F485312

General Info

Members Datasets Scaffolds Average Seq Length
905 363 1810 192

Family's Representative Sequence

Representative Sequence 3300021388|Ga0213875_10136598|Ga0213875_101365981
Length 225
Sequence VRRSRKKPSANANITLVSYRPVILARSAQAVWLVRDQGETMARTESNMLPLGTLAPDFQLPDVVSGRPTSLAEFHGKDALLVMFICRHCPFVKHVQDELARIGKDYAGESVGIIAISSNDAQEYPDDAPHSLREMTTELDFTFPYCFDETQDVARAYDAACTPDFYLFDKNRRLVYRGQLDDSRPGNNTPVTGKDLRTAIDAVLQGSPVSANQKPSIGCNIKWRS

Samples

Sample ID Description Type Environment
1 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
25 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
37 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
38 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
39 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
40 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
41 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
42 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
43 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
44 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
45 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
46 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
47 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
48 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
49 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
50 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
51 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
52 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
53 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
54 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
55 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
56 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
57 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
58 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
59 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
60 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
61 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
62 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
63 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
64 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
65 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
66 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
67 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
68 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
69 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
70 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
71 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
72 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
73 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
74 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
75 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
76 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
77 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
78 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
79 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
80 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
81 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
82 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
83 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
84 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
85 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
86 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
87 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
88 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
89 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
90 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
92 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
93 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
94 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
95 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
96 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
97 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
98 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
99 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
100 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
101 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
102 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
103 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
104 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
105 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
106 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
107 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
108 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
109 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
110 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
111 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
112 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
113 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
114 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
115 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
116 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
117 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
118 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
119 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
120 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
121 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
122 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
123 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
124 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
125 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
126 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
127 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
128 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
129 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
130 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
131 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
132 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
133 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
134 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
135 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
136 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
137 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
138 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
203 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
204 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
206 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
209 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
213 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
214 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
215 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
216 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
217 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
218 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
219 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
220 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
221 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
222 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
223 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
224 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
225 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
226 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
227 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
228 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
229 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
230 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
231 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
232 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
233 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
234 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
235 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
236 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
237 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
238 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
239 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
240 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
241 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
242 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
243 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
244 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
245 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
246 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
247 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
248 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
249 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
250 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
251 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
252 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
253 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
254 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
255 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
256 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
257 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
258 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
259 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
260 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
261 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
262 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
263 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
264 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
265 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
266 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
267 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
268 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
269 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
270 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
271 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
272 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
273 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
274 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
275 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
276 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
277 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
278 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
279 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
280 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
281 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
282 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
283 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
284 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
285 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
286 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
287 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
288 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
289 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
290 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
291 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
292 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
293 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
294 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
295 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
296 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
297 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
298 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
299 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
300 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
301 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
302 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
303 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
304 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
305 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
306 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
307 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
308 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
309 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
310 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
311 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
312 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
313 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
314 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
315 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
316 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
317 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
318 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
319 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
320 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
321 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
322 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
323 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
324 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
325 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
326 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
327 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
328 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
329 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
330 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
331 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
332 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
333 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
334 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
335 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
336 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
337 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
338 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
339 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
340 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
341 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
342 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
343 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
344 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
345 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
346 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
347 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
348 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
349 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
350 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
351 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
352 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
353 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
354 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
355 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
356 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
357 2831426010 Nostoc sp. 106C Isolate Unclassified
358 2848694841 Nostoc sp. RF31YmG Isolate Unclassified
359 2849660919 Nostoc sp. T09 Isolate Unclassified
360 2881247448 Flavobacterium beibuense RSKm HC5 Isolate Rhizosphere
361 2886627955 Nostoc sp. PA-18-2419 JC1668 Isolate Unclassified
362 2913912277 Desmonostoc muscorum LEGE 12446 Isolate Unclassified
363 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.67
Metatranscriptomes 0.55
Isolates 0.77

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.22
Nodule 0
Rhizoplane 1.88
Rhizosphere 91.6
Stem 0
Stem Tuber 0
Unclassified 8.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0213875_10136598 3300021388 Unclassified 1147
2 SwRhRL2b_contig_547326 2162886007 Bacteria 3075
3 JGI24740J21852_10006882 3300001979 Bacteria 4668
4 JGI24737J22298_10063550 3300001990 Bacteria 1108
5 JGI25157J39369_1003093 3300002741 Bacteria 3590
6 JGI25406J46586_10009103 3300003203 Unclassified 4457
7 JGI25406J46586_10108234 3300003203 Bacteria 824
8 rootL2_10112891 3300003322 Bacteria 1517
9 JGI26145J50221_1003897 3300003371 Bacteria 1200
10 Ga0065712_10027087 3300005290 Bacteria 1568
11 Ga0065715_10003097 3300005293 Bacteria 4469
12 Ga0065715_10059711 3300005293 Bacteria 1159
13 Ga0065715_10115281 3300005293 Bacteria 2420
14 Ga0065707_10089565 3300005295 Bacteria 4338
15 Ga0070676_10002759 3300005328 Bacteria 9073
16 Ga0070676_10178701 3300005328 Bacteria 1378
17 Ga0070683_100066695 3300005329 Bacteria 3353
18 Ga0070683_100068902 3300005329 Bacteria 3297
19 Ga0070683_100436742 3300005329 Bacteria 1249
20 Ga0070683_101179926 3300005329 Unclassified 736
21 Ga0070690_100020950 3300005330 Bacteria 3989
22 Ga0070690_100067336 3300005330 Bacteria 2320
23 Ga0070690_100761359 3300005330 Bacteria 748
24 Ga0070670_100005568 3300005331 Bacteria 10621
25 Ga0070670_100026378 3300005331 Bacteria 5001
26 Ga0070670_100338985 3300005331 Unclassified 1319
27 Ga0070677_10100446 3300005333 Bacteria 1274
28 Ga0068869_100043930 3300005334 Bacteria 3212
29 Ga0068869_100159513 3300005334 Bacteria 1755
30 Ga0068869_100231058 3300005334 Bacteria 1470
31 Ga0070666_10481042 3300005335 Bacteria 899
32 Ga0070680_100015205 3300005336 Bacteria 6030
33 Ga0070680_100053157 3300005336 Bacteria 3306
34 Ga0070680_100366858 3300005336 Bacteria 1225
35 Ga0070682_100487505 3300005337 Bacteria 952
36 Ga0068868_100090991 3300005338 Bacteria 2458
37 Ga0070660_100000126 3300005339 Bacteria 48064
38 Ga0070689_100002763 3300005340 Bacteria 11517
39 Ga0070689_100166261 3300005340 Bacteria 1785
40 Ga0070691_10034014 3300005341 Bacteria 2398
41 Ga0070691_10040445 3300005341 Bacteria 2203
42 Ga0070687_100026434 3300005343 Bacteria 2795
43 Ga0070687_100038820 3300005343 Bacteria 2389
44 Ga0070687_100080067 3300005343 Bacteria 1780
45 Ga0070661_100038183 3300005344 Unclassified 3495
46 Ga0070661_100566750 3300005344 Bacteria 915
47 Ga0070692_10037088 3300005345 Bacteria 2477
48 Ga0070692_10040270 3300005345 Bacteria 2389
49 Ga0070668_100014286 3300005347 Bacteria 5934
50 Ga0070668_100103554 3300005347 Bacteria 2258
51 Ga0070668_100130865 3300005347 Bacteria 2014
52 Ga0070669_100048976 3300005353 Bacteria 3085
53 Ga0070669_100078739 3300005353 Bacteria 2450
54 Ga0070675_100000205 3300005354 Bacteria 37555
55 Ga0070675_100021846 3300005354 Bacteria 5112
56 Ga0070675_100040822 3300005354 Bacteria 3789
57 Ga0070675_100196603 3300005354 Bacteria 1749
58 Ga0070675_100196610 3300005354 Bacteria 1749
59 Ga0070675_100260724 3300005354 Bacteria 1519
60 Ga0070675_100376600 3300005354 Bacteria 1263
61 Ga0070671_100004773 3300005355 Bacteria 10772
62 Ga0070671_100235790 3300005355 Unclassified 1553
63 Ga0070674_100019118 3300005356 Bacteria 4346
64 Ga0070673_100005336 3300005364 Bacteria 8207
65 Ga0070673_100202682 3300005364 Bacteria 1709
66 Ga0070673_100324504 3300005364 Bacteria 1361
67 Ga0070673_100512108 3300005364 Bacteria 1086
68 Ga0070673_100512586 3300005364 Bacteria 1086
69 Ga0070673_100592081 3300005364 Bacteria 1011
70 Ga0070673_100627450 3300005364 Unclassified 982
71 Ga0070688_100014286 3300005365 Bacteria 4497
72 Ga0070688_100088539 3300005365 Bacteria 2019
73 Ga0070688_100303339 3300005365 Bacteria 1155
74 Ga0070659_100001609 3300005366 Bacteria 16255
75 Ga0070703_10000235 3300005406 Bacteria 26740
76 Ga0070714_100033790 3300005435 Bacteria 4279
77 Ga0070713_100111998 3300005436 Bacteria 2381
78 Ga0070701_10006802 3300005438 Bacteria 4836
79 Ga0070701_10200328 3300005438 Bacteria 1180
80 Ga0070701_10486898 3300005438 Unclassified 798
81 Ga0070711_100055730 3300005439 Bacteria 2732
82 Ga0070705_100000426 3300005440 Bacteria 24222
83 Ga0070705_100007098 3300005440 Bacteria 5509
84 Ga0070705_100007422 3300005440 Bacteria 5392
85 Ga0070705_100014121 3300005440 Bacteria 4101
86 Ga0070705_100302255 3300005440 Bacteria 1147
87 Ga0070705_100544084 3300005440 Bacteria 889
88 Ga0070700_100002320 3300005441 Bacteria 9687
89 Ga0070700_100066869 3300005441 Bacteria 2282
90 Ga0070700_100189589 3300005441 Bacteria 1437
91 Ga0070694_100000204 3300005444 Bacteria 31438
92 Ga0070694_100001493 3300005444 Bacteria 13733
93 Ga0070694_100016147 3300005444 Bacteria 4699
94 Ga0070694_100024613 3300005444 Bacteria 3887
95 Ga0070694_100055450 3300005444 Bacteria 2688
96 Ga0070694_100471990 3300005444 Bacteria 994
97 Ga0070694_100772325 3300005444 Unclassified 786
98 Ga0070708_100035263 3300005445 Bacteria 4358
99 Ga0070708_100272423 3300005445 Bacteria 1592
100 Ga0070708_100287563 3300005445 Unclassified 1547
101 Ga0070708_100407339 3300005445 Bacteria 1282
102 Ga0070708_100801366 3300005445 Bacteria 885
103 Ga0070663_100019531 3300005455 Bacteria 4469
104 Ga0070678_100000430 3300005456 Bacteria 19839
105 Ga0070662_100010676 3300005457 Bacteria 6043
106 Ga0070662_100420080 3300005457 Bacteria 1106
107 Ga0070681_10037000 3300005458 Bacteria 4898
108 Ga0068867_100000949 3300005459 Bacteria 19737
109 Ga0068867_100009803 3300005459 Bacteria 6750
110 Ga0068867_100247680 3300005459 Bacteria 1448
111 Ga0070685_10014976 3300005466 Bacteria 4116
112 Ga0070685_10026271 3300005466 Unclassified 3208
113 Ga0070685_10075151 3300005466 Bacteria 2012
114 Ga0070706_100067652 3300005467 Bacteria 3304
115 Ga0070707_100012174 3300005468 Bacteria 8030
116 Ga0070707_100092336 3300005468 Bacteria 2931
117 Ga0070698_100015540 3300005471 Bacteria 8040
118 Ga0070698_100047125 3300005471 Bacteria 4406
119 Ga0070698_100253465 3300005471 Bacteria 1692
120 Ga0070698_100419221 3300005471 Bacteria 1273
121 Ga0070698_101014603 3300005471 Bacteria 777
122 Ga0070699_100010890 3300005518 Bacteria 7867
123 Ga0070699_100036650 3300005518 Bacteria 4243
124 Ga0070699_100086011 3300005518 Bacteria 2743
125 Ga0070699_100243957 3300005518 Bacteria 1604
126 Ga0070679_100149511 3300005530 Bacteria 2313
127 Ga0070679_100166962 3300005530 Bacteria 2174
128 Ga0070684_100057719 3300005535 Bacteria 3390
129 Ga0070684_100098088 3300005535 Bacteria 2614
130 Ga0070697_100028001 3300005536 Bacteria 4510
131 Ga0068853_101230701 3300005539 Bacteria 723
132 Ga0070672_100014999 3300005543 Bacteria 5505
133 Ga0070672_100056847 3300005543 Bacteria 3070
134 Ga0070672_100086181 3300005543 Bacteria 2525
135 Ga0070672_100216404 3300005543 Unclassified 1606
136 Ga0070672_100380044 3300005543 Bacteria 1208
137 Ga0070686_100030093 3300005544 Bacteria 3309
138 Ga0070686_100236030 3300005544 Bacteria 1329
139 Ga0070686_100408224 3300005544 Bacteria 1035
140 Ga0070686_101040648 3300005544 Bacteria 673
141 Ga0070695_100006049 3300005545 Bacteria 7148
142 Ga0070695_100014148 3300005545 Bacteria 4807
143 Ga0070695_100047791 3300005545 Bacteria 2734
144 Ga0070695_100059053 3300005545 Bacteria 2482
145 Ga0070695_100305475 3300005545 Unclassified 1177
146 Ga0070696_100005663 3300005546 Bacteria 8344
147 Ga0070696_100014054 3300005546 Bacteria 5375
148 Ga0070696_100015999 3300005546 Bacteria 5044
149 Ga0070696_100028045 3300005546 Bacteria 3840
150 Ga0070696_100087944 3300005546 Bacteria 2207
151 Ga0070696_100951173 3300005546 Unclassified 715
152 Ga0070693_100011708 3300005547 Bacteria 4423
153 Ga0070693_100515964 3300005547 Bacteria 850
154 Ga0070665_100044669 3300005548 Unclassified 4449
155 Ga0070665_100261383 3300005548 Bacteria 1732
156 Ga0070704_100002423 3300005549 Bacteria 10469
157 Ga0070704_100025154 3300005549 Bacteria 3916
158 Ga0070704_100043634 3300005549 Bacteria 3110
159 Ga0070704_100043902 3300005549 Bacteria 3102
160 Ga0070704_100142557 3300005549 Bacteria 1873
161 Ga0070704_100194535 3300005549 Bacteria 1633
162 Ga0070704_100210330 3300005549 Bacteria 1576
163 Ga0070704_100563684 3300005549 Bacteria 997
164 Ga0068855_100034230 3300005563 Bacteria 6060
165 Ga0068855_100476584 3300005563 Bacteria 1359
166 Ga0068855_100840086 3300005563 Bacteria 974
167 Ga0070664_100012202 3300005564 Bacteria 6982
168 Ga0070664_100077333 3300005564 Bacteria 2861
169 Ga0070664_100089690 3300005564 Bacteria 2660
170 Ga0070664_100188843 3300005564 Unclassified 1835
171 Ga0068857_100007058 3300005577 Bacteria 9673
172 Ga0068857_100042151 3300005577 Bacteria 4048
173 Ga0068857_100229050 3300005577 Bacteria 1699
174 Ga0068857_100539641 3300005577 Bacteria 1098
175 Ga0068856_100026914 3300005614 Bacteria 5610
176 Ga0068856_101598389 3300005614 Bacteria 665
177 Ga0070702_100154579 3300005615 Bacteria 1476
178 Ga0070702_100561824 3300005615 Bacteria 849
179 Ga0068852_100199891 3300005616 Bacteria 1891
180 Ga0068859_100000553 3300005617 Bacteria 37150
181 Ga0068859_100002238 3300005617 Bacteria 19628
182 Ga0068859_100006711 3300005617 Bacteria 11690
183 Ga0068859_100579526 3300005617 Bacteria 1216
184 Ga0068859_100712212 3300005617 Bacteria 1094
185 Ga0068859_101482329 3300005617 Bacteria 749
186 Ga0068864_100092053 3300005618 Bacteria 2676
187 Ga0068864_100309367 3300005618 Bacteria 1481
188 Ga0068864_100523521 3300005618 Bacteria 1143
189 Ga0068866_10020020 3300005718 Bacteria 3058
190 Ga0068866_10148416 3300005718 Bacteria 1355
191 Ga0068861_100006175 3300005719 Bacteria 8151
192 Ga0068861_100008693 3300005719 Bacteria 6987
193 Ga0068861_100628805 3300005719 Bacteria 989
194 Ga0068870_10002717 3300005840 Bacteria 7422
195 Ga0068870_10075449 3300005840 Bacteria 1849
196 Ga0068870_10355020 3300005840 Bacteria 942
197 Ga0068863_100081094 3300005841 Bacteria 3074
198 Ga0068863_100290103 3300005841 Bacteria 1586
199 Ga0068863_100498538 3300005841 Bacteria 1199
200 Ga0068863_100511003 3300005841 Bacteria 1184
201 Ga0068863_101284357 3300005841 Bacteria 739
202 Ga0068858_100496104 3300005842 Bacteria 1179
203 Ga0068858_100659849 3300005842 Bacteria 1017
204 Ga0068860_100027607 3300005843 Bacteria 5465
205 Ga0068860_100146387 3300005843 Unclassified 2273
206 Ga0068860_100160186 3300005843 Bacteria 2170
207 Ga0068860_100173530 3300005843 Bacteria 2083
208 Ga0068860_100574267 3300005843 Bacteria 1131
209 Ga0068862_100000956 3300005844 Bacteria 27785
210 Ga0068862_100040921 3300005844 Bacteria 3942
211 Ga0081455_10004203 3300005937 Bacteria 16225
212 Ga0081455_10106003 3300005937 Bacteria 2245
213 Ga0081540_1005042 3300005983 Bacteria 9909
214 Ga0081540_1127233 3300005983 Unclassified 1046
215 Ga0081539_10000649 3300005985 Bacteria 69909
216 Ga0081539_10008206 3300005985 Bacteria 9193
217 Ga0081539_10063410 3300005985 Bacteria 2016
218 Ga0075364_10263724 3300006051 Bacteria 1171
219 Ga0075364_10337349 3300006051 Bacteria 1027
220 Ga0075432_10000481 3300006058 Bacteria 11888
221 Ga0070715_10075097 3300006163 Bacteria 1520
222 Ga0075367_10049372 3300006178 Bacteria 2480
223 Ga0075427_10000664 3300006194 Bacteria 4080
224 Ga0075366_10033830 3300006195 Bacteria 3011
225 Ga0075366_10090080 3300006195 Bacteria 1837
226 Ga0075366_10599411 3300006195 Unclassified 683
227 Ga0097621_100026765 3300006237 Unclassified 4528
228 Ga0097621_100048085 3300006237 Unclassified 3459
229 Ga0097621_100056565 3300006237 Bacteria 3205
230 Ga0097621_100181293 3300006237 Bacteria 1820
231 Ga0097621_100454203 3300006237 Bacteria 1155
232 Ga0068871_100005672 3300006358 Bacteria 8757
233 Ga0068871_100010044 3300006358 Bacteria 6883
234 Ga0068871_100046731 3300006358 Bacteria 3488
235 Ga0068871_100053892 3300006358 Bacteria 3261
236 Ga0068871_100065165 3300006358 Bacteria 2984
237 Ga0068871_100105196 3300006358 Bacteria 2368
238 Ga0068871_100378962 3300006358 Bacteria 1256
239 Ga0068871_100445622 3300006358 Bacteria 1160
240 Ga0068871_100591322 3300006358 Bacteria 1008
241 Ga0075428_100004188 3300006844 Bacteria 15880
242 Ga0075428_100006548 3300006844 Bacteria 12951
243 Ga0075428_100007290 3300006844 Bacteria 12249
244 Ga0075428_100010723 3300006844 Bacteria 10188
245 Ga0075428_100021685 3300006844 Bacteria 7112
246 Ga0075428_100070643 3300006844 Bacteria 3816
247 Ga0075428_100134625 3300006844 Bacteria 2687
248 Ga0075428_100520138 3300006844 Bacteria 1273
249 Ga0075428_100592300 3300006844 Bacteria 1184
250 Ga0075428_101383508 3300006844 Bacteria 739
251 Ga0075430_100001975 3300006846 Bacteria 16885
252 Ga0075430_100002398 3300006846 Bacteria 15585
253 Ga0075430_100072090 3300006846 Bacteria 2897
254 Ga0075430_100077118 3300006846 Bacteria 2793
255 Ga0075430_100113512 3300006846 Bacteria 2258
256 Ga0075430_100265870 3300006846 Bacteria 1420
257 Ga0075431_100024858 3300006847 Bacteria 6141
258 Ga0075431_100030305 3300006847 Bacteria 5572
259 Ga0075431_100040409 3300006847 Bacteria 4807
260 Ga0075431_100057876 3300006847 Bacteria 3998
261 Ga0075431_100230498 3300006847 Bacteria 1887
262 Ga0075431_100345093 3300006847 Bacteria 1498
263 Ga0075433_10002179 3300006852 Bacteria 14842
264 Ga0075433_10004522 3300006852 Bacteria 10843
265 Ga0075433_10015058 3300006852 Bacteria 6332
266 Ga0075433_10072182 3300006852 Bacteria 3035
267 Ga0075433_10245464 3300006852 Bacteria 1589
268 Ga0075433_10682704 3300006852 Bacteria 900
269 Ga0075434_100005114 3300006871 Bacteria 11911
270 Ga0075434_100007185 3300006871 Bacteria 10300
271 Ga0075434_100008086 3300006871 Bacteria 9753
272 Ga0075434_100028095 3300006871 Bacteria 5525
273 Ga0075434_100061721 3300006871 Bacteria 3730
274 Ga0075434_100207006 3300006871 Bacteria 1982
275 Ga0075434_100973798 3300006871 Bacteria 862
276 Ga0075429_100002342 3300006880 Bacteria 15929
277 Ga0075429_100010767 3300006880 Bacteria 7910
278 Ga0075429_100085763 3300006880 Bacteria 2745
279 Ga0075429_100157634 3300006880 Bacteria 1988
280 Ga0075429_100208684 3300006880 Bacteria 1711
281 Ga0075429_101256717 3300006880 Bacteria 646
282 Ga0068865_100006547 3300006881 Bacteria 7117
283 Ga0068865_100023794 3300006881 Bacteria 4015
284 Ga0068865_100036410 3300006881 Bacteria 3318
285 Ga0068865_100064647 3300006881 Unclassified 2575
286 Ga0068865_100597380 3300006881 Bacteria 932
287 Ga0075436_100024789 3300006914 Bacteria 4125
288 Ga0075436_100073563 3300006914 Bacteria 2366
289 Ga0097620_100000553 3300006931 Bacteria 37150
290 Ga0097620_100002238 3300006931 Bacteria 19628
291 Ga0097620_100006710 3300006931 Bacteria 11690
292 Ga0097620_100406368 3300006931 Unclassified 1458
293 Ga0097620_100579527 3300006931 Bacteria 1216
294 Ga0097620_100712160 3300006931 Bacteria 1094
295 Ga0097620_101482443 3300006931 Bacteria 749
296 Ga0075435_100017256 3300007076 Bacteria 5459
297 Ga0075435_100019411 3300007076 Bacteria 5192
298 Ga0075435_100052865 3300007076 Bacteria 3273
299 Ga0075435_100175701 3300007076 Bacteria 1808
300 Ga0075435_100185525 3300007076 Bacteria 1759
301 Ga0075435_100195571 3300007076 Bacteria 1712
302 Ga0075435_100295554 3300007076 Bacteria 1384
303 Ga0105240_10057091 3300009093 Bacteria 4880
304 Ga0111539_10021679 3300009094 Bacteria 7902
305 Ga0111539_10025716 3300009094 Bacteria 7211
306 Ga0111539_10091250 3300009094 Bacteria 3579
307 Ga0111539_10103938 3300009094 Bacteria 3333
308 Ga0111539_10135064 3300009094 Bacteria 2889
309 Ga0111539_10767358 3300009094 Bacteria 1122
310 Ga0111539_12216669 3300009094 Bacteria 637
311 Ga0105245_10100484 3300009098 Bacteria 2675
312 Ga0105245_10145120 3300009098 Unclassified 2239
313 Ga0105245_10221404 3300009098 Bacteria 1826
314 Ga0105245_10908604 3300009098 Bacteria 922
315 Ga0114129_10004328 3300009147 Bacteria 20080
316 Ga0114129_10007140 3300009147 Bacteria 15899
317 Ga0114129_10012593 3300009147 Bacteria 12044
318 Ga0114129_10018492 3300009147 Bacteria 9923
319 Ga0114129_10047315 3300009147 Bacteria 6044
320 Ga0114129_10068654 3300009147 Bacteria 4942
321 Ga0114129_10068856 3300009147 Bacteria 4933
322 Ga0114129_10129978 3300009147 Bacteria 3460
323 Ga0114129_10146106 3300009147 Bacteria 3239
324 Ga0114129_10150032 3300009147 Bacteria 3190
325 Ga0114129_10166767 3300009147 Bacteria 3005
326 Ga0114129_10244979 3300009147 Bacteria 2408
327 Ga0114129_11364665 3300009147 Bacteria 876
328 Ga0105243_10000147 3300009148 Bacteria 80393
329 Ga0105243_10000546 3300009148 Bacteria 38024
330 Ga0105243_10031645 3300009148 Bacteria 4080
331 Ga0105243_10135184 3300009148 Bacteria 2097
332 Ga0105243_10543665 3300009148 Bacteria 1109
333 Ga0105243_11547443 3300009148 Bacteria 688
334 Ga0105243_11568696 3300009148 Bacteria 684
335 Ga0105241_10260615 3300009174 Bacteria 1473
336 Ga0105242_10000048 3300009176 Bacteria 80392
337 Ga0105242_10000910 3300009176 Bacteria 23016
338 Ga0105242_10077303 3300009176 Bacteria 2777
339 Ga0105242_10089034 3300009176 Unclassified 2594
340 Ga0105242_10089234 3300009176 Bacteria 2591
341 Ga0105242_10097531 3300009176 Bacteria 2485
342 Ga0105242_10122601 3300009176 Unclassified 2233
343 Ga0105242_10152327 3300009176 Bacteria 2017
344 Ga0105242_10352107 3300009176 Bacteria 1360
345 Ga0105242_10684617 3300009176 Bacteria 1001
346 Ga0105248_10073339 3300009177 Bacteria 3847
347 Ga0105248_10309916 3300009177 Unclassified 1778
348 Ga0105248_10393431 3300009177 Bacteria 1561
349 Ga0105248_10591047 3300009177 Bacteria 1252
350 Ga0105248_10611658 3300009177 Bacteria 1229
351 Ga0105248_10655264 3300009177 Bacteria 1185
352 Ga0105248_11336870 3300009177 Unclassified 811
353 Ga0105248_11873694 3300009177 Bacteria 680
354 Ga0105237_10068250 3300009545 Bacteria 3550
355 Ga0105238_10308028 3300009551 Bacteria 1568
356 Ga0105249_10008880 3300009553 Bacteria 8779
357 Ga0105249_10013595 3300009553 Bacteria 7190
358 Ga0105239_10025819 3300010375 Bacteria 6470
359 Ga0105239_11387380 3300010375 Bacteria 811
360 Ga0105246_10001275 3300011119 Bacteria 14796
361 Ga0105246_10859682 3300011119 Bacteria 810
362 Ga0105246_11004493 3300011119 Unclassified 755
363 Ga0157373_10189150 3300013100 Bacteria 1451
364 Ga0157371_10015780 3300013102 Bacteria 5652
365 Ga0157370_10041406 3300013104 Bacteria 4444
366 Ga0157370_10180483 3300013104 Bacteria 1962
367 Ga0157370_10628534 3300013104 Bacteria 982
368 Ga0157369_10007516 3300013105 Bacteria 12545
369 Ga0157374_10002355 3300013296 Bacteria 15942
370 Ga0157374_10020700 3300013296 Bacteria 5840
371 Ga0157374_10044400 3300013296 Bacteria 4108
372 Ga0157374_10085260 3300013296 Bacteria 3003
373 Ga0157374_11298530 3300013296 Bacteria 750
374 Ga0157378_10001206 3300013297 Bacteria 23475
375 Ga0157378_10065485 3300013297 Unclassified 3253
376 Ga0157378_10179332 3300013297 Bacteria 1992
377 Ga0157378_10413216 3300013297 Bacteria 1332
378 Ga0163162_10041261 3300013306 Bacteria 4617
379 Ga0163162_10943956 3300013306 Unclassified 974
380 Ga0157372_10414127 3300013307 Unclassified 1570
381 Ga0157375_10011510 3300013308 Bacteria 7813
382 Ga0157375_10022441 3300013308 Bacteria 5809
383 Ga0157375_10197971 3300013308 Bacteria 2164
384 Ga0157375_10488991 3300013308 Bacteria 1395
385 Ga0157375_11178709 3300013308 Bacteria 898
386 Ga0157375_11525047 3300013308 Bacteria 789
387 Ga0163163_10410237 3300014325 Bacteria 1413
388 Ga0163163_10689651 3300014325 Bacteria 1085
389 Ga0163163_12403111 3300014325 Bacteria 585
390 Ga0157380_10046918 3300014326 Bacteria 3395
391 Ga0157380_10458774 3300014326 Bacteria 1226
392 Ga0157380_11431529 3300014326 Bacteria 742
393 Ga0157377_10000773 3300014745 Bacteria 13246
394 Ga0157377_10026549 3300014745 Bacteria 3100
395 Ga0157379_10864374 3300014968 Bacteria 856
396 Ga0157376_10000103 3300014969 Bacteria 61822
397 Ga0157376_10020237 3300014969 Bacteria 5144
398 Ga0157376_10040237 3300014969 Bacteria 3819
399 Ga0157376_10043121 3300014969 Bacteria 3701
400 Ga0157376_10394330 3300014969 Bacteria 1337
401 Ga0182005_1021021 3300015265 Bacteria 1792
402 Ga0163161_10649430 3300017792 Bacteria 874
403 Ga0206354_11136710 3300020081 Bacteria 649
404 Ga0213872_10000164 3300021361 Bacteria 60317
405 Ga0213872_10019466 3300021361 Bacteria 3127
406 Ga0213876_10095323 3300021384 Unclassified 1576
407 Ga0213876_10151620 3300021384 Unclassified 1233
408 Ga0213875_10000008 3300021388 Bacteria 533344
409 Ga0213875_10000027 3300021388 Bacteria 190420
410 Ga0213875_10023631 3300021388 Bacteria 2935
411 Ga0213875_10169792 3300021388 Unclassified 1024
412 Ga0213875_10333175 3300021388 Viruses 720
413 Ga0213871_10001320 3300021441 Unclassified 4091
414 Ga0224712_10319224 3300022467 Bacteria 729
415 Ga0209646_1000002 3300025246 Bacteria 1425781
416 Ga0209026_1001083 3300025250 Bacteria 13118
417 Ga0207653_10000116 3300025885 Bacteria 56010
418 Ga0207682_10056838 3300025893 Bacteria 1630
419 Ga0207642_10071298 3300025899 Bacteria 1654
420 Ga0207688_10003059 3300025901 Bacteria 9120
421 Ga0207688_10047871 3300025901 Bacteria 2388
422 Ga0207688_10372826 3300025901 Bacteria 882
423 Ga0207680_10008513 3300025903 Bacteria 5041
424 Ga0207680_10258307 3300025903 Bacteria 1205
425 Ga0207647_10183519 3300025904 Bacteria 1214
426 Ga0207685_10186497 3300025905 Bacteria 965
427 Ga0207645_10000128 3300025907 Bacteria 57808
428 Ga0207643_10047126 3300025908 Bacteria 2437
429 Ga0207684_10054312 3300025910 Bacteria 3398
430 Ga0207684_10397852 3300025910 Bacteria 1184
431 Ga0207654_10174388 3300025911 Bacteria 1399
432 Ga0207707_10031178 3300025912 Bacteria 4664
433 Ga0207707_10149835 3300025912 Bacteria 2040
434 Ga0207695_10228925 3300025913 Bacteria 1764
435 Ga0207663_10204075 3300025916 Bacteria 1428
436 Ga0207660_10041867 3300025917 Bacteria 3212
437 Ga0207660_10056845 3300025917 Bacteria 2801
438 Ga0207660_10779044 3300025917 Bacteria 780
439 Ga0207662_10004142 3300025918 Bacteria 7587
440 Ga0207662_10015110 3300025918 Bacteria 4339
441 Ga0207662_10112895 3300025918 Bacteria 1696
442 Ga0207657_10000352 3300025919 Bacteria 48916
443 Ga0207649_10418413 3300025920 Bacteria 1006
444 Ga0207649_10571687 3300025920 Unclassified 867
445 Ga0207652_10509957 3300025921 Bacteria 1082
446 Ga0207652_10763055 3300025921 Bacteria 860
447 Ga0207646_10001278 3300025922 Bacteria 31485
448 Ga0207646_10011611 3300025922 Bacteria 8517
449 Ga0207646_10063392 3300025922 Bacteria 3300
450 Ga0207646_10851876 3300025922 Bacteria 810
451 Ga0207681_10002465 3300025923 Bacteria 11738
452 Ga0207681_10290283 3300025923 Bacteria 1291
453 Ga0207694_10857981 3300025924 Bacteria 767
454 Ga0207650_10025487 3300025925 Bacteria 4212
455 Ga0207650_10136777 3300025925 Bacteria 1923
456 Ga0207650_10147496 3300025925 Bacteria 1854
457 Ga0207659_10020805 3300025926 Bacteria 4344
458 Ga0207659_10027877 3300025926 Bacteria 3831
459 Ga0207659_10041792 3300025926 Bacteria 3212
460 Ga0207659_10062221 3300025926 Bacteria 2693
461 Ga0207659_10366650 3300025926 Bacteria 1198
462 Ga0207687_10007616 3300025927 Bacteria 7120
463 Ga0207687_10034360 3300025927 Unclassified 3442
464 Ga0207700_10089874 3300025928 Bacteria 2422
465 Ga0207664_10055101 3300025929 Bacteria 3154
466 Ga0207644_10116311 3300025931 Bacteria 2029
467 Ga0207690_10025677 3300025932 Bacteria 3702
468 Ga0207690_10286555 3300025932 Bacteria 1284
469 Ga0207706_10001281 3300025933 Bacteria 25364
470 Ga0207706_10191612 3300025933 Bacteria 1794
471 Ga0207706_10343303 3300025933 Bacteria 1299
472 Ga0207686_10000080 3300025934 Bacteria 80400
473 Ga0207686_10001797 3300025934 Bacteria 11921
474 Ga0207686_10013659 3300025934 Bacteria 4498
475 Ga0207686_10070554 3300025934 Bacteria 2246
476 Ga0207686_10137562 3300025934 Bacteria 1684
477 Ga0207686_10170814 3300025934 Unclassified 1533
478 Ga0207686_10247410 3300025934 Bacteria 1301
479 Ga0207686_10289520 3300025934 Bacteria 1212
480 Ga0207686_10667042 3300025934 Bacteria 824
481 Ga0207709_10000029 3300025935 Bacteria 333327
482 Ga0207709_10050131 3300025935 Bacteria 2552
483 Ga0207709_10064814 3300025935 Bacteria 2295
484 Ga0207709_10174298 3300025935 Bacteria 1512
485 Ga0207709_10505704 3300025935 Bacteria 944
486 Ga0207670_10041440 3300025936 Bacteria 3028
487 Ga0207669_10099536 3300025937 Bacteria 1917
488 Ga0207669_10232600 3300025937 Bacteria 1361
489 Ga0207704_10001396 3300025938 Bacteria 10791
490 Ga0207704_10093766 3300025938 Unclassified 1980
491 Ga0207704_10215449 3300025938 Bacteria 1417
492 Ga0207704_10738619 3300025938 Bacteria 818
493 Ga0207704_10881791 3300025938 Bacteria 751
494 Ga0207665_10513934 3300025939 Bacteria 927
495 Ga0207691_10000021 3300025940 Bacteria 133396
496 Ga0207691_10008500 3300025940 Bacteria 9859
497 Ga0207691_10192797 3300025940 Bacteria 1777
498 Ga0207691_10216707 3300025940 Bacteria 1661
499 Ga0207711_10137399 3300025941 Bacteria 2196
500 Ga0207711_10148357 3300025941 Unclassified 2114
501 Ga0207711_10546143 3300025941 Bacteria 1081
502 Ga0207711_10925199 3300025941 Bacteria 810
503 Ga0207689_10003325 3300025942 Bacteria 14719
504 Ga0207689_10154132 3300025942 Bacteria 1894
505 Ga0207689_10190408 3300025942 Bacteria 1692
506 Ga0207689_10641305 3300025942 Bacteria 895
507 Ga0207661_10109557 3300025944 Bacteria 2333
508 Ga0207679_10029070 3300025945 Bacteria 3845
509 Ga0207679_10186323 3300025945 Bacteria 1721
510 Ga0207679_10715975 3300025945 Bacteria 909
511 Ga0207679_11273785 3300025945 Bacteria 675
512 Ga0207667_10046665 3300025949 Bacteria 4588
513 Ga0207667_10407111 3300025949 Bacteria 1385
514 Ga0207667_10831219 3300025949 Bacteria 919
515 Ga0207651_10144072 3300025960 Bacteria 1845
516 Ga0207651_10200635 3300025960 Bacteria 1598
517 Ga0207651_10573988 3300025960 Bacteria 983
518 Ga0207651_10884050 3300025960 Bacteria 795
519 Ga0207651_10911337 3300025960 Bacteria 783
520 Ga0207651_11203706 3300025960 Bacteria 680
521 Ga0207712_10110869 3300025961 Bacteria 2058
522 Ga0207712_10477082 3300025961 Bacteria 1062
523 Ga0207668_10091372 3300025972 Bacteria 2237
524 Ga0207668_10280312 3300025972 Bacteria 1366
525 Ga0207658_10003897 3300025986 Bacteria 10496
526 Ga0207677_10140575 3300026023 Bacteria 1848
527 Ga0207677_10167670 3300026023 Bacteria 1713
528 Ga0207677_10172311 3300026023 Bacteria 1693
529 Ga0207677_11074327 3300026023 Bacteria 733
530 Ga0207703_10881483 3300026035 Bacteria 856
531 Ga0207703_11091928 3300026035 Bacteria 766
532 Ga0207639_10067725 3300026041 Bacteria 2779
533 Ga0207678_10312686 3300026067 Bacteria 1351
534 Ga0207678_10523299 3300026067 Bacteria 1035
535 Ga0207708_10000070 3300026075 Bacteria 82098
536 Ga0207708_10095638 3300026075 Bacteria 2294
537 Ga0207708_10141122 3300026075 Bacteria 1890
538 Ga0207708_10164183 3300026075 Bacteria 1755
539 Ga0207708_11483618 3300026075 Unclassified 596
540 Ga0207702_10565726 3300026078 Bacteria 1113
541 Ga0207641_10098276 3300026088 Bacteria 2574
542 Ga0207641_10371522 3300026088 Bacteria 1367
543 Ga0207641_10467898 3300026088 Bacteria 1220
544 Ga0207641_10557499 3300026088 Bacteria 1118
545 Ga0207641_10792196 3300026088 Bacteria 937
546 Ga0207641_10980496 3300026088 Bacteria 841
547 Ga0207648_10000103 3300026089 Bacteria 82511
548 Ga0207648_10001758 3300026089 Bacteria 23722
549 Ga0207648_10026928 3300026089 Bacteria 5106
550 Ga0207648_10236875 3300026089 Bacteria 1624
551 Ga0207676_10070298 3300026095 Bacteria 2807
552 Ga0207676_10469056 3300026095 Bacteria 1190
553 Ga0207676_10788201 3300026095 Bacteria 926
554 Ga0207676_11325877 3300026095 Bacteria 715
555 Ga0207674_10009653 3300026116 Bacteria 11005
556 Ga0207674_10034411 3300026116 Bacteria 5296
557 Ga0207674_10092172 3300026116 Bacteria 3020
558 Ga0207674_10287227 3300026116 Bacteria 1593
559 Ga0207675_100021788 3300026118 Bacteria 5965
560 Ga0207675_100110478 3300026118 Bacteria 2594
561 Ga0207675_100234756 3300026118 Bacteria 1770
562 Ga0207675_101753387 3300026118 Bacteria 640
563 Ga0207683_10000064 3300026121 Bacteria 80367
564 Ga0207683_10152530 3300026121 Bacteria 2086
565 Ga0207683_10769859 3300026121 Bacteria 893
566 Ga0209967_1000021 3300027364 Bacteria 19797
567 Ga0209967_1035348 3300027364 Bacteria 754
568 Ga0209981_1000025 3300027378 Bacteria 14801
569 Ga0209996_1000055 3300027395 Bacteria 15312
570 Ga0209984_1000124 3300027424 Bacteria 8872
571 Ga0210000_1000216 3300027462 Bacteria 8293
572 Ga0209995_1000035 3300027471 Bacteria 21587
573 Ga0209968_1000002 3300027526 Bacteria 78407
574 Ga0209970_1005132 3300027614 Bacteria 2164
575 Ga0210002_1000544 3300027617 Bacteria 5077
576 Ga0209971_1000231 3300027682 Bacteria 16031
577 Ga0209966_1000068 3300027695 Bacteria 46351
578 Ga0209974_10000012 3300027876 Bacteria 45142
579 Ga0209974_10119803 3300027876 Bacteria 932
580 Ga0207428_10000229 3300027907 Bacteria 77280
581 Ga0207428_10000552 3300027907 Bacteria 44415
582 Ga0207428_10004310 3300027907 Bacteria 13586
583 Ga0207428_10006010 3300027907 Bacteria 11240
584 Ga0207428_10383644 3300027907 Bacteria 1030
585 Ga0207428_10558656 3300027907 Bacteria 827
586 Ga0268266_10030709 3300028379 Bacteria 4564
587 Ga0268266_11088113 3300028379 Bacteria 773
588 Ga0268265_10000188 3300028380 Bacteria 73548
589 Ga0268265_10086717 3300028380 Bacteria 2489
590 Ga0268265_10326124 3300028380 Bacteria 1393
591 Ga0268264_10045724 3300028381 Bacteria 3635
592 Ga0268264_10094644 3300028381 Unclassified 2583
593 Ga0268264_10106478 3300028381 Bacteria 2448
594 Ga0268264_10129540 3300028381 Bacteria 2235
595 Ga0268264_10168198 3300028381 Bacteria 1981
596 Ga0265326_10008140 3300028558 Bacteria 3174
597 Ga0265325_10003457 3300031241 Bacteria 10308
598 Ga0307408_100469052 3300031548 Unclassified 1096
599 Ga0316575_10010383 3300031665 Bacteria 3420
600 Ga0316575_10019160 3300031665 Bacteria 2613
601 Ga0316579_10033633 3300031691 Bacteria 2355
602 Ga0265342_10015401 3300031712 Bacteria 5031
603 Ga0316576_10024048 3300031727 Bacteria 4251
604 Ga0316576_10024197 3300031727 Bacteria 4239
605 Ga0316576_10070955 3300031727 Bacteria 2569
606 Ga0316576_10127320 3300031727 Bacteria 1915
607 Ga0316576_10363654 3300031727 Bacteria 1075
608 Ga0316578_10003717 3300031728 Bacteria 7052
609 Ga0316578_10049211 3300031728 Bacteria 2462
610 Ga0316577_10024223 3300031733 Bacteria 3374
611 Ga0316577_10029166 3300031733 Bacteria 3079
612 Ga0316577_10217929 3300031733 Bacteria 1079
613 Ga0307414_10004175 3300032004 Bacteria 7803
614 Ga0307414_11276957 3300032004 Bacteria 681
615 Ga0316583_10025512 3300032133 Bacteria 2111
616 Ga0316585_10004611 3300032137 Bacteria 3850
617 Ga0316585_10016182 3300032137 Bacteria 2244
618 Ga0316580_10002371 3300032139 Bacteria 5165
619 Ga0316580_10013574 3300032139 Bacteria 2484
620 Ga0316580_10175922 3300032139 Bacteria 658
621 Ga0316587_1014501 3300033529 Bacteria 1300
622 Ga0316596_1027646 3300033541 Bacteria 1464
623 Ga0373940_0153134 3300035088 Bacteria 736
624 Ga0373955_0061732 3300035172 Bacteria 2071
625 Ga0316574_0017833 3300035398 Bacteria 4162
626 Ga0316574_0030842 3300035398 Bacteria 3249
627 Ga0316574_0038077 3300035398 Bacteria 2951
628 Ga0373931_0101831 3300035691 Bacteria 1616
629 Ga0373935_0086204 3300035692 Bacteria 2049
630 Ga0373935_0099683 3300035692 Bacteria 1913
631 Ga0373937_0017265 3300036401 Bacteria 6426
632 Ga0373937_0116183 3300036401 Bacteria 2492
633 Ga0373937_0475975 3300036401 Bacteria 1186
634 Ga0373937_1241535 3300036401 Bacteria 693
635 Ga0316582_0015857 3300036647 Bacteria 4321
636 Ga0316582_0037134 3300036647 Bacteria 3018
637 Ga0316582_0328536 3300036647 Bacteria 1052
638 Ga0316582_0395342 3300036647 Bacteria 952
639 Ga0316584_0000002 3300036712 Bacteria 102784
640 Ga0316584_0137215 3300036712 Bacteria 1825
641 Ga0316584_0260571 3300036712 Bacteria 1264
642 Ga0316584_0275716 3300036712 Bacteria 1223
643 Ga0436364_0040909 3300037853 Viruses 1026
644 Ga0436364_0083866 3300037853 Bacteria 2849
645 Ga0436364_0132615 3300037853 Bacteria 2743
646 Ga0436364_0159571 3300037853 Bacteria 1114
647 Ga0436364_0379493 3300037853 Bacteria 10371
648 Ga0436364_0446012 3300037853 Bacteria 193523
649 Ga0436364_0540839 3300037853 Unclassified 787
650 Ga0436364_0605834 3300037853 Bacteria 1344
651 Ga0436364_1086888 3300037853 Bacteria 6908
652 Ga0436364_1410583 3300037853 Bacteria 5448
653 Ga0436364_1415525 3300037853 Bacteria 425173
654 Ga0436364_1443017 3300037853 Unclassified 887
655 Ga0237819_07777 3300038705 Bacteria 1516
656 Ga0400483_021375 3300039062 Unclassified 1296
657 Ga0436365_0231405 3300039437 Unclassified 950
658 Ga0436365_0886087 3300039437 Bacteria 1733
659 Ga0436365_0950921 3300039437 Viruses 2660
660 Ga0436365_1025326 3300039437 Bacteria 1485
661 Ga0436365_1905373 3300039437 Unclassified 1505
662 Ga0436360_0615828 3300039438 Bacteria 6995
663 Ga0436360_0968139 3300039438 Bacteria 4542
664 Ga0436361_0167314 3300039447 Bacteria 59578
665 Ga0436361_0255738 3300039447 Bacteria 1678
666 Ga0436361_0267704 3300039447 Bacteria 23699
667 Ga0436361_0518279 3300039447 Bacteria 8252
668 Ga0436361_1162879 3300039447 Bacteria 31956
669 Ga0436363_0131103 3300039450 Bacteria 1464
670 Ga0436363_0321211 3300039450 Bacteria 1169
671 Ga0436363_0374324 3300039450 Bacteria 1308
672 Ga0436362_0094104 3300039453 Bacteria 2118
673 Ga0436362_0612154 3300039453 Unclassified 1014
674 Ga0439453_0004490 3300041408 Bacteria 2075
675 Ga0451805_095853 3300041461 Bacteria 659
676 Ga0451833_1460930 3300041491 Unclassified 2801
677 Ga0451835_0385845 3300041492 Bacteria 2722
678 Ga0451837_1169820 3300041494 Bacteria 715
679 Ga0451839_0451938 3300041496 Bacteria 2309
680 Ga0451849_0458272 3300041505 Bacteria 3248
681 Ga0451851_1268568 3300041507 Bacteria 1709
682 Ga0451853_1136400 3300041512 Bacteria 2109
683 Ga0466969_0002233 3300044656 Bacteria 10353
684 Ga0466966_0056152 3300044684 Bacteria 2492
685 Ga0466963_0771825 3300044694 Unclassified 678
686 Ga0453684_0699765 3300044712 Unclassified 1101
687 Ga0466970_0674981 3300044765 Unclassified 602
688 Ga0466959_0006744 3300045049 Bacteria 7994
689 Ga0451576_0019143 3300045051 Bacteria 7479
690 Ga0451576_0053894 3300045051 Bacteria 4211
691 Ga0451576_0063312 3300045051 Bacteria 3855
692 Ga0451576_0084312 3300045051 Bacteria 3305
693 Ga0451576_0769944 3300045051 Bacteria 1011
694 Ga0495603_0008704 3300046455 Bacteria 6135
695 Ga0495603_0049670 3300046455 Bacteria 2497
696 Ga0495603_0148308 3300046455 Bacteria 1363
697 Ga0495629_0000135 3300046459 Bacteria 64457
698 Ga0495629_0073224 3300046459 Bacteria 2392
699 Ga0495629_0244872 3300046459 Bacteria 1234
700 Ga0495641_0060246 3300046461 Unclassified 1715
701 Ga0495580_0207078 3300046472 Bacteria 1350
702 Ga0495582_0003175 3300046473 Bacteria 9231
703 Ga0495639_0016135 3300046475 Bacteria 3240
704 Ga0495639_0018159 3300046475 Bacteria 3059
705 Ga0495639_0123115 3300046475 Unclassified 1238
706 Ga0495639_0129828 3300046475 Bacteria 1206
707 Ga0495662_0164501 3300046476 Bacteria 1093
708 Ga0495664_0160760 3300046477 Bacteria 1363
709 Ga0495584_0038545 3300046491 Bacteria 2415
710 Ga0495584_0186754 3300046491 Bacteria 1053
711 Ga0495594_0017289 3300046499 Bacteria 3808
712 Ga0495594_0025974 3300046499 Bacteria 3150
713 Ga0495618_0212342 3300046514 Bacteria 1223
714 Ga0495663_0113445 3300046525 Bacteria 902
715 Ga0495663_0241367 3300046525 Bacteria 639
716 Ga0495666_0097499 3300046526 Unclassified 1386
717 Ga0495642_0103092 3300046528 Bacteria 1216
718 Ga0495642_0306074 3300046528 Bacteria 697
719 Ga0495640_0144845 3300046533 Bacteria 1529
720 Ga0495640_0532580 3300046533 Bacteria 713
721 Ga0495586_0003499 3300046535 Bacteria 8415
722 Ga0495609_0268653 3300046538 Bacteria 699
723 Ga0495621_0000739 3300046539 Bacteria 8291
724 Ga0495621_0011335 3300046539 Bacteria 2754
725 Ga0495621_0017974 3300046539 Bacteria 2292
726 Ga0495621_0116140 3300046539 Bacteria 1031
727 Ga0495621_0170598 3300046539 Bacteria 864
728 Ga0495622_0094839 3300046557 Bacteria 1370
729 Ga0495633_0022606 3300046558 Bacteria 3126
730 Ga0495656_0303296 3300046615 Bacteria 819
731 Ga0495634_0053446 3300046642 Bacteria 2706
732 Ga0495634_0092333 3300046642 Unclassified 1964
733 Ga0495635_0000492 3300046663 Bacteria 24874
734 Ga0495659_0006415 3300046664 Bacteria 3713
735 Ga0495659_0029806 3300046664 Bacteria 1896
736 Ga0495659_0037917 3300046664 Bacteria 1709
737 Ga0495659_0064149 3300046664 Bacteria 1363
738 Ga0495659_0133661 3300046664 Bacteria 985
739 Ga0495659_0154754 3300046664 Bacteria 922
740 Ga0495588_0010901 3300046674 Bacteria 4249
741 Ga0495588_0302697 3300046674 Bacteria 842
742 Ga0495623_0189138 3300046679 Bacteria 1191
743 Ga0495647_0082536 3300046681 Bacteria 1305
744 Ga0495658_0000006 3300046683 Bacteria 148671
745 Ga0495658_0090758 3300046683 Bacteria 1809
746 Ga0495613_0028445 3300046689 Bacteria 4157
747 Ga0495670_0014898 3300046691 Bacteria 3828
748 Ga0495600_0193367 3300046809 Bacteria 1308
749 Ga0495581_0001720 3300047315 Bacteria 12194
750 Ga0495581_0156921 3300047315 Bacteria 1330
751 Ga0495636_0023125 3300047318 Bacteria 2515
752 Ga0495676_0033928 3300047321 Bacteria 4289
753 Ga0495676_0103789 3300047321 Bacteria 2098
754 Ga0495676_0122238 3300047321 Bacteria 1892
755 Ga0495676_0128714 3300047321 Bacteria 1831
756 Ga0495680_0000476 3300047322 Bacteria 45115
757 Ga0495680_0031741 3300047322 Bacteria 4296
758 Ga0495680_0173851 3300047322 Bacteria 1558
759 Ga0495675_0280716 3300047444 Bacteria 993
760 Ga0495685_028547 3300047447 Bacteria 1919
761 Ga0495685_146690 3300047447 Bacteria 767
762 Ga0495684_0376861 3300047471 Bacteria 1002
763 Ga0495593_0071601 3300047673 Bacteria 1800
764 Ga0495614_0000534 3300048089 Bacteria 15711
765 Ga0496100_0042585 3300048903 Unclassified 2900
766 Ga0496101_0001671 3300048904 Bacteria 13309
767 Ga0496102_1198215 3300048905 Bacteria 679
768 Ga0496104_0160431 3300048907 Bacteria 2157
769 Ga0496104_0295760 3300048907 Unclassified 1532
770 Ga0496104_0448031 3300048907 Unclassified 1203
771 Ga0496105_0062310 3300048908 Unclassified 3078
772 Ga0496105_0172314 3300048908 Unclassified 1774
773 Ga0496105_0248382 3300048908 Bacteria 1442
774 Ga0496106_0114463 3300048909 Bacteria 2103
775 Ga0496106_0333106 3300048909 Bacteria 1219
776 Ga0496108_0154579 3300048911 Bacteria 1981
777 Ga0496108_0606002 3300048911 Bacteria 954
778 Ga0496114_0022830 3300048917 Bacteria 5099
779 Ga0496114_0729484 3300048917 Bacteria 867
780 Ga0496115_0193747 3300048918 Unclassified 1679
781 Ga0496126_0087502 3300048929 Bacteria 2745
782 Ga0501291_003678 3300049514 Bacteria 1923
783 Ga0501299_024419 3300049522 Unclassified 1128
784 Ga0501031_0089839 3300049568 Bacteria 2003
785 Ga0501031_0287052 3300049568 Bacteria 1067
786 Ga0501033_0146503 3300049570 Bacteria 1705
787 Ga0501036_0233707 3300049572 Bacteria 1542
788 Ga0501037_0126689 3300049573 Bacteria 1833
789 Ga0501037_0174099 3300049573 Bacteria 1529
790 Ga0501038_0337895 3300049574 Bacteria 1175
791 Ga0501039_0057316 3300049575 Bacteria 3017
792 Ga0501040_0076086 3300049576 Bacteria 2321
793 Ga0501040_0270990 3300049576 Unclassified 1212
794 Ga0501041_0091332 3300049577 Unclassified 1880
795 Ga0501041_0182552 3300049577 Bacteria 1313
796 Ga0501042_0081696 3300049578 Bacteria 2316
797 Ga0501043_0060356 3300049579 Bacteria 2977
798 Ga0501046_0270269 3300049580 Bacteria 1247
799 Ga0501047_0006062 3300049581 Bacteria 11365
800 Ga0501047_0013013 3300049581 Bacteria 7879
801 Ga0501048_0070543 3300049582 Bacteria 2468
802 Ga0501048_0130864 3300049582 Bacteria 1774
803 Ga0501048_0779590 3300049582 Bacteria 687
804 Ga0501048_0854332 3300049582 Bacteria 654
805 Ga0501067_0128155 3300049583 Unclassified 1412
806 Ga0501068_0143128 3300049584 Bacteria 1499
807 Ga0501068_0179157 3300049584 Bacteria 1340
808 Ga0501069_0063530 3300049585 Bacteria 2062
809 Ga0501071_0091157 3300049587 Bacteria 2239
810 Ga0501071_0261480 3300049587 Unclassified 1307
811 Ga0501072_0055942 3300049588 Bacteria 3109
812 Ga0501072_0195765 3300049588 Bacteria 1612
813 Ga0501073_0114097 3300049589 Bacteria 1873
814 Ga0501075_0020187 3300049591 Bacteria 4841
815 Ga0501075_0022155 3300049591 Bacteria 4638
816 Ga0501075_0031049 3300049591 Bacteria 3963
817 Ga0501076_0017743 3300049592 Bacteria 5411
818 Ga0501076_0327606 3300049592 Unclassified 1256
819 Ga0501077_0058546 3300049593 Bacteria 2446
820 Ga0501077_0115051 3300049593 Bacteria 1705
821 Ga0501079_0047627 3300049741 Bacteria 3308
822 Ga0501079_0289262 3300049741 Bacteria 1281
823 Ga0501080_0178054 3300049742 Bacteria 1958
824 Ga0501081_0017979 3300049743 Bacteria 4689
825 Ga0501081_0292303 3300049743 Bacteria 1194
826 Ga0501035_0276946 3300049822 Bacteria 1419
827 Ga0501044_0108097 3300049823 Bacteria 2792
828 Ga0501045_0034423 3300049824 Bacteria 3677
829 Ga0501045_0258018 3300049824 Bacteria 1297
830 nmdc:mga00v17_235305_c1 3300050491 Bacteria 1187
831 nmdc:mga0k408_102104_c1 3300050493 Bacteria 1691
832 nmdc:mga0k408_510855_c1 3300050493 Bacteria 712
833 nmdc:mga0k408_554916_c1 3300050493 Unclassified 679
834 nmdc:mga06z11_206559_c1 3300050494 Bacteria 1143
835 nmdc:mga05p37_106558_c1 3300050507 Bacteria 3448
836 nmdc:mga05p37_211228_c2 3300050507 Bacteria 1255
837 nmdc:mga05p37_272977_c1 3300050507 Bacteria 2019
838 nmdc:mga05p37_28328_c1 3300050507 Bacteria 6830
839 nmdc:mga05p37_2925_c1 3300050507 Bacteria 19830
840 nmdc:mga05p37_353316_c1 3300050507 Bacteria 1730
841 nmdc:mga05p37_414781_c1 3300050507 Bacteria 1569
842 nmdc:mga05p37_565046_c1 3300050507 Bacteria 1292
843 nmdc:mga05p37_705282_c1 3300050507 Bacteria 1120
844 nmdc:mga05p37_863569_c1 3300050507 Bacteria 981
845 nmdc:mga09592_151218_c1 3300050508 Bacteria 2003
846 nmdc:mga09592_17198_c1 3300050508 Bacteria 5922
847 nmdc:mga09592_234439_c1 3300050508 Bacteria 1590
848 nmdc:mga09592_2784_c1 3300050508 Bacteria 14164
849 nmdc:mga09592_778727_c1 3300050508 Bacteria 810
850 nmdc:mga0qj67_128745_c1 3300050509 Bacteria 2049
851 nmdc:mga0qj67_27291_c1 3300050509 Bacteria 4424
852 nmdc:mga0qj67_304444_c1 3300050509 Bacteria 1291
853 nmdc:mga0qj67_54277_c1 3300050509 Bacteria 3173
854 nmdc:mga06r32_21839_c1 3300050510 Bacteria 5910
855 nmdc:mga06r32_355153_c1 3300050510 Bacteria 1450
856 nmdc:mga06r32_91981_c1 3300050510 Bacteria 2965
857 nmdc:mga06r32_93134_c1 3300050510 Bacteria 2947
858 nmdc:mga08y16_164291_c1 3300050511 Bacteria 2306
859 nmdc:mga08y16_189167_c1 3300050511 Bacteria 2136
860 nmdc:mga08y16_19719_c1 3300050511 Bacteria 7110
861 nmdc:mga08y16_5837_c1 3300050511 Bacteria 12901
862 nmdc:mga08y16_86233_c1 3300050511 Bacteria 3272
863 nmdc:mga08y16_92450_c1 3300050511 Bacteria 3152
864 nmdc:mga0n895_1156_c1 3300050512 Bacteria 19326
865 nmdc:mga0n895_152373_c1 3300050512 Bacteria 2342
866 nmdc:mga0n895_34160_c1 3300050512 Bacteria 4894
867 nmdc:mga0n895_350734_c1 3300050512 Bacteria 1495
868 nmdc:mga0n895_43995_c1 3300050512 Bacteria 4355
869 nmdc:mga0n895_53093_c1 3300050512 Bacteria 3981
870 nmdc:mga0n895_569655_c1 3300050512 Bacteria 1137
871 nmdc:mga0n895_60233_c1 3300050512 Bacteria 3746
872 nmdc:mga0n895_766704_c1 3300050512 Bacteria 957
873 nmdc:mga0rr50_48380_c1 3300050513 Bacteria 3143
874 nmdc:mga0rr50_52856_c1 3300050513 Bacteria 3020
875 nmdc:mga0rr50_54155_c1 3300050513 Bacteria 2987
876 nmdc:mga0rr50_56856_c1 3300050513 Bacteria 2924
877 nmdc:mga08x19_20808_c1 3300050514 Bacteria 4043
878 nmdc:mga0a205_136355_c1 3300050515 Bacteria 2355
879 nmdc:mga0a205_219126_c1 3300050515 Bacteria 816
880 nmdc:mga0a205_278685_c1 3300050515 Bacteria 1548
881 nmdc:mga0a205_512191_c1 3300050515 Bacteria 1057
882 nmdc:mga0a205_630_c1 3300050515 Bacteria 28020
883 nmdc:mga0a205_631742_c1 3300050515 Bacteria 923
884 nmdc:mga0a205_802091_c1 3300050515 Bacteria 789
885 nmdc:mga0a205_81803_c1 3300050515 Bacteria 3120
886 nmdc:mga0a205_9197_c1 3300050515 Bacteria 9020
887 Ga0495595_0239523 3300053084 Unclassified 907
888 Ga0495619_0000696 3300053085 Bacteria 21976
889 Ga0495619_0449840 3300053085 Bacteria 888
890 Ga0501084_0009345 3300054114 Bacteria 8114
891 Ga0501084_0053463 3300054114 Bacteria 3378
892 Ga0590071_009187 3300059421 Bacteria 2324
893 Ga0501082_0030588 3300060353 Unclassified 4640
894 Ga0501082_0171457 3300060353 Bacteria 1887
895 Ga0501082_0672273 3300060353 Unclassified 906
896 Ga0530510_0001494 3300061734 Bacteria 15697
897 Ga0530510_0034403 3300061734 Bacteria 3650
898 Ga0530510_0049005 3300061734 Unclassified 3053
899 2831428420 2831426010 Bacteria 8662725
900 2848697301 2848694841 Bacteria 9205737
901 2849668455 2849660919 Bacteria 8251853
902 2881249464 2881247448 Bacteria 3717788
903 2886634050 2886627955 Bacteria 7618130
904 2913912869 2913912277 Bacteria 9037797
905 8003152862 8003151029 Bacteria 8187759
906 Ga0213875_10136598
907 SwRhRL2b_contig_547326
908 JGI24740J21852_10006882
909 JGI24737J22298_10063550
910 JGI25157J39369_1003093
911 JGI25406J46586_10009103
912 JGI25406J46586_10108234
913 rootL2_10112891
914 JGI26145J50221_1003897
915 Ga0065712_10027087
916 Ga0065715_10003097
917 Ga0065715_10059711
918 Ga0065715_10115281
919 Ga0065707_10089565
920 Ga0070676_10002759
921 Ga0070676_10178701
922 Ga0070683_100066695
923 Ga0070683_100068902
924 Ga0070683_100436742
925 Ga0070683_101179926
926 Ga0070690_100020950
927 Ga0070690_100067336
928 Ga0070690_100761359
929 Ga0070670_100005568
930 Ga0070670_100026378
931 Ga0070670_100338985
932 Ga0070677_10100446
933 Ga0068869_100043930
934 Ga0068869_100159513
935 Ga0068869_100231058
936 Ga0070666_10481042
937 Ga0070680_100015205
938 Ga0070680_100053157
939 Ga0070680_100366858
940 Ga0070682_100487505
941 Ga0068868_100090991
942 Ga0070660_100000126
943 Ga0070689_100002763
944 Ga0070689_100166261
945 Ga0070691_10034014
946 Ga0070691_10040445
947 Ga0070687_100026434
948 Ga0070687_100038820
949 Ga0070687_100080067
950 Ga0070661_100038183
951 Ga0070661_100566750
952 Ga0070692_10037088
953 Ga0070692_10040270
954 Ga0070668_100014286
955 Ga0070668_100103554
956 Ga0070668_100130865
957 Ga0070669_100048976
958 Ga0070669_100078739
959 Ga0070675_100000205
960 Ga0070675_100021846
961 Ga0070675_100040822
962 Ga0070675_100196603
963 Ga0070675_100196610
964 Ga0070675_100260724
965 Ga0070675_100376600
966 Ga0070671_100004773
967 Ga0070671_100235790
968 Ga0070674_100019118
969 Ga0070673_100005336
970 Ga0070673_100202682
971 Ga0070673_100324504
972 Ga0070673_100512108
973 Ga0070673_100512586
974 Ga0070673_100592081
975 Ga0070673_100627450
976 Ga0070688_100014286
977 Ga0070688_100088539
978 Ga0070688_100303339
979 Ga0070659_100001609
980 Ga0070703_10000235
981 Ga0070714_100033790
982 Ga0070713_100111998
983 Ga0070701_10006802
984 Ga0070701_10200328
985 Ga0070701_10486898
986 Ga0070711_100055730
987 Ga0070705_100000426
988 Ga0070705_100007098
989 Ga0070705_100007422
990 Ga0070705_100014121
991 Ga0070705_100302255
992 Ga0070705_100544084
993 Ga0070700_100002320
994 Ga0070700_100066869
995 Ga0070700_100189589
996 Ga0070694_100000204
997 Ga0070694_100001493
998 Ga0070694_100016147
999 Ga0070694_100024613
1000 Ga0070694_100055450
1001 Ga0070694_100471990
1002 Ga0070694_100772325
1003 Ga0070708_100035263
1004 Ga0070708_100272423
1005 Ga0070708_100287563
1006 Ga0070708_100407339
1007 Ga0070708_100801366
1008 Ga0070663_100019531
1009 Ga0070678_100000430
1010 Ga0070662_100010676
1011 Ga0070662_100420080
1012 Ga0070681_10037000
1013 Ga0068867_100000949
1014 Ga0068867_100009803
1015 Ga0068867_100247680
1016 Ga0070685_10014976
1017 Ga0070685_10026271
1018 Ga0070685_10075151
1019 Ga0070706_100067652
1020 Ga0070707_100012174
1021 Ga0070707_100092336
1022 Ga0070698_100015540
1023 Ga0070698_100047125
1024 Ga0070698_100253465
1025 Ga0070698_100419221
1026 Ga0070698_101014603
1027 Ga0070699_100010890
1028 Ga0070699_100036650
1029 Ga0070699_100086011
1030 Ga0070699_100243957
1031 Ga0070679_100149511
1032 Ga0070679_100166962
1033 Ga0070684_100057719
1034 Ga0070684_100098088
1035 Ga0070697_100028001
1036 Ga0068853_101230701
1037 Ga0070672_100014999
1038 Ga0070672_100056847
1039 Ga0070672_100086181
1040 Ga0070672_100216404
1041 Ga0070672_100380044
1042 Ga0070686_100030093
1043 Ga0070686_100236030
1044 Ga0070686_100408224
1045 Ga0070686_101040648
1046 Ga0070695_100006049
1047 Ga0070695_100014148
1048 Ga0070695_100047791
1049 Ga0070695_100059053
1050 Ga0070695_100305475
1051 Ga0070696_100005663
1052 Ga0070696_100014054
1053 Ga0070696_100015999
1054 Ga0070696_100028045
1055 Ga0070696_100087944
1056 Ga0070696_100951173
1057 Ga0070693_100011708
1058 Ga0070693_100515964
1059 Ga0070665_100044669
1060 Ga0070665_100261383
1061 Ga0070704_100002423
1062 Ga0070704_100025154
1063 Ga0070704_100043634
1064 Ga0070704_100043902
1065 Ga0070704_100142557
1066 Ga0070704_100194535
1067 Ga0070704_100210330
1068 Ga0070704_100563684
1069 Ga0068855_100034230
1070 Ga0068855_100476584
1071 Ga0068855_100840086
1072 Ga0070664_100012202
1073 Ga0070664_100077333
1074 Ga0070664_100089690
1075 Ga0070664_100188843
1076 Ga0068857_100007058
1077 Ga0068857_100042151
1078 Ga0068857_100229050
1079 Ga0068857_100539641
1080 Ga0068856_100026914
1081 Ga0068856_101598389
1082 Ga0070702_100154579
1083 Ga0070702_100561824
1084 Ga0068852_100199891
1085 Ga0068859_100000553
1086 Ga0068859_100002238
1087 Ga0068859_100006711
1088 Ga0068859_100579526
1089 Ga0068859_100712212
1090 Ga0068859_101482329
1091 Ga0068864_100092053
1092 Ga0068864_100309367
1093 Ga0068864_100523521
1094 Ga0068866_10020020
1095 Ga0068866_10148416
1096 Ga0068861_100006175
1097 Ga0068861_100008693
1098 Ga0068861_100628805
1099 Ga0068870_10002717
1100 Ga0068870_10075449
1101 Ga0068870_10355020
1102 Ga0068863_100081094
1103 Ga0068863_100290103
1104 Ga0068863_100498538
1105 Ga0068863_100511003
1106 Ga0068863_101284357
1107 Ga0068858_100496104
1108 Ga0068858_100659849
1109 Ga0068860_100027607
1110 Ga0068860_100146387
1111 Ga0068860_100160186
1112 Ga0068860_100173530
1113 Ga0068860_100574267
1114 Ga0068862_100000956
1115 Ga0068862_100040921
1116 Ga0081455_10004203
1117 Ga0081455_10106003
1118 Ga0081540_1005042
1119 Ga0081540_1127233
1120 Ga0081539_10000649
1121 Ga0081539_10008206
1122 Ga0081539_10063410
1123 Ga0075364_10263724
1124 Ga0075364_10337349
1125 Ga0075432_10000481
1126 Ga0070715_10075097
1127 Ga0075367_10049372
1128 Ga0075427_10000664
1129 Ga0075366_10033830
1130 Ga0075366_10090080
1131 Ga0075366_10599411
1132 Ga0097621_100026765
1133 Ga0097621_100048085
1134 Ga0097621_100056565
1135 Ga0097621_100181293
1136 Ga0097621_100454203
1137 Ga0068871_100005672
1138 Ga0068871_100010044
1139 Ga0068871_100046731
1140 Ga0068871_100053892
1141 Ga0068871_100065165
1142 Ga0068871_100105196
1143 Ga0068871_100378962
1144 Ga0068871_100445622
1145 Ga0068871_100591322
1146 Ga0075428_100004188
1147 Ga0075428_100006548
1148 Ga0075428_100007290
1149 Ga0075428_100010723
1150 Ga0075428_100021685
1151 Ga0075428_100070643
1152 Ga0075428_100134625
1153 Ga0075428_100520138
1154 Ga0075428_100592300
1155 Ga0075428_101383508
1156 Ga0075430_100001975
1157 Ga0075430_100002398
1158 Ga0075430_100072090
1159 Ga0075430_100077118
1160 Ga0075430_100113512
1161 Ga0075430_100265870
1162 Ga0075431_100024858
1163 Ga0075431_100030305
1164 Ga0075431_100040409
1165 Ga0075431_100057876
1166 Ga0075431_100230498
1167 Ga0075431_100345093
1168 Ga0075433_10002179
1169 Ga0075433_10004522
1170 Ga0075433_10015058
1171 Ga0075433_10072182
1172 Ga0075433_10245464
1173 Ga0075433_10682704
1174 Ga0075434_100005114
1175 Ga0075434_100007185
1176 Ga0075434_100008086
1177 Ga0075434_100028095
1178 Ga0075434_100061721
1179 Ga0075434_100207006
1180 Ga0075434_100973798
1181 Ga0075429_100002342
1182 Ga0075429_100010767
1183 Ga0075429_100085763
1184 Ga0075429_100157634
1185 Ga0075429_100208684
1186 Ga0075429_101256717
1187 Ga0068865_100006547
1188 Ga0068865_100023794
1189 Ga0068865_100036410
1190 Ga0068865_100064647
1191 Ga0068865_100597380
1192 Ga0075436_100024789
1193 Ga0075436_100073563
1194 Ga0097620_100000553
1195 Ga0097620_100002238
1196 Ga0097620_100006710
1197 Ga0097620_100406368
1198 Ga0097620_100579527
1199 Ga0097620_100712160
1200 Ga0097620_101482443
1201 Ga0075435_100017256
1202 Ga0075435_100019411
1203 Ga0075435_100052865
1204 Ga0075435_100175701
1205 Ga0075435_100185525
1206 Ga0075435_100195571
1207 Ga0075435_100295554
1208 Ga0105240_10057091
1209 Ga0111539_10021679
1210 Ga0111539_10025716
1211 Ga0111539_10091250
1212 Ga0111539_10103938
1213 Ga0111539_10135064
1214 Ga0111539_10767358
1215 Ga0111539_12216669
1216 Ga0105245_10100484
1217 Ga0105245_10145120
1218 Ga0105245_10221404
1219 Ga0105245_10908604
1220 Ga0114129_10004328
1221 Ga0114129_10007140
1222 Ga0114129_10012593
1223 Ga0114129_10018492
1224 Ga0114129_10047315
1225 Ga0114129_10068654
1226 Ga0114129_10068856
1227 Ga0114129_10129978
1228 Ga0114129_10146106
1229 Ga0114129_10150032
1230 Ga0114129_10166767
1231 Ga0114129_10244979
1232 Ga0114129_11364665
1233 Ga0105243_10000147
1234 Ga0105243_10000546
1235 Ga0105243_10031645
1236 Ga0105243_10135184
1237 Ga0105243_10543665
1238 Ga0105243_11547443
1239 Ga0105243_11568696
1240 Ga0105241_10260615
1241 Ga0105242_10000048
1242 Ga0105242_10000910
1243 Ga0105242_10077303
1244 Ga0105242_10089034
1245 Ga0105242_10089234
1246 Ga0105242_10097531
1247 Ga0105242_10122601
1248 Ga0105242_10152327
1249 Ga0105242_10352107
1250 Ga0105242_10684617
1251 Ga0105248_10073339
1252 Ga0105248_10309916
1253 Ga0105248_10393431
1254 Ga0105248_10591047
1255 Ga0105248_10611658
1256 Ga0105248_10655264
1257 Ga0105248_11336870
1258 Ga0105248_11873694
1259 Ga0105237_10068250
1260 Ga0105238_10308028
1261 Ga0105249_10008880
1262 Ga0105249_10013595
1263 Ga0105239_10025819
1264 Ga0105239_11387380
1265 Ga0105246_10001275
1266 Ga0105246_10859682
1267 Ga0105246_11004493
1268 Ga0157373_10189150
1269 Ga0157371_10015780
1270 Ga0157370_10041406
1271 Ga0157370_10180483
1272 Ga0157370_10628534
1273 Ga0157369_10007516
1274 Ga0157374_10002355
1275 Ga0157374_10020700
1276 Ga0157374_10044400
1277 Ga0157374_10085260
1278 Ga0157374_11298530
1279 Ga0157378_10001206
1280 Ga0157378_10065485
1281 Ga0157378_10179332
1282 Ga0157378_10413216
1283 Ga0163162_10041261
1284 Ga0163162_10943956
1285 Ga0157372_10414127
1286 Ga0157375_10011510
1287 Ga0157375_10022441
1288 Ga0157375_10197971
1289 Ga0157375_10488991
1290 Ga0157375_11178709
1291 Ga0157375_11525047
1292 Ga0163163_10410237
1293 Ga0163163_10689651
1294 Ga0163163_12403111
1295 Ga0157380_10046918
1296 Ga0157380_10458774
1297 Ga0157380_11431529
1298 Ga0157377_10000773
1299 Ga0157377_10026549
1300 Ga0157379_10864374
1301 Ga0157376_10000103
1302 Ga0157376_10020237
1303 Ga0157376_10040237
1304 Ga0157376_10043121
1305 Ga0157376_10394330
1306 Ga0182005_1021021
1307 Ga0163161_10649430
1308 Ga0206354_11136710
1309 Ga0213872_10000164
1310 Ga0213872_10019466
1311 Ga0213876_10095323
1312 Ga0213876_10151620
1313 Ga0213875_10000008
1314 Ga0213875_10000027
1315 Ga0213875_10023631
1316 Ga0213875_10169792
1317 Ga0213875_10333175
1318 Ga0213871_10001320
1319 Ga0224712_10319224
1320 Ga0209646_1000002
1321 Ga0209026_1001083
1322 Ga0207653_10000116
1323 Ga0207682_10056838
1324 Ga0207642_10071298
1325 Ga0207688_10003059
1326 Ga0207688_10047871
1327 Ga0207688_10372826
1328 Ga0207680_10008513
1329 Ga0207680_10258307
1330 Ga0207647_10183519
1331 Ga0207685_10186497
1332 Ga0207645_10000128
1333 Ga0207643_10047126
1334 Ga0207684_10054312
1335 Ga0207684_10397852
1336 Ga0207654_10174388
1337 Ga0207707_10031178
1338 Ga0207707_10149835
1339 Ga0207695_10228925
1340 Ga0207663_10204075
1341 Ga0207660_10041867
1342 Ga0207660_10056845
1343 Ga0207660_10779044
1344 Ga0207662_10004142
1345 Ga0207662_10015110
1346 Ga0207662_10112895
1347 Ga0207657_10000352
1348 Ga0207649_10418413
1349 Ga0207649_10571687
1350 Ga0207652_10509957
1351 Ga0207652_10763055
1352 Ga0207646_10001278
1353 Ga0207646_10011611
1354 Ga0207646_10063392
1355 Ga0207646_10851876
1356 Ga0207681_10002465
1357 Ga0207681_10290283
1358 Ga0207694_10857981
1359 Ga0207650_10025487
1360 Ga0207650_10136777
1361 Ga0207650_10147496
1362 Ga0207659_10020805
1363 Ga0207659_10027877
1364 Ga0207659_10041792
1365 Ga0207659_10062221
1366 Ga0207659_10366650
1367 Ga0207687_10007616
1368 Ga0207687_10034360
1369 Ga0207700_10089874
1370 Ga0207664_10055101
1371 Ga0207644_10116311
1372 Ga0207690_10025677
1373 Ga0207690_10286555
1374 Ga0207706_10001281
1375 Ga0207706_10191612
1376 Ga0207706_10343303
1377 Ga0207686_10000080
1378 Ga0207686_10001797
1379 Ga0207686_10013659
1380 Ga0207686_10070554
1381 Ga0207686_10137562
1382 Ga0207686_10170814
1383 Ga0207686_10247410
1384 Ga0207686_10289520
1385 Ga0207686_10667042
1386 Ga0207709_10000029
1387 Ga0207709_10050131
1388 Ga0207709_10064814
1389 Ga0207709_10174298
1390 Ga0207709_10505704
1391 Ga0207670_10041440
1392 Ga0207669_10099536
1393 Ga0207669_10232600
1394 Ga0207704_10001396
1395 Ga0207704_10093766
1396 Ga0207704_10215449
1397 Ga0207704_10738619
1398 Ga0207704_10881791
1399 Ga0207665_10513934
1400 Ga0207691_10000021
1401 Ga0207691_10008500
1402 Ga0207691_10192797
1403 Ga0207691_10216707
1404 Ga0207711_10137399
1405 Ga0207711_10148357
1406 Ga0207711_10546143
1407 Ga0207711_10925199
1408 Ga0207689_10003325
1409 Ga0207689_10154132
1410 Ga0207689_10190408
1411 Ga0207689_10641305
1412 Ga0207661_10109557
1413 Ga0207679_10029070
1414 Ga0207679_10186323
1415 Ga0207679_10715975
1416 Ga0207679_11273785
1417 Ga0207667_10046665
1418 Ga0207667_10407111
1419 Ga0207667_10831219
1420 Ga0207651_10144072
1421 Ga0207651_10200635
1422 Ga0207651_10573988
1423 Ga0207651_10884050
1424 Ga0207651_10911337
1425 Ga0207651_11203706
1426 Ga0207712_10110869
1427 Ga0207712_10477082
1428 Ga0207668_10091372
1429 Ga0207668_10280312
1430 Ga0207658_10003897
1431 Ga0207677_10140575
1432 Ga0207677_10167670
1433 Ga0207677_10172311
1434 Ga0207677_11074327
1435 Ga0207703_10881483
1436 Ga0207703_11091928
1437 Ga0207639_10067725
1438 Ga0207678_10312686
1439 Ga0207678_10523299
1440 Ga0207708_10000070
1441 Ga0207708_10095638
1442 Ga0207708_10141122
1443 Ga0207708_10164183
1444 Ga0207708_11483618
1445 Ga0207702_10565726
1446 Ga0207641_10098276
1447 Ga0207641_10371522
1448 Ga0207641_10467898
1449 Ga0207641_10557499
1450 Ga0207641_10792196
1451 Ga0207641_10980496
1452 Ga0207648_10000103
1453 Ga0207648_10001758
1454 Ga0207648_10026928
1455 Ga0207648_10236875
1456 Ga0207676_10070298
1457 Ga0207676_10469056
1458 Ga0207676_10788201
1459 Ga0207676_11325877
1460 Ga0207674_10009653
1461 Ga0207674_10034411
1462 Ga0207674_10092172
1463 Ga0207674_10287227
1464 Ga0207675_100021788
1465 Ga0207675_100110478
1466 Ga0207675_100234756
1467 Ga0207675_101753387
1468 Ga0207683_10000064
1469 Ga0207683_10152530
1470 Ga0207683_10769859
1471 Ga0209967_1000021
1472 Ga0209967_1035348
1473 Ga0209981_1000025
1474 Ga0209996_1000055
1475 Ga0209984_1000124
1476 Ga0210000_1000216
1477 Ga0209995_1000035
1478 Ga0209968_1000002
1479 Ga0209970_1005132
1480 Ga0210002_1000544
1481 Ga0209971_1000231
1482 Ga0209966_1000068
1483 Ga0209974_10000012
1484 Ga0209974_10119803
1485 Ga0207428_10000229
1486 Ga0207428_10000552
1487 Ga0207428_10004310
1488 Ga0207428_10006010
1489 Ga0207428_10383644
1490 Ga0207428_10558656
1491 Ga0268266_10030709
1492 Ga0268266_11088113
1493 Ga0268265_10000188
1494 Ga0268265_10086717
1495 Ga0268265_10326124
1496 Ga0268264_10045724
1497 Ga0268264_10094644
1498 Ga0268264_10106478
1499 Ga0268264_10129540
1500 Ga0268264_10168198
1501 Ga0265326_10008140
1502 Ga0265325_10003457
1503 Ga0307408_100469052
1504 Ga0316575_10010383
1505 Ga0316575_10019160
1506 Ga0316579_10033633
1507 Ga0265342_10015401
1508 Ga0316576_10024048
1509 Ga0316576_10024197
1510 Ga0316576_10070955
1511 Ga0316576_10127320
1512 Ga0316576_10363654
1513 Ga0316578_10003717
1514 Ga0316578_10049211
1515 Ga0316577_10024223
1516 Ga0316577_10029166
1517 Ga0316577_10217929
1518 Ga0307414_10004175
1519 Ga0307414_11276957
1520 Ga0316583_10025512
1521 Ga0316585_10004611
1522 Ga0316585_10016182
1523 Ga0316580_10002371
1524 Ga0316580_10013574
1525 Ga0316580_10175922
1526 Ga0316587_1014501
1527 Ga0316596_1027646
1528 Ga0373940_0153134
1529 Ga0373955_0061732
1530 Ga0316574_0017833
1531 Ga0316574_0030842
1532 Ga0316574_0038077
1533 Ga0373931_0101831
1534 Ga0373935_0086204
1535 Ga0373935_0099683
1536 Ga0373937_0017265
1537 Ga0373937_0116183
1538 Ga0373937_0475975
1539 Ga0373937_1241535
1540 Ga0316582_0015857
1541 Ga0316582_0037134
1542 Ga0316582_0328536
1543 Ga0316582_0395342
1544 Ga0316584_0000002
1545 Ga0316584_0137215
1546 Ga0316584_0260571
1547 Ga0316584_0275716
1548 Ga0436364_0040909
1549 Ga0436364_0083866
1550 Ga0436364_0132615
1551 Ga0436364_0159571
1552 Ga0436364_0379493
1553 Ga0436364_0446012
1554 Ga0436364_0540839
1555 Ga0436364_0605834
1556 Ga0436364_1086888
1557 Ga0436364_1410583
1558 Ga0436364_1415525
1559 Ga0436364_1443017
1560 Ga0237819_07777
1561 Ga0400483_021375
1562 Ga0436365_0231405
1563 Ga0436365_0886087
1564 Ga0436365_0950921
1565 Ga0436365_1025326
1566 Ga0436365_1905373
1567 Ga0436360_0615828
1568 Ga0436360_0968139
1569 Ga0436361_0167314
1570 Ga0436361_0255738
1571 Ga0436361_0267704
1572 Ga0436361_0518279
1573 Ga0436361_1162879
1574 Ga0436363_0131103
1575 Ga0436363_0321211
1576 Ga0436363_0374324
1577 Ga0436362_0094104
1578 Ga0436362_0612154
1579 Ga0439453_0004490
1580 Ga0451805_095853
1581 Ga0451833_1460930
1582 Ga0451835_0385845
1583 Ga0451837_1169820
1584 Ga0451839_0451938
1585 Ga0451849_0458272
1586 Ga0451851_1268568
1587 Ga0451853_1136400
1588 Ga0466969_0002233
1589 Ga0466966_0056152
1590 Ga0466963_0771825
1591 Ga0453684_0699765
1592 Ga0466970_0674981
1593 Ga0466959_0006744
1594 Ga0451576_0019143
1595 Ga0451576_0053894
1596 Ga0451576_0063312
1597 Ga0451576_0084312
1598 Ga0451576_0769944
1599 Ga0495603_0008704
1600 Ga0495603_0049670
1601 Ga0495603_0148308
1602 Ga0495629_0000135
1603 Ga0495629_0073224
1604 Ga0495629_0244872
1605 Ga0495641_0060246
1606 Ga0495580_0207078
1607 Ga0495582_0003175
1608 Ga0495639_0016135
1609 Ga0495639_0018159
1610 Ga0495639_0123115
1611 Ga0495639_0129828
1612 Ga0495662_0164501
1613 Ga0495664_0160760
1614 Ga0495584_0038545
1615 Ga0495584_0186754
1616 Ga0495594_0017289
1617 Ga0495594_0025974
1618 Ga0495618_0212342
1619 Ga0495663_0113445
1620 Ga0495663_0241367
1621 Ga0495666_0097499
1622 Ga0495642_0103092
1623 Ga0495642_0306074
1624 Ga0495640_0144845
1625 Ga0495640_0532580
1626 Ga0495586_0003499
1627 Ga0495609_0268653
1628 Ga0495621_0000739
1629 Ga0495621_0011335
1630 Ga0495621_0017974
1631 Ga0495621_0116140
1632 Ga0495621_0170598
1633 Ga0495622_0094839
1634 Ga0495633_0022606
1635 Ga0495656_0303296
1636 Ga0495634_0053446
1637 Ga0495634_0092333
1638 Ga0495635_0000492
1639 Ga0495659_0006415
1640 Ga0495659_0029806
1641 Ga0495659_0037917
1642 Ga0495659_0064149
1643 Ga0495659_0133661
1644 Ga0495659_0154754
1645 Ga0495588_0010901
1646 Ga0495588_0302697
1647 Ga0495623_0189138
1648 Ga0495647_0082536
1649 Ga0495658_0000006
1650 Ga0495658_0090758
1651 Ga0495613_0028445
1652 Ga0495670_0014898
1653 Ga0495600_0193367
1654 Ga0495581_0001720
1655 Ga0495581_0156921
1656 Ga0495636_0023125
1657 Ga0495676_0033928
1658 Ga0495676_0103789
1659 Ga0495676_0122238
1660 Ga0495676_0128714
1661 Ga0495680_0000476
1662 Ga0495680_0031741
1663 Ga0495680_0173851
1664 Ga0495675_0280716
1665 Ga0495685_028547
1666 Ga0495685_146690
1667 Ga0495684_0376861
1668 Ga0495593_0071601
1669 Ga0495614_0000534
1670 Ga0496100_0042585
1671 Ga0496101_0001671
1672 Ga0496102_1198215
1673 Ga0496104_0160431
1674 Ga0496104_0295760
1675 Ga0496104_0448031
1676 Ga0496105_0062310
1677 Ga0496105_0172314
1678 Ga0496105_0248382
1679 Ga0496106_0114463
1680 Ga0496106_0333106
1681 Ga0496108_0154579
1682 Ga0496108_0606002
1683 Ga0496114_0022830
1684 Ga0496114_0729484
1685 Ga0496115_0193747
1686 Ga0496126_0087502
1687 Ga0501291_003678
1688 Ga0501299_024419
1689 Ga0501031_0089839
1690 Ga0501031_0287052
1691 Ga0501033_0146503
1692 Ga0501036_0233707
1693 Ga0501037_0126689
1694 Ga0501037_0174099
1695 Ga0501038_0337895
1696 Ga0501039_0057316
1697 Ga0501040_0076086
1698 Ga0501040_0270990
1699 Ga0501041_0091332
1700 Ga0501041_0182552
1701 Ga0501042_0081696
1702 Ga0501043_0060356
1703 Ga0501046_0270269
1704 Ga0501047_0006062
1705 Ga0501047_0013013
1706 Ga0501048_0070543
1707 Ga0501048_0130864
1708 Ga0501048_0779590
1709 Ga0501048_0854332
1710 Ga0501067_0128155
1711 Ga0501068_0143128
1712 Ga0501068_0179157
1713 Ga0501069_0063530
1714 Ga0501071_0091157
1715 Ga0501071_0261480
1716 Ga0501072_0055942
1717 Ga0501072_0195765
1718 Ga0501073_0114097
1719 Ga0501075_0020187
1720 Ga0501075_0022155
1721 Ga0501075_0031049
1722 Ga0501076_0017743
1723 Ga0501076_0327606
1724 Ga0501077_0058546
1725 Ga0501077_0115051
1726 Ga0501079_0047627
1727 Ga0501079_0289262
1728 Ga0501080_0178054
1729 Ga0501081_0017979
1730 Ga0501081_0292303
1731 Ga0501035_0276946
1732 Ga0501044_0108097
1733 Ga0501045_0034423
1734 Ga0501045_0258018
1735 nmdc:mga00v17_235305_c1
1736 nmdc:mga0k408_102104_c1
1737 nmdc:mga0k408_510855_c1
1738 nmdc:mga0k408_554916_c1
1739 nmdc:mga06z11_206559_c1
1740 nmdc:mga05p37_106558_c1
1741 nmdc:mga05p37_211228_c2
1742 nmdc:mga05p37_272977_c1
1743 nmdc:mga05p37_28328_c1
1744 nmdc:mga05p37_2925_c1
1745 nmdc:mga05p37_353316_c1
1746 nmdc:mga05p37_414781_c1
1747 nmdc:mga05p37_565046_c1
1748 nmdc:mga05p37_705282_c1
1749 nmdc:mga05p37_863569_c1
1750 nmdc:mga09592_151218_c1
1751 nmdc:mga09592_17198_c1
1752 nmdc:mga09592_234439_c1
1753 nmdc:mga09592_2784_c1
1754 nmdc:mga09592_778727_c1
1755 nmdc:mga0qj67_128745_c1
1756 nmdc:mga0qj67_27291_c1
1757 nmdc:mga0qj67_304444_c1
1758 nmdc:mga0qj67_54277_c1
1759 nmdc:mga06r32_21839_c1
1760 nmdc:mga06r32_355153_c1
1761 nmdc:mga06r32_91981_c1
1762 nmdc:mga06r32_93134_c1
1763 nmdc:mga08y16_164291_c1
1764 nmdc:mga08y16_189167_c1
1765 nmdc:mga08y16_19719_c1
1766 nmdc:mga08y16_5837_c1
1767 nmdc:mga08y16_86233_c1
1768 nmdc:mga08y16_92450_c1
1769 nmdc:mga0n895_1156_c1
1770 nmdc:mga0n895_152373_c1
1771 nmdc:mga0n895_34160_c1
1772 nmdc:mga0n895_350734_c1
1773 nmdc:mga0n895_43995_c1
1774 nmdc:mga0n895_53093_c1
1775 nmdc:mga0n895_569655_c1
1776 nmdc:mga0n895_60233_c1
1777 nmdc:mga0n895_766704_c1
1778 nmdc:mga0rr50_48380_c1
1779 nmdc:mga0rr50_52856_c1
1780 nmdc:mga0rr50_54155_c1
1781 nmdc:mga0rr50_56856_c1
1782 nmdc:mga08x19_20808_c1
1783 nmdc:mga0a205_136355_c1
1784 nmdc:mga0a205_219126_c1
1785 nmdc:mga0a205_278685_c1
1786 nmdc:mga0a205_512191_c1
1787 nmdc:mga0a205_630_c1
1788 nmdc:mga0a205_631742_c1
1789 nmdc:mga0a205_802091_c1
1790 nmdc:mga0a205_81803_c1
1791 nmdc:mga0a205_9197_c1
1792 Ga0495595_0239523
1793 Ga0495619_0000696
1794 Ga0495619_0449840
1795 Ga0501084_0009345
1796 Ga0501084_0053463
1797 Ga0590071_009187
1798 Ga0501082_0030588
1799 Ga0501082_0171457
1800 Ga0501082_0672273
1801 Ga0530510_0001494
1802 Ga0530510_0034403
1803 Ga0530510_0049005
1804 2831428420
1805 2848697301
1806 2849668455
1807 2881249464
1808 2886634050
1809 2913912869
1810 8003152862

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00578

AhpC-TSA

AhpC/TSA family

51

177

0.91

PF08534

Redoxin

Redoxin

50

196

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3u5r-assembly1.cif.gz_E crystal structure of a hypothetical protein smc02350 from sinorhizobium meliloti 1021 0.9898 1 178
2ywi-assembly2.cif.gz_B crystal structure of uncharacterized conserved protein from geobacillus kaustophilus 0.9751 1 177
3u5r-assembly1.cif.gz_E crystal structure of a hypothetical protein smc02350 from sinorhizobium meliloti 1021 0.9577 1 178
2cvb-assembly1.cif.gz_A crystal structure of a thioredoxin-like protein from thermus thermophilus hb8 0.9474 2 182
2ywi-assembly2.cif.gz_B crystal structure of uncharacterized conserved protein from geobacillus kaustophilus 0.9095 1 177
ID Description Score Start End Superfamily
af_I1KAL3_50_244_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9793 1 178 3.40.30.10
af_P71990_1_182_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9784 1 176 3.40.30.10
2ywoA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9468 2 182 3.40.30.10
af_P71990_1_182_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9414 1 176 3.40.30.10
1st9A00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9388 5 129 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A8B3LJJ8-F1-model_v4 Thioredoxin family protein 0.9962 23 183 GO:0016491
AF-A0A3D9T831-F1-model_v4 AhpC/TSA family protein 0.9951 1 181 GO:0016209
GO:0016491
AF-A0A3S1YF74-F1-model_v4 Thioredoxin family protein 0.9949 34 183 GO:0016491
AF-A0A2S8TX47-F1-model_v4 deleted 0.9947 1 184
AF-A0A5C6DX65-F1-model_v4 Putative peroxiredoxin (EC 1.11.1.15) 0.993 1 183 GO:0004601

Map