 Bacteria 1919
301 Ga0157379_10728826 3300014968 Bacteria 932
302 Ga0157376_10306495 3300014969 Bacteria 1505
303 Ga0183363_1003 3300015690 Bacteria 421263
304 Ga0183361_11167 3300016635 Bacteria 1321
305 Ga0163161_10003908 3300017792 Bacteria 10452
306 Ga0206353_10503123 3300020082 Bacteria 3634
307 Ga0213876_10087211 3300021384 Bacteria 1652
308 Ga0209565_1000007 3300025263 Bacteria 784361
309 Ga0207666_1012494 3300025271 Bacteria 1184
310 Ga0209673_1001016 3300025273 Bacteria 33837
311 Ga0209675_1007707 3300025291 Bacteria 4076
312 Ga0209676_1016060 3300025292 Bacteria 2724
313 Ga0209758_1000005 3300025297 Bacteria 1368918
314 Ga0209758_1011190 3300025297 Bacteria 5235
315 Ga0209050_1000010 3300025298 Bacteria 980454
316 Ga0209050_1003636 3300025298 Bacteria 11148
317 Ga0209050_1005965 3300025298 Bacteria 7405
318 Ga0209256_1000008 3300025299 Bacteria 975723
319 Ga0207426_1051382 3300025302 Bacteria 1225
320 Ga0207426_1078811 3300025302 Bacteria 898
321 Ga0209257_1000027 3300025304 Bacteria 703541
322 Ga0209257_1002411 3300025304 Bacteria 18682
323 Ga0207697_10017346 3300025315 Bacteria 2959
324 Ga0207656_10002269 3300025321 Bacteria 6444
325 Ga0207656_10023356 3300025321 Bacteria 2489
326 Ga0207656_10096395 3300025321 Bacteria 1350
327 Ga0207656_10144858 3300025321 Bacteria 1122
328 Ga0207696_1027164 3300025711 Bacteria 1766
329 Ga0207713_1009812 3300025735 Bacteria 5361
330 Ga0207642_10198768 3300025899 Bacteria 1106
331 Ga0207688_10187812 3300025901 Bacteria 1235
332 Ga0207688_10244265 3300025901 Bacteria 1086
333 Ga0207680_10007920 3300025903 Bacteria 5194
334 Ga0207680_10011483 3300025903 Bacteria 4478
335 Ga0207680_10031782 3300025903 Bacteria 2994
336 Ga0207680_10058812 3300025903 Bacteria 2332
337 Ga0207680_10063454 3300025903 Bacteria 2261
338 Ga0207680_10089118 3300025903 Bacteria 1958
339 Ga0207680_10134194 3300025903 Bacteria 1634
340 Ga0207680_10240723 3300025903 Bacteria 1247
341 Ga0207647_10009717 3300025904 Bacteria 6824
342 Ga0207647_10017962 3300025904 Bacteria 4795
343 Ga0207647_10056670 3300025904 Bacteria 2404
344 Ga0207645_10011561 3300025907 Bacteria 6020
345 Ga0207645_10019534 3300025907 Bacteria 4441
346 Ga0207645_10109864 3300025907 Bacteria 1784
347 Ga0207645_10289255 3300025907 Bacteria 1089
348 Ga0207705_10003338 3300025909 Bacteria 12195
349 Ga0207705_10004852 3300025909 Bacteria 10104
350 Ga0207705_10013059 3300025909 Bacteria 5993
351 Ga0207705_10026948 3300025909 Bacteria 4096
352 Ga0207705_10041563 3300025909 Bacteria 3298
353 Ga0207705_10044100 3300025909 Bacteria 3205
354 Ga0207705_10046994 3300025909 Bacteria 3103
355 Ga0207705_10056628 3300025909 Bacteria 2827
356 Ga0207705_10204275 3300025909 Bacteria 1497
357 Ga0207707_10052080 3300025912 Bacteria 3565
358 Ga0207707_10079159 3300025912 Bacteria 2870
359 Ga0207695_10248961 3300025913 Bacteria 1677
360 Ga0207660_10013623 3300025917 Bacteria 5332
361 Ga0207662_10097390 3300025918 Bacteria 1818
362 Ga0207662_10124265 3300025918 Bacteria 1621
363 Ga0207657_10000868 3300025919 Bacteria 31880
364 Ga0207657_10002240 3300025919 Bacteria 20961
365 Ga0207657_10005291 3300025919 Bacteria 13520
366 Ga0207657_10005364 3300025919 Bacteria 13428
367 Ga0207657_10020284 3300025919 Bacteria 6286
368 Ga0207657_10058947 3300025919 Bacteria 3302
369 Ga0207657_10079808 3300025919 Bacteria 2752
370 Ga0207657_10098369 3300025919 Bacteria 2432
371 Ga0207657_10103969 3300025919 Bacteria 2353
372 Ga0207657_10243484 3300025919 Bacteria 1435
373 Ga0207657_10318709 3300025919 Bacteria 1230
374 Ga0207657_10525901 3300025919 Bacteria 925
375 Ga0207649_10016567 3300025920 Bacteria 4160
376 Ga0207649_10033073 3300025920 Bacteria 3087
377 Ga0207649_10069766 3300025920 Bacteria 2239
378 Ga0207649_10101659 3300025920 Bacteria 1904
379 Ga0207649_10466915 3300025920 Bacteria 955
380 Ga0207652_10079371 3300025921 Bacteria 2867
381 Ga0207652_10112659 3300025921 Bacteria 2414
382 Ga0207681_10000105 3300025923 Bacteria 71882
383 Ga0207681_10014001 3300025923 Bacteria 4972
384 Ga0207681_10077610 3300025923 Bacteria 2335
385 Ga0207681_10193397 3300025923 Bacteria 1558
386 Ga0207694_10181617 3300025924 Bacteria 1706
387 Ga0207650_10066169 3300025925 Bacteria 2709
388 Ga0207650_10319640 3300025925 Bacteria 1271
389 Ga0207650_10424245 3300025925 Bacteria 1104
390 Ga0207650_10574367 3300025925 Bacteria 946
391 Ga0207650_10637631 3300025925 Bacteria 898
392 Ga0207659_10056059 3300025926 Bacteria 2821
393 Ga0207659_10115655 3300025926 Bacteria 2046
394 Ga0207659_10230510 3300025926 Bacteria 1493
395 Ga0207659_10331747 3300025926 Bacteria 1258
396 Ga0207687_10021349 3300025927 Bacteria 4301
397 Ga0207687_10517732 3300025927 Bacteria 997
398 Ga0207664_10044911 3300025929 Bacteria 3462
399 Ga0207664_10690286 3300025929 Bacteria 918
400 Ga0207644_10000248 3300025931 Bacteria 36674
401 Ga0207644_10001119 3300025931 Bacteria 17213
402 Ga0207644_10001155 3300025931 Bacteria 16926
403 Ga0207644_10008128 3300025931 Bacteria 6873
404 Ga0207644_10013273 3300025931 Bacteria 5490
405 Ga0207644_10019152 3300025931 Bacteria 4640
406 Ga0207644_10052209 3300025931 Bacteria 2937
407 Ga0207644_10053199 3300025931 Bacteria 2913
408 Ga0207644_10086645 3300025931 Bacteria 2326
409 Ga0207644_10810488 3300025931 Bacteria 783
410 Ga0207690_10007784 3300025932 Bacteria 6359
411 Ga0207690_10024336 3300025932 Bacteria 3792
412 Ga0207690_10026180 3300025932 Bacteria 3671
413 Ga0207690_10085900 3300025932 Bacteria 2210
414 Ga0207690_10103557 3300025932 Bacteria 2037
415 Ga0207690_10128617 3300025932 Bacteria 1850
416 Ga0207690_10138886 3300025932 Bacteria 1788
417 Ga0207690_10419996 3300025932 Bacteria 1070
418 Ga0207706_10005564 3300025933 Bacteria 11747
419 Ga0207706_10005806 3300025933 Bacteria 11480
420 Ga0207706_10021528 3300025933 Bacteria 5788
421 Ga0207706_10025644 3300025933 Bacteria 5281
422 Ga0207706_10033942 3300025933 Bacteria 4542
423 Ga0207706_10064793 3300025933 Bacteria 3218
424 Ga0207706_10068398 3300025933 Bacteria 3125
425 Ga0207706_10367177 3300025933 Bacteria 1250
426 Ga0207706_10408131 3300025933 Bacteria 1177
427 Ga0207706_10582101 3300025933 Bacteria 962
428 Ga0207686_10188864 3300025934 Bacteria 1467
429 Ga0207709_10064525 3300025935 Bacteria 2300
430 Ga0207709_10260833 3300025935 Bacteria 1271
431 Ga0207709_10410454 3300025935 Bacteria 1038
432 Ga0207670_10152786 3300025936 Bacteria 1715
433 Ga0207669_10022729 3300025937 Bacteria 3336
434 Ga0207669_10109607 3300025937 Bacteria 1847
435 Ga0207669_10218881 3300025937 Bacteria 1396
436 Ga0207669_10259771 3300025937 Bacteria 1298
437 Ga0207704_10006416 3300025938 Bacteria 5486
438 Ga0207704_10621036 3300025938 Bacteria 887
439 Ga0207691_10001810 3300025940 Bacteria 20910
440 Ga0207691_10044375 3300025940 Bacteria 4093
441 Ga0207691_10058755 3300025940 Bacteria 3497
442 Ga0207691_10063146 3300025940 Bacteria 3360
443 Ga0207691_10065315 3300025940 Bacteria 3294
444 Ga0207691_10104915 3300025940 Bacteria 2518
445 Ga0207711_10000724 3300025941 Bacteria 32484
446 Ga0207711_10000748 3300025941 Bacteria 31824
447 Ga0207711_10001383 3300025941 Bacteria 22840
448 Ga0207711_10001795 3300025941 Bacteria 19646
449 Ga0207711_10003381 3300025941 Bacteria 13827
450 Ga0207711_10003474 3300025941 Bacteria 13639
451 Ga0207711_10004333 3300025941 Bacteria 12119
452 Ga0207711_10005686 3300025941 Bacteria 10530
453 Ga0207711_10007344 3300025941 Bacteria 9225
454 Ga0207711_10019139 3300025941 Bacteria 5698
455 Ga0207711_10022062 3300025941 Bacteria 5321
456 Ga0207711_10027834 3300025941 Bacteria 4751
457 Ga0207711_10096422 3300025941 Bacteria 2610
458 Ga0207711_10165843 3300025941 Bacteria 2002
459 Ga0207689_10008558 3300025942 Bacteria 8918
460 Ga0207689_10162968 3300025942 Bacteria 1837
461 Ga0207661_10116626 3300025944 Bacteria 2267
462 Ga0207661_10177565 3300025944 Bacteria 1858
463 Ga0207679_10005861 3300025945 Bacteria 7716
464 Ga0207679_10006949 3300025945 Bacteria 7171
465 Ga0207679_10013276 3300025945 Bacteria 5399
466 Ga0207679_10043087 3300025945 Bacteria 3247
467 Ga0207679_10111111 3300025945 Bacteria 2163
468 Ga0207679_10152578 3300025945 Bacteria 1882
469 Ga0207679_10336950 3300025945 Bacteria 1311
470 Ga0207667_10352161 3300025949 Bacteria 1502
471 Ga0207667_10460739 3300025949 Bacteria 1291
472 Ga0207667_10885579 3300025949 Bacteria 885
473 Ga0207667_10906184 3300025949 Bacteria 873
474 Ga0207651_10002259 3300025960 Bacteria 9149
475 Ga0207651_10016439 3300025960 Bacteria 4334
476 Ga0207651_10048109 3300025960 Bacteria 2880
477 Ga0207651_10434334 3300025960 Bacteria 1123
478 Ga0207712_10000629 3300025961 Bacteria 27931
479 Ga0207712_10038449 3300025961 Bacteria 3273
480 Ga0207712_10274154 3300025961 Bacteria 1374
481 Ga0207668_10012745 3300025972 Bacteria 5155
482 Ga0207640_10026004 3300025981 Bacteria 3550
483 Ga0207658_10000205 3300025986 Bacteria 61647
484 Ga0207658_10000359 3300025986 Bacteria 44920
485 Ga0207658_10009870 3300025986 Bacteria 6486
486 Ga0207658_10031774 3300025986 Bacteria 3752
487 Ga0207658_10588678 3300025986 Bacteria 998
488 Ga0207658_10605136 3300025986 Bacteria 985
489 Ga0207677_10003777 3300026023 Bacteria 8043
490 Ga0207677_10014749 3300026023 Bacteria 4575
491 Ga0207677_10644426 3300026023 Bacteria 934
492 Ga0207703_10000376 3300026035 Bacteria 47694
493 Ga0207703_10001763 3300026035 Bacteria 19334
494 Ga0207703_10012799 3300026035 Bacteria 6541
495 Ga0207703_10024235 3300026035 Bacteria 4774
496 Ga0207703_10027234 3300026035 Bacteria 4500
497 Ga0207703_10035362 3300026035 Bacteria 3970
498 Ga0207703_10039232 3300026035 Bacteria 3784
499 Ga0207639_10046376 3300026041 Bacteria 3279
500 Ga0207639_10111731 3300026041 Bacteria 2228
501 Ga0207639_10127158 3300026041 Bacteria 2104
502 Ga0207678_10000681 3300026067 Bacteria 31104
503 Ga0207678_10009708 3300026067 Bacteria 8463
504 Ga0207678_10011552 3300026067 Bacteria 7758
505 Ga0207678_10012349 3300026067 Bacteria 7498
506 Ga0207678_10056631 3300026067 Bacteria 3374
507 Ga0207678_10222164 3300026067 Bacteria 1617
508 Ga0207678_10289967 3300026067 Bacteria 1405
509 Ga0207678_10330988 3300026067 Bacteria 1311
510 Ga0207708_10506153 3300026075 Bacteria 1013
511 Ga0207702_10014863 3300026078 Bacteria 6458
512 Ga0207702_10190577 3300026078 Bacteria 1894
513 Ga0207702_10352715 3300026078 Bacteria 1408
514 Ga0207702_10454515 3300026078 Bacteria 1243
515 Ga0207641_10000817 3300026088 Bacteria 33157
516 Ga0207641_10003247 3300026088 Bacteria 14507
517 Ga0207641_10008362 3300026088 Bacteria 8551
518 Ga0207641_10030667 3300026088 Bacteria 4454
519 Ga0207641_10172641 3300026088 Bacteria 1974
520 Ga0207641_10189532 3300026088 Bacteria 1889
521 Ga0207648_10001389 3300026089 Bacteria 26669
522 Ga0207648_10011967 3300026089 Bacteria 8146
523 Ga0207648_10076108 3300026089 Bacteria 2925
524 Ga0207648_10109533 3300026089 Bacteria 2424
525 Ga0207676_10003927 3300026095 Bacteria 10496
526 Ga0207676_10004037 3300026095 Bacteria 10348
527 Ga0207676_10019732 3300026095 Bacteria 4923
528 Ga0207676_10030560 3300026095 Bacteria 4044
529 Ga0207676_10034399 3300026095 Bacteria 3836
530 Ga0207676_10050766 3300026095 Bacteria 3235
531 Ga0207674_10002210 3300026116 Bacteria 24650
532 Ga0207674_10023115 3300026116 Bacteria 6667
533 Ga0207674_10328720 3300026116 Bacteria 1478
534 Ga0207674_10375265 3300026116 Bacteria 1375
535 Ga0207674_10961871 3300026116 Bacteria 823
536 Ga0207675_100000568 3300026118 Bacteria 36188
537 Ga0207675_100162641 3300026118 Bacteria 2130
538 Ga0207675_100436963 3300026118 Bacteria 1295
539 Ga0207675_100851292 3300026118 Bacteria 927
540 Ga0207683_10001782 3300026121 Bacteria 19055
541 Ga0207683_10005777 3300026121 Bacteria 10604
542 Ga0207683_10123307 3300026121 Bacteria 2328
543 Ga0207683_10270024 3300026121 Bacteria 1554
544 Ga0207698_10014560 3300026142 Bacteria 5234
545 Ga0207698_10030407 3300026142 Bacteria 3883
546 Ga0207698_10170806 3300026142 Bacteria 1914
547 Ga0207698_10246373 3300026142 Bacteria 1632
548 Ga0207698_10258001 3300026142 Bacteria 1600
549 Ga0209974_10004641 3300027876 Bacteria 4884
550 Ga0268266_10001998 3300028379 Bacteria 22799
551 Ga0268266_10002205 3300028379 Bacteria 21315
552 Ga0268266_10028925 3300028379 Bacteria 4709
553 Ga0268266_10031817 3300028379 Bacteria 4482
554 Ga0268266_10042990 3300028379 Bacteria 3860
555 Ga0268266_10332689 3300028379 Bacteria 1424
556 Ga0268266_10585657 3300028379 Bacteria 1071
557 Ga0268265_10005660 3300028380 Bacteria 8536
558 Ga0268265_10010923 3300028380 Bacteria 6131
559 Ga0268265_10020971 3300028380 Bacteria 4568
560 Ga0268265_10027142 3300028380 Bacteria 4083
561 Ga0268265_10087229 3300028380 Bacteria 2482
562 Ga0268265_10125825 3300028380 Bacteria 2120
563 Ga0268265_10141668 3300028380 Bacteria 2013
564 Ga0268265_11022152 3300028380 Bacteria 817
565 Ga0268264_10000228 3300028381 Bacteria 108722
566 Ga0268264_10014583 3300028381 Bacteria 6455
567 Ga0268264_10049833 3300028381 Bacteria 3486
568 Ga0268264_10086834 3300028381 Bacteria 2689
569 Ga0268264_10115006 3300028381 Bacteria 2363
570 Ga0307515_10171424 3300028794 Bacteria 2161
571 Ga0307513_10030747 3300031456 Bacteria 6096
572 Ga0307408_100076794 3300031548 Bacteria 2486
573 Ga0307408_100081523 3300031548 Bacteria 2419
574 Ga0307508_10124618 3300031616 Bacteria 2179
575 Ga0307516_10127761 3300031730 Bacteria 2325
576 Ga0307405_10000893 3300031731 Bacteria 11834
577 Ga0307405_10182310 3300031731 Bacteria 1509
578 Ga0307405_10333445 3300031731 Bacteria 1163
579 Ga0307413_10001276 3300031824 Bacteria 9393
580 Ga0307410_10027516 3300031852 Bacteria 3594
581 Ga0307410_10634418 3300031852 Bacteria 894
582 Ga0307406_10002193 3300031901 Bacteria 10634
583 Ga0307406_10035254 3300031901 Bacteria 3076
584 Ga0307406_10169494 3300031901 Bacteria 1578
585 Ga0307407_10096364 3300031903 Bacteria 1826
586 Ga0307412_10002006 3300031911 Bacteria 11290
587 Ga0307412_10142298 3300031911 Bacteria 1758
588 Ga0307409_100736396 3300031995 Bacteria 988
589 Ga0307416_100002373 3300032002 Bacteria 10776
590 Ga0307416_100005106 3300032002 Bacteria 8012
591 Ga0307416_100030495 3300032002 Bacteria 4047
592 Ga0307416_100898989 3300032002 Bacteria 985
593 Ga0307416_101042768 3300032002 Bacteria 921
594 Ga0307414_10296222 3300032004 Bacteria 1366
595 Ga0307414_10302055 3300032004 Bacteria 1354
596 Ga0307414_10398595 3300032004 Bacteria 1194
597 Ga0307414_10628947 3300032004 Bacteria 965
598 Ga0307411_10003495 3300032005 Bacteria 7299
599 Ga0307411_10020905 3300032005 Bacteria 3818
600 Ga0307415_100000632 3300032126 Bacteria 15442
601 Ga0307415_100004323 3300032126 Bacteria 7355
602 Ga0307415_100010882 3300032126 Bacteria 5174
603 Ga0307415_100040164 3300032126 Bacteria 3098
604 Ga0307510_10017255 3300033180 Bacteria 8518
605 Ga0307510_10052161 3300033180 Bacteria 4317
606 Ga0316596_1045629 3300033541 Bacteria 1156
607 Ga0373940_0040249 3300035088 Bacteria 1282
608 Ga0373949_0085340 3300035090 Bacteria 847
609 Ga0373952_0082453 3300035092 Bacteria 823
610 Ga0373943_0011702 3300035170 Bacteria 3949
611 Ga0373931_0192679 3300035691 Bacteria 1214
612 Ga0373935_0179724 3300035692 Bacteria 1452
613 Ga0373937_0073957 3300036401 Bacteria 3144
614 Ga0395899_0000732 3300037312 Bacteria 32768
615 Ga0395899_0003877 3300037312 Bacteria 11787
616 Ga0395899_0007496 3300037312 Bacteria 8428
617 Ga0395899_0016128 3300037312 Bacteria 5696
618 Ga0395899_0191075 3300037312 Bacteria 1433
619 Ga0395899_0193432 3300037312 Bacteria 1422
620 Ga0395899_0289365 3300037312 Bacteria 1112
621 Ga0395900_0001059 3300037418 Bacteria 35203
622 Ga0395900_0002358 3300037418 Bacteria 20904
623 Ga0395900_0011356 3300037418 Bacteria 9111
624 Ga0395900_0041612 3300037418 Bacteria 4736
625 Ga0395900_0053747 3300037418 Bacteria 4145
626 Ga0395900_0064293 3300037418 Bacteria 3771
627 Ga0395900_0101520 3300037418 Bacteria 2955
628 Ga0395900_0121960 3300037418 Bacteria 2674
629 Ga0395900_0149229 3300037418 Bacteria 2389
630 Ga0395900_0215547 3300037418 Bacteria 1937
631 Ga0395900_0445874 3300037418 Bacteria 1251
632 Ga0395900_0607628 3300037418 Bacteria 1033
633 Ga0395900_0741008 3300037418 Bacteria 913
634 Ga0395900_0785197 3300037418 Bacteria 881
635 Ga0395900_0795800 3300037418 Bacteria 874
636 Ga0395898_0009587 3300037466 Bacteria 10169
637 Ga0395898_0043547 3300037466 Bacteria 4422
638 Ga0395898_0048764 3300037466 Bacteria 4152
639 Ga0395898_0063110 3300037466 Bacteria 3596
640 Ga0395898_0206310 3300037466 Bacteria 1875
641 Ga0395898_0299874 3300037466 Bacteria 1533
642 Ga0395898_0885097 3300037466 Bacteria 831
643 Ga0395905_0000204 3300037471 Bacteria 92152
644 Ga0395905_0002039 3300037471 Bacteria 23073
645 Ga0395905_0003861 3300037471 Bacteria 15809
646 Ga0395905_0006180 3300037471 Bacteria 12086
647 Ga0395905_0016548 3300037471 Bacteria 7010
648 Ga0395905_0017736 3300037471 Bacteria 6759
649 Ga0395905_0017949 3300037471 Bacteria 6719
650 Ga0395905_0035013 3300037471 Bacteria 4714
651 Ga0395905_0045026 3300037471 Bacteria 4139
652 Ga0395905_0062326 3300037471 Bacteria 3488
653 Ga0395905_0080957 3300037471 Bacteria 3043
654 Ga0395905_0089884 3300037471 Bacteria 2878
655 Ga0395905_0110740 3300037471 Bacteria 2578
656 Ga0395905_0124837 3300037471 Bacteria 2420
657 Ga0395905_0132906 3300037471 Bacteria 2340
658 Ga0395905_0137015 3300037471 Bacteria 2303
659 Ga0395905_0149479 3300037471 Bacteria 2197
660 Ga0395905_0153826 3300037471 Bacteria 2163
661 Ga0395905_0304451 3300037471 Bacteria 1481
662 Ga0395905_0354486 3300037471 Bacteria 1359
663 Ga0395905_0507387 3300037471 Bacteria 1106
664 Ga0395905_0509558 3300037471 Bacteria 1103
665 Ga0395905_0552667 3300037471 Bacteria 1052
666 Ga0395905_0661894 3300037471 Bacteria 946
667 Ga0395901_0000208 3300038443 Bacteria 73874
668 Ga0395901_0013604 3300038443 Bacteria 8273
669 Ga0395901_0016571 3300038443 Bacteria 7510
670 Ga0395901_0018771 3300038443 Bacteria 7065
671 Ga0395901_0031581 3300038443 Bacteria 5460
672 Ga0395901_0127530 3300038443 Bacteria 2674
673 Ga0395901_0194349 3300038443 Bacteria 2128
674 Ga0395901_0265419 3300038443 Bacteria 1786
675 Ga0395901_0395067 3300038443 Bacteria 1421
676 Ga0395901_0628663 3300038443 Bacteria 1079
677 Ga0436365_0033000 3300039437 Bacteria 3591
678 Ga0436361_0383568 3300039447 Bacteria 4247
679 Ga0436361_0951343 3300039447 Bacteria 5426
680 Ga0439439_0019853 3300041406 Bacteria 1669
681 Ga0439447_057541 3300041407 Bacteria 919
682 Ga0439461_0000083 3300041410 Bacteria 12407
683 Ga0439461_0011296 3300041410 Bacteria 1654
684 Ga0439465_0001274 3300041413 Bacteria 8105
685 Ga0439465_0004929 3300041413 Bacteria 4289
686 Ga0439465_0007637 3300041413 Bacteria 3430
687 Ga0451793_1551258 3300041452 Bacteria 833
688 Ga0451807_1694753 3300041486 Bacteria 2644
689 Ga0439431_0001511 3300041997 Bacteria 5135
690 Ga0439442_047808 3300042002 Bacteria 901
691 Ga0439445_0007385 3300042004 Bacteria 2548
692 Ga0439432_000391 3300042006 Bacteria 16191
693 Ga0439432_031899 3300042006 Bacteria 1702
694 Ga0439449_0020647 3300042007 Bacteria 2468
695 Ga0439462_0000163 3300042015 Bacteria 11098
696 Ga0450905_000685 3300042142 Bacteria 4150
697 Ga0450889_000465 3300042144 Bacteria 4494
698 Ga0439446_0104539 3300042156 Bacteria 898
699 Ga0439458_0001726 3300042157 Bacteria 5465
700 Ga0439434_0000796 3300042435 Bacteria 9092
701 Ga0439434_0001302 3300042435 Bacteria 7193
702 Ga0439464_0000541 3300042439 Bacteria 7823
703 Ga0466972_0062664 3300044658 Bacteria 1782
704 Ga0466966_0041833 3300044684 Bacteria 2943
705 Ga0466961_0098474 3300044693 Bacteria 1843
706 Ga0466963_0007297 3300044694 Bacteria 6591
707 Ga0466970_0041736 3300044765 Bacteria 2439
708 Ga0466970_0387417 3300044765 Bacteria 796
709 Ga0466957_0119607 3300044842 Bacteria 1678
710 Ga0466959_0070232 3300045049 Bacteria 2537
711 Ga0466967_0027999 3300045976 Bacteria 4697
712 Ga0466967_0044914 3300045976 Bacteria 3836
713 Ga0466967_0199621 3300045976 Bacteria 1894
714 Ga0495627_026097 3300046453 Bacteria 1888
715 Ga0495583_0014859 3300046506 Bacteria 4264
716 Ga0495663_0050595 3300046525 Bacteria 1285
717 Ga0495642_0027977 3300046528 Bacteria 2244
718 Ga0495642_0042081 3300046528 Bacteria 1860
719 Ga0495598_0000438 3300046537 Bacteria 7557
720 Ga0495668_0002859 3300046616 Bacteria 13693
721 Ga0495668_0011174 3300046616 Bacteria 5389
722 Ga0495668_0016910 3300046616 Bacteria 4236
723 Ga0495668_0036933 3300046616 Bacteria 2736
724 Ga0495668_0072129 3300046616 Bacteria 1897
725 Ga0495668_0148019 3300046616 Bacteria 1286
726 Ga0495625_0395067 3300046660 Bacteria 865
727 Ga0495661_0096729 3300046665 Bacteria 1669
728 Ga0495669_0000090 3300046684 Bacteria 60222
729 Ga0495669_0007174 3300046684 Bacteria 4669
730 Ga0495669_0027579 3300046684 Bacteria 2485
731 Ga0495670_0000017 3300046691 Bacteria 120427
732 Ga0495670_0009359 3300046691 Bacteria 4820
733 Ga0495636_0280375 3300047318 Bacteria 776
734 Ga0495677_0004345 3300047445 Bacteria 5445
735 Ga0495677_0004406 3300047445 Bacteria 5408
736 Ga0495686_0187873 3300047472 Bacteria 1193
737 Ga0496100_0007641 3300048903 Bacteria 5979
738 Ga0496100_0007971 3300048903 Bacteria 5884
739 Ga0496100_0121979 3300048903 Bacteria 1824
740 Ga0496100_0160190 3300048903 Bacteria 1613
741 Ga0496100_0516656 3300048903 Bacteria 921
742 Ga0496101_0007869 3300048904 Bacteria 6935
743 Ga0496101_0018596 3300048904 Bacteria 4727
744 Ga0496101_0024027 3300048904 Bacteria 4216
745 Ga0496101_0191793 3300048904 Bacteria 1577
746 Ga0496101_0307705 3300048904 Bacteria 1242
747 Ga0496101_0329057 3300048904 Bacteria 1199
748 Ga0496101_0382310 3300048904 Bacteria 1108
749 Ga0496102_0063484 3300048905 Bacteria 3382
750 Ga0496102_0267384 3300048905 Bacteria 1612
751 Ga0496103_0000289 3300048906 Bacteria 47033
752 Ga0496104_0000161 3300048907 Bacteria 60841
753 Ga0496104_0000477 3300048907 Bacteria 34490
754 Ga0496105_0013787 3300048908 Bacteria 6419
755 Ga0496105_0018885 3300048908 Bacteria 5552
756 Ga0496105_0148677 3300048908 Bacteria 1926
757 Ga0496106_0019431 3300048909 Bacteria 5039
758 Ga0496106_0113325 3300048909 Bacteria 2113
759 Ga0496106_0155519 3300048909 Bacteria 1805
760 Ga0496106_0336173 3300048909 Bacteria 1213
761 Ga0496106_0590673 3300048909 Bacteria 890
762 Ga0496107_0008078 3300048910 Bacteria 7266
763 Ga0496107_0020708 3300048910 Bacteria 4647
764 Ga0496107_0038934 3300048910 Bacteria 3410
765 Ga0496107_0047833 3300048910 Bacteria 3080
766 Ga0496107_0099796 3300048910 Bacteria 2128
767 Ga0496107_0206471 3300048910 Bacteria 1460
768 Ga0496107_0284903 3300048910 Bacteria 1230
769 Ga0496108_0000483 3300048911 Bacteria 31924
770 Ga0496108_0007321 3300048911 Bacteria 8947
771 Ga0496108_0015856 3300048911 Bacteria 6143
772 Ga0496108_0088830 3300048911 Bacteria 2626
773 Ga0496108_0100530 3300048911 Bacteria 2466
774 Ga0496108_0328000 3300048911 Bacteria 1334
775 Ga0496108_0931928 3300048911 Bacteria 744
776 Ga0496109_0000765 3300048912 Bacteria 26746
777 Ga0496109_0001630 3300048912 Bacteria 18749
778 Ga0496109_0006413 3300048912 Bacteria 9904
779 Ga0496109_0048037 3300048912 Bacteria 3882
780 Ga0496109_0060928 3300048912 Bacteria 3449
781 Ga0496109_0150138 3300048912 Bacteria 2182
782 Ga0496109_0233201 3300048912 Bacteria 1732
783 Ga0496109_0487740 3300048912 Bacteria 1163
784 Ga0496109_0806290 3300048912 Bacteria 877
785 Ga0496110_0001524 3300048913 Bacteria 16817
786 Ga0496110_0008357 3300048913 Bacteria 8327
787 Ga0496110_0021450 3300048913 Bacteria 5470
788 Ga0496110_0027620 3300048913 Bacteria 4866
789 Ga0496111_0002167 3300048914 Bacteria 11754
790 Ga0496111_0012076 3300048914 Bacteria 5840
791 Ga0496111_0133133 3300048914 Bacteria 1840
792 Ga0496111_0143151 3300048914 Bacteria 1772
793 Ga0496111_0149052 3300048914 Bacteria 1735
794 Ga0496111_0163715 3300048914 Bacteria 1652
795 Ga0496112_0001631 3300048915 Bacteria 17374
796 Ga0496112_0024451 3300048915 Bacteria 5784
797 Ga0496112_0034069 3300048915 Bacteria 4955
798 Ga0496112_0034997 3300048915 Bacteria 4888
799 Ga0496112_0102728 3300048915 Bacteria 2828
800 Ga0496112_0104835 3300048915 Bacteria 2797
801 Ga0496112_0165479 3300048915 Bacteria 2178
802 Ga0496112_0172328 3300048915 Bacteria 2129
803 Ga0496113_0003331 3300048916 Bacteria 9596
804 Ga0496113_0011729 3300048916 Bacteria 5864
805 Ga0496113_0163528 3300048916 Bacteria 1760
806 Ga0496114_0000162 3300048917 Bacteria 47188
807 Ga0496114_0028375 3300048917 Bacteria 4592
808 Ga0496114_0623103 3300048917 Bacteria 950
809 Ga0496115_0026907 3300048918 Bacteria 4494
810 Ga0496115_0041325 3300048918 Bacteria 3669
811 Ga0496117_0014969 3300048920 Bacteria 6646
812 Ga0496118_0034873 3300048921 Bacteria 4097
813 Ga0496119_0000734 3300048922 Bacteria 44175
814 Ga0496120_0028258 3300048923 Bacteria 3438
815 Ga0496121_0009641 3300048924 Bacteria 11060
816 Ga0496121_0016344 3300048924 Bacteria 7668
817 Ga0496122_0016591 3300048925 Bacteria 6953
818 Ga0496123_0006076 3300048926 Bacteria 11848
819 Ga0496124_0006526 3300048927 Bacteria 12690
820 Ga0496125_0072756 3300048928 Bacteria 2676
821 Ga0496126_0000661 3300048929 Bacteria 63847
822 Ga0501032_0008370 3300049569 Bacteria 7540
823 Ga0501033_0009316 3300049570 Bacteria 7562
824 Ga0501033_0166772 3300049570 Bacteria 1583
825 Ga0501034_0024565 3300049571 Bacteria 6129
826 Ga0501034_0211173 3300049571 Bacteria 1896
827 Ga0501036_0026215 3300049572 Bacteria 4920
828 Ga0501037_0019877 3300049573 Bacteria 4956
829 Ga0501037_0175535 3300049573 Bacteria 1522
830 Ga0501038_0014173 3300049574 Bacteria 7262
831 Ga0501039_0035822 3300049575 Bacteria 3830
832 Ga0501039_0224852 3300049575 Bacteria 1475
833 Ga0501043_0061572 3300049579 Bacteria 2947
834 Ga0501043_0090184 3300049579 Bacteria 2410
835 Ga0501043_0749040 3300049579 Bacteria 710
836 Ga0501046_0004038 3300049580 Bacteria 13394
837 Ga0501047_0013850 3300049581 Bacteria 7657
838 Ga0501047_0041687 3300049581 Bacteria 4435
839 Ga0501048_0004818 3300049582 Bacteria 10285
840 Ga0501048_0059226 3300049582 Bacteria 2714
841 Ga0501067_0022576 3300049583 Bacteria 3482
842 Ga0501067_0046122 3300049583 Bacteria 2419
843 Ga0501068_0002828 3300049584 Bacteria 9230
844 Ga0501068_0011189 3300049584 Bacteria 5057
845 Ga0501069_0005584 3300049585 Bacteria 6545
846 Ga0501070_0011936 3300049586 Bacteria 7337
847 Ga0501070_0128619 3300049586 Bacteria 2093
848 Ga0501070_0147657 3300049586 Bacteria 1940
849 Ga0501073_0006565 3300049589 Bacteria 8656
850 Ga0501073_0011449 3300049589 Bacteria 6489
851 Ga0501073_0017094 3300049589 Bacteria 5253
852 Ga0501073_0243637 3300049589 Bacteria 1241
853 Ga0501074_0027284 3300049590 Bacteria 4140
854 Ga0501074_0446870 3300049590 Bacteria 917
855 Ga0501207_012688 3300049654 Bacteria 1269
856 Ga0501242_020514 3300049674 Bacteria 850
857 Ga0501247_013884 3300049677 Bacteria 995
858 Ga0501225_0005489 3300049705 Bacteria 3720
859 Ga0501079_0130445 3300049741 Bacteria 1956
860 Ga0501080_0005541 3300049742 Bacteria 11273
861 Ga0501080_0047371 3300049742 Bacteria 4001
862 Ga0501080_0125486 3300049742 Bacteria 2377
863 Ga0501080_0660514 3300049742 Bacteria 924
864 Ga0501083_0003134 3300049744 Bacteria 11501
865 Ga0501083_0037678 3300049744 Bacteria 3292
866 Ga0501083_0167809 3300049744 Bacteria 1435
867 Ga0501035_0200080 3300049822 Bacteria 1714
868 Ga0501035_0377184 3300049822 Bacteria 1183
869 Ga0501044_0018457 3300049823 Bacteria 7473
870 Ga0501044_0022969 3300049823 Bacteria 6639
871 Ga0501044_0064259 3300049823 Bacteria 3747
872 Ga0501044_0087644 3300049823 Bacteria 3144
873 nmdc:mga0k408_158065_c1 3300050493 Bacteria 1350
874 nmdc:mga08y16_13971_c1 3300050511 Bacteria 8452
875 nmdc:mga0rr50_292575_c1 3300050513 Bacteria 1361
876 nmdc:mga0a205_1895_c1 3300050515 Bacteria 18155
877 Ga0500578_0023188 3300053086 Bacteria 3986
878 Ga0500643_033993 3300053087 Bacteria 1538
879 Ga0500644_0036283 3300053088 Bacteria 1604
880 Ga0500651_0214031 3300053093 Bacteria 1132
881 Ga0500566_0031285 3300053094 Bacteria 3103
882 Ga0500641_0007151 3300053096 Bacteria 3975
883 Ga0500641_0023402 3300053096 Bacteria 2375
884 Ga0500654_116217 3300053099 Bacteria 1073
885 Ga0500595_000514 3300053119 Bacteria 23372
886 Ga0500595_050930 3300053119 Bacteria 1284
887 Ga0500652_137751 3300053131 Bacteria 1017
888 Ga0500658_0000049 3300053134 Bacteria 65535
889 Ga0500658_0004102 3300053134 Bacteria 5480
890 Ga0500658_0017152 3300053134 Bacteria 2702
891 Ga0500573_0167193 3300053140 Bacteria 1192
892 Ga0500604_0002130 3300053151 Bacteria 5441
893 Ga0500604_0045917 3300053151 Bacteria 1334
894 Ga0500616_0002088 3300053153 Bacteria 17465
895 Ga0500609_007986 3300053731 Bacteria 1427
896 Ga0500587_000297 3300053739 Bacteria 5556
897 Ga0501082_0012990 3300060353 Bacteria 7158
898 Ga0501082_0039019 3300060353 Bacteria 4096
899 Ga0501082_0129034 3300060353 Bacteria 2194

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049654 Ga0501207_012688 Ga0501207_012688_195_851 201
2 3300035092 Ga0373952_0082453 Ga0373952_0082453_15_653 212
3 3300045976 Ga0466967_0199621 Ga0466967_0199621_1193_1837 214
4 3300053088 Ga0500644_0036283 Ga0500644_0036283_64_786 214
5 3300037312 Ga0395899_0193432 Ga0395899_0193432_46_696 216
6 3300044693 Ga0466961_0098474 Ga0466961_0098474_21_671 216
7 3300044765 Ga0466970_0387417 Ga0466970_0387417_133_783 216
8 3300046616 Ga0495668_0002859 Ga0495668_0002859_11701_12351 216
9 3300048904 Ga0496101_0307705 Ga0496101_0307705_522_1172 216
10 3300048909 Ga0496106_0590673 Ga0496106_0590673_215_865 216
11 3300048911 Ga0496108_0931928 Ga0496108_0931928_50_700 216
12 3300048915 Ga0496112_0102728 Ga0496112_0102728_2107_2757 216
13 3300049579 Ga0501043_0749040 Ga0501043_0749040_20_670 216
14 3300009545 Ga0105237_10158213 Ga0105237_101582133 217
15 3300009551 Ga0105238_10051207 Ga0105238_100512073 217
16 3300009098 Ga0105245_10020016 Ga0105245_100200165 218
17 3300011119 Ga0105246_10100023 Ga0105246_101000232 218
18 3300005355 Ga0070671_100873844 Ga0070671_1008738441 221
19 3300005364 Ga0070673_100197802 Ga0070673_1001978023 221
20 3300005459 Ga0068867_100428871 Ga0068867_1004288711 221
21 3300005543 Ga0070672_100080366 Ga0070672_1000803663 221
22 3300006237 Ga0097621_100030812 Ga0097621_1000308125 221
23 3300006358 Ga0068871_100051763 Ga0068871_1000517633 221
24 3300025931 Ga0207644_10810488 Ga0207644_108104881 221
25 3300025940 Ga0207691_10104915 Ga0207691_101049152 221
26 3300025960 Ga0207651_10434334 Ga0207651_104343342 221
27 3300026121 Ga0207683_10123307 Ga0207683_101233071 221
28 3300032004 Ga0307414_10296222 Ga0307414_102962222 227
29 3300006844 Ga0075428_100243409 Ga0075428_1002434092 228
30 3300005290 Ga0065712_10126381 Ga0065712_101263812 230
31 3300005354 Ga0070675_100081613 Ga0070675_1000816133 230
32 3300005455 Ga0070663_100061469 Ga0070663_1000614694 230
33 3300005564 Ga0070664_100084102 Ga0070664_1000841023 230
34 3300005617 Ga0068859_100014058 Ga0068859_1000140583 230
35 3300005841 Ga0068863_100005398 Ga0068863_10000539812 230
36 3300005842 Ga0068858_100145529 Ga0068858_1001455294 230
37 3300005844 Ga0068862_100211773 Ga0068862_1002117733 230
38 3300006931 Ga0097620_100014058 Ga0097620_1000140583 230
39 3300009174 Ga0105241_10050172 Ga0105241_100501723 230
40 3300009176 Ga0105242_10204338 Ga0105242_102043382 230
41 3300025925 Ga0207650_10424245 Ga0207650_104242452 230
42 3300025926 Ga0207659_10115655 Ga0207659_101156553 230
43 3300025933 Ga0207706_10408131 Ga0207706_104081313 230
44 3300025938 Ga0207704_10621036 Ga0207704_106210361 230
45 3300025945 Ga0207679_10111111 Ga0207679_101111113 230
46 3300026035 Ga0207703_10027234 Ga0207703_100272343 230
47 3300026067 Ga0207678_10009708 Ga0207678_100097084 230
48 3300026088 Ga0207641_10008362 Ga0207641_100083625 230
49 3300026095 Ga0207676_10004037 Ga0207676_100040374 230
50 3300028380 Ga0268265_10125825 Ga0268265_101258253 230
51 3300035088 Ga0373940_0040249 Ga0373940_0040249_415_1137 230
52 3300005617 Ga0068859_100249132 Ga0068859_1002491321 232
53 3300005718 Ga0068866_10005315 Ga0068866_100053153 232
54 3300006931 Ga0097620_100249122 Ga0097620_1002491221 232
55 3300028380 Ga0268265_10010923 Ga0268265_100109234 232
56 3300025933 Ga0207706_10367177 Ga0207706_103671771 235
57 3300048910 Ga0496107_0206471 Ga0496107_0206471_302_1009 235
58 3300053099 Ga0500654_116217 Ga0500654_116217_352_1059 235
59 iso_pu_bacteria 2643221622 2644125557 236
60 iso_pu_bacteria 2738541275 2738711222 236
61 iso_pu_bacteria 2738541301 2738849647 236
62 iso_pu_bacteria 2738541304 2738865376 236
63 iso_pu_bacteria 2738543022 2739297894 236
64 iso_pu_bacteria 2738543033 2739359572 236
65 iso_pu_bacteria 2848297114 2848300448 236
66 iso_pu_bacteria 2896253425 2896253677 236
67 iso_pu_bacteria 2928100450 2928103966 236
68 iso_pu_bacteria 2928959182 2928961490 236
69 iso_pu_bacteria 2937843397 2937848574 236
70 3300038443 Ga0395901_0395067 Ga0395901_0395067_69_782 237
71 3300045976 Ga0466967_0027999 Ga0466967_0027999_1813_2526 237
72 iso_pu_bacteria 2896429255 2896431442 237
73 2162886007 SwRhRL2b_contig_2264840 SwRhRL2b_0608.00000020 240
74 3300000043 ARcpr5yngRDRAFT_c009745 ARcpr5yngRDRAFT_0097451 240
75 3300001979 JGI24740J21852_10073782 JGI24740J21852_100737821 240
76 3300001989 JGI24739J22299_10041723 JGI24739J22299_100417232 240
77 3300001990 JGI24737J22298_10006549 JGI24737J22298_100065494 240
78 3300001990 JGI24737J22298_10012841 JGI24737J22298_100128413 240
79 3300003215 JGI25153J46596_10000126 JGI25153J46596_1000012612 240
80 3300003215 JGI25153J46596_10060671 JGI25153J46596_100606712 240
81 3300003773 Ga0055537_1003751 Ga0055537_10037513 240
82 3300003775 Ga0055524_1000245 Ga0055524_100024555 240
83 3300003791 Ga0055530_10000064 Ga0055530_1000006413 240
84 3300003794 Ga0055531_10000073 Ga0055531_1000007313 240
85 3300003794 Ga0055531_10047592 Ga0055531_100475921 240
86 3300003794 Ga0055531_10054580 Ga0055531_100545802 240
87 3300005262 Ga0065165_1006490 Ga0065165_10064904 240
88 3300005262 Ga0065165_1010172 Ga0065165_10101723 240
89 3300005290 Ga0065712_10359175 Ga0065712_103591751 240
90 3300005293 Ga0065715_10095621 Ga0065715_100956214 240
91 3300005327 Ga0070658_10005417 Ga0070658_100054174 240
92 3300005327 Ga0070658_10034829 Ga0070658_100348294 240
93 3300005327 Ga0070658_10074198 Ga0070658_100741984 240
94 3300005327 Ga0070658_10095591 Ga0070658_100955912 240
95 3300005327 Ga0070658_10112829 Ga0070658_101128292 240
96 3300005327 Ga0070658_10117618 Ga0070658_101176183 240
97 3300005328 Ga0070676_10096112 Ga0070676_100961121 240
98 3300005328 Ga0070676_10151734 Ga0070676_101517342 240
99 3300005328 Ga0070676_10309565 Ga0070676_103095652 240
100 3300005329 Ga0070683_100145988 Ga0070683_1001459884 240
101 3300005329 Ga0070683_100146607 Ga0070683_1001466072 240
102 3300005330 Ga0070690_100011596 Ga0070690_1000115964 240
103 3300005331 Ga0070670_100028508 Ga0070670_1000285083 240
104 3300005331 Ga0070670_100031460 Ga0070670_1000314603 240
105 3300005331 Ga0070670_100063761 Ga0070670_1000637614 240
106 3300005331 Ga0070670_100082914 Ga0070670_1000829143 240
107 3300005335 Ga0070666_10005242 Ga0070666_100052424 240
108 3300005335 Ga0070666_10023613 Ga0070666_100236132 240
109 3300005336 Ga0070680_100098143 Ga0070680_1000981433 240
110 3300005336 Ga0070680_100126515 Ga0070680_1001265152 240
111 3300005338 Ga0068868_100001315 Ga0068868_10000131516 240
112 3300005338 Ga0068868_100019311 Ga0068868_1000193114 240
113 3300005338 Ga0068868_100028424 Ga0068868_1000284243 240
114 3300005338 Ga0068868_100149061 Ga0068868_1001490611 240
115 3300005339 Ga0070660_100006409 Ga0070660_1000064097 240
116 3300005339 Ga0070660_100016068 Ga0070660_1000160683 240
117 3300005339 Ga0070660_100028804 Ga0070660_1000288042 240
118 3300005339 Ga0070660_100032953 Ga0070660_1000329534 240
119 3300005339 Ga0070660_100099383 Ga0070660_1000993833 240
120 3300005344 Ga0070661_100016193 Ga0070661_1000161934 240
121 3300005344 Ga0070661_100025904 Ga0070661_1000259042 240
122 3300005344 Ga0070661_100047542 Ga0070661_1000475422 240
123 3300005344 Ga0070661_100056067 Ga0070661_1000560673 240
124 3300005344 Ga0070661_100252837 Ga0070661_1002528372 240
125 3300005345 Ga0070692_10011905 Ga0070692_100119054 240
126 3300005345 Ga0070692_10224532 Ga0070692_102245321 240
127 3300005347 Ga0070668_100002681 Ga0070668_1000026815 240
128 3300005347 Ga0070668_100252404 Ga0070668_1002524042 240
129 3300005353 Ga0070669_100000068 Ga0070669_10000006878 240
130 3300005353 Ga0070669_100020982 Ga0070669_1000209823 240
131 3300005353 Ga0070669_100081289 Ga0070669_1000812893 240
132 3300005354 Ga0070675_100085366 Ga0070675_1000853662 240
133 3300005355 Ga0070671_100000777 Ga0070671_1000007772 240
134 3300005355 Ga0070671_100007788 Ga0070671_1000077884 240
135 3300005355 Ga0070671_100011151 Ga0070671_1000111513 240
136 3300005355 Ga0070671_100012348 Ga0070671_1000123482 240
137 3300005355 Ga0070671_100025045 Ga0070671_1000250454 240
138 3300005355 Ga0070671_100092282 Ga0070671_1000922822 240
139 3300005355 Ga0070671_100106591 Ga0070671_1001065913 240
140 3300005355 Ga0070671_100186709 Ga0070671_1001867092 240
141 3300005355 Ga0070671_100545605 Ga0070671_1005456051 240
142 3300005356 Ga0070674_100020059 Ga0070674_1000200592 240
143 3300005356 Ga0070674_100159829 Ga0070674_1001598292 240
144 3300005356 Ga0070674_100264259 Ga0070674_1002642592 240
145 3300005364 Ga0070673_100026160 Ga0070673_1000261604 240
146 3300005364 Ga0070673_100059648 Ga0070673_1000596482 240
147 3300005364 Ga0070673_100063883 Ga0070673_1000638833 240
148 3300005364 Ga0070673_100168984 Ga0070673_1001689842 240
149 3300005365 Ga0070688_100166852 Ga0070688_1001668522 240
150 3300005366 Ga0070659_100002551 Ga0070659_1000025518 240
151 3300005366 Ga0070659_100010070 Ga0070659_1000100704 240
152 3300005366 Ga0070659_100020119 Ga0070659_1000201193 240
153 3300005366 Ga0070659_100029930 Ga0070659_1000299304 240
154 3300005366 Ga0070659_100042504 Ga0070659_1000425043 240
155 3300005366 Ga0070659_100059956 Ga0070659_1000599563 240
156 3300005366 Ga0070659_100068896 Ga0070659_1000688964 240
157 3300005366 Ga0070659_100194547 Ga0070659_1001945472 240
158 3300005366 Ga0070659_100309130 Ga0070659_1003091302 240
159 3300005367 Ga0070667_100000885 Ga0070667_1000008852 240
160 3300005367 Ga0070667_100006375 Ga0070667_1000063754 240
161 3300005367 Ga0070667_100010927 Ga0070667_1000109273 240
162 3300005367 Ga0070667_100018985 Ga0070667_1000189853 240
163 3300005367 Ga0070667_100048257 Ga0070667_1000482573 240
164 3300005367 Ga0070667_100113736 Ga0070667_1001137363 240
165 3300005367 Ga0070667_100217836 Ga0070667_1002178363 240
166 3300005367 Ga0070667_100334528 Ga0070667_1003345282 240
167 3300005367 Ga0070667_100363210 Ga0070667_1003632102 240
168 3300005435 Ga0070714_100092608 Ga0070714_1000926081 240
169 3300005435 Ga0070714_100575646 Ga0070714_1005756462 240
170 3300005436 Ga0070713_100310802 Ga0070713_1003108022 240
171 3300005444 Ga0070694_100009270 Ga0070694_1000092703 240
172 3300005455 Ga0070663_100000991 Ga0070663_1000009913 240
173 3300005455 Ga0070663_100036923 Ga0070663_1000369233 240
174 3300005455 Ga0070663_100066486 Ga0070663_1000664863 240
175 3300005455 Ga0070663_100093820 Ga0070663_1000938202 240
176 3300005455 Ga0070663_100132960 Ga0070663_1001329602 240
177 3300005455 Ga0070663_100156413 Ga0070663_1001564133 240
178 3300005456 Ga0070678_100023347 Ga0070678_1000233473 240
179 3300005456 Ga0070678_100111826 Ga0070678_1001118261 240
180 3300005456 Ga0070678_100175038 Ga0070678_1001750382 240
181 3300005456 Ga0070678_100318384 Ga0070678_1003183842 240
182 3300005457 Ga0070662_100006707 Ga0070662_1000067074 240
183 3300005457 Ga0070662_100027144 Ga0070662_1000271443 240
184 3300005457 Ga0070662_100167048 Ga0070662_1001670482 240
185 3300005457 Ga0070662_100215143 Ga0070662_1002151432 240
186 3300005458 Ga0070681_10259039 Ga0070681_102590393 240
187 3300005459 Ga0068867_100002219 Ga0068867_1000022197 240
188 3300005459 Ga0068867_100121372 Ga0068867_1001213723 240
189 3300005459 Ga0068867_100126736 Ga0068867_1001267364 240
190 3300005459 Ga0068867_100170820 Ga0068867_1001708204 240
191 3300005466 Ga0070685_10474398 Ga0070685_104743981 240
192 3300005530 Ga0070679_100022822 Ga0070679_1000228224 240
193 3300005530 Ga0070679_100330461 Ga0070679_1003304612 240
194 3300005535 Ga0070684_100491043 Ga0070684_1004910432 240
195 3300005539 Ga0068853_100019988 Ga0068853_1000199883 240
196 3300005543 Ga0070672_100031263 Ga0070672_1000312634 240
197 3300005543 Ga0070672_100089713 Ga0070672_1000897133 240
198 3300005543 Ga0070672_100120228 Ga0070672_1001202282 240
199 3300005544 Ga0070686_100001063 Ga0070686_1000010638 240
200 3300005545 Ga0070695_100022680 Ga0070695_1000226802 240
201 3300005546 Ga0070696_100011198 Ga0070696_1000111984 240
202 3300005547 Ga0070693_100132503 Ga0070693_1001325032 240
203 3300005548 Ga0070665_100001845 Ga0070665_1000018457 240
204 3300005548 Ga0070665_100002264 Ga0070665_1000022645 240
205 3300005548 Ga0070665_100012623 Ga0070665_1000126234 240
206 3300005548 Ga0070665_100169147 Ga0070665_1001691472 240
207 3300005548 Ga0070665_100399278 Ga0070665_1003992782 240
208 3300005549 Ga0070704_100101393 Ga0070704_1001013932 240
209 3300005563 Ga0068855_100056364 Ga0068855_1000563644 240
210 3300005563 Ga0068855_100144320 Ga0068855_1001443203 240
211 3300005563 Ga0068855_100204060 Ga0068855_1002040603 240
212 3300005563 Ga0068855_101099922 Ga0068855_1010999221 240
213 3300005564 Ga0070664_100003956 Ga0070664_1000039569 240
214 3300005564 Ga0070664_100005115 Ga0070664_1000051154 240
215 3300005564 Ga0070664_100008101 Ga0070664_1000081013 240
216 3300005564 Ga0070664_100026386 Ga0070664_1000263864 240
217 3300005564 Ga0070664_100039130 Ga0070664_1000391302 240
218 3300005564 Ga0070664_100075351 Ga0070664_1000753512 240
219 3300005564 Ga0070664_100111731 Ga0070664_1001117312 240
220 3300005564 Ga0070664_100151349 Ga0070664_1001513492 240
221 3300005564 Ga0070664_100316769 Ga0070664_1003167691 240
222 3300005577 Ga0068857_100003144 Ga0068857_1000031446 240
223 3300005577 Ga0068857_100064083 Ga0068857_1000640834 240
224 3300005577 Ga0068857_100291401 Ga0068857_1002914012 240
225 3300005577 Ga0068857_100400961 Ga0068857_1004009611 240
226 3300005578 Ga0068854_100160932 Ga0068854_1001609322 240
227 3300005614 Ga0068856_100006667 Ga0068856_1000066677 240
228 3300005614 Ga0068856_100094019 Ga0068856_1000940193 240
229 3300005616 Ga0068852_100000980 Ga0068852_1000009809 240
230 3300005616 Ga0068852_100018839 Ga0068852_1000188394 240
231 3300005616 Ga0068852_100046996 Ga0068852_1000469964 240
232 3300005616 Ga0068852_100063641 Ga0068852_1000636414 240
233 3300005616 Ga0068852_100110241 Ga0068852_1001102412 240
234 3300005616 Ga0068852_100174487 Ga0068852_1001744871 240
235 3300005616 Ga0068852_100270042 Ga0068852_1002700421 240
236 3300005616 Ga0068852_100339466 Ga0068852_1003394662 240
237 3300005617 Ga0068859_100003574 Ga0068859_10000357412 240
238 3300005617 Ga0068859_100027091 Ga0068859_1000270914 240
239 3300005617 Ga0068859_100197078 Ga0068859_1001970782 240
240 3300005617 Ga0068859_100370963 Ga0068859_1003709632 240
241 3300005618 Ga0068864_100000644 Ga0068864_10000064423 240
242 3300005618 Ga0068864_100000652 Ga0068864_10000065221 240
243 3300005618 Ga0068864_100007139 Ga0068864_1000071393 240
244 3300005618 Ga0068864_100007619 Ga0068864_1000076193 240
245 3300005618 Ga0068864_100017564 Ga0068864_1000175643 240
246 3300005618 Ga0068864_100033788 Ga0068864_1000337884 240
247 3300005618 Ga0068864_100237775 Ga0068864_1002377752 240
248 3300005719 Ga0068861_100105991 Ga0068861_1001059912 240
249 3300005834 Ga0068851_10003801 Ga0068851_100038013 240
250 3300005834 Ga0068851_10006508 Ga0068851_100065083 240
251 3300005834 Ga0068851_10017140 Ga0068851_100171403 240
252 3300005834 Ga0068851_10185897 Ga0068851_101858972 240
253 3300005841 Ga0068863_100005821 Ga0068863_1000058219 240
254 3300005841 Ga0068863_100006923 Ga0068863_1000069237 240
255 3300005841 Ga0068863_100007794 Ga0068863_1000077943 240
256 3300005841 Ga0068863_100022840 Ga0068863_1000228404 240
257 3300005841 Ga0068863_100151238 Ga0068863_1001512382 240
258 3300005842 Ga0068858_100000338 Ga0068858_10000033833 240
259 3300005842 Ga0068858_100001356 Ga0068858_10000135610 240
260 3300005842 Ga0068858_100011333 Ga0068858_1000113334 240
261 3300005842 Ga0068858_100015292 Ga0068858_1000152923 240
262 3300005842 Ga0068858_100089996 Ga0068858_1000899962 240
263 3300005842 Ga0068858_100228759 Ga0068858_1002287592 240
264 3300005843 Ga0068860_100000164 Ga0068860_10000016496 240
265 3300005843 Ga0068860_100010261 Ga0068860_1000102613 240
266 3300005843 Ga0068860_100014304 Ga0068860_1000143042 240
267 3300005843 Ga0068860_100031747 Ga0068860_1000317473 240
268 3300005843 Ga0068860_100094916 Ga0068860_1000949162 240
269 3300005843 Ga0068860_100097821 Ga0068860_1000978212 240
270 3300005843 Ga0068860_100148802 Ga0068860_1001488023 240
271 3300005844 Ga0068862_100013225 Ga0068862_1000132257 240
272 3300005844 Ga0068862_100027070 Ga0068862_1000270704 240
273 3300005844 Ga0068862_100145065 Ga0068862_1001450652 240
274 3300005844 Ga0068862_100400715 Ga0068862_1004007152 240
275 3300005844 Ga0068862_100535272 Ga0068862_1005352723 240
276 3300006195 Ga0075366_10164086 Ga0075366_101640862 240
277 3300006237 Ga0097621_100035903 Ga0097621_1000359033 240
278 3300006237 Ga0097621_100095911 Ga0097621_1000959113 240
279 3300006237 Ga0097621_100611649 Ga0097621_1006116492 240
280 3300006358 Ga0068871_100046466 Ga0068871_1000464663 240
281 3300006852 Ga0075433_10025912 Ga0075433_100259123 240
282 3300006881 Ga0068865_100014709 Ga0068865_1000147094 240
283 3300006931 Ga0097620_100003574 Ga0097620_1000035743 240
284 3300006931 Ga0097620_100027091 Ga0097620_1000270913 240
285 3300006931 Ga0097620_100197052 Ga0097620_1001970522 240
286 3300006931 Ga0097620_100370975 Ga0097620_1003709752 240
287 3300007076 Ga0075435_100368170 Ga0075435_1003681702 240
288 3300009011 Ga0105251_10066085 Ga0105251_100660852 240
289 3300009011 Ga0105251_10085531 Ga0105251_100855312 240
290 3300009093 Ga0105240_10233002 Ga0105240_102330022 240
291 3300009093 Ga0105240_10289998 Ga0105240_102899983 240
292 3300009094 Ga0111539_10017289 Ga0111539_100172895 240
293 3300009098 Ga0105245_10020409 Ga0105245_100204094 240
294 3300009148 Ga0105243_10121505 Ga0105243_101215052 240
295 3300009148 Ga0105243_10369708 Ga0105243_103697082 240
296 3300009176 Ga0105242_10002830 Ga0105242_100028304 240
297 3300009177 Ga0105248_10000898 Ga0105248_1000089839 240
298 3300009177 Ga0105248_10001310 Ga0105248_1000131012 240
299 3300009177 Ga0105248_10005770 Ga0105248_100057708 240
300 3300009177 Ga0105248_10006692 Ga0105248_100066925 240
301 3300009177 Ga0105248_10007974 Ga0105248_100079743 240
302 3300009177 Ga0105248_10008536 Ga0105248_100085364 240
303 3300009177 Ga0105248_10009978 Ga0105248_100099782 240
304 3300009177 Ga0105248_10012217 Ga0105248_100122179 240
305 3300009177 Ga0105248_10060856 Ga0105248_100608562 240
306 3300009177 Ga0105248_10080506 Ga0105248_100805063 240
307 3300009177 Ga0105248_10271396 Ga0105248_102713963 240
308 3300009545 Ga0105237_10030373 Ga0105237_100303733 240
309 3300009545 Ga0105237_10154785 Ga0105237_101547852 240
310 3300009551 Ga0105238_10318030 Ga0105238_103180302 240
311 3300009553 Ga0105249_10066447 Ga0105249_100664474 240
312 3300009553 Ga0105249_10139116 Ga0105249_101391162 240
313 3300009553 Ga0105249_10169322 Ga0105249_101693224 240
314 3300009553 Ga0105249_10390789 Ga0105249_103907892 240
315 3300009553 Ga0105249_10663919 Ga0105249_106639191 240
316 3300011119 Ga0105246_10050934 Ga0105246_100509344 240
317 3300013100 Ga0157373_10096111 Ga0157373_100961114 240
318 3300013100 Ga0157373_10178975 Ga0157373_101789751 240
319 3300013100 Ga0157373_10187832 Ga0157373_101878322 240
320 3300013100 Ga0157373_10219312 Ga0157373_102193122 240
321 3300013102 Ga0157371_10017846 Ga0157371_100178464 240
322 3300013102 Ga0157371_10077134 Ga0157371_100771344 240
323 3300013104 Ga0157370_10716494 Ga0157370_107164942 240
324 3300013105 Ga0157369_10035624 Ga0157369_100356243 240
325 3300013105 Ga0157369_10426685 Ga0157369_104266852 240
326 3300013297 Ga0157378_10030245 Ga0157378_100302451 240
327 3300013297 Ga0157378_10094676 Ga0157378_100946762 240
328 3300013297 Ga0157378_10144132 Ga0157378_101441322 240
329 3300013297 Ga0157378_10426477 Ga0157378_104264771 240
330 3300013306 Ga0163162_10006162 Ga0163162_100061624 240
331 3300013306 Ga0163162_10006556 Ga0163162_1000655613 240
332 3300013306 Ga0163162_10063486 Ga0163162_100634863 240
333 3300013306 Ga0163162_10136868 Ga0163162_101368683 240
334 3300013306 Ga0163162_10358151 Ga0163162_103581512 240
335 3300013307 Ga0157372_10360175 Ga0157372_103601753 240
336 3300013308 Ga0157375_10157881 Ga0157375_101578812 240
337 3300013308 Ga0157375_10338185 Ga0157375_103381852 240
338 3300014325 Ga0163163_10003408 Ga0163163_100034084 240
339 3300014325 Ga0163163_10009604 Ga0163163_100096043 240
340 3300014325 Ga0163163_10032541 Ga0163163_100325414 240
341 3300014326 Ga0157380_10000643 Ga0157380_1000064317 240
342 3300014497 Ga0182008_10015626 Ga0182008_100156263 240
343 3300014497 Ga0182008_10251015 Ga0182008_102510151 240
344 3300014745 Ga0157377_10057529 Ga0157377_100575293 240
345 3300014968 Ga0157379_10002639 Ga0157379_1000263911 240
346 3300014968 Ga0157379_10159058 Ga0157379_101590582 240
347 3300014968 Ga0157379_10178292 Ga0157379_101782922 240
348 3300014968 Ga0157379_10728826 Ga0157379_107288262 240
349 3300014969 Ga0157376_10306495 Ga0157376_103064952 240
350 3300015690 Ga0183363_1003 Ga0183363_1003294 240
351 3300016635 Ga0183361_11167 Ga0183361_111671 240
352 3300017792 Ga0163161_10003908 Ga0163161_100039084 240
353 3300020082 Ga0206353_10503123 Ga0206353_105031233 240
354 3300021384 Ga0213876_10087211 Ga0213876_100872113 240
355 3300025263 Ga0209565_1000007 Ga0209565_1000007339 240
356 3300025271 Ga0207666_1012494 Ga0207666_10124942 240
357 3300025273 Ga0209673_1001016 Ga0209673_100101626 240
358 3300025291 Ga0209675_1007707 Ga0209675_10077072 240
359 3300025292 Ga0209676_1016060 Ga0209676_10160603 240
360 3300025297 Ga0209758_1000005 Ga0209758_1000005701 240
361 3300025297 Ga0209758_1011190 Ga0209758_10111905 240
362 3300025298 Ga0209050_1000010 Ga0209050_1000010833 240
363 3300025298 Ga0209050_1003636 Ga0209050_100363610 240
364 3300025298 Ga0209050_1005965 Ga0209050_10059652 240
365 3300025299 Ga0209256_1000008 Ga0209256_1000008181 240
366 3300025302 Ga0207426_1051382 Ga0207426_10513822 240
367 3300025302 Ga0207426_1078811 Ga0207426_10788111 240
368 3300025304 Ga0209257_1000027 Ga0209257_1000027475 240
369 3300025304 Ga0209257_1002411 Ga0209257_10024117 240
370 3300025315 Ga0207697_10017346 Ga0207697_100173462 240
371 3300025321 Ga0207656_10002269 Ga0207656_100022694 240
372 3300025321 Ga0207656_10023356 Ga0207656_100233563 240
373 3300025321 Ga0207656_10096395 Ga0207656_100963953 240
374 3300025321 Ga0207656_10144858 Ga0207656_101448582 240
375 3300025711 Ga0207696_1027164 Ga0207696_10271642 240
376 3300025735 Ga0207713_1009812 Ga0207713_10098123 240
377 3300025899 Ga0207642_10198768 Ga0207642_101987682 240
378 3300025901 Ga0207688_10187812 Ga0207688_101878122 240
379 3300025901 Ga0207688_10244265 Ga0207688_102442652 240
380 3300025903 Ga0207680_10007920 Ga0207680_100079203 240
381 3300025903 Ga0207680_10011483 Ga0207680_100114834 240
382 3300025903 Ga0207680_10031782 Ga0207680_100317824 240
383 3300025903 Ga0207680_10058812 Ga0207680_100588123 240
384 3300025903 Ga0207680_10063454 Ga0207680_100634542 240
385 3300025903 Ga0207680_10089118 Ga0207680_100891182 240
386 3300025903 Ga0207680_10134194 Ga0207680_101341942 240
387 3300025903 Ga0207680_10240723 Ga0207680_102407233 240
388 3300025904 Ga0207647_10009717 Ga0207647_100097174 240
389 3300025904 Ga0207647_10017962 Ga0207647_100179624 240
390 3300025904 Ga0207647_10056670 Ga0207647_100566703 240
391 3300025907 Ga0207645_10011561 Ga0207645_100115612 240
392 3300025907 Ga0207645_10019534 Ga0207645_100195342 240
393 3300025907 Ga0207645_10109864 Ga0207645_101098642 240
394 3300025907 Ga0207645_10289255 Ga0207645_102892553 240
395 3300025909 Ga0207705_10003338 Ga0207705_100033384 240
396 3300025909 Ga0207705_10004852 Ga0207705_100048523 240
397 3300025909 Ga0207705_10013059 Ga0207705_100130594 240
398 3300025909 Ga0207705_10026948 Ga0207705_100269483 240
399 3300025909 Ga0207705_10041563 Ga0207705_100415633 240
400 3300025909 Ga0207705_10044100 Ga0207705_100441004 240
401 3300025909 Ga0207705_10046994 Ga0207705_100469942 240
402 3300025909 Ga0207705_10056628 Ga0207705_100566281 240
403 3300025909 Ga0207705_10204275 Ga0207705_102042751 240
404 3300025912 Ga0207707_10052080 Ga0207707_100520803 240
405 3300025912 Ga0207707_10079159 Ga0207707_100791594 240
406 3300025913 Ga0207695_10248961 Ga0207695_102489611 240
407 3300025917 Ga0207660_10013623 Ga0207660_100136234 240
408 3300025918 Ga0207662_10097390 Ga0207662_100973902 240
409 3300025918 Ga0207662_10124265 Ga0207662_101242653 240
410 3300025919 Ga0207657_10000868 Ga0207657_100008683 240
411 3300025919 Ga0207657_10002240 Ga0207657_1000224013 240
412 3300025919 Ga0207657_10005291 Ga0207657_100052913 240
413 3300025919 Ga0207657_10005364 Ga0207657_100053649 240
414 3300025919 Ga0207657_10020284 Ga0207657_100202843 240
415 3300025919 Ga0207657_10058947 Ga0207657_100589473 240
416 3300025919 Ga0207657_10079808 Ga0207657_100798083 240
417 3300025919 Ga0207657_10098369 Ga0207657_100983692 240
418 3300025919 Ga0207657_10103969 Ga0207657_101039692 240
419 3300025919 Ga0207657_10243484 Ga0207657_102434841 240
420 3300025919 Ga0207657_10318709 Ga0207657_103187092 240
421 3300025919 Ga0207657_10525901 Ga0207657_105259011 240
422 3300025920 Ga0207649_10016567 Ga0207649_100165674 240
423 3300025920 Ga0207649_10033073 Ga0207649_100330732 240
424 3300025920 Ga0207649_10069766 Ga0207649_100697663 240
425 3300025920 Ga0207649_10101659 Ga0207649_101016592 240
426 3300025920 Ga0207649_10466915 Ga0207649_104669151 240
427 3300025921 Ga0207652_10079371 Ga0207652_100793713 240
428 3300025921 Ga0207652_10112659 Ga0207652_101126593 240
429 3300025923 Ga0207681_10000105 Ga0207681_1000010525 240
430 3300025923 Ga0207681_10014001 Ga0207681_100140013 240
431 3300025923 Ga0207681_10077610 Ga0207681_100776102 240
432 3300025923 Ga0207681_10193397 Ga0207681_101933973 240
433 3300025924 Ga0207694_10181617 Ga0207694_101816173 240
434 3300025925 Ga0207650_10066169 Ga0207650_100661692 240
435 3300025925 Ga0207650_10319640 Ga0207650_103196403 240
436 3300025925 Ga0207650_10574367 Ga0207650_105743672 240
437 3300025925 Ga0207650_10637631 Ga0207650_106376311 240
438 3300025926 Ga0207659_10056059 Ga0207659_100560593 240
439 3300025926 Ga0207659_10230510 Ga0207659_102305101 240
440 3300025926 Ga0207659_10331747 Ga0207659_103317472 240
441 3300025927 Ga0207687_10021349 Ga0207687_100213494 240
442 3300025927 Ga0207687_10517732 Ga0207687_105177321 240
443 3300025929 Ga0207664_10044911 Ga0207664_100449113 240
444 3300025929 Ga0207664_10690286 Ga0207664_106902862 240
445 3300025931 Ga0207644_10000248 Ga0207644_100002483 240
446 3300025931 Ga0207644_10001119 Ga0207644_100011195 240
447 3300025931 Ga0207644_10001155 Ga0207644_100011554 240
448 3300025931 Ga0207644_10008128 Ga0207644_100081285 240
449 3300025931 Ga0207644_10013273 Ga0207644_100132733 240
450 3300025931 Ga0207644_10019152 Ga0207644_100191524 240
451 3300025931 Ga0207644_10052209 Ga0207644_100522092 240
452 3300025931 Ga0207644_10053199 Ga0207644_100531993 240
453 3300025931 Ga0207644_10086645 Ga0207644_100866452 240
454 3300025932 Ga0207690_10007784 Ga0207690_100077844 240
455 3300025932 Ga0207690_10024336 Ga0207690_100243364 240
456 3300025932 Ga0207690_10026180 Ga0207690_100261804 240
457 3300025932 Ga0207690_10085900 Ga0207690_100859003 240
458 3300025932 Ga0207690_10103557 Ga0207690_101035572 240
459 3300025932 Ga0207690_10128617 Ga0207690_101286173 240
460 3300025932 Ga0207690_10138886 Ga0207690_101388862 240
461 3300025932 Ga0207690_10419996 Ga0207690_104199962 240
462 3300025933 Ga0207706_10005564 Ga0207706_100055646 240
463 3300025933 Ga0207706_10005806 Ga0207706_100058065 240
464 3300025933 Ga0207706_10021528 Ga0207706_100215284 240
465 3300025933 Ga0207706_10025644 Ga0207706_100256443 240
466 3300025933 Ga0207706_10033942 Ga0207706_100339423 240
467 3300025933 Ga0207706_10064793 Ga0207706_100647932 240
468 3300025933 Ga0207706_10068398 Ga0207706_100683984 240
469 3300025933 Ga0207706_10582101 Ga0207706_105821011 240
470 3300025934 Ga0207686_10188864 Ga0207686_101888641 240
471 3300025935 Ga0207709_10064525 Ga0207709_100645253 240
472 3300025935 Ga0207709_10260833 Ga0207709_102608332 240
473 3300025935 Ga0207709_10410454 Ga0207709_104104542 240
474 3300025936 Ga0207670_10152786 Ga0207670_101527862 240
475 3300025937 Ga0207669_10022729 Ga0207669_100227294 240
476 3300025937 Ga0207669_10109607 Ga0207669_101096072 240
477 3300025937 Ga0207669_10218881 Ga0207669_102188811 240
478 3300025937 Ga0207669_10259771 Ga0207669_102597712 240
479 3300025938 Ga0207704_10006416 Ga0207704_100064163 240
480 3300025940 Ga0207691_10001810 Ga0207691_100018104 240
481 3300025940 Ga0207691_10044375 Ga0207691_100443753 240
482 3300025940 Ga0207691_10058755 Ga0207691_100587552 240
483 3300025940 Ga0207691_10063146 Ga0207691_100631462 240
484 3300025940 Ga0207691_10065315 Ga0207691_100653153 240
485 3300025941 Ga0207711_10000724 Ga0207711_1000072410 240
486 3300025941 Ga0207711_10000748 Ga0207711_1000074818 240
487 3300025941 Ga0207711_10001383 Ga0207711_100013838 240
488 3300025941 Ga0207711_10001795 Ga0207711_100017955 240
489 3300025941 Ga0207711_10003381 Ga0207711_1000338113 240
490 3300025941 Ga0207711_10003474 Ga0207711_1000347410 240
491 3300025941 Ga0207711_10004333 Ga0207711_100043339 240
492 3300025941 Ga0207711_10005686 Ga0207711_100056862 240
493 3300025941 Ga0207711_10007344 Ga0207711_100073449 240
494 3300025941 Ga0207711_10019139 Ga0207711_100191392 240
495 3300025941 Ga0207711_10022062 Ga0207711_100220623 240
496 3300025941 Ga0207711_10027834 Ga0207711_100278343 240
497 3300025941 Ga0207711_10096422 Ga0207711_100964222 240
498 3300025941 Ga0207711_10165843 Ga0207711_101658431 240
499 3300025942 Ga0207689_10008558 Ga0207689_100085583 240
500 3300025942 Ga0207689_10162968 Ga0207689_101629681 240
501 3300025944 Ga0207661_10116626 Ga0207661_101166262 240
502 3300025944 Ga0207661_10177565 Ga0207661_101775652 240
503 3300025945 Ga0207679_10005861 Ga0207679_100058615 240
504 3300025945 Ga0207679_10006949 Ga0207679_100069492 240
505 3300025945 Ga0207679_10013276 Ga0207679_100132763 240
506 3300025945 Ga0207679_10043087 Ga0207679_100430873 240
507 3300025945 Ga0207679_10152578 Ga0207679_101525783 240
508 3300025945 Ga0207679_10336950 Ga0207679_103369502 240
509 3300025949 Ga0207667_10352161 Ga0207667_103521611 240
510 3300025949 Ga0207667_10460739 Ga0207667_104607391 240
511 3300025949 Ga0207667_10885579 Ga0207667_108855792 240
512 3300025949 Ga0207667_10906184 Ga0207667_109061841 240
513 3300025960 Ga0207651_10002259 Ga0207651_100022594 240
514 3300025960 Ga0207651_10016439 Ga0207651_100164394 240
515 3300025960 Ga0207651_10048109 Ga0207651_100481093 240
516 3300025961 Ga0207712_10000629 Ga0207712_1000062929 240
517 3300025961 Ga0207712_10038449 Ga0207712_100384494 240
518 3300025961 Ga0207712_10274154 Ga0207712_102741542 240
519 3300025972 Ga0207668_10012745 Ga0207668_100127454 240
520 3300025981 Ga0207640_10026004 Ga0207640_100260042 240
521 3300025986 Ga0207658_10000205 Ga0207658_100002053 240
522 3300025986 Ga0207658_10000359 Ga0207658_1000035922 240
523 3300025986 Ga0207658_10009870 Ga0207658_100098706 240
524 3300025986 Ga0207658_10031774 Ga0207658_100317743 240
525 3300025986 Ga0207658_10588678 Ga0207658_105886782 240
526 3300025986 Ga0207658_10605136 Ga0207658_106051362 240
527 3300026023 Ga0207677_10003777 Ga0207677_100037771 240
528 3300026023 Ga0207677_10014749 Ga0207677_100147494 240
529 3300026023 Ga0207677_10644426 Ga0207677_106444262 240
530 3300026035 Ga0207703_10000376 Ga0207703_1000037630 240
531 3300026035 Ga0207703_10001763 Ga0207703_1000176316 240
532 3300026035 Ga0207703_10012799 Ga0207703_100127993 240
533 3300026035 Ga0207703_10024235 Ga0207703_100242353 240
534 3300026035 Ga0207703_10035362 Ga0207703_100353623 240
535 3300026035 Ga0207703_10039232 Ga0207703_100392323 240
536 3300026041 Ga0207639_10046376 Ga0207639_100463763 240
537 3300026041 Ga0207639_10111731 Ga0207639_101117313 240
538 3300026041 Ga0207639_10127158 Ga0207639_101271581 240
539 3300026067 Ga0207678_10000681 Ga0207678_1000068121 240
540 3300026067 Ga0207678_10011552 Ga0207678_100115524 240
541 3300026067 Ga0207678_10012349 Ga0207678_100123493 240
542 3300026067 Ga0207678_10056631 Ga0207678_100566312 240
543 3300026067 Ga0207678_10222164 Ga0207678_102221641 240
544 3300026067 Ga0207678_10289967 Ga0207678_102899672 240
545 3300026067 Ga0207678_10330988 Ga0207678_103309881 240
546 3300026075 Ga0207708_10506153 Ga0207708_105061532 240
547 3300026078 Ga0207702_10014863 Ga0207702_100148633 240
548 3300026078 Ga0207702_10190577 Ga0207702_101905772 240
549 3300026078 Ga0207702_10352715 Ga0207702_103527153 240
550 3300026078 Ga0207702_10454515 Ga0207702_104545151 240
551 3300026088 Ga0207641_10000817 Ga0207641_1000081732 240
552 3300026088 Ga0207641_10003247 Ga0207641_100032476 240
553 3300026088 Ga0207641_10030667 Ga0207641_100306671 240
554 3300026088 Ga0207641_10172641 Ga0207641_101726413 240
555 3300026088 Ga0207641_10189532 Ga0207641_101895323 240
556 3300026089 Ga0207648_10001389 Ga0207648_1000138925 240
557 3300026089 Ga0207648_10011967 Ga0207648_100119674 240
558 3300026089 Ga0207648_10076108 Ga0207648_100761084 240
559 3300026089 Ga0207648_10109533 Ga0207648_101095332 240
560 3300026095 Ga0207676_10003927 Ga0207676_1000392711 240
561 3300026095 Ga0207676_10019732 Ga0207676_100197325 240
562 3300026095 Ga0207676_10030560 Ga0207676_100305603 240
563 3300026095 Ga0207676_10034399 Ga0207676_100343991 240
564 3300026095 Ga0207676_10050766 Ga0207676_100507662 240
565 3300026116 Ga0207674_10002210 Ga0207674_100022104 240
566 3300026116 Ga0207674_10023115 Ga0207674_100231154 240
567 3300026116 Ga0207674_10328720 Ga0207674_103287201 240
568 3300026116 Ga0207674_10375265 Ga0207674_103752653 240
569 3300026116 Ga0207674_10961871 Ga0207674_109618711 240
570 3300026118 Ga0207675_100000568 Ga0207675_1000005683 240
571 3300026118 Ga0207675_100162641 Ga0207675_1001626412 240
572 3300026118 Ga0207675_100436963 Ga0207675_1004369632 240
573 3300026118 Ga0207675_100851292 Ga0207675_1008512922 240
574 3300026121 Ga0207683_10001782 Ga0207683_100017823 240
575 3300026121 Ga0207683_10005777 Ga0207683_100057774 240
576 3300026121 Ga0207683_10270024 Ga0207683_102700242 240
577 3300026142 Ga0207698_10014560 Ga0207698_100145602 240
578 3300026142 Ga0207698_10030407 Ga0207698_100304074 240
579 3300026142 Ga0207698_10170806 Ga0207698_101708062 240
580 3300026142 Ga0207698_10246373 Ga0207698_102463732 240
581 3300026142 Ga0207698_10258001 Ga0207698_102580012 240
582 3300027876 Ga0209974_10004641 Ga0209974_100046413 240
583 3300028379 Ga0268266_10001998 Ga0268266_1000199817 240
584 3300028379 Ga0268266_10002205 Ga0268266_100022057 240
585 3300028379 Ga0268266_10028925 Ga0268266_100289254 240
586 3300028379 Ga0268266_10031817 Ga0268266_100318174 240
587 3300028379 Ga0268266_10042990 Ga0268266_100429903 240
588 3300028379 Ga0268266_10332689 Ga0268266_103326892 240
589 3300028379 Ga0268266_10585657 Ga0268266_105856571 240
590 3300028380 Ga0268265_10005660 Ga0268265_100056606 240
591 3300028380 Ga0268265_10020971 Ga0268265_100209713 240
592 3300028380 Ga0268265_10027142 Ga0268265_100271423 240
593 3300028380 Ga0268265_10087229 Ga0268265_100872294 240
594 3300028380 Ga0268265_10141668 Ga0268265_101416683 240
595 3300028380 Ga0268265_11022152 Ga0268265_110221521 240
596 3300028381 Ga0268264_10000228 Ga0268264_1000022822 240
597 3300028381 Ga0268264_10014583 Ga0268264_100145832 240
598 3300028381 Ga0268264_10049833 Ga0268264_100498332 240
599 3300028381 Ga0268264_10086834 Ga0268264_100868343 240
600 3300028381 Ga0268264_10115006 Ga0268264_101150062 240
601 3300028794 Ga0307515_10171424 Ga0307515_101714242 240
602 3300031456 Ga0307513_10030747 Ga0307513_100307473 240
603 3300031548 Ga0307408_100076794 Ga0307408_1000767942 240
604 3300031548 Ga0307408_100081523 Ga0307408_1000815233 240
605 3300031616 Ga0307508_10124618 Ga0307508_101246182 240
606 3300031730 Ga0307516_10127761 Ga0307516_101277611 240
607 3300031731 Ga0307405_10000893 Ga0307405_1000089313 240
608 3300031731 Ga0307405_10182310 Ga0307405_101823101 240
609 3300031731 Ga0307405_10333445 Ga0307405_103334452 240
610 3300031824 Ga0307413_10001276 Ga0307413_100012763 240
611 3300031852 Ga0307410_10027516 Ga0307410_100275161 240
612 3300031852 Ga0307410_10634418 Ga0307410_106344182 240
613 3300031901 Ga0307406_10002193 Ga0307406_1000219311 240
614 3300031901 Ga0307406_10035254 Ga0307406_100352544 240
615 3300031901 Ga0307406_10169494 Ga0307406_101694942 240
616 3300031903 Ga0307407_10096364 Ga0307407_100963643 240
617 3300031911 Ga0307412_10002006 Ga0307412_1000200612 240
618 3300031911 Ga0307412_10142298 Ga0307412_101422981 240
619 3300031995 Ga0307409_100736396 Ga0307409_1007363961 240
620 3300032002 Ga0307416_100002373 Ga0307416_10000237310 240
621 3300032002 Ga0307416_100005106 Ga0307416_1000051064 240
622 3300032002 Ga0307416_100030495 Ga0307416_1000304952 240
623 3300032002 Ga0307416_100898989 Ga0307416_1008989891 240
624 3300032002 Ga0307416_101042768 Ga0307416_1010427682 240
625 3300032004 Ga0307414_10302055 Ga0307414_103020553 240
626 3300032004 Ga0307414_10398595 Ga0307414_103985951 240
627 3300032004 Ga0307414_10628947 Ga0307414_106289472 240
628 3300032005 Ga0307411_10003495 Ga0307411_100034957 240
629 3300032005 Ga0307411_10020905 Ga0307411_100209054 240
630 3300032126 Ga0307415_100000632 Ga0307415_1000006323 240
631 3300032126 Ga0307415_100004323 Ga0307415_1000043234 240
632 3300032126 Ga0307415_100010882 Ga0307415_1000108824 240
633 3300032126 Ga0307415_100040164 Ga0307415_1000401642 240
634 3300033180 Ga0307510_10017255 Ga0307510_100172551 240
635 3300033180 Ga0307510_10052161 Ga0307510_100521613 240
636 3300033541 Ga0316596_1045629 Ga0316596_10456291 240
637 3300035090 Ga0373949_0085340 Ga0373949_0085340_54_776 240
638 3300035170 Ga0373943_0011702 Ga0373943_0011702_2706_3428 240
639 3300035691 Ga0373931_0192679 Ga0373931_0192679_120_842 240
640 3300035692 Ga0373935_0179724 Ga0373935_0179724_620_1342 240
641 3300036401 Ga0373937_0073957 Ga0373937_0073957_1908_2630 240
642 3300037312 Ga0395899_0000732 Ga0395899_0000732_27720_28442 240
643 3300037312 Ga0395899_0003877 Ga0395899_0003877_8678_9400 240
644 3300037312 Ga0395899_0007496 Ga0395899_0007496_2319_3041 240
645 3300037312 Ga0395899_0016128 Ga0395899_0016128_577_1302 240
646 3300037312 Ga0395899_0191075 Ga0395899_0191075_236_958 240
647 3300037312 Ga0395899_0289365 Ga0395899_0289365_141_863 240
648 3300037418 Ga0395900_0001059 Ga0395900_0001059_19162_19884 240
649 3300037418 Ga0395900_0002358 Ga0395900_0002358_12590_13312 240
650 3300037418 Ga0395900_0011356 Ga0395900_0011356_3262_3984 240
651 3300037418 Ga0395900_0041612 Ga0395900_0041612_1580_2302 240
652 3300037418 Ga0395900_0053747 Ga0395900_0053747_1235_1957 240
653 3300037418 Ga0395900_0064293 Ga0395900_0064293_1069_1791 240
654 3300037418 Ga0395900_0101520 Ga0395900_0101520_393_1115 240
655 3300037418 Ga0395900_0121960 Ga0395900_0121960_623_1345 240
656 3300037418 Ga0395900_0149229 Ga0395900_0149229_1016_1738 240
657 3300037418 Ga0395900_0215547 Ga0395900_0215547_1013_1735 240
658 3300037418 Ga0395900_0445874 Ga0395900_0445874_511_1233 240
659 3300037418 Ga0395900_0607628 Ga0395900_0607628_150_872 240
660 3300037418 Ga0395900_0741008 Ga0395900_0741008_49_771 240
661 3300037418 Ga0395900_0785197 Ga0395900_0785197_108_830 240
662 3300037418 Ga0395900_0795800 Ga0395900_0795800_70_792 240
663 3300037466 Ga0395898_0009587 Ga0395898_0009587_6323_7045 240
664 3300037466 Ga0395898_0043547 Ga0395898_0043547_1927_2649 240
665 3300037466 Ga0395898_0048764 Ga0395898_0048764_3086_3808 240
666 3300037466 Ga0395898_0063110 Ga0395898_0063110_2472_3194 240
667 3300037466 Ga0395898_0206310 Ga0395898_0206310_755_1477 240
668 3300037466 Ga0395898_0299874 Ga0395898_0299874_736_1458 240
669 3300037466 Ga0395898_0885097 Ga0395898_0885097_77_799 240
670 3300037471 Ga0395905_0000204 Ga0395905_0000204_47404_48126 240
671 3300037471 Ga0395905_0002039 Ga0395905_0002039_4758_5480 240
672 3300037471 Ga0395905_0003861 Ga0395905_0003861_14206_14928 240
673 3300037471 Ga0395905_0006180 Ga0395905_0006180_2346_3068 240
674 3300037471 Ga0395905_0016548 Ga0395905_0016548_4961_5683 240
675 3300037471 Ga0395905_0017736 Ga0395905_0017736_2585_3307 240
676 3300037471 Ga0395905_0017949 Ga0395905_0017949_1496_2218 240
677 3300037471 Ga0395905_0035013 Ga0395905_0035013_2586_3359 240
678 3300037471 Ga0395905_0045026 Ga0395905_0045026_2312_3034 240
679 3300037471 Ga0395905_0062326 Ga0395905_0062326_56_778 240
680 3300037471 Ga0395905_0080957 Ga0395905_0080957_747_1469 240
681 3300037471 Ga0395905_0089884 Ga0395905_0089884_1987_2709 240
682 3300037471 Ga0395905_0110740 Ga0395905_0110740_1041_1763 240
683 3300037471 Ga0395905_0124837 Ga0395905_0124837_1459_2181 240
684 3300037471 Ga0395905_0132906 Ga0395905_0132906_1190_1912 240
685 3300037471 Ga0395905_0137015 Ga0395905_0137015_45_767 240
686 3300037471 Ga0395905_0149479 Ga0395905_0149479_1235_1957 240
687 3300037471 Ga0395905_0153826 Ga0395905_0153826_250_972 240
688 3300037471 Ga0395905_0304451 Ga0395905_0304451_66_788 240
689 3300037471 Ga0395905_0354486 Ga0395905_0354486_598_1320 240
690 3300037471 Ga0395905_0507387 Ga0395905_0507387_255_977 240
691 3300037471 Ga0395905_0509558 Ga0395905_0509558_175_900 240
692 3300037471 Ga0395905_0552667 Ga0395905_0552667_45_767 240
693 3300037471 Ga0395905_0661894 Ga0395905_0661894_79_801 240
694 3300038443 Ga0395901_0000208 Ga0395901_0000208_52965_53687 240
695 3300038443 Ga0395901_0013604 Ga0395901_0013604_5969_6691 240
696 3300038443 Ga0395901_0016571 Ga0395901_0016571_4798_5520 240
697 3300038443 Ga0395901_0018771 Ga0395901_0018771_5548_6270 240
698 3300038443 Ga0395901_0031581 Ga0395901_0031581_3108_3845 240
699 3300038443 Ga0395901_0127530 Ga0395901_0127530_1913_2635 240
700 3300038443 Ga0395901_0194349 Ga0395901_0194349_690_1412 240
701 3300038443 Ga0395901_0265419 Ga0395901_0265419_901_1623 240
702 3300038443 Ga0395901_0628663 Ga0395901_0628663_89_811 240
703 3300039437 Ga0436365_0033000 Ga0436365_0033000_1181_1903 240
704 3300039447 Ga0436361_0383568 Ga0436361_0383568_1761_2483 240
705 3300039447 Ga0436361_0951343 Ga0436361_0951343_792_1514 240
706 3300041406 Ga0439439_0019853 Ga0439439_0019853_765_1487 240
707 3300041407 Ga0439447_057541 Ga0439447_057541_137_859 240
708 3300041410 Ga0439461_0000083 Ga0439461_0000083_6431_7153 240
709 3300041410 Ga0439461_0011296 Ga0439461_0011296_34_756 240
710 3300041413 Ga0439465_0001274 Ga0439465_0001274_5513_6235 240
711 3300041413 Ga0439465_0004929 Ga0439465_0004929_1509_2231 240
712 3300041413 Ga0439465_0007637 Ga0439465_0007637_2698_3420 240
713 3300041452 Ga0451793_1551258 Ga0451793_1551258_72_794 240
714 3300041486 Ga0451807_1694753 Ga0451807_1694753_1231_1953 240
715 3300041997 Ga0439431_0001511 Ga0439431_0001511_616_1338 240
716 3300042002 Ga0439442_047808 Ga0439442_047808_157_879 240
717 3300042004 Ga0439445_0007385 Ga0439445_0007385_1398_2120 240
718 3300042006 Ga0439432_000391 Ga0439432_000391_8371_9093 240
719 3300042006 Ga0439432_031899 Ga0439432_031899_400_1122 240
720 3300042007 Ga0439449_0020647 Ga0439449_0020647_752_1474 240
721 3300042015 Ga0439462_0000163 Ga0439462_0000163_4169_4891 240
722 3300042142 Ga0450905_000685 Ga0450905_000685_2229_2957 240
723 3300042144 Ga0450889_000465 Ga0450889_000465_3270_3998 240
724 3300042156 Ga0439446_0104539 Ga0439446_0104539_156_878 240
725 3300042157 Ga0439458_0001726 Ga0439458_0001726_1898_2620 240
726 3300042435 Ga0439434_0000796 Ga0439434_0000796_5521_6243 240
727 3300042435 Ga0439434_0001302 Ga0439434_0001302_5609_6331 240
728 3300042439 Ga0439464_0000541 Ga0439464_0000541_3380_4102 240
729 3300044658 Ga0466972_0062664 Ga0466972_0062664_798_1520 240
730 3300044684 Ga0466966_0041833 Ga0466966_0041833_2052_2774 240
731 3300044694 Ga0466963_0007297 Ga0466963_0007297_3682_4404 240
732 3300044765 Ga0466970_0041736 Ga0466970_0041736_507_1229 240
733 3300044842 Ga0466957_0119607 Ga0466957_0119607_575_1297 240
734 3300045049 Ga0466959_0070232 Ga0466959_0070232_1350_2072 240
735 3300045976 Ga0466967_0044914 Ga0466967_0044914_2821_3543 240
736 3300046453 Ga0495627_026097 Ga0495627_026097_98_820 240
737 3300046506 Ga0495583_0014859 Ga0495583_0014859_3482_4204 240
738 3300046525 Ga0495663_0050595 Ga0495663_0050595_41_763 240
739 3300046528 Ga0495642_0027977 Ga0495642_0027977_437_1159 240
740 3300046528 Ga0495642_0042081 Ga0495642_0042081_257_979 240
741 3300046537 Ga0495598_0000438 Ga0495598_0000438_4400_5122 240
742 3300046616 Ga0495668_0011174 Ga0495668_0011174_3965_4687 240
743 3300046616 Ga0495668_0016910 Ga0495668_0016910_179_901 240
744 3300046616 Ga0495668_0036933 Ga0495668_0036933_343_1065 240
745 3300046616 Ga0495668_0072129 Ga0495668_0072129_609_1331 240
746 3300046616 Ga0495668_0148019 Ga0495668_0148019_280_1002 240
747 3300046660 Ga0495625_0395067 Ga0495625_0395067_10_732 240
748 3300046665 Ga0495661_0096729 Ga0495661_0096729_30_752 240
749 3300046684 Ga0495669_0000090 Ga0495669_0000090_15019_15741 240
750 3300046684 Ga0495669_0007174 Ga0495669_0007174_3389_4111 240
751 3300046684 Ga0495669_0027579 Ga0495669_0027579_580_1302 240
752 3300046691 Ga0495670_0000017 Ga0495670_0000017_86008_86730 240
753 3300046691 Ga0495670_0009359 Ga0495670_0009359_2606_3328 240
754 3300047318 Ga0495636_0280375 Ga0495636_0280375_13_735 240
755 3300047445 Ga0495677_0004345 Ga0495677_0004345_2911_3633 240
756 3300047445 Ga0495677_0004406 Ga0495677_0004406_4284_5006 240
757 3300047472 Ga0495686_0187873 Ga0495686_0187873_362_1084 240
758 3300048903 Ga0496100_0007641 Ga0496100_0007641_2720_3442 240
759 3300048903 Ga0496100_0007971 Ga0496100_0007971_4732_5454 240
760 3300048903 Ga0496100_0121979 Ga0496100_0121979_723_1445 240
761 3300048903 Ga0496100_0160190 Ga0496100_0160190_848_1570 240
762 3300048903 Ga0496100_0516656 Ga0496100_0516656_95_820 240
763 3300048904 Ga0496101_0007869 Ga0496101_0007869_1170_1892 240
764 3300048904 Ga0496101_0018596 Ga0496101_0018596_3575_4297 240
765 3300048904 Ga0496101_0024027 Ga0496101_0024027_2344_3066 240
766 3300048904 Ga0496101_0191793 Ga0496101_0191793_132_854 240
767 3300048904 Ga0496101_0329057 Ga0496101_0329057_244_1017 240
768 3300048904 Ga0496101_0382310 Ga0496101_0382310_92_814 240
769 3300048905 Ga0496102_0063484 Ga0496102_0063484_2267_2989 240
770 3300048905 Ga0496102_0267384 Ga0496102_0267384_499_1221 240
771 3300048906 Ga0496103_0000289 Ga0496103_0000289_34231_34953 240
772 3300048907 Ga0496104_0000161 Ga0496104_0000161_52343_53065 240
773 3300048907 Ga0496104_0000477 Ga0496104_0000477_27364_28089 240
774 3300048908 Ga0496105_0013787 Ga0496105_0013787_5646_6368 240
775 3300048908 Ga0496105_0018885 Ga0496105_0018885_723_1445 240
776 3300048908 Ga0496105_0148677 Ga0496105_0148677_326_1099 240
777 3300048909 Ga0496106_0019431 Ga0496106_0019431_1898_2620 240
778 3300048909 Ga0496106_0113325 Ga0496106_0113325_704_1426 240
779 3300048909 Ga0496106_0155519 Ga0496106_0155519_164_886 240
780 3300048909 Ga0496106_0336173 Ga0496106_0336173_85_807 240
781 3300048910 Ga0496107_0008078 Ga0496107_0008078_4551_5273 240
782 3300048910 Ga0496107_0020708 Ga0496107_0020708_849_1571 240
783 3300048910 Ga0496107_0038934 Ga0496107_0038934_2546_3268 240
784 3300048910 Ga0496107_0047833 Ga0496107_0047833_949_1671 240
785 3300048910 Ga0496107_0099796 Ga0496107_0099796_1246_1968 240
786 3300048910 Ga0496107_0284903 Ga0496107_0284903_397_1119 240
787 3300048911 Ga0496108_0000483 Ga0496108_0000483_3312_4034 240
788 3300048911 Ga0496108_0007321 Ga0496108_0007321_4558_5280 240
789 3300048911 Ga0496108_0015856 Ga0496108_0015856_2752_3474 240
790 3300048911 Ga0496108_0088830 Ga0496108_0088830_1545_2267 240
791 3300048911 Ga0496108_0100530 Ga0496108_0100530_1224_1946 240
792 3300048911 Ga0496108_0328000 Ga0496108_0328000_512_1234 240
793 3300048912 Ga0496109_0000765 Ga0496109_0000765_21617_22339 240
794 3300048912 Ga0496109_0001630 Ga0496109_0001630_10568_11290 240
795 3300048912 Ga0496109_0006413 Ga0496109_0006413_6156_6878 240
796 3300048912 Ga0496109_0048037 Ga0496109_0048037_2377_3150 240
797 3300048912 Ga0496109_0060928 Ga0496109_0060928_783_1508 240
798 3300048912 Ga0496109_0150138 Ga0496109_0150138_1435_2157 240
799 3300048912 Ga0496109_0233201 Ga0496109_0233201_113_835 240
800 3300048912 Ga0496109_0487740 Ga0496109_0487740_348_1070 240
801 3300048912 Ga0496109_0806290 Ga0496109_0806290_94_816 240
802 3300048913 Ga0496110_0001524 Ga0496110_0001524_11423_12145 240
803 3300048913 Ga0496110_0008357 Ga0496110_0008357_183_956 240
804 3300048913 Ga0496110_0021450 Ga0496110_0021450_1879_2601 240
805 3300048913 Ga0496110_0027620 Ga0496110_0027620_1927_2649 240
806 3300048914 Ga0496111_0002167 Ga0496111_0002167_7172_7894 240
807 3300048914 Ga0496111_0012076 Ga0496111_0012076_1322_2044 240
808 3300048914 Ga0496111_0133133 Ga0496111_0133133_276_1049 240
809 3300048914 Ga0496111_0143151 Ga0496111_0143151_820_1542 240
810 3300048914 Ga0496111_0149052 Ga0496111_0149052_817_1539 240
811 3300048914 Ga0496111_0163715 Ga0496111_0163715_511_1233 240
812 3300048915 Ga0496112_0001631 Ga0496112_0001631_2862_3584 240
813 3300048915 Ga0496112_0024451 Ga0496112_0024451_4945_5667 240
814 3300048915 Ga0496112_0034069 Ga0496112_0034069_4041_4763 240
815 3300048915 Ga0496112_0034997 Ga0496112_0034997_1644_2417 240
816 3300048915 Ga0496112_0104835 Ga0496112_0104835_2059_2781 240
817 3300048915 Ga0496112_0165479 Ga0496112_0165479_455_1177 240
818 3300048915 Ga0496112_0172328 Ga0496112_0172328_805_1527 240
819 3300048916 Ga0496113_0003331 Ga0496113_0003331_5637_6359 240
820 3300048916 Ga0496113_0011729 Ga0496113_0011729_2619_3392 240
821 3300048916 Ga0496113_0163528 Ga0496113_0163528_432_1154 240
822 3300048917 Ga0496114_0000162 Ga0496114_0000162_8631_9353 240
823 3300048917 Ga0496114_0028375 Ga0496114_0028375_3070_3792 240
824 3300048917 Ga0496114_0623103 Ga0496114_0623103_26_751 240
825 3300048918 Ga0496115_0026907 Ga0496115_0026907_2327_3052 240
826 3300048918 Ga0496115_0041325 Ga0496115_0041325_1417_2139 240
827 3300048920 Ga0496117_0014969 Ga0496117_0014969_5874_6596 240
828 3300048921 Ga0496118_0034873 Ga0496118_0034873_3186_3908 240
829 3300048922 Ga0496119_0000734 Ga0496119_0000734_5734_6456 240
830 3300048923 Ga0496120_0028258 Ga0496120_0028258_139_861 240
831 3300048924 Ga0496121_0009641 Ga0496121_0009641_62_784 240
832 3300048924 Ga0496121_0016344 Ga0496121_0016344_82_804 240
833 3300048925 Ga0496122_0016591 Ga0496122_0016591_595_1317 240
834 3300048926 Ga0496123_0006076 Ga0496123_0006076_6853_7575 240
835 3300048927 Ga0496124_0006526 Ga0496124_0006526_6302_7024 240
836 3300048928 Ga0496125_0072756 Ga0496125_0072756_1869_2591 240
837 3300048929 Ga0496126_0000661 Ga0496126_0000661_14696_15418 240
838 3300049569 Ga0501032_0008370 Ga0501032_0008370_4023_4745 240
839 3300049570 Ga0501033_0009316 Ga0501033_0009316_1103_1825 240
840 3300049570 Ga0501033_0166772 Ga0501033_0166772_806_1528 240
841 3300049571 Ga0501034_0024565 Ga0501034_0024565_3806_4528 240
842 3300049571 Ga0501034_0211173 Ga0501034_0211173_906_1628 240
843 3300049572 Ga0501036_0026215 Ga0501036_0026215_1191_1913 240
844 3300049573 Ga0501037_0019877 Ga0501037_0019877_1007_1729 240
845 3300049573 Ga0501037_0175535 Ga0501037_0175535_475_1197 240
846 3300049574 Ga0501038_0014173 Ga0501038_0014173_2749_3471 240
847 3300049575 Ga0501039_0035822 Ga0501039_0035822_260_982 240
848 3300049575 Ga0501039_0224852 Ga0501039_0224852_368_1090 240
849 3300049579 Ga0501043_0061572 Ga0501043_0061572_1299_2021 240
850 3300049579 Ga0501043_0090184 Ga0501043_0090184_540_1262 240
851 3300049580 Ga0501046_0004038 Ga0501046_0004038_2787_3509 240
852 3300049581 Ga0501047_0013850 Ga0501047_0013850_4554_5276 240
853 3300049581 Ga0501047_0041687 Ga0501047_0041687_2285_3007 240
854 3300049582 Ga0501048_0004818 Ga0501048_0004818_4011_4733 240
855 3300049582 Ga0501048_0059226 Ga0501048_0059226_135_857 240
856 3300049583 Ga0501067_0022576 Ga0501067_0022576_2733_3455 240
857 3300049583 Ga0501067_0046122 Ga0501067_0046122_1168_1890 240
858 3300049584 Ga0501068_0002828 Ga0501068_0002828_7324_8046 240
859 3300049584 Ga0501068_0011189 Ga0501068_0011189_1491_2213 240
860 3300049585 Ga0501069_0005584 Ga0501069_0005584_4767_5489 240
861 3300049586 Ga0501070_0011936 Ga0501070_0011936_1176_1898 240
862 3300049586 Ga0501070_0128619 Ga0501070_0128619_1069_1791 240
863 3300049586 Ga0501070_0147657 Ga0501070_0147657_847_1569 240
864 3300049589 Ga0501073_0006565 Ga0501073_0006565_6753_7475 240
865 3300049589 Ga0501073_0011449 Ga0501073_0011449_1990_2712 240
866 3300049589 Ga0501073_0017094 Ga0501073_0017094_1692_2414 240
867 3300049589 Ga0501073_0243637 Ga0501073_0243637_371_1093 240
868 3300049590 Ga0501074_0027284 Ga0501074_0027284_910_1632 240
869 3300049590 Ga0501074_0446870 Ga0501074_0446870_88_810 240
870 3300049674 Ga0501242_020514 Ga0501242_020514_11_733 240
871 3300049677 Ga0501247_013884 Ga0501247_013884_130_852 240
872 3300049705 Ga0501225_0005489 Ga0501225_0005489_2844_3617 240
873 3300049741 Ga0501079_0130445 Ga0501079_0130445_48_770 240
874 3300049742 Ga0501080_0005541 Ga0501080_0005541_9253_9975 240
875 3300049742 Ga0501080_0047371 Ga0501080_0047371_578_1300 240
876 3300049742 Ga0501080_0125486 Ga0501080_0125486_595_1317 240
877 3300049742 Ga0501080_0660514 Ga0501080_0660514_66_788 240
878 3300049744 Ga0501083_0003134 Ga0501083_0003134_6986_7708 240
879 3300049744 Ga0501083_0037678 Ga0501083_0037678_1879_2601 240
880 3300049744 Ga0501083_0167809 Ga0501083_0167809_638_1360 240
881 3300049822 Ga0501035_0200080 Ga0501035_0200080_326_1048 240
882 3300049822 Ga0501035_0377184 Ga0501035_0377184_229_951 240
883 3300049823 Ga0501044_0018457 Ga0501044_0018457_2613_3335 240
884 3300049823 Ga0501044_0022969 Ga0501044_0022969_3806_4528 240
885 3300049823 Ga0501044_0064259 Ga0501044_0064259_656_1378 240
886 3300049823 Ga0501044_0087644 Ga0501044_0087644_2119_2841 240
887 3300050493 nmdc:mga0k408_158065_c1 nmdc:mga0k408_158065_c1_392_1114 240
888 3300050511 nmdc:mga08y16_13971_c1 nmdc:mga08y16_13971_c1_1062_1790 240
889 3300050513 nmdc:mga0rr50_292575_c1 nmdc:mga0rr50_292575_c1_373_1095 240
890 3300050515 nmdc:mga0a205_1895_c1 nmdc:mga0a205_1895_c1_5469_6191 240
891 3300053086 Ga0500578_0023188 Ga0500578_0023188_28_750 240
892 3300053087 Ga0500643_033993 Ga0500643_033993_182_904 240
893 3300053093 Ga0500651_0214031 Ga0500651_0214031_258_980 240
894 3300053094 Ga0500566_0031285 Ga0500566_0031285_302_1024 240
895 3300053096 Ga0500641_0007151 Ga0500641_0007151_1328_2050 240
896 3300053096 Ga0500641_0023402 Ga0500641_0023402_330_1052 240
897 3300053119 Ga0500595_000514 Ga0500595_000514_18065_18787 240
898 3300053119 Ga0500595_050930 Ga0500595_050930_534_1256 240
899 3300053131 Ga0500652_137751 Ga0500652_137751_147_869 240
900 3300053134 Ga0500658_0000049 Ga0500658_0000049_54005_54727 240
901 3300053134 Ga0500658_0004102 Ga0500658_0004102_2085_2807 240
902 3300053134 Ga0500658_0017152 Ga0500658_0017152_1953_2675 240
903 3300053140 Ga0500573_0167193 Ga0500573_0167193_419_1141 240
904 3300053151 Ga0500604_0002130 Ga0500604_0002130_2073_2795 240
905 3300053151 Ga0500604_0045917 Ga0500604_0045917_454_1176 240
906 3300053153 Ga0500616_0002088 Ga0500616_0002088_7938_8660 240
907 3300053731 Ga0500609_007986 Ga0500609_007986_101_823 240
908 3300053739 Ga0500587_000297 Ga0500587_000297_1423_2145 240
909 3300060353 Ga0501082_0012990 Ga0501082_0012990_3559_4281 240
910 3300060353 Ga0501082_0039019 Ga0501082_0039019_2162_2884 240
911 3300060353 Ga0501082_0129034 Ga0501082_0129034_366_1088 240

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

108

219

0.96

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

9

115

0.96

PF00106

adh_short

short chain dehydrogenase

108

174

0.95

PF00106

adh_short

short chain dehydrogenase

3

113

0.94

PF08659

KR

KR domain

4

114

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
4kms-assembly1.cif.gz_A-2 crystal structure of acetoacetyl-coa reductase from rickettsia felis 0.959 1 236
4wk6-assembly1.cif.gz_D crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg) (g141a) from vibrio cholerae in complex with nadph 0.9565 3 240
4kms-assembly1.cif.gz_B-2 crystal structure of acetoacetyl-coa reductase from rickettsia felis 0.9564 1 236
4k6c-assembly1.cif.gz_A x-ray crystal structure of a putative acetoacyl-coa reductase from burkholderia cenocepacia 0.9542 2 240
4n5l-assembly1.cif.gz_A crystal structure of (r)-3-hydroxybutyryl-coa dehydrogenase from ralstonia eutropha 0.9495 2 240
ID Description Score Start End Superfamily
4kmsB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9564 1 236 3.40.50.720
4kmsB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9357 1 236 3.40.50.720
af_Q0JDU3_1_168_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9308 74 239 3.40.50.720
4ni5A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9306 2 240 3.40.50.720
4rziB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9288 3 239 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A7R8W4L7-F1-model_v4 3-oxoacyl-[acyl-carrier-protein] reductase (EC 1.1.1.100) 0.9676 1 235 GO:0005737
GO:0018454
GO:0042619
AF-A0A526RE03-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9597 1 174 GO:0016491
AF-N0B6H7-F1-model_v4 Acetoacetyl-CoA reductase 0.9573 1 240 GO:0005737
GO:0018454
GO:0042619
AF-A0A6A5LF29-F1-model_v4 deleted 0.957 1 227
AF-A0A2S6R0W4-F1-model_v4 Acetoacetyl-CoA reductase (EC 1.1.1.36) 0.9569 1 240 GO:0005737
GO:0018454
GO:0042619

Feature Viewer

pLDDT pTM Quality
89.63 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map