F485414

General Info

Members Datasets Scaffolds Average Seq Length
909 400 909 230

Family's Representative Sequence

Representative Sequence 3300031249|Ga0265339_10233698|Ga0265339_102336981
Length 253
Sequence VGACGAAVGYNGGMGDLPDHSELSASASGPTRASAFAVHVFTASGAALGLLALDAASRRGWPLMFLWLGLALIVDGVDGTFARRLRVAEVVPRWSGEVLDFVVDFVTYVFVPAYAIAVGGLLPDKLAVPLALVVVVTGALYCADRRMKTDDNYFRGFPALWNLAAFYLFLLRPNPWIAAAAIGALAVLTFVPFPFIHPMRVRRGRTLNIALLAVWSVLAVAALWQDLQPQPWIVVALCAVGLYFLGAGLTRRS

Samples

Sample ID Description Type Environment
1 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
2 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
3 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
4 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
5 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
6 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
7 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
8 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
9 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
10 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
11 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
12 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
13 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
14 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
15 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
16 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
17 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
18 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
19 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
20 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
21 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
22 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
23 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
24 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
25 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
26 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
27 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
28 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
29 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
30 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
31 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
32 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
33 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
34 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
35 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
36 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
37 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
38 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
39 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
40 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
41 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
42 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
43 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
44 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
45 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
46 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
47 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
48 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
49 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
50 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
51 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
52 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
53 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
54 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
55 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
56 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
57 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
58 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
59 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
60 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
61 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
62 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
63 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
64 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
65 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
66 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
67 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
68 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
69 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
70 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
71 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
72 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
73 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
74 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
75 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
76 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
77 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
78 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
79 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
80 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
81 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
82 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
83 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
84 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
85 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
86 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
87 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
88 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
89 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
90 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
91 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
92 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
93 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
94 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
95 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
96 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
97 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
98 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
99 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
100 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
101 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
102 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
103 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
104 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
105 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
106 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
107 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
108 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
109 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
110 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
111 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
112 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
113 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
114 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
115 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
116 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
117 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
118 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
119 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
120 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
121 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
122 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
123 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
124 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
125 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
126 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
127 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
128 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
129 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
130 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
131 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
132 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
133 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
134 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
135 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
136 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
137 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
138 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
139 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
140 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
141 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
142 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
143 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
144 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
145 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
146 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
147 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
148 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
149 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
150 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
151 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
152 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
153 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
154 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
155 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
156 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
157 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
159 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
223 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
224 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
225 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
226 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
227 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
228 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
229 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
233 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
234 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
235 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
236 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
237 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
238 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
239 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
240 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
241 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
242 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
243 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
244 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
245 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
246 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
247 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
248 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
249 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
250 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
251 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
252 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
253 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
254 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
255 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
256 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
257 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
258 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
259 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
260 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
261 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
262 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
263 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
264 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
265 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
266 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
267 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
268 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
269 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
270 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
271 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
272 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
273 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
274 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
275 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
276 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
277 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
278 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
279 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
280 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
281 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
282 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
283 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
284 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
285 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
286 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
287 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
288 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
289 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
290 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
291 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
292 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
293 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
294 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
295 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
296 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
297 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
298 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
299 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
300 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
301 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
302 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
303 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
304 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
305 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
306 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
307 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
308 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
309 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
310 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
311 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
312 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
313 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
314 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
315 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
316 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
317 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
318 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
319 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
320 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
321 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
322 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
323 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
324 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
325 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
326 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
327 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
328 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
329 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
330 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
331 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
332 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
333 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
334 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
335 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
336 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
337 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
338 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
339 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
340 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
341 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
342 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
343 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
344 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
345 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
346 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
347 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
348 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
349 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
350 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
351 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
352 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
353 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
354 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
355 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
356 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
357 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
358 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
359 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
360 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
361 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
362 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
363 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
364 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
365 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
366 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
367 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
368 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
369 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
370 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
371 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
372 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
373 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
374 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
375 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
376 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
377 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
378 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
379 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
380 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
381 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
382 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
383 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
384 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
385 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
386 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
387 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
388 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
389 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
390 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
391 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
392 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
393 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
394 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
395 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
396 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
397 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
398 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
399 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
400 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.52
Nodule 0
Rhizoplane 9.02
Rhizosphere 86.8
Stem 0
Stem Tuber 0
Unclassified 0.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 2214772983 2209111006 Bacteria 12374
2 ARSoilYngRDRAFT_c00234 3300000042 Bacteria 8859
3 ARcpr5yngRDRAFT_c000900 3300000043 Bacteria 3501
4 ARSoilOldRDRAFT_c000126 3300000044 Bacteria 13655
5 ARCol0oldRDRAFT_c00368 3300000045 Bacteria 4373
6 ARCol0yngRDRAFT_1000669 3300000652 Bacteria 3511
7 JGI24736J21556_1007238 3300001904 Bacteria 1866
8 JGI24752J21851_1002485 3300001976 Bacteria 2455
9 JGI24747J21853_1003999 3300001978 Bacteria 1300
10 JGI24739J22299_10002770 3300001989 Bacteria 6738
11 JGI24737J22298_10000960 3300001990 Bacteria 10240
12 JGI24737J22298_10007118 3300001990 Bacteria 3790
13 JGI24743J22301_10005364 3300001991 Bacteria 2136
14 JGI24750J21931_1000172 3300002070 Bacteria 10780
15 JGI24745J21846_1000099 3300002073 Bacteria 6492
16 JGI24738J21930_10000223 3300002075 Bacteria 15332
17 JGI24749J21850_1000914 3300002076 Bacteria 4235
18 JGI24035J26624_1001421 3300002126 Bacteria 2256
19 JGI24034J26672_10000557 3300002239 Bacteria 4762
20 JGI24742J22300_10000264 3300002244 Bacteria 7810
21 JGI25406J46586_10015257 3300003203 Bacteria 3245
22 JGI25405J52794_10009433 3300003911 Bacteria 1843
23 Ga0065704_10074561 3300005289 Bacteria 6184
24 Ga0065712_10070835 3300005290 Bacteria 5657
25 Ga0065715_10003522 3300005293 Bacteria 3983
26 Ga0065715_10114409 3300005293 Bacteria 2452
27 Ga0065715_10199137 3300005293 Bacteria 1371
28 Ga0065707_10138112 3300005295 Bacteria 1811
29 Ga0070676_10000012 3300005328 Bacteria 58061
30 Ga0070683_100000139 3300005329 Bacteria 46987
31 Ga0070683_100028063 3300005329 Bacteria 5084
32 Ga0070683_100131284 3300005329 Bacteria 2370
33 Ga0070690_100005164 3300005330 Bacteria 7309
34 Ga0070690_100005412 3300005330 Bacteria 7168
35 Ga0070690_100195677 3300005330 Bacteria 1404
36 Ga0070670_100028821 3300005331 Bacteria 4779
37 Ga0070670_100080618 3300005331 Bacteria 2797
38 Ga0070670_100086294 3300005331 Bacteria 2697
39 Ga0070677_10000125 3300005333 Bacteria 25491
40 Ga0070677_10022517 3300005333 Bacteria 2322
41 Ga0068869_100000605 3300005334 Bacteria 20215
42 Ga0068869_100400594 3300005334 Bacteria 1129
43 Ga0070666_10017025 3300005335 Bacteria 4656
44 Ga0070666_10030551 3300005335 Bacteria 3550
45 Ga0070680_100000179 3300005336 Bacteria 40975
46 Ga0070680_100014505 3300005336 Bacteria 6165
47 Ga0070680_100365293 3300005336 Bacteria 1228
48 Ga0070682_100000319 3300005337 Bacteria 33197
49 Ga0070682_100151071 3300005337 Bacteria 1594
50 Ga0070682_100297041 3300005337 Unclassified 1184
51 Ga0068868_100000593 3300005338 Bacteria 24375
52 Ga0068868_100289458 3300005338 Bacteria 1389
53 Ga0068868_100456107 3300005338 Unclassified 1113
54 Ga0070660_100001605 3300005339 Bacteria 15534
55 Ga0070689_100004685 3300005340 Bacteria 9267
56 Ga0070689_100019695 3300005340 Bacteria 4991
57 Ga0070689_100203237 3300005340 Bacteria 1618
58 Ga0070689_100286571 3300005340 Bacteria 1368
59 Ga0070691_10001565 3300005341 Bacteria 9871
60 Ga0070691_10007128 3300005341 Bacteria 5124
61 Ga0070687_100003572 3300005343 Bacteria 6061
62 Ga0070687_100059049 3300005343 Bacteria 2018
63 Ga0070687_100124778 3300005343 Bacteria 1478
64 Ga0070687_100467046 3300005343 Unclassified 843
65 Ga0070661_100001455 3300005344 Bacteria 16432
66 Ga0070661_100156980 3300005344 Bacteria 1722
67 Ga0070661_100229140 3300005344 Bacteria 1427
68 Ga0070692_10000434 3300005345 Bacteria 12695
69 Ga0070692_10002195 3300005345 Bacteria 7472
70 Ga0070668_100004423 3300005347 Bacteria 10433
71 Ga0070668_100030654 3300005347 Bacteria 4090
72 Ga0070668_100112463 3300005347 Bacteria 2168
73 Ga0070669_100000409 3300005353 Bacteria 32911
74 Ga0070669_100069410 3300005353 Bacteria 2603
75 Ga0070675_100000166 3300005354 Bacteria 40573
76 Ga0070675_100022484 3300005354 Bacteria 5039
77 Ga0070671_100005938 3300005355 Bacteria 9730
78 Ga0070671_100006280 3300005355 Bacteria 9470
79 Ga0070671_100589752 3300005355 Bacteria 960
80 Ga0070674_100000644 3300005356 Bacteria 17586
81 Ga0070674_100003641 3300005356 Bacteria 8682
82 Ga0070674_100092065 3300005356 Bacteria 2191
83 Ga0070674_100350086 3300005356 Unclassified 1193
84 Ga0070673_100000041 3300005364 Bacteria 54096
85 Ga0070673_100057607 3300005364 Bacteria 3070
86 Ga0070673_100310502 3300005364 Bacteria 1391
87 Ga0070688_100000180 3300005365 Bacteria 33887
88 Ga0070688_100011831 3300005365 Bacteria 4866
89 Ga0070688_100544024 3300005365 Bacteria 882
90 Ga0070659_100000752 3300005366 Bacteria 23551
91 Ga0070659_100091485 3300005366 Unclassified 2438
92 Ga0070659_100305726 3300005366 Bacteria 1327
93 Ga0070667_100000365 3300005367 Bacteria 49335
94 Ga0070667_100111792 3300005367 Bacteria 2370
95 Ga0070667_100264796 3300005367 Bacteria 1540
96 Ga0070667_100404215 3300005367 Bacteria 1243
97 Ga0070703_10003914 3300005406 Bacteria 4219
98 Ga0070703_10012992 3300005406 Bacteria 2360
99 Ga0070709_10003137 3300005434 Bacteria 8867
100 Ga0070714_100009592 3300005435 Bacteria 7619
101 Ga0070714_100088726 3300005435 Bacteria 2706
102 Ga0070713_100034352 3300005436 Bacteria 4072
103 Ga0070713_100097183 3300005436 Bacteria 2544
104 Ga0070713_100102543 3300005436 Bacteria 2481
105 Ga0070710_10005022 3300005437 Bacteria 6261
106 Ga0070710_10009725 3300005437 Bacteria 4710
107 Ga0070710_10044400 3300005437 Bacteria 2466
108 Ga0070701_10000493 3300005438 Bacteria 13517
109 Ga0070701_10012908 3300005438 Bacteria 3784
110 Ga0070711_100015744 3300005439 Bacteria 4789
111 Ga0070711_100030851 3300005439 Bacteria 3553
112 Ga0070705_100002314 3300005440 Bacteria 9618
113 Ga0070700_100000467 3300005441 Bacteria 20231
114 Ga0070700_100015212 3300005441 Bacteria 4359
115 Ga0070694_100000065 3300005444 Bacteria 49515
116 Ga0070694_100029375 3300005444 Bacteria 3587
117 Ga0070694_100116812 3300005444 Bacteria 1909
118 Ga0070708_100113795 3300005445 Bacteria 2489
119 Ga0070708_100501514 3300005445 Unclassified 1145
120 Ga0070663_100000473 3300005455 Bacteria 21137
121 Ga0070663_100019373 3300005455 Bacteria 4483
122 Ga0070663_100160367 3300005455 Bacteria 1731
123 Ga0070663_100173840 3300005455 Bacteria 1666
124 Ga0070678_100000091 3300005456 Bacteria 34559
125 Ga0070678_100007141 3300005456 Bacteria 6603
126 Ga0070678_100034927 3300005456 Bacteria 3505
127 Ga0070678_100364214 3300005456 Bacteria 1246
128 Ga0070662_100006535 3300005457 Bacteria 7521
129 Ga0070662_100026059 3300005457 Bacteria 4045
130 Ga0070681_10010003 3300005458 Bacteria 9350
131 Ga0070681_10084108 3300005458 Bacteria 3134
132 Ga0070681_10086642 3300005458 Bacteria 3085
133 Ga0068867_100000859 3300005459 Bacteria 20487
134 Ga0068867_100146404 3300005459 Bacteria 1852
135 Ga0070685_10001731 3300005466 Bacteria 11442
136 Ga0070685_10010966 3300005466 Bacteria 4727
137 Ga0070685_10015115 3300005466 Bacteria 4096
138 Ga0070698_100054628 3300005471 Bacteria 4054
139 Ga0070699_100001464 3300005518 Bacteria 21616
140 Ga0070679_100012754 3300005530 Bacteria 8038
141 Ga0070679_100387110 3300005530 Unclassified 1345
142 Ga0070684_100000219 3300005535 Bacteria 39995
143 Ga0070684_100160770 3300005535 Bacteria 2037
144 Ga0070684_100175075 3300005535 Bacteria 1950
145 Ga0070697_100400514 3300005536 Bacteria 1191
146 Ga0068853_100000600 3300005539 Bacteria 24713
147 Ga0068853_100137654 3300005539 Unclassified 2190
148 Ga0068853_100185112 3300005539 Bacteria 1890
149 Ga0068853_101055976 3300005539 Bacteria 783
150 Ga0070672_100000019 3300005543 Bacteria 69855
151 Ga0070672_100284015 3300005543 Bacteria 1400
152 Ga0070686_100007875 3300005544 Bacteria 5955
153 Ga0070686_100013377 3300005544 Bacteria 4697
154 Ga0070686_100032042 3300005544 Unclassified 3220
155 Ga0070686_100074077 3300005544 Bacteria 2237
156 Ga0070695_100000474 3300005545 Bacteria 20848
157 Ga0070696_100003100 3300005546 Bacteria 11055
158 Ga0070696_100068780 3300005546 Bacteria 2487
159 Ga0070696_100078891 3300005546 Bacteria 2329
160 Ga0070696_100107349 3300005546 Bacteria 2008
161 Ga0070693_100001868 3300005547 Bacteria 9623
162 Ga0070693_100146914 3300005547 Bacteria 1490
163 Ga0070665_100010015 3300005548 Bacteria 9588
164 Ga0070665_100298004 3300005548 Bacteria 1615
165 Ga0070704_100000252 3300005549 Bacteria 23218
166 Ga0070704_100001606 3300005549 Bacteria 12238
167 Ga0068855_100019721 3300005563 Bacteria 8099
168 Ga0068855_100139952 3300005563 Bacteria 2760
169 Ga0070664_100000819 3300005564 Bacteria 23927
170 Ga0070664_100069340 3300005564 Bacteria 3017
171 Ga0068857_100113854 3300005577 Bacteria 2432
172 Ga0068857_100618567 3300005577 Bacteria 1025
173 Ga0068854_100001736 3300005578 Bacteria 13299
174 Ga0068856_100002295 3300005614 Bacteria 19718
175 Ga0068856_100110986 3300005614 Bacteria 2739
176 Ga0070702_100000898 3300005615 Bacteria 11591
177 Ga0070702_100050904 3300005615 Bacteria 2368
178 Ga0068852_100001992 3300005616 Bacteria 13920
179 Ga0068852_100417869 3300005616 Bacteria 1322
180 Ga0068859_100001870 3300005617 Bacteria 21434
181 Ga0068859_100229692 3300005617 Bacteria 1943
182 Ga0068859_100535432 3300005617 Bacteria 1266
183 Ga0068859_101135365 3300005617 Bacteria 860
184 Ga0068864_100000429 3300005618 Bacteria 36391
185 Ga0068864_100095718 3300005618 Bacteria 2626
186 Ga0068866_10001028 3300005718 Bacteria 12272
187 Ga0068866_10053984 3300005718 Bacteria 2057
188 Ga0068861_100000169 3300005719 Bacteria 34559
189 Ga0068861_100126569 3300005719 Unclassified 2068
190 Ga0068861_100326621 3300005719 Bacteria 1338
191 Ga0068870_10000586 3300005840 Bacteria 13817
192 Ga0068863_100000381 3300005841 Bacteria 45003
193 Ga0068863_100045258 3300005841 Bacteria 4177
194 Ga0068863_100284008 3300005841 Bacteria 1604
195 Ga0068858_100009197 3300005842 Bacteria 9441
196 Ga0068858_100047150 3300005842 Unclassified 3995
197 Ga0068858_100134470 3300005842 Bacteria 2320
198 Ga0068858_100426437 3300005842 Bacteria 1276
199 Ga0068860_100001472 3300005843 Bacteria 25432
200 Ga0068860_100417216 3300005843 Bacteria 1330
201 Ga0068860_100457462 3300005843 Unclassified 1269
202 Ga0068862_100001886 3300005844 Bacteria 19006
203 Ga0081455_10000036 3300005937 Bacteria 136303
204 Ga0081455_10011971 3300005937 Bacteria 8683
205 Ga0081455_10012017 3300005937 Bacteria 8664
206 Ga0081455_10219782 3300005937 Bacteria 1409
207 Ga0081540_1006238 3300005983 Bacteria 8734
208 Ga0081539_10000800 3300005985 Bacteria 61179
209 Ga0070717_10089000 3300006028 Bacteria 2604
210 Ga0075365_10010543 3300006038 Bacteria 5387
211 Ga0075365_10117200 3300006038 Bacteria 1834
212 Ga0075365_10139257 3300006038 Bacteria 1684
213 Ga0075368_10027809 3300006042 Bacteria 2183
214 Ga0075368_10029855 3300006042 Bacteria 2109
215 Ga0075364_10057707 3300006051 Bacteria 2543
216 Ga0075364_10215227 3300006051 Bacteria 1303
217 Ga0075432_10000873 3300006058 Bacteria 9497
218 Ga0070715_10005082 3300006163 Unclassified 4364
219 Ga0070715_10050840 3300006163 Bacteria 1781
220 Ga0070716_100195534 3300006173 Bacteria 1340
221 Ga0070716_100389171 3300006173 Bacteria 999
222 Ga0070712_100299297 3300006175 Bacteria 1301
223 Ga0070712_100303161 3300006175 Bacteria 1293
224 Ga0070712_100305067 3300006175 Bacteria 1290
225 Ga0070712_100434228 3300006175 Bacteria 1091
226 Ga0075362_10124626 3300006177 Bacteria 1221
227 Ga0075367_10012283 3300006178 Bacteria 4560
228 Ga0075367_10019938 3300006178 Bacteria 3727
229 Ga0097621_100001234 3300006237 Bacteria 17707
230 Ga0097621_100036113 3300006237 Bacteria 3952
231 Ga0097621_100324419 3300006237 Bacteria 1364
232 Ga0068871_100000068 3300006358 Bacteria 57531
233 Ga0068871_100012500 3300006358 Bacteria 6262
234 Ga0068871_100025352 3300006358 Bacteria 4612
235 Ga0075428_100035558 3300006844 Bacteria 5491
236 Ga0075428_100079853 3300006844 Bacteria 3570
237 Ga0075428_100143764 3300006844 Bacteria 2593
238 Ga0075428_100178935 3300006844 Bacteria 2296
239 Ga0075428_100200466 3300006844 Bacteria 2157
240 Ga0075430_100004696 3300006846 Bacteria 11490
241 Ga0075431_100006639 3300006847 Bacteria 11490
242 Ga0075431_100019203 3300006847 Bacteria 6966
243 Ga0075431_100032045 3300006847 Bacteria 5416
244 Ga0075433_10001599 3300006852 Bacteria 16784
245 Ga0075433_10099038 3300006852 Bacteria 2581
246 Ga0075433_10152765 3300006852 Bacteria 2054
247 Ga0075434_100000576 3300006871 Bacteria 28251
248 Ga0075434_100001666 3300006871 Bacteria 18944
249 Ga0075434_100002138 3300006871 Bacteria 17193
250 Ga0075434_100364476 3300006871 Bacteria 1466
251 Ga0075429_100060828 3300006880 Bacteria 3289
252 Ga0075429_100109255 3300006880 Bacteria 2417
253 Ga0068865_100005133 3300006881 Bacteria 7927
254 Ga0068865_100123831 3300006881 Bacteria 1927
255 Ga0068865_100182517 3300006881 Unclassified 1617
256 Ga0097620_100001870 3300006931 Bacteria 21434
257 Ga0097620_100229680 3300006931 Bacteria 1943
258 Ga0097620_100535431 3300006931 Bacteria 1266
259 Ga0097620_101135323 3300006931 Bacteria 860
260 Ga0075435_100002716 3300007076 Bacteria 11816
261 Ga0075435_100358961 3300007076 Bacteria 1250
262 Ga0075435_100365050 3300007076 Bacteria 1239
263 Ga0075435_100453275 3300007076 Bacteria 1106
264 Ga0105251_10030580 3300009011 Bacteria 2702
265 Ga0105244_10058949 3300009036 Bacteria 1936
266 Ga0105250_10042528 3300009092 Bacteria 1821
267 Ga0105250_10211111 3300009092 Unclassified 821
268 Ga0105240_10068510 3300009093 Bacteria 4394
269 Ga0105240_10219427 3300009093 Bacteria 2216
270 Ga0111539_10000082 3300009094 Bacteria 96811
271 Ga0111539_10000503 3300009094 Bacteria 49808
272 Ga0111539_10003417 3300009094 Bacteria 20918
273 Ga0111539_10159099 3300009094 Bacteria 2642
274 Ga0111539_10171712 3300009094 Bacteria 2533
275 Ga0111539_10630065 3300009094 Bacteria 1249
276 Ga0111539_10661815 3300009094 Bacteria 1216
277 Ga0111539_10762633 3300009094 Bacteria 1126
278 Ga0111539_10912107 3300009094 Bacteria 1022
279 Ga0105245_10000780 3300009098 Bacteria 28901
280 Ga0105245_10091423 3300009098 Bacteria 2801
281 Ga0105245_10176454 3300009098 Bacteria 2038
282 Ga0105247_10002726 3300009101 Bacteria 11844
283 Ga0105247_10028323 3300009101 Bacteria 3389
284 Ga0105247_10029759 3300009101 Bacteria 3310
285 Ga0105247_10109400 3300009101 Bacteria 1776
286 Ga0105247_10160703 3300009101 Bacteria 1487
287 Ga0114129_10009008 3300009147 Bacteria 14232
288 Ga0114129_10010082 3300009147 Bacteria 13469
289 Ga0114129_10012751 3300009147 Bacteria 11966
290 Ga0114129_10013874 3300009147 Bacteria 11481
291 Ga0105243_10001083 3300009148 Bacteria 24917
292 Ga0105243_10016567 3300009148 Bacteria 5573
293 Ga0105243_10195204 3300009148 Bacteria 1771
294 Ga0105243_10600505 3300009148 Bacteria 1059
295 Ga0105241_10000760 3300009174 Bacteria 24503
296 Ga0105241_10323813 3300009174 Bacteria 1330
297 Ga0105241_10388460 3300009174 Bacteria 1221
298 Ga0105242_10019812 3300009176 Bacteria 5270
299 Ga0105242_10039143 3300009176 Bacteria 3815
300 Ga0105242_10247165 3300009176 Bacteria 1606
301 Ga0105248_10011305 3300009177 Bacteria 9844
302 Ga0105248_10031416 3300009177 Bacteria 5936
303 Ga0105248_10311016 3300009177 Bacteria 1774
304 Ga0105248_10477198 3300009177 Bacteria 1406
305 Ga0105248_10756855 3300009177 Bacteria 1096
306 Ga0105237_10006171 3300009545 Bacteria 13387
307 Ga0105237_10024205 3300009545 Bacteria 6213
308 Ga0105237_10379394 3300009545 Bacteria 1418
309 Ga0105237_10745220 3300009545 Bacteria 986
310 Ga0105238_10067718 3300009551 Bacteria 3571
311 Ga0105238_10074611 3300009551 Bacteria 3384
312 Ga0105238_10335711 3300009551 Bacteria 1499
313 Ga0105249_10002196 3300009553 Bacteria 16907
314 Ga0105249_10028272 3300009553 Bacteria 5062
315 Ga0105249_10048163 3300009553 Bacteria 3886
316 Ga0105249_10134000 3300009553 Bacteria 2369
317 Ga0099796_10000300 3300010159 Bacteria 7837
318 Ga0105239_10002791 3300010375 Bacteria 21868
319 Ga0105239_10065027 3300010375 Bacteria 4005
320 Ga0105239_10222845 3300010375 Bacteria 2115
321 Ga0105239_10242668 3300010375 Bacteria 2022
322 Ga0105239_10282106 3300010375 Bacteria 1870
323 Ga0105239_10355496 3300010375 Bacteria 1654
324 Ga0105239_10446280 3300010375 Bacteria 1467
325 Ga0105246_10001585 3300011119 Bacteria 13535
326 Ga0105246_10096520 3300011119 Bacteria 2143
327 Ga0105246_10099937 3300011119 Bacteria 2110
328 Ga0105246_10113686 3300011119 Bacteria 1993
329 Ga0105246_10123073 3300011119 Bacteria 1925
330 Ga0105246_10497987 3300011119 Bacteria 1034
331 Ga0157335_1000547 3300012492 Unclassified 1751
332 Ga0157342_1000614 3300012507 Bacteria 2274
333 Ga0157316_1000263 3300012510 Bacteria 2605
334 Ga0157373_10006240 3300013100 Bacteria 8908
335 Ga0157373_10118237 3300013100 Bacteria 1863
336 Ga0157371_10085248 3300013102 Bacteria 2238
337 Ga0157371_10141704 3300013102 Unclassified 1712
338 Ga0157369_10085097 3300013105 Bacteria 3379
339 Ga0157369_10542855 3300013105 Bacteria 1202
340 Ga0157369_10630522 3300013105 Bacteria 1106
341 Ga0157374_10001691 3300013296 Bacteria 18474
342 Ga0157374_10141327 3300013296 Bacteria 2337
343 Ga0157378_10001445 3300013297 Bacteria 21386
344 Ga0157378_10052925 3300013297 Bacteria 3612
345 Ga0157378_10127916 3300013297 Bacteria 2348
346 Ga0157378_10184044 3300013297 Bacteria 1966
347 Ga0157378_10206469 3300013297 Bacteria 1861
348 Ga0157378_10307755 3300013297 Bacteria 1536
349 Ga0157378_10731982 3300013297 Bacteria 1011
350 Ga0163162_10000790 3300013306 Bacteria 29412
351 Ga0163162_10018394 3300013306 Bacteria 6847
352 Ga0163162_10069104 3300013306 Bacteria 3584
353 Ga0163162_10327920 3300013306 Unclassified 1663
354 Ga0157372_10009037 3300013307 Bacteria 10590
355 Ga0157372_10236874 3300013307 Bacteria 2117
356 Ga0157372_11033726 3300013307 Bacteria 951
357 Ga0157375_10000468 3300013308 Bacteria 36848
358 Ga0157375_10078898 3300013308 Bacteria 3327
359 Ga0157375_10087945 3300013308 Bacteria 3160
360 Ga0157375_10390805 3300013308 Bacteria 1558
361 Ga0163163_10003322 3300014325 Bacteria 13641
362 Ga0163163_10020189 3300014325 Bacteria 6270
363 Ga0163163_10156862 3300014325 Bacteria 2320
364 Ga0157380_10002913 3300014326 Bacteria 11638
365 Ga0157380_10009719 3300014326 Bacteria 6903
366 Ga0157380_10144196 3300014326 Bacteria 2050
367 Ga0157380_10668194 3300014326 Bacteria 1039
368 Ga0157377_10000276 3300014745 Bacteria 24762
369 Ga0157377_10349621 3300014745 Unclassified 991
370 Ga0157379_10002285 3300014968 Bacteria 15975
371 Ga0157379_10063216 3300014968 Bacteria 3310
372 Ga0157379_10105406 3300014968 Unclassified 2530
373 Ga0157379_10110590 3300014968 Bacteria 2467
374 Ga0157379_10147731 3300014968 Bacteria 2120
375 Ga0157379_10496643 3300014968 Bacteria 1131
376 Ga0157379_10530703 3300014968 Bacteria 1093
377 Ga0157376_10000692 3300014969 Bacteria 21811
378 Ga0157376_10153359 3300014969 Unclassified 2080
379 Ga0163161_10000384 3300017792 Bacteria 37040
380 Ga0163161_10047076 3300017792 Bacteria 3114
381 Ga0213876_10168301 3300021384 Bacteria 1166
382 Ga0207666_1000097 3300025271 Bacteria 13853
383 Ga0207673_1000201 3300025290 Bacteria 5994
384 Ga0207697_10000550 3300025315 Bacteria 21243
385 Ga0207697_10013264 3300025315 Bacteria 3440
386 Ga0207656_10176504 3300025321 Bacteria 1023
387 Ga0207653_10010851 3300025885 Bacteria 2843
388 Ga0207653_10018054 3300025885 Bacteria 2223
389 Ga0207682_10000088 3300025893 Bacteria 41732
390 Ga0207682_10001441 3300025893 Bacteria 10974
391 Ga0207692_10001966 3300025898 Bacteria 7840
392 Ga0207642_10000381 3300025899 Bacteria 13280
393 Ga0207710_10001324 3300025900 Bacteria 12473
394 Ga0207710_10009271 3300025900 Bacteria 4140
395 Ga0207688_10001203 3300025901 Bacteria 13390
396 Ga0207688_10021688 3300025901 Bacteria 3513
397 Ga0207680_10009047 3300025903 Bacteria 4921
398 Ga0207647_10002714 3300025904 Bacteria 13370
399 Ga0207647_10020089 3300025904 Bacteria 4484
400 Ga0207685_10005159 3300025905 Unclassified 3414
401 Ga0207685_10006707 3300025905 Bacteria 3158
402 Ga0207645_10000140 3300025907 Bacteria 55845
403 Ga0207645_10037790 3300025907 Bacteria 3098
404 Ga0207643_10000083 3300025908 Bacteria 62116
405 Ga0207654_10002699 3300025911 Bacteria 9011
406 Ga0207654_10208412 3300025911 Bacteria 1291
407 Ga0207707_10020854 3300025912 Bacteria 5724
408 Ga0207707_10122457 3300025912 Bacteria 2274
409 Ga0207707_10395287 3300025912 Unclassified 1187
410 Ga0207695_10156107 3300025913 Bacteria 2216
411 Ga0207671_10004533 3300025914 Bacteria 13203
412 Ga0207693_10007583 3300025915 Bacteria 8914
413 Ga0207693_10021626 3300025915 Bacteria 5112
414 Ga0207693_10068883 3300025915 Bacteria 2770
415 Ga0207693_10300615 3300025915 Bacteria 1257
416 Ga0207663_10126218 3300025916 Unclassified 1760
417 Ga0207660_10000073 3300025917 Bacteria 51871
418 Ga0207660_10024362 3300025917 Bacteria 4097
419 Ga0207662_10000964 3300025918 Bacteria 13368
420 Ga0207662_10019591 3300025918 Bacteria 3853
421 Ga0207662_10020636 3300025918 Bacteria 3760
422 Ga0207657_10005395 3300025919 Bacteria 13362
423 Ga0207657_10020125 3300025919 Bacteria 6315
424 Ga0207657_10077205 3300025919 Bacteria 2808
425 Ga0207649_10000450 3300025920 Bacteria 29604
426 Ga0207649_10020627 3300025920 Bacteria 3781
427 Ga0207649_10026888 3300025920 Bacteria 3371
428 Ga0207652_10008726 3300025921 Bacteria 8158
429 Ga0207681_10000097 3300025923 Bacteria 73836
430 Ga0207681_10060128 3300025923 Bacteria 2607
431 Ga0207694_10059954 3300025924 Bacteria 2961
432 Ga0207650_10061678 3300025925 Bacteria 2800
433 Ga0207659_10000092 3300025926 Bacteria 52642
434 Ga0207659_10045065 3300025926 Bacteria 3107
435 Ga0207659_10071746 3300025926 Bacteria 2529
436 Ga0207659_10131290 3300025926 Bacteria 1934
437 Ga0207687_10000219 3300025927 Bacteria 38995
438 Ga0207687_10188559 3300025927 Unclassified 1603
439 Ga0207687_10271732 3300025927 Bacteria 1355
440 Ga0207700_10064607 3300025928 Bacteria 2788
441 Ga0207664_10060581 3300025929 Bacteria 3017
442 Ga0207644_10005083 3300025931 Bacteria 8591
443 Ga0207690_10003312 3300025932 Bacteria 9636
444 Ga0207690_10080436 3300025932 Unclassified 2274
445 Ga0207706_10004310 3300025933 Bacteria 13370
446 Ga0207706_10008823 3300025933 Bacteria 9280
447 Ga0207706_10035694 3300025933 Bacteria 4419
448 Ga0207706_10402431 3300025933 Bacteria 1187
449 Ga0207686_10000796 3300025934 Bacteria 19364
450 Ga0207686_10007990 3300025934 Bacteria 5703
451 Ga0207686_10062208 3300025934 Bacteria 2369
452 Ga0207709_10000362 3300025935 Bacteria 45886
453 Ga0207709_10086413 3300025935 Bacteria 2036
454 Ga0207709_10328809 3300025935 Bacteria 1147
455 Ga0207709_10443875 3300025935 Bacteria 1001
456 Ga0207709_10447410 3300025935 Bacteria 998
457 Ga0207670_10002375 3300025936 Bacteria 9862
458 Ga0207670_10029666 3300025936 Bacteria 3486
459 Ga0207670_10228066 3300025936 Unclassified 1429
460 Ga0207670_10239254 3300025936 Bacteria 1398
461 Ga0207669_10000350 3300025937 Bacteria 20966
462 Ga0207669_10073600 3300025937 Bacteria 2156
463 Ga0207669_10085232 3300025937 Bacteria 2039
464 Ga0207704_10000479 3300025938 Bacteria 17812
465 Ga0207704_10062358 3300025938 Unclassified 2318
466 Ga0207665_10070872 3300025939 Bacteria 2379
467 Ga0207665_10089903 3300025939 Bacteria 2127
468 Ga0207665_10089990 3300025939 Unclassified 2126
469 Ga0207691_10000283 3300025940 Bacteria 50040
470 Ga0207691_10008505 3300025940 Bacteria 9857
471 Ga0207711_10009170 3300025941 Bacteria 8267
472 Ga0207711_10009675 3300025941 Bacteria 8032
473 Ga0207711_10250856 3300025941 Bacteria 1625
474 Ga0207711_10319498 3300025941 Bacteria 1434
475 Ga0207711_10392689 3300025941 Bacteria 1288
476 Ga0207711_10497578 3300025941 Bacteria 1136
477 Ga0207689_10000085 3300025942 Bacteria 75467
478 Ga0207689_10051690 3300025942 Bacteria 3387
479 Ga0207689_10282423 3300025942 Bacteria 1375
480 Ga0207661_10000464 3300025944 Bacteria 26194
481 Ga0207679_10000030 3300025945 Bacteria 169351
482 Ga0207679_10063136 3300025945 Bacteria 2764
483 Ga0207679_10190730 3300025945 Bacteria 1704
484 Ga0207651_10000422 3300025960 Bacteria 18024
485 Ga0207712_10004682 3300025961 Bacteria 8649
486 Ga0207668_10000114 3300025972 Bacteria 57323
487 Ga0207640_10000141 3300025981 Bacteria 52638
488 Ga0207658_10002853 3300025986 Bacteria 12371
489 Ga0207658_10051359 3300025986 Bacteria 3038
490 Ga0207658_10155178 3300025986 Bacteria 1870
491 Ga0207677_10001776 3300026023 Bacteria 11384
492 Ga0207677_10194252 3300026023 Bacteria 1608
493 Ga0207703_10000983 3300026035 Bacteria 27443
494 Ga0207703_10043709 3300026035 Bacteria 3597
495 Ga0207639_10000305 3300026041 Bacteria 34869
496 Ga0207639_10417235 3300026041 Bacteria 1213
497 Ga0207639_10522236 3300026041 Unclassified 1087
498 Ga0207678_10000125 3300026067 Bacteria 63817
499 Ga0207678_10016358 3300026067 Bacteria 6513
500 Ga0207678_10197514 3300026067 Unclassified 1719
501 Ga0207678_10317254 3300026067 Bacteria 1341
502 Ga0207708_10000187 3300026075 Bacteria 48792
503 Ga0207708_10014918 3300026075 Bacteria 5818
504 Ga0207702_10005437 3300026078 Bacteria 11146
505 Ga0207702_10058876 3300026078 Bacteria 3270
506 Ga0207641_10003649 3300026088 Bacteria 13575
507 Ga0207641_10055119 3300026088 Bacteria 3376
508 Ga0207641_10216229 3300026088 Bacteria 1775
509 Ga0207641_10425394 3300026088 Bacteria 1279
510 Ga0207648_10002168 3300026089 Bacteria 21342
511 Ga0207648_10218410 3300026089 Unclassified 1694
512 Ga0207676_10000074 3300026095 Bacteria 101208
513 Ga0207676_10169502 3300026095 Bacteria 1900
514 Ga0207676_10340378 3300026095 Bacteria 1384
515 Ga0207674_10002501 3300026116 Bacteria 23186
516 Ga0207674_10065449 3300026116 Bacteria 3663
517 Ga0207674_10502099 3300026116 Bacteria 1172
518 Ga0207675_100004556 3300026118 Bacteria 13370
519 Ga0207675_100033895 3300026118 Bacteria 4759
520 Ga0207675_100268737 3300026118 Unclassified 1654
521 Ga0207683_10000014 3300026121 Bacteria 128817
522 Ga0207683_10003999 3300026121 Bacteria 12769
523 Ga0207683_10005944 3300026121 Bacteria 10462
524 Ga0207698_10001242 3300026142 Bacteria 14899
525 Ga0207698_10436252 3300026142 Bacteria 1261
526 Ga0210002_1005455 3300027617 Bacteria 1907
527 Ga0209983_1006800 3300027665 Bacteria 2347
528 Ga0209971_1013855 3300027682 Bacteria 1911
529 Ga0209966_1009479 3300027695 Bacteria 1740
530 Ga0209998_10000361 3300027717 Bacteria 13355
531 Ga0209998_10001516 3300027717 Bacteria 5583
532 Ga0209974_10002250 3300027876 Bacteria 7018
533 Ga0209974_10012895 3300027876 Bacteria 2790
534 Ga0207428_10000114 3300027907 Bacteria 109533
535 Ga0207428_10000467 3300027907 Bacteria 48756
536 Ga0207428_10011322 3300027907 Bacteria 7891
537 Ga0207428_10039888 3300027907 Bacteria 3812
538 Ga0207428_10081442 3300027907 Bacteria 2527
539 Ga0268266_10034656 3300028379 Bacteria 4293
540 Ga0268266_10041670 3300028379 Bacteria 3919
541 Ga0268266_10444325 3300028379 Bacteria 1232
542 Ga0268265_10001371 3300028380 Bacteria 20700
543 Ga0268265_10611835 3300028380 Bacteria 1043
544 Ga0268265_10617535 3300028380 Bacteria 1038
545 Ga0268264_10000469 3300028381 Bacteria 54801
546 Ga0268264_10016375 3300028381 Bacteria 6070
547 Ga0265340_10021068 3300031247 Bacteria 3344
548 Ga0265340_10023219 3300031247 Bacteria 3164
549 Ga0265339_10233698 3300031249 Bacteria 895
550 Ga0307508_10000001 3300031616 Bacteria 553635
551 Ga0373930_0000150 3300034816 Bacteria 7874
552 Ga0373948_0000307 3300034817 Bacteria 5896
553 Ga0373948_0020966 3300034817 Bacteria 1248
554 Ga0373950_0002075 3300034818 Bacteria 2717
555 Ga0373958_0001702 3300034819 Bacteria 2986
556 Ga0373958_0002841 3300034819 Bacteria 2464
557 Ga0373938_0002852 3300034957 Bacteria 2790
558 Ga0373926_0132204 3300035083 Bacteria 945
559 Ga0373928_0000222 3300035084 Bacteria 11055
560 Ga0373928_0004477 3300035084 Bacteria 2663
561 Ga0373928_0025802 3300035084 Bacteria 1269
562 Ga0373929_0002384 3300035085 Bacteria 3453
563 Ga0373929_0002872 3300035085 Bacteria 3145
564 Ga0373929_0003760 3300035085 Bacteria 2721
565 Ga0373940_0012698 3300035088 Bacteria 2021
566 Ga0373949_0001450 3300035090 Bacteria 6781
567 Ga0373949_0006107 3300035090 Bacteria 2665
568 Ga0373949_0007302 3300035090 Bacteria 2419
569 Ga0373951_0006621 3300035091 Bacteria 2648
570 Ga0373951_0007633 3300035091 Bacteria 2456
571 Ga0373951_0039164 3300035091 Bacteria 1138
572 Ga0373952_0000029 3300035092 Bacteria 16517
573 Ga0373952_0002545 3300035092 Bacteria 3284
574 Ga0373932_0001251 3300035112 Bacteria 7218
575 Ga0373932_0001864 3300035112 Bacteria 5647
576 Ga0373932_0023866 3300035112 Bacteria 1640
577 Ga0373936_0006326 3300035113 Bacteria 4461
578 Ga0373939_0000339 3300035114 Bacteria 11943
579 Ga0373939_0001987 3300035114 Bacteria 4883
580 Ga0373941_0002285 3300035115 Bacteria 4194
581 Ga0373941_0021633 3300035115 Bacteria 1817
582 Ga0373953_0028414 3300035117 Bacteria 2156
583 Ga0373954_0126152 3300035118 Unclassified 1244
584 Ga0373956_0006309 3300035119 Bacteria 4747
585 Ga0373957_0006384 3300035120 Bacteria 3712
586 Ga0373960_0000372 3300035121 Bacteria 8658
587 Ga0373960_0004334 3300035121 Bacteria 3246
588 Ga0373943_0016793 3300035170 Bacteria 3344
589 Ga0373943_0042928 3300035170 Bacteria 2193
590 Ga0373946_0028615 3300035171 Bacteria 2211
591 Ga0373946_0115322 3300035171 Bacteria 1220
592 Ga0373946_0232748 3300035171 Bacteria 893
593 Ga0373955_0001269 3300035172 Bacteria 10731
594 Ga0373955_0001523 3300035172 Bacteria 9899
595 Ga0373955_0004969 3300035172 Bacteria 5934
596 Ga0373942_0000767 3300035207 Bacteria 8832
597 Ga0373942_0003994 3300035207 Bacteria 3441
598 Ga0373961_0001835 3300035241 Bacteria 5803
599 Ga0373961_0003896 3300035241 Bacteria 3641
600 Ga0373961_0068546 3300035241 Bacteria 1092
601 Ga0373962_0005930 3300035242 Bacteria 2950
602 Ga0373924_0023997 3300035410 Bacteria 2399
603 Ga0373931_0000169 3300035691 Bacteria 28308
604 Ga0373931_0021996 3300035691 Bacteria 3205
605 Ga0373935_0011709 3300035692 Bacteria 5268
606 Ga0373935_0020667 3300035692 Bacteria 4024
607 Ga0373935_0073204 3300035692 Bacteria 2213
608 Ga0373935_0210026 3300035692 Bacteria 1348
609 Ga0373927_0001115 3300035695 Bacteria 20393
610 Ga0373927_0016232 3300035695 Bacteria 4914
611 Ga0373927_0118710 3300035695 Unclassified 1726
612 Ga0373927_0327201 3300035695 Unclassified 1009
613 Ga0373933_0001124 3300035724 Bacteria 15927
614 Ga0373933_0017906 3300035724 Bacteria 3978
615 Ga0373947_0005580 3300035725 Bacteria 7335
616 Ga0373947_0036517 3300035725 Bacteria 2914
617 Ga0373947_0038674 3300035725 Bacteria 2835
618 Ga0373937_0004918 3300036401 Bacteria 11357
619 Ga0373937_0012121 3300036401 Bacteria 7568
620 Ga0373937_0049021 3300036401 Bacteria 3867
621 Ga0373925_0001344 3300037068 Bacteria 21480
622 Ga0373925_0009626 3300037068 Bacteria 7042
623 Ga0373925_0127186 3300037068 Bacteria 1983
624 Ga0395898_0073421 3300037466 Bacteria 3305
625 Ga0436364_0267689 3300037853 Bacteria 1399
626 Ga0436364_0449714 3300037853 Bacteria 1150
627 Ga0395901_0079135 3300038443 Bacteria 3432
628 Ga0436365_0977831 3300039437 Bacteria 4422
629 Ga0453684_0037028 3300044712 Bacteria 6705
630 Ga0451576_0033369 3300045051 Bacteria 5472
631 Ga0451576_0664672 3300045051 Bacteria 1095
632 Ga0495592_0024186 3300046454 Bacteria 4617
633 Ga0495603_0046132 3300046455 Unclassified 2597
634 Ga0495590_0045792 3300046457 Bacteria 1526
635 Ga0495629_0000535 3300046459 Bacteria 31312
636 Ga0495629_0020891 3300046459 Bacteria 4673
637 Ga0495629_0205634 3300046459 Bacteria 1360
638 Ga0495641_0065839 3300046461 Bacteria 1631
639 Ga0495651_0011021 3300046462 Bacteria 6956
640 Ga0495653_0008326 3300046463 Bacteria 8500
641 Ga0495653_0012564 3300046463 Bacteria 6915
642 Ga0495653_0124079 3300046463 Bacteria 1836
643 Ga0495653_0477127 3300046463 Bacteria 781
644 Ga0495580_0043554 3300046472 Unclassified 3194
645 Ga0495582_0085855 3300046473 Bacteria 1751
646 Ga0495639_0025045 3300046475 Unclassified 2629
647 Ga0495639_0026471 3300046475 Bacteria 2564
648 Ga0495639_0029697 3300046475 Bacteria 2427
649 Ga0495662_0010283 3300046476 Bacteria 4586
650 Ga0495662_0097428 3300046476 Bacteria 1438
651 Ga0495664_0003537 3300046477 Bacteria 8521
652 Ga0495664_0094440 3300046477 Unclassified 1800
653 Ga0495584_0053237 3300046491 Unclassified 2037
654 Ga0495584_0061215 3300046491 Unclassified 1892
655 Ga0495585_0008366 3300046492 Bacteria 6274
656 Ga0495594_0042775 3300046499 Bacteria 2481
657 Ga0495608_0001474 3300046511 Bacteria 16724
658 Ga0495608_0070865 3300046511 Unclassified 2275
659 Ga0495616_0133964 3300046513 Unclassified 1133
660 Ga0495618_0004984 3300046514 Bacteria 8114
661 Ga0495618_0048527 3300046514 Unclassified 2680
662 Ga0495628_0001927 3300046516 Bacteria 18830
663 Ga0495628_0023873 3300046516 Bacteria 5015
664 Ga0495630_0121732 3300046517 Bacteria 1979
665 Ga0495630_0132895 3300046517 Bacteria 1890
666 Ga0495630_0149540 3300046517 Unclassified 1776
667 Ga0495644_0002701 3300046523 Bacteria 7045
668 Ga0495666_0119340 3300046526 Bacteria 1236
669 Ga0495666_0153376 3300046526 Bacteria 1070
670 Ga0495652_0022449 3300046529 Bacteria 5599
671 Ga0495652_0087560 3300046529 Bacteria 2554
672 Ga0495652_0560970 3300046529 Bacteria 784
673 Ga0495665_0084203 3300046531 Unclassified 1671
674 Ga0495640_0027462 3300046533 Bacteria 4104
675 Ga0495640_0071975 3300046533 Unclassified 2317
676 Ga0495640_0216381 3300046533 Bacteria 1209
677 Ga0495586_0133216 3300046535 Bacteria 1392
678 Ga0495587_0002240 3300046536 Bacteria 12923
679 Ga0495587_0035407 3300046536 Bacteria 3007
680 Ga0495598_0007286 3300046537 Bacteria 2533
681 Ga0495598_0031957 3300046537 Bacteria 1484
682 Ga0495609_0058799 3300046538 Unclassified 1700
683 Ga0495645_0002539 3300046543 Bacteria 12383
684 Ga0495645_0019854 3300046543 Bacteria 4842
685 Ga0495622_0015565 3300046557 Bacteria 3535
686 Ga0495622_0045597 3300046557 Bacteria 2037
687 Ga0495633_0002969 3300046558 Bacteria 11596
688 Ga0495667_0001150 3300046559 Bacteria 17257
689 Ga0495656_0002822 3300046615 Bacteria 5812
690 Ga0495634_0026079 3300046642 Bacteria 4081
691 Ga0495635_0003881 3300046663 Bacteria 10388
692 Ga0495635_0021401 3300046663 Bacteria 4506
693 Ga0495659_0001458 3300046664 Bacteria 8030
694 Ga0495657_0010946 3300046675 Bacteria 6803
695 Ga0495599_0004481 3300046678 Bacteria 8275
696 Ga0495599_0017530 3300046678 Bacteria 4451
697 Ga0495623_0000420 3300046679 Bacteria 27960
698 Ga0495646_0020687 3300046680 Bacteria 4163
699 Ga0495646_0054930 3300046680 Bacteria 2393
700 Ga0495647_0079004 3300046681 Bacteria 1331
701 Ga0495658_0000788 3300046683 Bacteria 17050
702 Ga0495658_0006062 3300046683 Bacteria 5938
703 Ga0495658_0009215 3300046683 Bacteria 4909
704 Ga0495669_0031148 3300046684 Bacteria 2342
705 Ga0495624_0026468 3300046690 Unclassified 3801
706 Ga0495624_0051811 3300046690 Bacteria 2595
707 Ga0495624_0091076 3300046690 Bacteria 1881
708 Ga0495670_0000291 3300046691 Bacteria 23680
709 Ga0495600_0001326 3300046809 Bacteria 13661
710 Ga0495600_0181767 3300046809 Unclassified 1355
711 Ga0495581_0049705 3300047315 Bacteria 2421
712 Ga0495581_0055269 3300047315 Bacteria 2291
713 Ga0495581_0090989 3300047315 Bacteria 1770
714 Ga0495604_0003891 3300047317 Bacteria 11887
715 Ga0495604_0009082 3300047317 Bacteria 7865
716 Ga0495604_0017520 3300047317 Bacteria 5736
717 Ga0495674_0015363 3300047319 Bacteria 7160
718 Ga0495674_0027169 3300047319 Bacteria 5232
719 Ga0495674_0069524 3300047319 Unclassified 3044
720 Ga0495676_0076650 3300047321 Bacteria 2552
721 Ga0495676_0241439 3300047321 Unclassified 1236
722 Ga0495680_0011254 3300047322 Bacteria 7932
723 Ga0495680_0012959 3300047322 Bacteria 7301
724 Ga0495680_0062737 3300047322 Unclassified 2856
725 Ga0495675_0001544 3300047444 Bacteria 13904
726 Ga0495679_064249 3300047446 Bacteria 1070
727 Ga0495684_0002087 3300047471 Bacteria 16070
728 Ga0495684_0080591 3300047471 Bacteria 2471
729 Ga0495684_0173060 3300047471 Bacteria 1604
730 Ga0495593_0004626 3300047673 Bacteria 8180
731 Ga0495593_0113374 3300047673 Bacteria 1383
732 Ga0495602_0000740 3300048088 Bacteria 30918
733 Ga0495602_0005526 3300048088 Bacteria 13262
734 Ga0495614_0031402 3300048089 Bacteria 2286
735 Ga0496100_0000106 3300048903 Bacteria 48123
736 Ga0496100_0002951 3300048903 Bacteria 8748
737 Ga0496100_0003648 3300048903 Bacteria 8050
738 Ga0496100_0038103 3300048903 Bacteria 3044
739 Ga0496101_0000992 3300048904 Bacteria 16792
740 Ga0496101_0020995 3300048904 Bacteria 4481
741 Ga0496101_0073824 3300048904 Bacteria 2506
742 Ga0496101_0242314 3300048904 Bacteria 1403
743 Ga0496102_0011236 3300048905 Bacteria 7715
744 Ga0496102_0015419 3300048905 Bacteria 6656
745 Ga0496102_0019045 3300048905 Bacteria 6041
746 Ga0496102_0039093 3300048905 Bacteria 4285
747 Ga0496102_0411558 3300048905 Unclassified 1270
748 Ga0496103_0006368 3300048906 Bacteria 7051
749 Ga0496103_0013457 3300048906 Bacteria 4853
750 Ga0496103_0036108 3300048906 Bacteria 3026
751 Ga0496103_0052592 3300048906 Bacteria 2522
752 Ga0496103_0055978 3300048906 Bacteria 2447
753 Ga0496104_0000090 3300048907 Bacteria 87877
754 Ga0496104_0031476 3300048907 Bacteria 4934
755 Ga0496104_0113779 3300048907 Bacteria 2595
756 Ga0496104_0205803 3300048907 Bacteria 1879
757 Ga0496104_0425755 3300048907 Bacteria 1239
758 Ga0496104_0479199 3300048907 Bacteria 1155
759 Ga0496105_0001574 3300048908 Bacteria 16176
760 Ga0496105_0017852 3300048908 Bacteria 5693
761 Ga0496105_0048173 3300048908 Unclassified 3517
762 Ga0496105_0134964 3300048908 Bacteria 2033
763 Ga0496105_0160810 3300048908 Bacteria 1844
764 Ga0496106_0002499 3300048909 Bacteria 13684
765 Ga0496106_0009258 3300048909 Bacteria 7278
766 Ga0496106_0012172 3300048909 Bacteria 6349
767 Ga0496106_0013964 3300048909 Bacteria 5939
768 Ga0496106_0131447 3300048909 Bacteria 1963
769 Ga0496106_0379020 3300048909 Bacteria 1137
770 Ga0496107_0000223 3300048910 Bacteria 30018
771 Ga0496107_0005132 3300048910 Bacteria 8934
772 Ga0496107_0034213 3300048910 Bacteria 3639
773 Ga0496107_0037809 3300048910 Bacteria 3464
774 Ga0496107_0041516 3300048910 Bacteria 3303
775 Ga0496107_0050009 3300048910 Bacteria 3013
776 Ga0496107_0056685 3300048910 Bacteria 2831
777 Ga0496107_0193349 3300048910 Bacteria 1512
778 Ga0496107_0414525 3300048910 Bacteria 1002
779 Ga0496108_0003914 3300048911 Bacteria 11960
780 Ga0496108_0024154 3300048911 Bacteria 5003
781 Ga0496108_0029666 3300048911 Unclassified 4531
782 Ga0496108_0046748 3300048911 Bacteria 3617
783 Ga0496108_0206535 3300048911 Bacteria 1704
784 Ga0496109_0014846 3300048912 Bacteria 6778
785 Ga0496109_0015516 3300048912 Bacteria 6641
786 Ga0496109_0016176 3300048912 Bacteria 6519
787 Ga0496109_0040980 3300048912 Bacteria 4195
788 Ga0496109_0072253 3300048912 Bacteria 3169
789 Ga0496109_0375756 3300048912 Bacteria 1342
790 Ga0496110_0033819 3300048913 Bacteria 4424
791 Ga0496110_0044706 3300048913 Bacteria 3868
792 Ga0496110_0046530 3300048913 Bacteria 3796
793 Ga0496110_0281739 3300048913 Bacteria 1514
794 Ga0496110_0410407 3300048913 Bacteria 1235
795 Ga0496111_0000845 3300048914 Bacteria 16533
796 Ga0496111_0031018 3300048914 Unclassified 3804
797 Ga0496111_0079994 3300048914 Bacteria 2384
798 Ga0496111_0101954 3300048914 Bacteria 2109
799 Ga0496112_0005655 3300048915 Bacteria 10853
800 Ga0496112_0061551 3300048915 Bacteria 3700
801 Ga0496112_0066193 3300048915 Bacteria 3565
802 Ga0496112_0237397 3300048915 Bacteria 1776
803 Ga0496113_0002918 3300048916 Bacteria 10091
804 Ga0496113_0006216 3300048916 Bacteria 7545
805 Ga0496113_0010789 3300048916 Bacteria 6060
806 Ga0496113_0042033 3300048916 Bacteria 3376
807 Ga0496113_0374571 3300048916 Unclassified 1142
808 Ga0496113_0457070 3300048916 Unclassified 1026
809 Ga0496114_0006841 3300048917 Bacteria 8982
810 Ga0496114_0025893 3300048917 Unclassified 4798
811 Ga0496114_0224542 3300048917 Bacteria 1649
812 Ga0496115_0021146 3300048918 Bacteria 5022
813 Ga0496115_0021880 3300048918 Bacteria 4945
814 Ga0496115_0073152 3300048918 Bacteria 2781
815 Ga0496115_0094696 3300048918 Bacteria 2443
816 Ga0496115_0278132 3300048918 Bacteria 1374
817 Ga0496125_0107116 3300048928 Bacteria 2038
818 Ga0501031_0266556 3300049568 Bacteria 1113
819 Ga0501033_0007367 3300049570 Bacteria 8568
820 Ga0501038_0484154 3300049574 Bacteria 948
821 Ga0501039_0029805 3300049575 Bacteria 4204
822 Ga0501040_0103265 3300049576 Bacteria 1990
823 Ga0501042_0019235 3300049578 Bacteria 4740
824 Ga0501046_0152671 3300049580 Bacteria 1742
825 Ga0501047_0068764 3300049581 Bacteria 3411
826 Ga0501069_0208641 3300049585 Unclassified 1134
827 Ga0501070_0055529 3300049586 Bacteria 3283
828 Ga0501070_0775467 3300049586 Bacteria 754
829 Ga0501071_0064617 3300049587 Bacteria 2655
830 Ga0501072_0019938 3300049588 Bacteria 5190
831 Ga0501075_0243387 3300049591 Bacteria 1371
832 Ga0501076_0029463 3300049592 Bacteria 4269
833 Ga0501083_0106933 3300049744 Bacteria 1841
834 Ga0501035_0065778 3300049822 Bacteria 3218
835 Ga0501044_0003955 3300049823 Bacteria 16596
836 Ga0501044_0175607 3300049823 Bacteria 2111
837 nmdc:mga00v17_118794_c1 3300050491 Bacteria 1682
838 nmdc:mga00v17_171279_c1 3300050491 Bacteria 1400
839 nmdc:mga00v17_304296_c1 3300050491 Bacteria 1036
840 nmdc:mga0yw44_267910_c1 3300050492 Bacteria 1140
841 nmdc:mga0k408_358283_c1 3300050493 Bacteria 869
842 nmdc:mga06z11_1795_c1 3300050494 Bacteria 8072
843 nmdc:mga06z11_64498_c1 3300050494 Bacteria 1920
844 nmdc:mga04h51_17806_c1 3300050495 Bacteria 2083
845 nmdc:mga04h51_39759_c1 3300050495 Bacteria 1529
846 nmdc:mga07m45_285125_c1 3300050496 Bacteria 960
847 nmdc:mga07m45_95619_c1 3300050496 Bacteria 1397
848 nmdc:mga05p37_13519_c1 3300050507 Bacteria 9784
849 nmdc:mga05p37_180891_c1 3300050507 Bacteria 2565
850 nmdc:mga05p37_259496_c1 3300050507 Bacteria 2080
851 nmdc:mga05p37_4379_c1 3300050507 Bacteria 10579
852 nmdc:mga05p37_50911_c1 3300050507 Bacteria 5093
853 nmdc:mga05p37_56_c3 3300050507 Bacteria 77819
854 nmdc:mga09592_976_c1 3300050508 Bacteria 22595
855 nmdc:mga0qj67_4772_c1 3300050509 Bacteria 9855
856 nmdc:mga06r32_290979_c1 3300050510 Bacteria 1620
857 nmdc:mga06r32_34244_c1 3300050510 Bacteria 4789
858 nmdc:mga06r32_45073_c1 3300050510 Bacteria 4202
859 nmdc:mga08y16_10784_c1 3300050511 Bacteria 9592
860 nmdc:mga08y16_191257_c1 3300050511 Bacteria 2123
861 nmdc:mga08y16_206_c1 3300050511 Bacteria 46039
862 nmdc:mga08y16_2396_c1 3300050511 Bacteria 19256
863 nmdc:mga08y16_77919_c1 3300050511 Bacteria 3455
864 nmdc:mga0n895_13740_c1 3300050512 Bacteria 7320
865 nmdc:mga0n895_2745_c1 3300050512 Bacteria 8963
866 nmdc:mga0n895_51689_c1 3300050512 Bacteria 4032
867 nmdc:mga0n895_5847_c1 3300050512 Bacteria 10340
868 nmdc:mga0rr50_154672_c1 3300050513 Bacteria 1857
869 nmdc:mga0rr50_35409_c1 3300050513 Bacteria 3585
870 nmdc:mga0rr50_44591_c1 3300050513 Bacteria 3253
871 nmdc:mga0rr50_468651_c1 3300050513 Bacteria 1069
872 nmdc:mga0rr50_667742_c1 3300050513 Bacteria 887
873 nmdc:mga0rr50_8402_c1 3300050513 Bacteria 6426
874 nmdc:mga08x19_205001_c1 3300050514 Bacteria 1352
875 nmdc:mga08x19_77184_c1 3300050514 Bacteria 2181
876 nmdc:mga0a205_11514_c1 3300050515 Bacteria 8147
877 nmdc:mga0a205_171324_c1 3300050515 Bacteria 2067
878 nmdc:mga0a205_425513_c1 3300050515 Bacteria 1189
879 nmdc:mga0a205_605874_c1 3300050515 Bacteria 948
880 nmdc:mga0a205_80_c1 3300050515 Bacteria 53083
881 nmdc:mga0sz30_870_c2 3300050516 Bacteria 8470
882 Ga0495601_0000360 3300053077 Bacteria 23959
883 Ga0495601_0001260 3300053077 Bacteria 13862
884 Ga0495601_0070227 3300053077 Bacteria 2235
885 Ga0495612_0000964 3300053078 Bacteria 11832
886 Ga0495612_0002659 3300053078 Bacteria 7371
887 Ga0500610_0104324 3300053079 Bacteria 1464
888 Ga0495655_0043799 3300053083 Bacteria 1155
889 Ga0495595_0000969 3300053084 Bacteria 11036
890 Ga0495595_0001276 3300053084 Bacteria 9815
891 Ga0495595_0037109 3300053084 Unclassified 2214
892 Ga0495595_0089550 3300053084 Bacteria 1475
893 Ga0495619_0000375 3300053085 Bacteria 30799
894 Ga0495619_0000581 3300053085 Bacteria 24290
895 Ga0495619_0001851 3300053085 Bacteria 14080
896 Ga0495619_0101189 3300053085 Bacteria 1962
897 Ga0500643_008928 3300053087 Bacteria 3880
898 Ga0500644_0000331 3300053088 Bacteria 24183
899 Ga0500651_0006053 3300053093 Bacteria 6949
900 Ga0500651_0223687 3300053093 Bacteria 1103
901 Ga0500566_0024974 3300053094 Bacteria 3504
902 Ga0500641_0022136 3300053096 Bacteria 2431
903 Ga0500595_000002 3300053119 Bacteria 1074388
904 Ga0500616_0000002 3300053153 Bacteria 1611257
905 Ga0500622_0001529 3300053156 Bacteria 18331
906 Ga0501084_0045729 3300054114 Bacteria 3665
907 Ga0501084_0561880 3300054114 Bacteria 964
908 Ga0501082_0371206 3300060353 Bacteria 1248
909 Ga0530510_0044424 3300061734 Bacteria 3211

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005616 Ga0068852_100417869 Ga0068852_1004178691 201
2 3300005843 Ga0068860_100417216 Ga0068860_1004172162 201
3 3300026142 Ga0207698_10436252 Ga0207698_104362521 201
4 3300035691 Ga0373931_0021996 Ga0373931_0021996_2209_2964 201
5 3300037466 Ga0395898_0073421 Ga0395898_0073421_688_1425 201
6 3300048913 Ga0496110_0410407 Ga0496110_0410407_363_1070 201
7 3300053085 Ga0495619_0101189 Ga0495619_0101189_895_1596 201
8 3300005343 Ga0070687_100059049 Ga0070687_1000590493 202
9 3300005355 Ga0070671_100589752 Ga0070671_1005897521 202
10 3300005364 Ga0070673_100310502 Ga0070673_1003105022 202
11 3300005366 Ga0070659_100305726 Ga0070659_1003057262 202
12 3300005564 Ga0070664_100069340 Ga0070664_1000693402 202
13 3300006051 Ga0075364_10215227 Ga0075364_102152272 202
14 3300006844 Ga0075428_100178935 Ga0075428_1001789352 202
15 3300006871 Ga0075434_100002138 Ga0075434_1000021383 202
16 3300009094 Ga0111539_10159099 Ga0111539_101590993 202
17 3300009101 Ga0105247_10109400 Ga0105247_101094002 202
18 3300009147 Ga0114129_10010082 Ga0114129_100100826 202
19 3300009553 Ga0105249_10048163 Ga0105249_100481633 202
20 3300010375 Ga0105239_10065027 Ga0105239_100650277 202
21 3300013306 Ga0163162_10069104 Ga0163162_100691042 202
22 3300025945 Ga0207679_10063136 Ga0207679_100631362 202
23 3300027907 Ga0207428_10081442 Ga0207428_100814421 202
24 3300048903 Ga0496100_0038103 Ga0496100_0038103_1990_2745 202
25 3300048904 Ga0496101_0073824 Ga0496101_0073824_1267_2022 202
26 3300048905 Ga0496102_0015419 Ga0496102_0015419_144_899 202
27 3300048906 Ga0496103_0013457 Ga0496103_0013457_2244_2999 202
28 3300048907 Ga0496104_0031476 Ga0496104_0031476_4051_4806 202
29 3300048908 Ga0496105_0017852 Ga0496105_0017852_3542_4297 202
30 3300048909 Ga0496106_0009258 Ga0496106_0009258_3264_4019 202
31 3300048910 Ga0496107_0005132 Ga0496107_0005132_6095_6850 202
32 3300048911 Ga0496108_0024154 Ga0496108_0024154_768_1523 202
33 3300048912 Ga0496109_0015516 Ga0496109_0015516_5758_6513 202
34 3300048913 Ga0496110_0033819 Ga0496110_0033819_3541_4296 202
35 3300048914 Ga0496111_0000845 Ga0496111_0000845_15530_16285 202
36 3300048915 Ga0496112_0005655 Ga0496112_0005655_7462_8217 202
37 3300048916 Ga0496113_0002918 Ga0496113_0002918_7542_8297 202
38 3300050491 nmdc:mga00v17_171279_c1 nmdc:mga00v17_171279_c1_301_1056 202
39 3300050507 nmdc:mga05p37_4379_c1 nmdc:mga05p37_4379_c1_7552_8307 202
40 3300050511 nmdc:mga08y16_191257_c1 nmdc:mga08y16_191257_c1_34_789 202
41 3300050512 nmdc:mga0n895_13740_c1 nmdc:mga0n895_13740_c1_788_1543 202
42 3300050513 nmdc:mga0rr50_667742_c1 nmdc:mga0rr50_667742_c1_67_822 202
43 3300005347 Ga0070668_100030654 Ga0070668_1000306543 206
44 3300046457 Ga0495590_0045792 Ga0495590_0045792_217_900 206
45 3300046529 Ga0495652_0560970 Ga0495652_0560970_20_721 206
46 3300053083 Ga0495655_0043799 Ga0495655_0043799_176_859 206
47 3300005331 Ga0070670_100086294 Ga0070670_1000862943 207
48 3300013105 Ga0157369_10085097 Ga0157369_100850973 208
49 3300006038 Ga0075365_10117200 Ga0075365_101172003 209
50 3300006177 Ga0075362_10124626 Ga0075362_101246262 209
51 3300006844 Ga0075428_100200466 Ga0075428_1002004663 209
52 3300006847 Ga0075431_100032045 Ga0075431_1000320453 209
53 3300009094 Ga0111539_10762633 Ga0111539_107626331 209
54 3300046463 Ga0495653_0477127 Ga0495653_0477127_22_711 209
55 3300050491 nmdc:mga00v17_118794_c1 nmdc:mga00v17_118794_c1_149_832 209
56 3300054114 Ga0501084_0561880 Ga0501084_0561880_45_773 214
57 3300049570 Ga0501033_0007367 Ga0501033_0007367_1817_2515 215
58 3300049574 Ga0501038_0484154 Ga0501038_0484154_127_825 215
59 3300049823 Ga0501044_0175607 Ga0501044_0175607_1391_2089 215
60 3300050492 nmdc:mga0yw44_267910_c1 nmdc:mga0yw44_267910_c1_394_1044 215
61 3300050495 nmdc:mga04h51_39759_c1 nmdc:mga04h51_39759_c1_456_1106 215
62 3300050496 nmdc:mga07m45_285125_c1 nmdc:mga07m45_285125_c1_64_714 215
63 3300050507 nmdc:mga05p37_180891_c1 nmdc:mga05p37_180891_c1_1254_2006 215
64 3300031616 Ga0307508_10000001 Ga0307508_10000001175 216
65 3300005330 Ga0070690_100195677 Ga0070690_1001956771 220
66 3300005340 Ga0070689_100019695 Ga0070689_1000196954 220
67 3300005343 Ga0070687_100124778 Ga0070687_1001247782 220
68 3300005617 Ga0068859_100535432 Ga0068859_1005354322 220
69 3300006931 Ga0097620_100535431 Ga0097620_1005354312 220
70 3300009148 Ga0105243_10195204 Ga0105243_101952042 220
71 3300013297 Ga0157378_10206469 Ga0157378_102064692 220
72 3300014326 Ga0157380_10144196 Ga0157380_101441963 220
73 3300025918 Ga0207662_10020636 Ga0207662_100206362 220
74 3300025935 Ga0207709_10328809 Ga0207709_103288092 220
75 3300025935 Ga0207709_10443875 Ga0207709_104438752 220
76 3300025936 Ga0207670_10029666 Ga0207670_100296664 220
77 3300049586 Ga0501070_0775467 Ga0501070_0775467_29_703 220
78 3300031247 Ga0265340_10023219 Ga0265340_100232193 221
79 3300010159 Ga0099796_10000300 Ga0099796_100003002 222
80 3300021384 Ga0213876_10168301 Ga0213876_101683012 222
81 3300037853 Ga0436364_0449714 Ga0436364_0449714_163_882 222
82 3300039437 Ga0436365_0977831 Ga0436365_0977831_483_1202 222
83 3300050493 nmdc:mga0k408_358283_c1 nmdc:mga0k408_358283_c1_163_837 222
84 3300031249 Ga0265339_10233698 Ga0265339_102336981 223
85 3300050510 nmdc:mga06r32_290979_c1 nmdc:mga06r32_290979_c1_40_756 223
86 3300003911 JGI25405J52794_10009433 JGI25405J52794_100094332 224
87 3300005471 Ga0070698_100054628 Ga0070698_1000546283 224
88 3300005518 Ga0070699_100001464 Ga0070699_1000014642 224
89 3300005937 Ga0081455_10011971 Ga0081455_100119719 224
90 3300006038 Ga0075365_10139257 Ga0075365_101392572 224
91 3300006844 Ga0075428_100079853 Ga0075428_1000798533 224
92 3300006844 Ga0075428_100143764 Ga0075428_1001437643 224
93 3300006847 Ga0075431_100019203 Ga0075431_1000192036 224
94 3300006880 Ga0075429_100109255 Ga0075429_1001092552 224
95 3300009147 Ga0114129_10012751 Ga0114129_100127518 224
96 3300035725 Ga0373947_0036517 Ga0373947_0036517_1101_1856 224
97 3300038443 Ga0395901_0079135 Ga0395901_0079135_1401_2078 224
98 3300048916 Ga0496113_0042033 Ga0496113_0042033_1383_2066 224
99 3300050507 nmdc:mga05p37_50911_c1 nmdc:mga05p37_50911_c1_2362_3039 224
100 3300050510 nmdc:mga06r32_45073_c1 nmdc:mga06r32_45073_c1_1432_2109 224
101 3300050514 nmdc:mga08x19_205001_c1 nmdc:mga08x19_205001_c1_510_1187 224
102 3300009094 Ga0111539_10912107 Ga0111539_109121072 225
103 3300009177 Ga0105248_10756855 Ga0105248_107568552 225
104 3300013297 Ga0157378_10307755 Ga0157378_103077552 225
105 3300025941 Ga0207711_10392689 Ga0207711_103926892 225
106 3300037853 Ga0436364_0267689 Ga0436364_0267689_563_1273 225
107 3300048917 Ga0496114_0224542 Ga0496114_0224542_647_1408 225
108 3300049744 Ga0501083_0106933 Ga0501083_0106933_998_1711 225
109 3300050515 nmdc:mga0a205_605874_c1 nmdc:mga0a205_605874_c1_79_810 225
110 3300053079 Ga0500610_0104324 Ga0500610_0104324_211_918 225
111 3300053084 Ga0495595_0089550 Ga0495595_0089550_692_1453 225
112 3300060353 Ga0501082_0371206 Ga0501082_0371206_313_1026 225
113 3300003203 JGI25406J46586_10015257 JGI25406J46586_100152573 226
114 3300005333 Ga0070677_10022517 Ga0070677_100225173 226
115 3300005334 Ga0068869_100400594 Ga0068869_1004005941 226
116 3300005338 Ga0068868_100289458 Ga0068868_1002894582 226
117 3300005354 Ga0070675_100022484 Ga0070675_1000224844 226
118 3300005356 Ga0070674_100003641 Ga0070674_1000036418 226
119 3300005437 Ga0070710_10009725 Ga0070710_100097255 226
120 3300005456 Ga0070678_100364214 Ga0070678_1003642142 226
121 3300005466 Ga0070685_10010966 Ga0070685_100109663 226
122 3300005544 Ga0070686_100074077 Ga0070686_1000740773 226
123 3300005577 Ga0068857_100113854 Ga0068857_1001138543 226
124 3300005617 Ga0068859_100229692 Ga0068859_1002296923 226
125 3300005618 Ga0068864_100095718 Ga0068864_1000957184 226
126 3300005841 Ga0068863_100045258 Ga0068863_1000452582 226
127 3300005842 Ga0068858_100426437 Ga0068858_1004264372 226
128 3300005983 Ga0081540_1006238 Ga0081540_10062387 226
129 3300005985 Ga0081539_10000800 Ga0081539_1000080019 226
130 3300006931 Ga0097620_100229680 Ga0097620_1002296803 226
131 3300009094 Ga0111539_10171712 Ga0111539_101717122 226
132 3300009094 Ga0111539_10630065 Ga0111539_106300652 226
133 3300009101 Ga0105247_10028323 Ga0105247_100283234 226
134 3300009148 Ga0105243_10600505 Ga0105243_106005052 226
135 3300009177 Ga0105248_10477198 Ga0105248_104771981 226
136 3300009545 Ga0105237_10379394 Ga0105237_103793942 226
137 3300011119 Ga0105246_10123073 Ga0105246_101230733 226
138 3300011119 Ga0105246_10497987 Ga0105246_104979872 226
139 3300013297 Ga0157378_10731982 Ga0157378_107319822 226
140 3300013307 Ga0157372_10236874 Ga0157372_102368742 226
141 3300014326 Ga0157380_10668194 Ga0157380_106681942 226
142 3300014968 Ga0157379_10530703 Ga0157379_105307031 226
143 3300025893 Ga0207682_10001441 Ga0207682_100014417 226
144 3300025900 Ga0207710_10009271 Ga0207710_100092714 226
145 3300025907 Ga0207645_10037790 Ga0207645_100377902 226
146 3300025926 Ga0207659_10071746 Ga0207659_100717462 226
147 3300025926 Ga0207659_10131290 Ga0207659_101312903 226
148 3300025937 Ga0207669_10073600 Ga0207669_100736003 226
149 3300025940 Ga0207691_10008505 Ga0207691_100085054 226
150 3300025941 Ga0207711_10250856 Ga0207711_102508563 226
151 3300025942 Ga0207689_10051690 Ga0207689_100516903 226
152 3300025945 Ga0207679_10190730 Ga0207679_101907302 226
153 3300026023 Ga0207677_10194252 Ga0207677_101942522 226
154 3300026041 Ga0207639_10417235 Ga0207639_104172352 226
155 3300026088 Ga0207641_10216229 Ga0207641_102162292 226
156 3300026095 Ga0207676_10169502 Ga0207676_101695022 226
157 3300026116 Ga0207674_10065449 Ga0207674_100654494 226
158 3300026121 Ga0207683_10005944 Ga0207683_100059448 226
159 3300027907 Ga0207428_10039888 Ga0207428_100398883 226
160 3300028380 Ga0268265_10611835 Ga0268265_106118352 226
161 3300028380 Ga0268265_10617535 Ga0268265_106175352 226
162 3300031247 Ga0265340_10021068 Ga0265340_100210683 226
163 3300046537 Ga0495598_0031957 Ga0495598_0031957_119_829 226
164 3300048910 Ga0496107_0193349 Ga0496107_0193349_243_992 226
165 3300048913 Ga0496110_0281739 Ga0496110_0281739_497_1189 226
166 3300049568 Ga0501031_0266556 Ga0501031_0266556_317_1009 226
167 3300049575 Ga0501039_0029805 Ga0501039_0029805_1642_2349 226
168 3300049576 Ga0501040_0103265 Ga0501040_0103265_961_1668 226
169 3300049578 Ga0501042_0019235 Ga0501042_0019235_1839_2546 226
170 3300049580 Ga0501046_0152671 Ga0501046_0152671_196_888 226
171 3300049581 Ga0501047_0068764 Ga0501047_0068764_1631_2323 226
172 3300049585 Ga0501069_0208641 Ga0501069_0208641_22_729 226
173 3300049586 Ga0501070_0055529 Ga0501070_0055529_1894_2586 226
174 3300049587 Ga0501071_0064617 Ga0501071_0064617_743_1450 226
175 3300049588 Ga0501072_0019938 Ga0501072_0019938_3145_3852 226
176 3300049591 Ga0501075_0243387 Ga0501075_0243387_530_1237 226
177 3300049592 Ga0501076_0029463 Ga0501076_0029463_3549_4256 226
178 3300049822 Ga0501035_0065778 Ga0501035_0065778_950_1642 226
179 3300049823 Ga0501044_0003955 Ga0501044_0003955_15718_16410 226
180 3300050507 nmdc:mga05p37_259496_c1 nmdc:mga05p37_259496_c1_948_1673 226
181 3300050511 nmdc:mga08y16_77919_c1 nmdc:mga08y16_77919_c1_971_1687 226
182 3300054114 Ga0501084_0045729 Ga0501084_0045729_2707_3414 226
183 3300061734 Ga0530510_0044424 Ga0530510_0044424_1930_2637 226
184 3300005937 Ga0081455_10000036 Ga0081455_10000036125 227
185 3300035695 Ga0373927_0001115 Ga0373927_0001115_16745_17485 227
186 3300037068 Ga0373925_0001344 Ga0373925_0001344_15852_16592 227
187 2209111006 2214772983 2213792888 228
188 3300000042 ARSoilYngRDRAFT_c00234 ARSoilYngRDRAFT_002348 228
189 3300000043 ARcpr5yngRDRAFT_c000900 ARcpr5yngRDRAFT_0009004 228
190 3300000044 ARSoilOldRDRAFT_c000126 ARSoilOldRDRAFT_00012614 228
191 3300000045 ARCol0oldRDRAFT_c00368 ARCol0oldRDRAFT_003683 228
192 3300000652 ARCol0yngRDRAFT_1000669 ARCol0yngRDRAFT_10006694 228
193 3300001904 JGI24736J21556_1007238 JGI24736J21556_10072381 228
194 3300001976 JGI24752J21851_1002485 JGI24752J21851_10024852 228
195 3300001978 JGI24747J21853_1003999 JGI24747J21853_10039991 228
196 3300001989 JGI24739J22299_10002770 JGI24739J22299_100027701 228
197 3300001990 JGI24737J22298_10000960 JGI24737J22298_100009607 228
198 3300001990 JGI24737J22298_10007118 JGI24737J22298_100071184 228
199 3300001991 JGI24743J22301_10005364 JGI24743J22301_100053641 228
200 3300002070 JGI24750J21931_1000172 JGI24750J21931_100017211 228
201 3300002073 JGI24745J21846_1000099 JGI24745J21846_10000994 228
202 3300002075 JGI24738J21930_10000223 JGI24738J21930_100002238 228
203 3300002076 JGI24749J21850_1000914 JGI24749J21850_10009142 228
204 3300002126 JGI24035J26624_1001421 JGI24035J26624_10014212 228
205 3300002239 JGI24034J26672_10000557 JGI24034J26672_100005573 228
206 3300002244 JGI24742J22300_10000264 JGI24742J22300_100002645 228
207 3300005289 Ga0065704_10074561 Ga0065704_100745617 228
208 3300005290 Ga0065712_10070835 Ga0065712_100708354 228
209 3300005293 Ga0065715_10003522 Ga0065715_100035223 228
210 3300005293 Ga0065715_10114409 Ga0065715_101144091 228
211 3300005293 Ga0065715_10199137 Ga0065715_101991372 228
212 3300005295 Ga0065707_10138112 Ga0065707_101381122 228
213 3300005328 Ga0070676_10000012 Ga0070676_1000001249 228
214 3300005329 Ga0070683_100000139 Ga0070683_10000013916 228
215 3300005329 Ga0070683_100028063 Ga0070683_1000280634 228
216 3300005329 Ga0070683_100131284 Ga0070683_1001312842 228
217 3300005330 Ga0070690_100005164 Ga0070690_1000051646 228
218 3300005330 Ga0070690_100005412 Ga0070690_1000054125 228
219 3300005331 Ga0070670_100028821 Ga0070670_1000288216 228
220 3300005331 Ga0070670_100080618 Ga0070670_1000806183 228
221 3300005333 Ga0070677_10000125 Ga0070677_100001258 228
222 3300005334 Ga0068869_100000605 Ga0068869_10000060510 228
223 3300005335 Ga0070666_10017025 Ga0070666_100170252 228
224 3300005335 Ga0070666_10030551 Ga0070666_100305513 228
225 3300005336 Ga0070680_100000179 Ga0070680_10000017913 228
226 3300005336 Ga0070680_100014505 Ga0070680_1000145055 228
227 3300005336 Ga0070680_100365293 Ga0070680_1003652932 228
228 3300005337 Ga0070682_100000319 Ga0070682_1000003197 228
229 3300005337 Ga0070682_100151071 Ga0070682_1001510712 228
230 3300005337 Ga0070682_100297041 Ga0070682_1002970412 228
231 3300005338 Ga0068868_100000593 Ga0068868_1000005932 228
232 3300005338 Ga0068868_100456107 Ga0068868_1004561072 228
233 3300005339 Ga0070660_100001605 Ga0070660_1000016057 228
234 3300005340 Ga0070689_100004685 Ga0070689_1000046857 228
235 3300005340 Ga0070689_100203237 Ga0070689_1002032372 228
236 3300005340 Ga0070689_100286571 Ga0070689_1002865712 228
237 3300005341 Ga0070691_10001565 Ga0070691_100015657 228
238 3300005341 Ga0070691_10007128 Ga0070691_100071286 228
239 3300005343 Ga0070687_100003572 Ga0070687_1000035725 228
240 3300005343 Ga0070687_100467046 Ga0070687_1004670461 228
241 3300005344 Ga0070661_100001455 Ga0070661_10000145511 228
242 3300005344 Ga0070661_100156980 Ga0070661_1001569802 228
243 3300005344 Ga0070661_100229140 Ga0070661_1002291401 228
244 3300005345 Ga0070692_10000434 Ga0070692_100004345 228
245 3300005345 Ga0070692_10002195 Ga0070692_100021958 228
246 3300005347 Ga0070668_100004423 Ga0070668_1000044238 228
247 3300005347 Ga0070668_100112463 Ga0070668_1001124632 228
248 3300005353 Ga0070669_100000409 Ga0070669_1000004097 228
249 3300005353 Ga0070669_100069410 Ga0070669_1000694102 228
250 3300005354 Ga0070675_100000166 Ga0070675_10000016635 228
251 3300005355 Ga0070671_100005938 Ga0070671_1000059385 228
252 3300005355 Ga0070671_100006280 Ga0070671_1000062807 228
253 3300005356 Ga0070674_100000644 Ga0070674_10000064415 228
254 3300005356 Ga0070674_100092065 Ga0070674_1000920653 228
255 3300005356 Ga0070674_100350086 Ga0070674_1003500862 228
256 3300005364 Ga0070673_100000041 Ga0070673_10000004116 228
257 3300005364 Ga0070673_100057607 Ga0070673_1000576073 228
258 3300005365 Ga0070688_100000180 Ga0070688_10000018019 228
259 3300005365 Ga0070688_100011831 Ga0070688_1000118314 228
260 3300005365 Ga0070688_100544024 Ga0070688_1005440241 228
261 3300005366 Ga0070659_100000752 Ga0070659_10000075212 228
262 3300005366 Ga0070659_100091485 Ga0070659_1000914853 228
263 3300005367 Ga0070667_100000365 Ga0070667_1000003656 228
264 3300005367 Ga0070667_100111792 Ga0070667_1001117921 228
265 3300005367 Ga0070667_100264796 Ga0070667_1002647962 228
266 3300005367 Ga0070667_100404215 Ga0070667_1004042152 228
267 3300005406 Ga0070703_10003914 Ga0070703_100039142 228
268 3300005406 Ga0070703_10012992 Ga0070703_100129923 228
269 3300005434 Ga0070709_10003137 Ga0070709_100031373 228
270 3300005435 Ga0070714_100009592 Ga0070714_1000095928 228
271 3300005435 Ga0070714_100088726 Ga0070714_1000887262 228
272 3300005436 Ga0070713_100034352 Ga0070713_1000343523 228
273 3300005436 Ga0070713_100097183 Ga0070713_1000971832 228
274 3300005436 Ga0070713_100102543 Ga0070713_1001025433 228
275 3300005437 Ga0070710_10005022 Ga0070710_100050224 228
276 3300005437 Ga0070710_10044400 Ga0070710_100444002 228
277 3300005438 Ga0070701_10000493 Ga0070701_1000049311 228
278 3300005438 Ga0070701_10012908 Ga0070701_100129081 228
279 3300005439 Ga0070711_100015744 Ga0070711_1000157444 228
280 3300005439 Ga0070711_100030851 Ga0070711_1000308515 228
281 3300005440 Ga0070705_100002314 Ga0070705_1000023149 228
282 3300005441 Ga0070700_100000467 Ga0070700_10000046713 228
283 3300005441 Ga0070700_100015212 Ga0070700_1000152125 228
284 3300005444 Ga0070694_100000065 Ga0070694_10000006545 228
285 3300005444 Ga0070694_100029375 Ga0070694_1000293754 228
286 3300005444 Ga0070694_100116812 Ga0070694_1001168122 228
287 3300005445 Ga0070708_100113795 Ga0070708_1001137952 228
288 3300005445 Ga0070708_100501514 Ga0070708_1005015141 228
289 3300005455 Ga0070663_100000473 Ga0070663_10000047311 228
290 3300005455 Ga0070663_100019373 Ga0070663_1000193734 228
291 3300005455 Ga0070663_100160367 Ga0070663_1001603673 228
292 3300005455 Ga0070663_100173840 Ga0070663_1001738402 228
293 3300005456 Ga0070678_100000091 Ga0070678_1000000917 228
294 3300005456 Ga0070678_100007141 Ga0070678_1000071414 228
295 3300005456 Ga0070678_100034927 Ga0070678_1000349273 228
296 3300005457 Ga0070662_100006535 Ga0070662_1000065357 228
297 3300005457 Ga0070662_100026059 Ga0070662_1000260594 228
298 3300005458 Ga0070681_10010003 Ga0070681_1001000310 228
299 3300005458 Ga0070681_10084108 Ga0070681_100841082 228
300 3300005458 Ga0070681_10086642 Ga0070681_100866422 228
301 3300005459 Ga0068867_100000859 Ga0068867_10000085923 228
302 3300005459 Ga0068867_100146404 Ga0068867_1001464042 228
303 3300005466 Ga0070685_10001731 Ga0070685_100017315 228
304 3300005466 Ga0070685_10015115 Ga0070685_100151152 228
305 3300005530 Ga0070679_100012754 Ga0070679_1000127547 228
306 3300005530 Ga0070679_100387110 Ga0070679_1003871102 228
307 3300005535 Ga0070684_100000219 Ga0070684_1000002197 228
308 3300005535 Ga0070684_100160770 Ga0070684_1001607702 228
309 3300005535 Ga0070684_100175075 Ga0070684_1001750753 228
310 3300005536 Ga0070697_100400514 Ga0070697_1004005142 228
311 3300005539 Ga0068853_100000600 Ga0068853_10000060018 228
312 3300005539 Ga0068853_100137654 Ga0068853_1001376542 228
313 3300005539 Ga0068853_100185112 Ga0068853_1001851123 228
314 3300005539 Ga0068853_101055976 Ga0068853_1010559761 228
315 3300005543 Ga0070672_100000019 Ga0070672_10000001916 228
316 3300005543 Ga0070672_100284015 Ga0070672_1002840152 228
317 3300005544 Ga0070686_100007875 Ga0070686_1000078756 228
318 3300005544 Ga0070686_100013377 Ga0070686_1000133775 228
319 3300005544 Ga0070686_100032042 Ga0070686_1000320423 228
320 3300005545 Ga0070695_100000474 Ga0070695_10000047413 228
321 3300005546 Ga0070696_100003100 Ga0070696_10000310013 228
322 3300005546 Ga0070696_100068780 Ga0070696_1000687802 228
323 3300005546 Ga0070696_100078891 Ga0070696_1000788912 228
324 3300005546 Ga0070696_100107349 Ga0070696_1001073492 228
325 3300005547 Ga0070693_100001868 Ga0070693_1000018688 228
326 3300005547 Ga0070693_100146914 Ga0070693_1001469142 228
327 3300005548 Ga0070665_100010015 Ga0070665_1000100155 228
328 3300005548 Ga0070665_100298004 Ga0070665_1002980043 228
329 3300005549 Ga0070704_100000252 Ga0070704_10000025217 228
330 3300005549 Ga0070704_100001606 Ga0070704_10000160614 228
331 3300005563 Ga0068855_100019721 Ga0068855_1000197218 228
332 3300005563 Ga0068855_100139952 Ga0068855_1001399522 228
333 3300005564 Ga0070664_100000819 Ga0070664_10000081914 228
334 3300005577 Ga0068857_100618567 Ga0068857_1006185672 228
335 3300005578 Ga0068854_100001736 Ga0068854_1000017363 228
336 3300005614 Ga0068856_100002295 Ga0068856_10000229519 228
337 3300005614 Ga0068856_100110986 Ga0068856_1001109863 228
338 3300005615 Ga0070702_100000898 Ga0070702_1000008987 228
339 3300005615 Ga0070702_100050904 Ga0070702_1000509043 228
340 3300005616 Ga0068852_100001992 Ga0068852_1000019927 228
341 3300005617 Ga0068859_100001870 Ga0068859_1000018702 228
342 3300005617 Ga0068859_101135365 Ga0068859_1011353652 228
343 3300005618 Ga0068864_100000429 Ga0068864_10000042930 228
344 3300005718 Ga0068866_10001028 Ga0068866_100010283 228
345 3300005718 Ga0068866_10053984 Ga0068866_100539843 228
346 3300005719 Ga0068861_100000169 Ga0068861_1000001698 228
347 3300005719 Ga0068861_100126569 Ga0068861_1001265692 228
348 3300005719 Ga0068861_100326621 Ga0068861_1003266212 228
349 3300005840 Ga0068870_10000586 Ga0068870_100005867 228
350 3300005841 Ga0068863_100000381 Ga0068863_10000038127 228
351 3300005841 Ga0068863_100284008 Ga0068863_1002840082 228
352 3300005842 Ga0068858_100009197 Ga0068858_1000091977 228
353 3300005842 Ga0068858_100047150 Ga0068858_1000471502 228
354 3300005842 Ga0068858_100134470 Ga0068858_1001344703 228
355 3300005843 Ga0068860_100001472 Ga0068860_10000147217 228
356 3300005843 Ga0068860_100457462 Ga0068860_1004574622 228
357 3300005844 Ga0068862_100001886 Ga0068862_1000018868 228
358 3300005937 Ga0081455_10012017 Ga0081455_100120173 228
359 3300005937 Ga0081455_10219782 Ga0081455_102197822 228
360 3300006028 Ga0070717_10089000 Ga0070717_100890003 228
361 3300006038 Ga0075365_10010543 Ga0075365_100105436 228
362 3300006042 Ga0075368_10027809 Ga0075368_100278093 228
363 3300006042 Ga0075368_10029855 Ga0075368_100298552 228
364 3300006051 Ga0075364_10057707 Ga0075364_100577072 228
365 3300006058 Ga0075432_10000873 Ga0075432_100008733 228
366 3300006163 Ga0070715_10005082 Ga0070715_100050822 228
367 3300006163 Ga0070715_10050840 Ga0070715_100508402 228
368 3300006173 Ga0070716_100195534 Ga0070716_1001955342 228
369 3300006173 Ga0070716_100389171 Ga0070716_1003891712 228
370 3300006175 Ga0070712_100299297 Ga0070712_1002992972 228
371 3300006175 Ga0070712_100303161 Ga0070712_1003031612 228
372 3300006175 Ga0070712_100305067 Ga0070712_1003050672 228
373 3300006175 Ga0070712_100434228 Ga0070712_1004342282 228
374 3300006178 Ga0075367_10012283 Ga0075367_100122832 228
375 3300006178 Ga0075367_10019938 Ga0075367_100199382 228
376 3300006237 Ga0097621_100001234 Ga0097621_1000012348 228
377 3300006237 Ga0097621_100036113 Ga0097621_1000361133 228
378 3300006237 Ga0097621_100324419 Ga0097621_1003244192 228
379 3300006358 Ga0068871_100000068 Ga0068871_10000006850 228
380 3300006358 Ga0068871_100012500 Ga0068871_1000125003 228
381 3300006358 Ga0068871_100025352 Ga0068871_1000253522 228
382 3300006844 Ga0075428_100035558 Ga0075428_1000355583 228
383 3300006846 Ga0075430_100004696 Ga0075430_1000046963 228
384 3300006847 Ga0075431_100006639 Ga0075431_1000066393 228
385 3300006852 Ga0075433_10001599 Ga0075433_100015999 228
386 3300006852 Ga0075433_10099038 Ga0075433_100990382 228
387 3300006852 Ga0075433_10152765 Ga0075433_101527653 228
388 3300006871 Ga0075434_100000576 Ga0075434_10000057620 228
389 3300006871 Ga0075434_100001666 Ga0075434_1000016668 228
390 3300006871 Ga0075434_100364476 Ga0075434_1003644762 228
391 3300006880 Ga0075429_100060828 Ga0075429_1000608283 228
392 3300006881 Ga0068865_100005133 Ga0068865_1000051334 228
393 3300006881 Ga0068865_100123831 Ga0068865_1001238313 228
394 3300006881 Ga0068865_100182517 Ga0068865_1001825172 228
395 3300006931 Ga0097620_100001870 Ga0097620_1000018702 228
396 3300006931 Ga0097620_101135323 Ga0097620_1011353231 228
397 3300007076 Ga0075435_100002716 Ga0075435_1000027167 228
398 3300007076 Ga0075435_100358961 Ga0075435_1003589612 228
399 3300007076 Ga0075435_100365050 Ga0075435_1003650502 228
400 3300007076 Ga0075435_100453275 Ga0075435_1004532752 228
401 3300009011 Ga0105251_10030580 Ga0105251_100305802 228
402 3300009036 Ga0105244_10058949 Ga0105244_100589492 228
403 3300009092 Ga0105250_10042528 Ga0105250_100425283 228
404 3300009092 Ga0105250_10211111 Ga0105250_102111111 228
405 3300009093 Ga0105240_10068510 Ga0105240_100685104 228
406 3300009093 Ga0105240_10219427 Ga0105240_102194272 228
407 3300009094 Ga0111539_10000082 Ga0111539_1000008217 228
408 3300009094 Ga0111539_10000503 Ga0111539_1000050331 228
409 3300009094 Ga0111539_10003417 Ga0111539_1000341710 228
410 3300009094 Ga0111539_10661815 Ga0111539_106618151 228
411 3300009098 Ga0105245_10000780 Ga0105245_1000078016 228
412 3300009098 Ga0105245_10091423 Ga0105245_100914231 228
413 3300009098 Ga0105245_10176454 Ga0105245_101764543 228
414 3300009101 Ga0105247_10002726 Ga0105247_100027264 228
415 3300009101 Ga0105247_10029759 Ga0105247_100297593 228
416 3300009101 Ga0105247_10160703 Ga0105247_101607032 228
417 3300009147 Ga0114129_10009008 Ga0114129_1000900815 228
418 3300009147 Ga0114129_10013874 Ga0114129_100138749 228
419 3300009148 Ga0105243_10001083 Ga0105243_1000108317 228
420 3300009148 Ga0105243_10016567 Ga0105243_100165676 228
421 3300009174 Ga0105241_10000760 Ga0105241_1000076016 228
422 3300009174 Ga0105241_10323813 Ga0105241_103238132 228
423 3300009174 Ga0105241_10388460 Ga0105241_103884602 228
424 3300009176 Ga0105242_10019812 Ga0105242_100198124 228
425 3300009176 Ga0105242_10039143 Ga0105242_100391432 228
426 3300009176 Ga0105242_10247165 Ga0105242_102471652 228
427 3300009177 Ga0105248_10011305 Ga0105248_100113056 228
428 3300009177 Ga0105248_10031416 Ga0105248_100314166 228
429 3300009177 Ga0105248_10311016 Ga0105248_103110162 228
430 3300009545 Ga0105237_10006171 Ga0105237_1000617114 228
431 3300009545 Ga0105237_10024205 Ga0105237_100242056 228
432 3300009545 Ga0105237_10745220 Ga0105237_107452202 228
433 3300009551 Ga0105238_10067718 Ga0105238_100677184 228
434 3300009551 Ga0105238_10074611 Ga0105238_100746113 228
435 3300009551 Ga0105238_10335711 Ga0105238_103357112 228
436 3300009553 Ga0105249_10002196 Ga0105249_100021966 228
437 3300009553 Ga0105249_10028272 Ga0105249_100282723 228
438 3300009553 Ga0105249_10134000 Ga0105249_101340003 228
439 3300010375 Ga0105239_10002791 Ga0105239_1000279115 228
440 3300010375 Ga0105239_10222845 Ga0105239_102228453 228
441 3300010375 Ga0105239_10242668 Ga0105239_102426683 228
442 3300010375 Ga0105239_10282106 Ga0105239_102821062 228
443 3300010375 Ga0105239_10355496 Ga0105239_103554962 228
444 3300010375 Ga0105239_10446280 Ga0105239_104462802 228
445 3300011119 Ga0105246_10001585 Ga0105246_1000158516 228
446 3300011119 Ga0105246_10096520 Ga0105246_100965202 228
447 3300011119 Ga0105246_10099937 Ga0105246_100999373 228
448 3300011119 Ga0105246_10113686 Ga0105246_101136862 228
449 3300012492 Ga0157335_1000547 Ga0157335_10005472 228
450 3300012507 Ga0157342_1000614 Ga0157342_10006142 228
451 3300012510 Ga0157316_1000263 Ga0157316_10002634 228
452 3300013100 Ga0157373_10006240 Ga0157373_100062409 228
453 3300013100 Ga0157373_10118237 Ga0157373_101182372 228
454 3300013102 Ga0157371_10085248 Ga0157371_100852482 228
455 3300013102 Ga0157371_10141704 Ga0157371_101417042 228
456 3300013105 Ga0157369_10542855 Ga0157369_105428552 228
457 3300013105 Ga0157369_10630522 Ga0157369_106305222 228
458 3300013296 Ga0157374_10001691 Ga0157374_1000169111 228
459 3300013296 Ga0157374_10141327 Ga0157374_101413272 228
460 3300013297 Ga0157378_10001445 Ga0157378_1000144510 228
461 3300013297 Ga0157378_10052925 Ga0157378_100529252 228
462 3300013297 Ga0157378_10127916 Ga0157378_101279162 228
463 3300013297 Ga0157378_10184044 Ga0157378_101840443 228
464 3300013306 Ga0163162_10000790 Ga0163162_1000079011 228
465 3300013306 Ga0163162_10018394 Ga0163162_100183943 228
466 3300013306 Ga0163162_10327920 Ga0163162_103279202 228
467 3300013307 Ga0157372_10009037 Ga0157372_100090376 228
468 3300013307 Ga0157372_11033726 Ga0157372_110337262 228
469 3300013308 Ga0157375_10000468 Ga0157375_1000046821 228
470 3300013308 Ga0157375_10078898 Ga0157375_100788983 228
471 3300013308 Ga0157375_10087945 Ga0157375_100879452 228
472 3300013308 Ga0157375_10390805 Ga0157375_103908052 228
473 3300014325 Ga0163163_10003322 Ga0163163_1000332219 228
474 3300014325 Ga0163163_10020189 Ga0163163_100201894 228
475 3300014325 Ga0163163_10156862 Ga0163163_101568623 228
476 3300014326 Ga0157380_10002913 Ga0157380_100029137 228
477 3300014326 Ga0157380_10009719 Ga0157380_100097193 228
478 3300014745 Ga0157377_10000276 Ga0157377_1000027617 228
479 3300014745 Ga0157377_10349621 Ga0157377_103496212 228
480 3300014968 Ga0157379_10002285 Ga0157379_1000228512 228
481 3300014968 Ga0157379_10063216 Ga0157379_100632163 228
482 3300014968 Ga0157379_10105406 Ga0157379_101054062 228
483 3300014968 Ga0157379_10110590 Ga0157379_101105903 228
484 3300014968 Ga0157379_10147731 Ga0157379_101477312 228
485 3300014968 Ga0157379_10496643 Ga0157379_104966432 228
486 3300014969 Ga0157376_10000692 Ga0157376_100006926 228
487 3300014969 Ga0157376_10153359 Ga0157376_101533592 228
488 3300017792 Ga0163161_10000384 Ga0163161_1000038416 228
489 3300017792 Ga0163161_10047076 Ga0163161_100470764 228
490 3300025271 Ga0207666_1000097 Ga0207666_100009710 228
491 3300025290 Ga0207673_1000201 Ga0207673_10002014 228
492 3300025315 Ga0207697_10000550 Ga0207697_1000055010 228
493 3300025315 Ga0207697_10013264 Ga0207697_100132643 228
494 3300025321 Ga0207656_10176504 Ga0207656_101765042 228
495 3300025885 Ga0207653_10010851 Ga0207653_100108513 228
496 3300025885 Ga0207653_10018054 Ga0207653_100180542 228
497 3300025893 Ga0207682_10000088 Ga0207682_1000008817 228
498 3300025898 Ga0207692_10001966 Ga0207692_100019666 228
499 3300025899 Ga0207642_10000381 Ga0207642_1000038116 228
500 3300025900 Ga0207710_10001324 Ga0207710_100013244 228
501 3300025901 Ga0207688_10001203 Ga0207688_100012037 228
502 3300025901 Ga0207688_10021688 Ga0207688_100216883 228
503 3300025903 Ga0207680_10009047 Ga0207680_100090476 228
504 3300025904 Ga0207647_10002714 Ga0207647_100027147 228
505 3300025904 Ga0207647_10020089 Ga0207647_100200895 228
506 3300025905 Ga0207685_10005159 Ga0207685_100051594 228
507 3300025905 Ga0207685_10006707 Ga0207685_100067074 228
508 3300025907 Ga0207645_10000140 Ga0207645_100001407 228
509 3300025908 Ga0207643_10000083 Ga0207643_100000837 228
510 3300025911 Ga0207654_10002699 Ga0207654_100026995 228
511 3300025911 Ga0207654_10208412 Ga0207654_102084122 228
512 3300025912 Ga0207707_10020854 Ga0207707_100208544 228
513 3300025912 Ga0207707_10122457 Ga0207707_101224573 228
514 3300025912 Ga0207707_10395287 Ga0207707_103952872 228
515 3300025913 Ga0207695_10156107 Ga0207695_101561073 228
516 3300025914 Ga0207671_10004533 Ga0207671_100045334 228
517 3300025915 Ga0207693_10007583 Ga0207693_100075839 228
518 3300025915 Ga0207693_10021626 Ga0207693_100216264 228
519 3300025915 Ga0207693_10068883 Ga0207693_100688834 228
520 3300025915 Ga0207693_10300615 Ga0207693_103006152 228
521 3300025916 Ga0207663_10126218 Ga0207663_101262183 228
522 3300025917 Ga0207660_10000073 Ga0207660_1000007317 228
523 3300025917 Ga0207660_10024362 Ga0207660_100243622 228
524 3300025918 Ga0207662_10000964 Ga0207662_1000096410 228
525 3300025918 Ga0207662_10019591 Ga0207662_100195916 228
526 3300025919 Ga0207657_10005395 Ga0207657_1000539510 228
527 3300025919 Ga0207657_10020125 Ga0207657_100201255 228
528 3300025919 Ga0207657_10077205 Ga0207657_100772053 228
529 3300025920 Ga0207649_10000450 Ga0207649_1000045016 228
530 3300025920 Ga0207649_10020627 Ga0207649_100206273 228
531 3300025920 Ga0207649_10026888 Ga0207649_100268883 228
532 3300025921 Ga0207652_10008726 Ga0207652_100087264 228
533 3300025923 Ga0207681_10000097 Ga0207681_1000009735 228
534 3300025923 Ga0207681_10060128 Ga0207681_100601283 228
535 3300025924 Ga0207694_10059954 Ga0207694_100599543 228
536 3300025925 Ga0207650_10061678 Ga0207650_100616783 228
537 3300025926 Ga0207659_10000092 Ga0207659_1000009243 228
538 3300025926 Ga0207659_10045065 Ga0207659_100450653 228
539 3300025927 Ga0207687_10000219 Ga0207687_100002193 228
540 3300025927 Ga0207687_10188559 Ga0207687_101885592 228
541 3300025927 Ga0207687_10271732 Ga0207687_102717322 228
542 3300025928 Ga0207700_10064607 Ga0207700_100646073 228
543 3300025929 Ga0207664_10060581 Ga0207664_100605813 228
544 3300025931 Ga0207644_10005083 Ga0207644_100050834 228
545 3300025932 Ga0207690_10003312 Ga0207690_100033123 228
546 3300025932 Ga0207690_10080436 Ga0207690_100804363 228
547 3300025933 Ga0207706_10004310 Ga0207706_100043107 228
548 3300025933 Ga0207706_10008823 Ga0207706_100088236 228
549 3300025933 Ga0207706_10035694 Ga0207706_100356943 228
550 3300025933 Ga0207706_10402431 Ga0207706_104024312 228
551 3300025934 Ga0207686_10000796 Ga0207686_100007968 228
552 3300025934 Ga0207686_10007990 Ga0207686_100079905 228
553 3300025934 Ga0207686_10062208 Ga0207686_100622082 228
554 3300025935 Ga0207709_10000362 Ga0207709_1000036227 228
555 3300025935 Ga0207709_10086413 Ga0207709_100864133 228
556 3300025935 Ga0207709_10447410 Ga0207709_104474102 228
557 3300025936 Ga0207670_10002375 Ga0207670_1000237510 228
558 3300025936 Ga0207670_10228066 Ga0207670_102280662 228
559 3300025936 Ga0207670_10239254 Ga0207670_102392542 228
560 3300025937 Ga0207669_10000350 Ga0207669_100003509 228
561 3300025937 Ga0207669_10085232 Ga0207669_100852322 228
562 3300025938 Ga0207704_10000479 Ga0207704_100004797 228
563 3300025938 Ga0207704_10062358 Ga0207704_100623582 228
564 3300025939 Ga0207665_10070872 Ga0207665_100708722 228
565 3300025939 Ga0207665_10089903 Ga0207665_100899031 228
566 3300025939 Ga0207665_10089990 Ga0207665_100899902 228
567 3300025940 Ga0207691_10000283 Ga0207691_1000028343 228
568 3300025941 Ga0207711_10009170 Ga0207711_100091708 228
569 3300025941 Ga0207711_10009675 Ga0207711_100096753 228
570 3300025941 Ga0207711_10319498 Ga0207711_103194982 228
571 3300025941 Ga0207711_10497578 Ga0207711_104975782 228
572 3300025942 Ga0207689_10000085 Ga0207689_1000008566 228
573 3300025942 Ga0207689_10282423 Ga0207689_102824232 228
574 3300025944 Ga0207661_10000464 Ga0207661_1000046417 228
575 3300025945 Ga0207679_10000030 Ga0207679_10000030150 228
576 3300025960 Ga0207651_10000422 Ga0207651_100004224 228
577 3300025961 Ga0207712_10004682 Ga0207712_100046829 228
578 3300025972 Ga0207668_10000114 Ga0207668_1000011443 228
579 3300025981 Ga0207640_10000141 Ga0207640_1000014153 228
580 3300025986 Ga0207658_10002853 Ga0207658_1000285311 228
581 3300025986 Ga0207658_10051359 Ga0207658_100513593 228
582 3300025986 Ga0207658_10155178 Ga0207658_101551782 228
583 3300026023 Ga0207677_10001776 Ga0207677_100017763 228
584 3300026035 Ga0207703_10000983 Ga0207703_1000098310 228
585 3300026035 Ga0207703_10043709 Ga0207703_100437093 228
586 3300026041 Ga0207639_10000305 Ga0207639_1000030516 228
587 3300026041 Ga0207639_10522236 Ga0207639_105222362 228
588 3300026067 Ga0207678_10000125 Ga0207678_1000012550 228
589 3300026067 Ga0207678_10016358 Ga0207678_100163582 228
590 3300026067 Ga0207678_10197514 Ga0207678_101975143 228
591 3300026067 Ga0207678_10317254 Ga0207678_103172541 228
592 3300026075 Ga0207708_10000187 Ga0207708_1000018710 228
593 3300026075 Ga0207708_10014918 Ga0207708_100149185 228
594 3300026078 Ga0207702_10005437 Ga0207702_100054377 228
595 3300026078 Ga0207702_10058876 Ga0207702_100588763 228
596 3300026088 Ga0207641_10003649 Ga0207641_1000364916 228
597 3300026088 Ga0207641_10055119 Ga0207641_100551193 228
598 3300026088 Ga0207641_10425394 Ga0207641_104253942 228
599 3300026089 Ga0207648_10002168 Ga0207648_1000216817 228
600 3300026089 Ga0207648_10218410 Ga0207648_102184102 228
601 3300026095 Ga0207676_10000074 Ga0207676_1000007416 228
602 3300026095 Ga0207676_10340378 Ga0207676_103403782 228
603 3300026116 Ga0207674_10002501 Ga0207674_1000250110 228
604 3300026116 Ga0207674_10502099 Ga0207674_105020991 228
605 3300026118 Ga0207675_100004556 Ga0207675_10000455610 228
606 3300026118 Ga0207675_100033895 Ga0207675_1000338955 228
607 3300026118 Ga0207675_100268737 Ga0207675_1002687372 228
608 3300026121 Ga0207683_10000014 Ga0207683_1000001444 228
609 3300026121 Ga0207683_10003999 Ga0207683_1000399910 228
610 3300026142 Ga0207698_10001242 Ga0207698_100012427 228
611 3300027617 Ga0210002_1005455 Ga0210002_10054552 228
612 3300027665 Ga0209983_1006800 Ga0209983_10068002 228
613 3300027682 Ga0209971_1013855 Ga0209971_10138553 228
614 3300027695 Ga0209966_1009479 Ga0209966_10094792 228
615 3300027717 Ga0209998_10000361 Ga0209998_1000036110 228
616 3300027717 Ga0209998_10001516 Ga0209998_100015164 228
617 3300027876 Ga0209974_10002250 Ga0209974_100022503 228
618 3300027876 Ga0209974_10012895 Ga0209974_100128954 228
619 3300027907 Ga0207428_10000114 Ga0207428_1000011471 228
620 3300027907 Ga0207428_10000467 Ga0207428_1000046732 228
621 3300027907 Ga0207428_10011322 Ga0207428_100113224 228
622 3300028379 Ga0268266_10034656 Ga0268266_100346563 228
623 3300028379 Ga0268266_10041670 Ga0268266_100416703 228
624 3300028379 Ga0268266_10444325 Ga0268266_104443252 228
625 3300028380 Ga0268265_10001371 Ga0268265_100013714 228
626 3300028381 Ga0268264_10000469 Ga0268264_1000046915 228
627 3300028381 Ga0268264_10016375 Ga0268264_100163752 228
628 3300034816 Ga0373930_0000150 Ga0373930_0000150_5554_6240 228
629 3300034817 Ga0373948_0000307 Ga0373948_0000307_3352_4038 228
630 3300034817 Ga0373948_0020966 Ga0373948_0020966_91_777 228
631 3300034818 Ga0373950_0002075 Ga0373950_0002075_686_1372 228
632 3300034819 Ga0373958_0001702 Ga0373958_0001702_1469_2155 228
633 3300034819 Ga0373958_0002841 Ga0373958_0002841_1035_1733 228
634 3300034957 Ga0373938_0002852 Ga0373938_0002852_467_1153 228
635 3300035083 Ga0373926_0132204 Ga0373926_0132204_88_786 228
636 3300035084 Ga0373928_0000222 Ga0373928_0000222_9386_10072 228
637 3300035084 Ga0373928_0004477 Ga0373928_0004477_1090_1776 228
638 3300035084 Ga0373928_0025802 Ga0373928_0025802_217_915 228
639 3300035085 Ga0373929_0002384 Ga0373929_0002384_36_722 228
640 3300035085 Ga0373929_0002872 Ga0373929_0002872_825_1523 228
641 3300035085 Ga0373929_0003760 Ga0373929_0003760_1266_1952 228
642 3300035088 Ga0373940_0012698 Ga0373940_0012698_117_803 228
643 3300035090 Ga0373949_0001450 Ga0373949_0001450_3598_4284 228
644 3300035090 Ga0373949_0006107 Ga0373949_0006107_401_1087 228
645 3300035090 Ga0373949_0007302 Ga0373949_0007302_1159_1857 228
646 3300035091 Ga0373951_0006621 Ga0373951_0006621_373_1059 228
647 3300035091 Ga0373951_0007633 Ga0373951_0007633_1735_2433 228
648 3300035091 Ga0373951_0039164 Ga0373951_0039164_27_713 228
649 3300035092 Ga0373952_0000029 Ga0373952_0000029_3912_4598 228
650 3300035092 Ga0373952_0002545 Ga0373952_0002545_376_1062 228
651 3300035112 Ga0373932_0001251 Ga0373932_0001251_2259_2945 228
652 3300035112 Ga0373932_0001864 Ga0373932_0001864_1411_2097 228
653 3300035112 Ga0373932_0023866 Ga0373932_0023866_642_1340 228
654 3300035113 Ga0373936_0006326 Ga0373936_0006326_3726_4424 228
655 3300035114 Ga0373939_0000339 Ga0373939_0000339_3480_4166 228
656 3300035114 Ga0373939_0001987 Ga0373939_0001987_3046_3750 228
657 3300035115 Ga0373941_0002285 Ga0373941_0002285_687_1373 228
658 3300035115 Ga0373941_0021633 Ga0373941_0021633_668_1354 228
659 3300035117 Ga0373953_0028414 Ga0373953_0028414_431_1120 228
660 3300035118 Ga0373954_0126152 Ga0373954_0126152_227_913 228
661 3300035119 Ga0373956_0006309 Ga0373956_0006309_3954_4640 228
662 3300035120 Ga0373957_0006384 Ga0373957_0006384_1247_1936 228
663 3300035121 Ga0373960_0000372 Ga0373960_0000372_4886_5572 228
664 3300035121 Ga0373960_0004334 Ga0373960_0004334_2154_2852 228
665 3300035170 Ga0373943_0016793 Ga0373943_0016793_2441_3139 228
666 3300035170 Ga0373943_0042928 Ga0373943_0042928_406_1095 228
667 3300035171 Ga0373946_0028615 Ga0373946_0028615_967_1665 228
668 3300035171 Ga0373946_0115322 Ga0373946_0115322_82_771 228
669 3300035171 Ga0373946_0232748 Ga0373946_0232748_87_776 228
670 3300035172 Ga0373955_0001269 Ga0373955_0001269_5551_6249 228
671 3300035172 Ga0373955_0001523 Ga0373955_0001523_4086_4772 228
672 3300035172 Ga0373955_0004969 Ga0373955_0004969_4940_5629 228
673 3300035207 Ga0373942_0000767 Ga0373942_0000767_3083_3769 228
674 3300035207 Ga0373942_0003994 Ga0373942_0003994_979_1665 228
675 3300035241 Ga0373961_0001835 Ga0373961_0001835_2529_3215 228
676 3300035241 Ga0373961_0003896 Ga0373961_0003896_583_1269 228
677 3300035241 Ga0373961_0068546 Ga0373961_0068546_284_982 228
678 3300035242 Ga0373962_0005930 Ga0373962_0005930_2144_2830 228
679 3300035410 Ga0373924_0023997 Ga0373924_0023997_1671_2360 228
680 3300035691 Ga0373931_0000169 Ga0373931_0000169_17391_18077 228
681 3300035692 Ga0373935_0011709 Ga0373935_0011709_4229_4927 228
682 3300035692 Ga0373935_0020667 Ga0373935_0020667_3315_4013 228
683 3300035692 Ga0373935_0073204 Ga0373935_0073204_426_1115 228
684 3300035692 Ga0373935_0210026 Ga0373935_0210026_86_775 228
685 3300035695 Ga0373927_0016232 Ga0373927_0016232_2792_3490 228
686 3300035695 Ga0373927_0118710 Ga0373927_0118710_291_977 228
687 3300035695 Ga0373927_0327201 Ga0373927_0327201_272_970 228
688 3300035724 Ga0373933_0001124 Ga0373933_0001124_13554_14243 228
689 3300035724 Ga0373933_0017906 Ga0373933_0017906_2847_3545 228
690 3300035725 Ga0373947_0005580 Ga0373947_0005580_855_1553 228
691 3300035725 Ga0373947_0038674 Ga0373947_0038674_769_1467 228
692 3300036401 Ga0373937_0004918 Ga0373937_0004918_1480_2169 228
693 3300036401 Ga0373937_0012121 Ga0373937_0012121_1730_2416 228
694 3300036401 Ga0373937_0049021 Ga0373937_0049021_688_1386 228
695 3300037068 Ga0373925_0009626 Ga0373925_0009626_5481_6179 228
696 3300037068 Ga0373925_0127186 Ga0373925_0127186_763_1452 228
697 3300044712 Ga0453684_0037028 Ga0453684_0037028_5316_6002 228
698 3300045051 Ga0451576_0033369 Ga0451576_0033369_1733_2419 228
699 3300045051 Ga0451576_0664672 Ga0451576_0664672_157_855 228
700 3300046454 Ga0495592_0024186 Ga0495592_0024186_636_1325 228
701 3300046455 Ga0495603_0046132 Ga0495603_0046132_404_1102 228
702 3300046459 Ga0495629_0000535 Ga0495629_0000535_13682_14380 228
703 3300046459 Ga0495629_0020891 Ga0495629_0020891_147_836 228
704 3300046459 Ga0495629_0205634 Ga0495629_0205634_182_871 228
705 3300046461 Ga0495641_0065839 Ga0495641_0065839_929_1618 228
706 3300046462 Ga0495651_0011021 Ga0495651_0011021_2316_3005 228
707 3300046463 Ga0495653_0008326 Ga0495653_0008326_6335_7024 228
708 3300046463 Ga0495653_0012564 Ga0495653_0012564_5018_5716 228
709 3300046463 Ga0495653_0124079 Ga0495653_0124079_526_1215 228
710 3300046472 Ga0495580_0043554 Ga0495580_0043554_41_739 228
711 3300046473 Ga0495582_0085855 Ga0495582_0085855_962_1660 228
712 3300046475 Ga0495639_0025045 Ga0495639_0025045_1597_2295 228
713 3300046475 Ga0495639_0026471 Ga0495639_0026471_1570_2268 228
714 3300046475 Ga0495639_0029697 Ga0495639_0029697_691_1380 228
715 3300046476 Ga0495662_0010283 Ga0495662_0010283_3724_4422 228
716 3300046476 Ga0495662_0097428 Ga0495662_0097428_285_974 228
717 3300046477 Ga0495664_0003537 Ga0495664_0003537_6456_7145 228
718 3300046477 Ga0495664_0094440 Ga0495664_0094440_416_1102 228
719 3300046491 Ga0495584_0053237 Ga0495584_0053237_1046_1732 228
720 3300046491 Ga0495584_0061215 Ga0495584_0061215_543_1241 228
721 3300046492 Ga0495585_0008366 Ga0495585_0008366_4943_5641 228
722 3300046499 Ga0495594_0042775 Ga0495594_0042775_1676_2374 228
723 3300046511 Ga0495608_0001474 Ga0495608_0001474_1995_2684 228
724 3300046511 Ga0495608_0070865 Ga0495608_0070865_1538_2236 228
725 3300046513 Ga0495616_0133964 Ga0495616_0133964_143_841 228
726 3300046514 Ga0495618_0004984 Ga0495618_0004984_2789_3478 228
727 3300046514 Ga0495618_0048527 Ga0495618_0048527_1337_2035 228
728 3300046516 Ga0495628_0001927 Ga0495628_0001927_8798_9484 228
729 3300046516 Ga0495628_0023873 Ga0495628_0023873_2310_3008 228
730 3300046517 Ga0495630_0121732 Ga0495630_0121732_1060_1749 228
731 3300046517 Ga0495630_0132895 Ga0495630_0132895_718_1407 228
732 3300046517 Ga0495630_0149540 Ga0495630_0149540_180_878 228
733 3300046523 Ga0495644_0002701 Ga0495644_0002701_1572_2270 228
734 3300046526 Ga0495666_0119340 Ga0495666_0119340_403_1101 228
735 3300046526 Ga0495666_0153376 Ga0495666_0153376_38_736 228
736 3300046529 Ga0495652_0022449 Ga0495652_0022449_2788_3486 228
737 3300046529 Ga0495652_0087560 Ga0495652_0087560_1099_1788 228
738 3300046531 Ga0495665_0084203 Ga0495665_0084203_141_839 228
739 3300046533 Ga0495640_0027462 Ga0495640_0027462_2306_2995 228
740 3300046533 Ga0495640_0071975 Ga0495640_0071975_1285_1983 228
741 3300046533 Ga0495640_0216381 Ga0495640_0216381_223_912 228
742 3300046535 Ga0495586_0133216 Ga0495586_0133216_394_1083 228
743 3300046536 Ga0495587_0002240 Ga0495587_0002240_8740_9429 228
744 3300046536 Ga0495587_0035407 Ga0495587_0035407_86_772 228
745 3300046537 Ga0495598_0007286 Ga0495598_0007286_446_1144 228
746 3300046538 Ga0495609_0058799 Ga0495609_0058799_802_1500 228
747 3300046543 Ga0495645_0002539 Ga0495645_0002539_8368_9057 228
748 3300046543 Ga0495645_0019854 Ga0495645_0019854_1858_2544 228
749 3300046557 Ga0495622_0015565 Ga0495622_0015565_2273_2971 228
750 3300046557 Ga0495622_0045597 Ga0495622_0045597_1115_1804 228
751 3300046558 Ga0495633_0002969 Ga0495633_0002969_10442_11140 228
752 3300046559 Ga0495667_0001150 Ga0495667_0001150_16103_16792 228
753 3300046615 Ga0495656_0002822 Ga0495656_0002822_4879_5577 228
754 3300046642 Ga0495634_0026079 Ga0495634_0026079_2234_2923 228
755 3300046663 Ga0495635_0003881 Ga0495635_0003881_2548_3237 228
756 3300046663 Ga0495635_0021401 Ga0495635_0021401_1694_2392 228
757 3300046664 Ga0495659_0001458 Ga0495659_0001458_5595_6293 228
758 3300046675 Ga0495657_0010946 Ga0495657_0010946_3214_3903 228
759 3300046678 Ga0495599_0004481 Ga0495599_0004481_3954_4643 228
760 3300046678 Ga0495599_0017530 Ga0495599_0017530_2383_3081 228
761 3300046679 Ga0495623_0000420 Ga0495623_0000420_25967_26656 228
762 3300046680 Ga0495646_0020687 Ga0495646_0020687_147_845 228
763 3300046680 Ga0495646_0054930 Ga0495646_0054930_1367_2056 228
764 3300046681 Ga0495647_0079004 Ga0495647_0079004_223_912 228
765 3300046683 Ga0495658_0000788 Ga0495658_0000788_1925_2623 228
766 3300046683 Ga0495658_0006062 Ga0495658_0006062_3845_4534 228
767 3300046683 Ga0495658_0009215 Ga0495658_0009215_1895_2593 228
768 3300046684 Ga0495669_0031148 Ga0495669_0031148_352_1038 228
769 3300046690 Ga0495624_0026468 Ga0495624_0026468_796_1494 228
770 3300046690 Ga0495624_0051811 Ga0495624_0051811_422_1111 228
771 3300046690 Ga0495624_0091076 Ga0495624_0091076_1030_1719 228
772 3300046691 Ga0495670_0000291 Ga0495670_0000291_15877_16575 228
773 3300046809 Ga0495600_0001326 Ga0495600_0001326_2489_3175 228
774 3300046809 Ga0495600_0181767 Ga0495600_0181767_638_1336 228
775 3300047315 Ga0495581_0049705 Ga0495581_0049705_329_1027 228
776 3300047315 Ga0495581_0055269 Ga0495581_0055269_1098_1787 228
777 3300047315 Ga0495581_0090989 Ga0495581_0090989_344_1042 228
778 3300047317 Ga0495604_0003891 Ga0495604_0003891_7118_7807 228
779 3300047317 Ga0495604_0009082 Ga0495604_0009082_848_1546 228
780 3300047317 Ga0495604_0017520 Ga0495604_0017520_4856_5542 228
781 3300047319 Ga0495674_0015363 Ga0495674_0015363_2649_3338 228
782 3300047319 Ga0495674_0027169 Ga0495674_0027169_1965_2654 228
783 3300047319 Ga0495674_0069524 Ga0495674_0069524_1462_2160 228
784 3300047321 Ga0495676_0076650 Ga0495676_0076650_1815_2513 228
785 3300047321 Ga0495676_0241439 Ga0495676_0241439_38_736 228
786 3300047322 Ga0495680_0011254 Ga0495680_0011254_4143_4841 228
787 3300047322 Ga0495680_0012959 Ga0495680_0012959_2744_3433 228
788 3300047322 Ga0495680_0062737 Ga0495680_0062737_1061_1759 228
789 3300047444 Ga0495675_0001544 Ga0495675_0001544_9280_9969 228
790 3300047446 Ga0495679_064249 Ga0495679_064249_337_1035 228
791 3300047471 Ga0495684_0002087 Ga0495684_0002087_7129_7827 228
792 3300047471 Ga0495684_0080591 Ga0495684_0080591_323_1021 228
793 3300047471 Ga0495684_0173060 Ga0495684_0173060_525_1214 228
794 3300047673 Ga0495593_0004626 Ga0495593_0004626_4138_4836 228
795 3300047673 Ga0495593_0113374 Ga0495593_0113374_386_1075 228
796 3300048088 Ga0495602_0000740 Ga0495602_0000740_26540_27226 228
797 3300048088 Ga0495602_0005526 Ga0495602_0005526_9375_10064 228
798 3300048089 Ga0495614_0031402 Ga0495614_0031402_1479_2168 228
799 3300048903 Ga0496100_0000106 Ga0496100_0000106_36761_37447 228
800 3300048903 Ga0496100_0002951 Ga0496100_0002951_4165_4854 228
801 3300048903 Ga0496100_0003648 Ga0496100_0003648_2512_3210 228
802 3300048904 Ga0496101_0000992 Ga0496101_0000992_10177_10863 228
803 3300048904 Ga0496101_0020995 Ga0496101_0020995_3495_4184 228
804 3300048904 Ga0496101_0242314 Ga0496101_0242314_122_820 228
805 3300048905 Ga0496102_0011236 Ga0496102_0011236_5464_6150 228
806 3300048905 Ga0496102_0019045 Ga0496102_0019045_3829_4518 228
807 3300048905 Ga0496102_0039093 Ga0496102_0039093_2165_2851 228
808 3300048905 Ga0496102_0411558 Ga0496102_0411558_105_803 228
809 3300048906 Ga0496103_0006368 Ga0496103_0006368_4869_5555 228
810 3300048906 Ga0496103_0036108 Ga0496103_0036108_394_1083 228
811 3300048906 Ga0496103_0052592 Ga0496103_0052592_1027_1725 228
812 3300048906 Ga0496103_0055978 Ga0496103_0055978_1615_2313 228
813 3300048907 Ga0496104_0000090 Ga0496104_0000090_74119_74805 228
814 3300048907 Ga0496104_0113779 Ga0496104_0113779_1844_2530 228
815 3300048907 Ga0496104_0205803 Ga0496104_0205803_798_1496 228
816 3300048907 Ga0496104_0425755 Ga0496104_0425755_84_773 228
817 3300048907 Ga0496104_0479199 Ga0496104_0479199_301_999 228
818 3300048908 Ga0496105_0001574 Ga0496105_0001574_3451_4137 228
819 3300048908 Ga0496105_0048173 Ga0496105_0048173_2480_3178 228
820 3300048908 Ga0496105_0134964 Ga0496105_0134964_370_1059 228
821 3300048908 Ga0496105_0160810 Ga0496105_0160810_621_1307 228
822 3300048909 Ga0496106_0002499 Ga0496106_0002499_10405_11091 228
823 3300048909 Ga0496106_0012172 Ga0496106_0012172_1229_1918 228
824 3300048909 Ga0496106_0013964 Ga0496106_0013964_2158_2844 228
825 3300048909 Ga0496106_0131447 Ga0496106_0131447_798_1496 228
826 3300048909 Ga0496106_0379020 Ga0496106_0379020_336_1025 228
827 3300048910 Ga0496107_0000223 Ga0496107_0000223_6817_7503 228
828 3300048910 Ga0496107_0034213 Ga0496107_0034213_2913_3599 228
829 3300048910 Ga0496107_0037809 Ga0496107_0037809_1419_2108 228
830 3300048910 Ga0496107_0041516 Ga0496107_0041516_330_1016 228
831 3300048910 Ga0496107_0050009 Ga0496107_0050009_140_829 228
832 3300048910 Ga0496107_0056685 Ga0496107_0056685_468_1166 228
833 3300048910 Ga0496107_0414525 Ga0496107_0414525_112_810 228
834 3300048911 Ga0496108_0003914 Ga0496108_0003914_2745_3431 228
835 3300048911 Ga0496108_0029666 Ga0496108_0029666_3366_4064 228
836 3300048911 Ga0496108_0046748 Ga0496108_0046748_1644_2333 228
837 3300048911 Ga0496108_0206535 Ga0496108_0206535_704_1402 228
838 3300048912 Ga0496109_0014846 Ga0496109_0014846_1523_2209 228
839 3300048912 Ga0496109_0016176 Ga0496109_0016176_1266_1964 228
840 3300048912 Ga0496109_0040980 Ga0496109_0040980_829_1527 228
841 3300048912 Ga0496109_0072253 Ga0496109_0072253_1652_2341 228
842 3300048912 Ga0496109_0375756 Ga0496109_0375756_379_1065 228
843 3300048913 Ga0496110_0044706 Ga0496110_0044706_469_1167 228
844 3300048913 Ga0496110_0046530 Ga0496110_0046530_1376_2062 228
845 3300048914 Ga0496111_0031018 Ga0496111_0031018_2639_3337 228
846 3300048914 Ga0496111_0079994 Ga0496111_0079994_561_1247 228
847 3300048914 Ga0496111_0101954 Ga0496111_0101954_979_1665 228
848 3300048915 Ga0496112_0061551 Ga0496112_0061551_385_1083 228
849 3300048915 Ga0496112_0066193 Ga0496112_0066193_384_1082 228
850 3300048915 Ga0496112_0237397 Ga0496112_0237397_685_1371 228
851 3300048916 Ga0496113_0006216 Ga0496113_0006216_2762_3448 228
852 3300048916 Ga0496113_0010789 Ga0496113_0010789_2288_2974 228
853 3300048916 Ga0496113_0374571 Ga0496113_0374571_105_803 228
854 3300048916 Ga0496113_0457070 Ga0496113_0457070_120_806 228
855 3300048917 Ga0496114_0006841 Ga0496114_0006841_5608_6294 228
856 3300048917 Ga0496114_0025893 Ga0496114_0025893_672_1370 228
857 3300048918 Ga0496115_0021146 Ga0496115_0021146_1451_2137 228
858 3300048918 Ga0496115_0021880 Ga0496115_0021880_230_916 228
859 3300048918 Ga0496115_0073152 Ga0496115_0073152_26_724 228
860 3300048918 Ga0496115_0094696 Ga0496115_0094696_725_1414 228
861 3300048918 Ga0496115_0278132 Ga0496115_0278132_573_1262 228
862 3300048928 Ga0496125_0107116 Ga0496125_0107116_405_1103 228
863 3300050491 nmdc:mga00v17_304296_c1 nmdc:mga00v17_304296_c1_98_793 228
864 3300050494 nmdc:mga06z11_1795_c1 nmdc:mga06z11_1795_c1_5185_5871 228
865 3300050494 nmdc:mga06z11_64498_c1 nmdc:mga06z11_64498_c1_776_1471 228
866 3300050495 nmdc:mga04h51_17806_c1 nmdc:mga04h51_17806_c1_1250_1945 228
867 3300050496 nmdc:mga07m45_95619_c1 nmdc:mga07m45_95619_c1_539_1225 228
868 3300050507 nmdc:mga05p37_13519_c1 nmdc:mga05p37_13519_c1_4607_5293 228
869 3300050507 nmdc:mga05p37_56_c3 nmdc:mga05p37_56_c3_36399_37085 228
870 3300050508 nmdc:mga09592_976_c1 nmdc:mga09592_976_c1_6291_6977 228
871 3300050509 nmdc:mga0qj67_4772_c1 nmdc:mga0qj67_4772_c1_438_1124 228
872 3300050510 nmdc:mga06r32_34244_c1 nmdc:mga06r32_34244_c1_2017_2703 228
873 3300050511 nmdc:mga08y16_10784_c1 nmdc:mga08y16_10784_c1_6709_7395 228
874 3300050511 nmdc:mga08y16_206_c1 nmdc:mga08y16_206_c1_8955_9641 228
875 3300050511 nmdc:mga08y16_2396_c1 nmdc:mga08y16_2396_c1_7632_8318 228
876 3300050512 nmdc:mga0n895_2745_c1 nmdc:mga0n895_2745_c1_7662_8348 228
877 3300050512 nmdc:mga0n895_51689_c1 nmdc:mga0n895_51689_c1_3037_3723 228
878 3300050512 nmdc:mga0n895_5847_c1 nmdc:mga0n895_5847_c1_8250_8936 228
879 3300050513 nmdc:mga0rr50_154672_c1 nmdc:mga0rr50_154672_c1_1036_1722 228
880 3300050513 nmdc:mga0rr50_35409_c1 nmdc:mga0rr50_35409_c1_2604_3302 228
881 3300050513 nmdc:mga0rr50_44591_c1 nmdc:mga0rr50_44591_c1_1326_2012 228
882 3300050513 nmdc:mga0rr50_468651_c1 nmdc:mga0rr50_468651_c1_265_954 228
883 3300050513 nmdc:mga0rr50_8402_c1 nmdc:mga0rr50_8402_c1_374_1060 228
884 3300050514 nmdc:mga08x19_77184_c1 nmdc:mga08x19_77184_c1_840_1538 228
885 3300050515 nmdc:mga0a205_11514_c1 nmdc:mga0a205_11514_c1_1508_2194 228
886 3300050515 nmdc:mga0a205_171324_c1 nmdc:mga0a205_171324_c1_990_1676 228
887 3300050515 nmdc:mga0a205_425513_c1 nmdc:mga0a205_425513_c1_206_904 228
888 3300050515 nmdc:mga0a205_80_c1 nmdc:mga0a205_80_c1_43367_44053 228
889 3300050516 nmdc:mga0sz30_870_c2 nmdc:mga0sz30_870_c2_169_864 228
890 3300053077 Ga0495601_0000360 Ga0495601_0000360_14564_15250 228
891 3300053077 Ga0495601_0001260 Ga0495601_0001260_2484_3173 228
892 3300053077 Ga0495601_0070227 Ga0495601_0070227_1460_2149 228
893 3300053078 Ga0495612_0000964 Ga0495612_0000964_2303_2992 228
894 3300053078 Ga0495612_0002659 Ga0495612_0002659_3202_3891 228
895 3300053084 Ga0495595_0000969 Ga0495595_0000969_9470_10156 228
896 3300053084 Ga0495595_0001276 Ga0495595_0001276_7266_7955 228
897 3300053084 Ga0495595_0037109 Ga0495595_0037109_1337_2035 228
898 3300053085 Ga0495619_0000375 Ga0495619_0000375_13236_13934 228
899 3300053085 Ga0495619_0000581 Ga0495619_0000581_8716_9402 228
900 3300053085 Ga0495619_0001851 Ga0495619_0001851_9996_10685 228
901 3300053087 Ga0500643_008928 Ga0500643_008928_1602_2288 228
902 3300053088 Ga0500644_0000331 Ga0500644_0000331_23413_24099 228
903 3300053093 Ga0500651_0006053 Ga0500651_0006053_4449_5135 228
904 3300053093 Ga0500651_0223687 Ga0500651_0223687_264_950 228
905 3300053094 Ga0500566_0024974 Ga0500566_0024974_1851_2537 228
906 3300053096 Ga0500641_0022136 Ga0500641_0022136_1529_2224 228
907 3300053119 Ga0500595_000002 Ga0500595_000002_45350_46036 228
908 3300053153 Ga0500616_0000002 Ga0500616_0000002_60125_60862 228
909 3300053156 Ga0500622_0001529 Ga0500622_0001529_15977_16744 228

Structural Annotation

Top 5 Hits

ID Description Score Start End
7b1l-assembly1.cif.gz_A crystal structure of phosphatidyl serine synthase (pss) in the closed conformation with bound citrate. 0.7644 12 220
7b1l-assembly1.cif.gz_A crystal structure of phosphatidyl serine synthase (pss) in the closed conformation with bound citrate. 0.7103 12 220
5d92-assembly2.cif.gz_B structure of a phosphatidylinositolphosphate (pip) synthase from renibacterium salmoninarum 0.6497 14 166
2e2a-assembly1.cif.gz_B asp81leu enzyme iia from the lactose specific pts from lactococcus lactis 0.526 1 117
2wy2-assembly1.cif.gz_C nmr structure of the iiachitobiose-iibchitobiose phosphoryl transition state complex of the n,n'-diacetylchitoboise brance of the e. coli phosphotransferase system. 0.5251 9 114
ID Description Score Start End Superfamily
af_E7F188_23_199_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.8043 8 171 1.20.120.1760
af_P9WPG1_2_192_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.7682 9 168 1.20.120.1760
af_D3ZGY5_32_207_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.7654 2 175 1.20.120.1760
af_Q58609_4_200_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.751 12 220 1.20.120.1760
af_D3ZGY5_32_207_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.7353 2 175 1.20.120.1760
ID Description Score Start End GO Terms
AF-A0A2D8K2J1-F1-model_v4 Phosphatidylcholine synthase 0.9838 4 89 GO:0008654
GO:0016020
GO:0016780
AF-A0A6B0XY63-F1-model_v4 Phosphatidylcholine synthase 0.9823 5 97 GO:0008654
GO:0016020
GO:0016780
AF-A0A1E3WBB4-F1-model_v4 Phosphatidylcholine synthase (PC synthase) (PCS) (EC 2.7.8.24) (CDP-diglyceride-choline O-phosphatidyltransferase) 0.9792 5 223 GO:0005886
GO:0008654
GO:0050520
AF-X1BUJ5-F1-model_v4 Phosphatidylcholine synthase 0.9791 5 97 GO:0008654
GO:0016020
GO:0016780
AF-X0X199-F1-model_v4 Phosphatidylcholine synthase 0.9782 5 124 GO:0008654
GO:0016020
GO:0016780

Feature Viewer

pLDDT pTM Quality
86.65 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map