F485241

General Info

Members Datasets Scaffolds Average Seq Length
903 381 1806 119

Family's Representative Sequence

Representative Sequence 3300009553|Ga0105249_10574164|Ga0105249_105741642
Length 141
Sequence MGYLTRWFYTMPVDRLSTTFSALADPTRRAILARLALGETSVTELAEPFAMSMPAVSKHLKVLERAGLITRGREAQWRPCRIDAQALKPVDEWLENYRRLWEERFDRLEVYLRELQAEDGSRSGGKRVSRNAREKKRGRKK

Samples

Sample ID Description Type Environment
1 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
7 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
8 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
9 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
10 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
11 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
12 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
13 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
14 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
15 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
16 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
28 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
29 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
40 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
41 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
42 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
43 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
44 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
45 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
46 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
47 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
48 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
49 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
50 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
51 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
52 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
53 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
54 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
55 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
56 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
57 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
58 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
59 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
60 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
61 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
62 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
63 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
64 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
65 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
66 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
67 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
68 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
69 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
70 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
71 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
72 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
73 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
74 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
75 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
76 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
77 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
78 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
79 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
80 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
81 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
82 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
83 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
84 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
85 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
86 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
87 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
88 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
89 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
90 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
91 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
92 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
93 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
94 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
95 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
96 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
97 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
98 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
99 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
100 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
101 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
102 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
103 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
104 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
105 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
106 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
107 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
108 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
109 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
110 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
111 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
112 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
113 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
114 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
115 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
116 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
117 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
118 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
119 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
120 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
121 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
122 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
123 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
124 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
125 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
126 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
127 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
128 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
129 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
130 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
131 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
132 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
133 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
134 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
135 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
136 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
137 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
138 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
139 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
140 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
141 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
142 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
143 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
144 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
145 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
146 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
147 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
148 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
149 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
150 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
151 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
152 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
153 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
215 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
216 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
220 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
221 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
222 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
223 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
224 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
225 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
226 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
227 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
228 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
229 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
230 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
231 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
232 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
233 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
234 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
235 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
236 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
237 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
238 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
239 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
240 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
241 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
242 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
243 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
244 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
245 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
246 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
247 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
248 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
249 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
250 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
251 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
252 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
253 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
254 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
255 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
256 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
257 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
258 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
259 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
260 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
261 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
262 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
263 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
264 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
265 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
266 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
267 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
268 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
269 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
270 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
271 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
272 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
273 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
274 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
275 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
276 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
277 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
278 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
279 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
280 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
281 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
282 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
283 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
284 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
285 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
286 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
287 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
288 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
289 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
290 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
291 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
292 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
293 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
294 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
295 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
296 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
297 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
298 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
299 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
300 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
301 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
302 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
303 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
304 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
305 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
306 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
307 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
308 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
309 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
310 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
311 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
312 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
313 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
314 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
315 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
316 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
317 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
318 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
319 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
320 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
321 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
322 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
323 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
324 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
325 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
326 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
327 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
328 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
329 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
330 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
331 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
332 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
333 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
334 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
335 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
336 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
337 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
338 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
339 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
340 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
341 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
342 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
343 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
344 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
345 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
346 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
347 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
348 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
349 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
350 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
351 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
352 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
353 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
354 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
355 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
356 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
357 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
358 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
359 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
360 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
361 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
362 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
363 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
364 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
365 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
366 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
367 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
368 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
369 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
370 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
371 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
372 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
373 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
374 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
375 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
376 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
377 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
378 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
379 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
380 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
381 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.89
Metatranscriptomes 0.11
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.42
Nodule 0
Rhizoplane 7.53
Rhizosphere 80.29
Stem 0
Stem Tuber 0
Unclassified 3.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105249_10574164 3300009553 Bacteria 1180
2 JGI24743J22301_10035802 3300001991 Bacteria 987
3 JGI24738J21930_10034282 3300002075 Bacteria 1034
4 JGI24744J21845_10032240 3300002077 Bacteria 1000
5 JGI24744J21845_10113249 3300002077 Bacteria 504
6 JGI24751J29686_10044588 3300002459 Bacteria 916
7 JGI25152J39213_1005884 3300002773 Bacteria 3468
8 JGI25151J46595_10000072 3300003187 Bacteria 136769
9 JGI25406J46586_10004307 3300003203 Bacteria 6642
10 JGI25406J46586_10021166 3300003203 Bacteria 2615
11 JGI25165J46597_1032491 3300003214 Bacteria 672
12 JGI25153J46596_10014785 3300003215 Bacteria 3223
13 rootH2_10176863 3300003320 Bacteria 1395
14 JGI25160J50197_1076211 3300003354 Bacteria 631
15 Ga0055526_1002917 3300003771 Bacteria 11237
16 Ga0055528_1006856 3300003790 Bacteria 5115
17 Ga0055540_1005427 3300003792 Bacteria 5359
18 Ga0065165_1116946 3300005262 Bacteria 650
19 Ga0070676_11075693 3300005328 Bacteria 607
20 Ga0070683_100262573 3300005329 Bacteria 1643
21 Ga0070683_100835609 3300005329 Bacteria 883
22 Ga0070683_101154649 3300005329 Bacteria 744
23 Ga0070690_100737925 3300005330 Bacteria 759
24 Ga0070670_100063230 3300005331 Bacteria 3176
25 Ga0070670_100694654 3300005331 Bacteria 915
26 Ga0070670_100853162 3300005331 Bacteria 824
27 Ga0068869_100503442 3300005334 Bacteria 1011
28 Ga0068869_100913078 3300005334 Bacteria 760
29 Ga0070666_10161118 3300005335 Bacteria 1568
30 Ga0070680_100201860 3300005336 Bacteria 1677
31 Ga0070680_101211830 3300005336 Bacteria 653
32 Ga0070682_100517008 3300005337 Bacteria 928
33 Ga0068868_100014282 3300005338 Bacteria 5850
34 Ga0068868_100026632 3300005338 Bacteria 4409
35 Ga0068868_100108394 3300005338 Bacteria 2254
36 Ga0070689_100230054 3300005340 Bacteria 1524
37 Ga0070689_100308305 3300005340 Bacteria 1319
38 Ga0070691_10387331 3300005341 Bacteria 785
39 Ga0070691_10565902 3300005341 Bacteria 666
40 Ga0070687_100058531 3300005343 Bacteria 2025
41 Ga0070687_100226901 3300005343 Bacteria 1147
42 Ga0070692_10073570 3300005345 Bacteria 1826
43 Ga0070692_10213264 3300005345 Bacteria 1137
44 Ga0070668_100095666 3300005347 Bacteria 2346
45 Ga0070668_100462437 3300005347 Bacteria 1093
46 Ga0070668_100483055 3300005347 Bacteria 1070
47 Ga0070668_100726371 3300005347 Bacteria 878
48 Ga0070668_101952978 3300005347 Bacteria 541
49 Ga0070669_100008734 3300005353 Bacteria 7229
50 Ga0070669_100122377 3300005353 Bacteria 1987
51 Ga0070669_100351066 3300005353 Bacteria 1197
52 Ga0070675_100001709 3300005354 Bacteria 16206
53 Ga0070675_100007238 3300005354 Bacteria 8558
54 Ga0070675_100285378 3300005354 Bacteria 1452
55 Ga0070675_100387831 3300005354 Bacteria 1244
56 Ga0070675_101128369 3300005354 Bacteria 721
57 Ga0070671_100017707 3300005355 Bacteria 5774
58 Ga0070674_100005254 3300005356 Bacteria 7456
59 Ga0070674_100032868 3300005356 Bacteria 3448
60 Ga0070674_100105659 3300005356 Bacteria 2059
61 Ga0070674_100380969 3300005356 Bacteria 1147
62 Ga0070674_100892758 3300005356 Bacteria 774
63 Ga0070673_100320919 3300005364 Bacteria 1368
64 Ga0070688_100212990 3300005365 Bacteria 1358
65 Ga0070659_100651084 3300005366 Bacteria 908
66 Ga0070659_101965991 3300005366 Bacteria 525
67 Ga0070667_100014940 3300005367 Bacteria 6414
68 Ga0070703_10451157 3300005406 Unclassified 570
69 Ga0070709_10611977 3300005434 Bacteria 840
70 Ga0070713_100795993 3300005436 Bacteria 906
71 Ga0070701_10026478 3300005438 Bacteria 2829
72 Ga0070701_10121320 3300005438 Unclassified 1473
73 Ga0070701_10404315 3300005438 Bacteria 866
74 Ga0070711_100547687 3300005439 Bacteria 959
75 Ga0070705_100344620 3300005440 Bacteria 1084
76 Ga0070705_101052305 3300005440 Bacteria 663
77 Ga0070700_100044114 3300005441 Bacteria 2745
78 Ga0070700_100152967 3300005441 Bacteria 1580
79 Ga0070700_100707279 3300005441 Bacteria 802
80 Ga0070700_100727299 3300005441 Bacteria 792
81 Ga0070708_100162546 3300005445 Bacteria 2081
82 Ga0070708_100309521 3300005445 Bacteria 1488
83 Ga0070708_101714544 3300005445 Bacteria 584
84 Ga0070663_100023340 3300005455 Bacteria 4145
85 Ga0070663_100618980 3300005455 Bacteria 912
86 Ga0070678_100048978 3300005456 Bacteria 3047
87 Ga0070678_100079711 3300005456 Bacteria 2478
88 Ga0070678_100137148 3300005456 Bacteria 1952
89 Ga0070662_100090357 3300005457 Unclassified 2298
90 Ga0070662_100431225 3300005457 Bacteria 1092
91 Ga0070662_100449131 3300005457 Bacteria 1070
92 Ga0070681_10169674 3300005458 Bacteria 2104
93 Ga0070681_10651727 3300005458 Bacteria 968
94 Ga0068867_100018670 3300005459 Bacteria 4930
95 Ga0068867_100023816 3300005459 Bacteria 4385
96 Ga0068867_100039810 3300005459 Bacteria 3428
97 Ga0068867_100132901 3300005459 Bacteria 1936
98 Ga0068867_100304601 3300005459 Bacteria 1315
99 Ga0068867_101021772 3300005459 Bacteria 751
100 Ga0068867_101043100 3300005459 Bacteria 743
101 Ga0068867_101487789 3300005459 Bacteria 630
102 Ga0070706_100381663 3300005467 Bacteria 1312
103 Ga0070707_100225561 3300005468 Bacteria 1824
104 Ga0070698_100699642 3300005471 Bacteria 955
105 Ga0070698_101036731 3300005471 Bacteria 768
106 Ga0070698_101051637 3300005471 Bacteria 762
107 Ga0070699_100767441 3300005518 Bacteria 882
108 Ga0070699_101993754 3300005518 Bacteria 531
109 Ga0070684_100026085 3300005535 Bacteria 4919
110 Ga0070684_100669054 3300005535 Bacteria 967
111 Ga0070684_100771641 3300005535 Bacteria 898
112 Ga0070684_101163666 3300005535 Bacteria 725
113 Ga0070697_100128418 3300005536 Bacteria 2124
114 Ga0070697_100802533 3300005536 Bacteria 833
115 Ga0068853_100041079 3300005539 Bacteria 3949
116 Ga0068853_100578273 3300005539 Bacteria 1066
117 Ga0070672_100073439 3300005543 Bacteria 2726
118 Ga0070686_100011385 3300005544 Bacteria 5045
119 Ga0070686_100079725 3300005544 Bacteria 2165
120 Ga0070686_100166723 3300005544 Unclassified 1555
121 Ga0070686_100427847 3300005544 Bacteria 1013
122 Ga0070686_100758014 3300005544 Bacteria 779
123 Ga0070695_100022717 3300005545 Bacteria 3850
124 Ga0070695_100179920 3300005545 Bacteria 1497
125 Ga0070696_100004721 3300005546 Bacteria 9112
126 Ga0070696_100166435 3300005546 Bacteria 1627
127 Ga0070665_100483887 3300005548 Bacteria 1248
128 Ga0070704_100011186 3300005549 Bacteria 5490
129 Ga0070704_100248675 3300005549 Bacteria 1459
130 Ga0070704_101296619 3300005549 Bacteria 666
131 Ga0070704_101725182 3300005549 Bacteria 579
132 Ga0068855_100007679 3300005563 Bacteria 13030
133 Ga0070664_100089122 3300005564 Bacteria 2669
134 Ga0070664_101212027 3300005564 Bacteria 712
135 Ga0068857_100241334 3300005577 Bacteria 1654
136 Ga0068854_100011182 3300005578 Bacteria 5832
137 Ga0068854_100299707 3300005578 Unclassified 1300
138 Ga0068854_100328426 3300005578 Bacteria 1245
139 Ga0068856_100001927 3300005614 Bacteria 21632
140 Ga0068856_100293492 3300005614 Bacteria 1643
141 Ga0068856_100722212 3300005614 Bacteria 1016
142 Ga0070702_100041605 3300005615 Bacteria 2579
143 Ga0070702_100123414 3300005615 Bacteria 1625
144 Ga0070702_100581729 3300005615 Bacteria 836
145 Ga0068852_100022289 3300005616 Bacteria 5077
146 Ga0068852_100211773 3300005616 Unclassified 1839
147 Ga0068859_100003226 3300005617 Bacteria 16604
148 Ga0068859_100053585 3300005617 Bacteria 4057
149 Ga0068859_100288371 3300005617 Unclassified 1734
150 Ga0068859_100673651 3300005617 Bacteria 1126
151 Ga0068859_100832690 3300005617 Bacteria 1009
152 Ga0068864_100055818 3300005618 Bacteria 3411
153 Ga0068864_100099195 3300005618 Bacteria 2580
154 Ga0068864_100205735 3300005618 Bacteria 1810
155 Ga0068866_10002402 3300005718 Bacteria 7744
156 Ga0068866_10018393 3300005718 Bacteria 3160
157 Ga0068866_10063690 3300005718 Unclassified 1923
158 Ga0068866_10121288 3300005718 Bacteria 1474
159 Ga0068866_10508985 3300005718 Bacteria 798
160 Ga0068861_100015511 3300005719 Bacteria 5371
161 Ga0068861_101708029 3300005719 Bacteria 623
162 Ga0068861_101947188 3300005719 Bacteria 585
163 Ga0068851_10127365 3300005834 Unclassified 1374
164 Ga0068851_10598947 3300005834 Bacteria 670
165 Ga0068870_10012931 3300005840 Bacteria 3911
166 Ga0068870_10406458 3300005840 Bacteria 887
167 Ga0068863_100284722 3300005841 Bacteria 1602
168 Ga0068863_100420183 3300005841 Bacteria 1310
169 Ga0068863_101091274 3300005841 Bacteria 802
170 Ga0068863_101832819 3300005841 Bacteria 616
171 Ga0068858_100003199 3300005842 Bacteria 16359
172 Ga0068858_100060728 3300005842 Unclassified 3494
173 Ga0068858_100522788 3300005842 Bacteria 1148
174 Ga0068860_100045203 3300005843 Bacteria 4198
175 Ga0068860_100075102 3300005843 Unclassified 3215
176 Ga0068860_101035736 3300005843 Bacteria 839
177 Ga0068860_102034347 3300005843 Bacteria 596
178 Ga0068862_100034384 3300005844 Bacteria 4288
179 Ga0068862_100229964 3300005844 Bacteria 1682
180 Ga0068862_100855986 3300005844 Bacteria 891
181 Ga0081455_10000861 3300005937 Bacteria 39120
182 Ga0081455_10253371 3300005937 Bacteria 1286
183 Ga0081538_10031288 3300005981 Bacteria 3593
184 Ga0081539_10000170 3300005985 Bacteria 152854
185 Ga0081539_10005432 3300005985 Bacteria 13008
186 Ga0070717_10203228 3300006028 Bacteria 1736
187 Ga0075365_10847455 3300006038 Bacteria 645
188 Ga0075365_10889982 3300006038 Bacteria 628
189 Ga0075368_10010950 3300006042 Bacteria 3290
190 Ga0075368_10087749 3300006042 Bacteria 1270
191 Ga0075363_100168194 3300006048 Bacteria 1244
192 Ga0075363_100309376 3300006048 Bacteria 918
193 Ga0075364_10012038 3300006051 Bacteria 5276
194 Ga0075364_10393273 3300006051 Bacteria 946
195 Ga0075432_10000721 3300006058 Bacteria 10203
196 Ga0070715_10049814 3300006163 Bacteria 1796
197 Ga0070716_101067806 3300006173 Archaea 642
198 Ga0070712_100262277 3300006175 Bacteria 1385
199 Ga0070712_100308030 3300006175 Bacteria 1284
200 Ga0075362_10160836 3300006177 Bacteria 1081
201 Ga0075367_10006983 3300006178 Bacteria 5750
202 Ga0075367_10012500 3300006178 Bacteria 4531
203 Ga0075367_10062237 3300006178 Bacteria 2228
204 Ga0075369_10023013 3300006186 Bacteria 2573
205 Ga0075369_10086268 3300006186 Bacteria 1397
206 Ga0075369_10352497 3300006186 Bacteria 691
207 Ga0075366_10247967 3300006195 Bacteria 1086
208 Ga0075366_11007741 3300006195 Bacteria 520
209 Ga0097621_100000526 3300006237 Bacteria 26837
210 Ga0097621_100182438 3300006237 Bacteria 1814
211 Ga0097621_100522449 3300006237 Bacteria 1078
212 Ga0068871_100000606 3300006358 Bacteria 24637
213 Ga0068871_100099395 3300006358 Bacteria 2436
214 Ga0068871_100154071 3300006358 Bacteria 1961
215 Ga0075428_100026330 3300006844 Bacteria 6438
216 Ga0075428_100195806 3300006844 Bacteria 2185
217 Ga0075428_100381229 3300006844 Bacteria 1512
218 Ga0075428_100501680 3300006844 Bacteria 1298
219 Ga0075428_100868259 3300006844 Bacteria 958
220 Ga0075430_100023627 3300006846 Bacteria 5234
221 Ga0075430_100218830 3300006846 Bacteria 1580
222 Ga0075430_100274345 3300006846 Bacteria 1395
223 Ga0075430_100728518 3300006846 Bacteria 817
224 Ga0075431_100091689 3300006847 Bacteria 3136
225 Ga0075431_100153200 3300006847 Bacteria 2373
226 Ga0075431_100358554 3300006847 Bacteria 1465
227 Ga0075431_100784891 3300006847 Bacteria 926
228 Ga0075431_100831225 3300006847 Bacteria 896
229 Ga0075433_10004624 3300006852 Bacteria 10738
230 Ga0075433_10616062 3300006852 Bacteria 952
231 Ga0075433_11148971 3300006852 Bacteria 675
232 Ga0075434_100094791 3300006871 Bacteria 2990
233 Ga0075429_100003072 3300006880 Bacteria 14154
234 Ga0075429_100036324 3300006880 Bacteria 4285
235 Ga0075429_100086891 3300006880 Bacteria 2725
236 Ga0075429_100344942 3300006880 Bacteria 1304
237 Ga0068865_100009215 3300006881 Bacteria 6112
238 Ga0068865_100013057 3300006881 Bacteria 5239
239 Ga0068865_100085425 3300006881 Bacteria 2276
240 Ga0068865_100112555 3300006881 Bacteria 2011
241 Ga0068865_100131237 3300006881 Bacteria 1877
242 Ga0068865_101499882 3300006881 Bacteria 604
243 Ga0075436_100003921 3300006914 Bacteria 10196
244 Ga0075436_100175889 3300006914 Unclassified 1512
245 Ga0097620_100003226 3300006931 Bacteria 16604
246 Ga0097620_100053587 3300006931 Bacteria 4057
247 Ga0097620_100288380 3300006931 Unclassified 1734
248 Ga0097620_100673623 3300006931 Bacteria 1126
249 Ga0097620_100794126 3300006931 Bacteria 1034
250 Ga0097620_100832747 3300006931 Bacteria 1009
251 Ga0097620_100989871 3300006931 Bacteria 923
252 Ga0075435_100008934 3300007076 Bacteria 7223
253 Ga0075435_100289561 3300007076 Bacteria 1399
254 Ga0099794_10272694 3300007265 Bacteria 874
255 Ga0099795_10084327 3300007788 Bacteria 1221
256 Ga0105240_10000024 3300009093 Bacteria 375919
257 Ga0105240_10000931 3300009093 Bacteria 52113
258 Ga0105240_10029937 3300009093 Bacteria 7084
259 Ga0105240_10259156 3300009093 Bacteria 2007
260 Ga0111539_10000267 3300009094 Bacteria 62144
261 Ga0111539_10004381 3300009094 Bacteria 18469
262 Ga0111539_10013014 3300009094 Bacteria 10410
263 Ga0111539_10063769 3300009094 Bacteria 4360
264 Ga0111539_10085474 3300009094 Bacteria 3707
265 Ga0111539_11183014 3300009094 Bacteria 888
266 Ga0111539_11599520 3300009094 Bacteria 756
267 Ga0105245_10040254 3300009098 Bacteria 4162
268 Ga0105245_10083031 3300009098 Bacteria 2932
269 Ga0105245_10315924 3300009098 Bacteria 1537
270 Ga0105245_10518628 3300009098 Bacteria 1210
271 Ga0105245_11164984 3300009098 Bacteria 818
272 Ga0105247_10032054 3300009101 Bacteria 3192
273 Ga0105247_10242186 3300009101 Bacteria 1229
274 Ga0105247_11140761 3300009101 Bacteria 617
275 Ga0114129_10056554 3300009147 Bacteria 5494
276 Ga0114129_10069655 3300009147 Bacteria 4903
277 Ga0114129_10130560 3300009147 Bacteria 3451
278 Ga0114129_10438060 3300009147 Bacteria 1716
279 Ga0114129_10556348 3300009147 Bacteria 1491
280 Ga0114129_10764027 3300009147 Bacteria 1236
281 Ga0114129_11258224 3300009147 Bacteria 919
282 Ga0114129_11320940 3300009147 Unclassified 893
283 Ga0114129_12915392 3300009147 Bacteria 565
284 Ga0105243_10014856 3300009148 Bacteria 5891
285 Ga0105243_10036128 3300009148 Bacteria 3833
286 Ga0105243_10036834 3300009148 Bacteria 3799
287 Ga0105243_11226159 3300009148 Bacteria 764
288 Ga0105243_11790472 3300009148 Bacteria 645
289 Ga0105243_12673717 3300009148 Bacteria 539
290 Ga0105241_10042510 3300009174 Bacteria 3438
291 Ga0105241_10229619 3300009174 Unclassified 1564
292 Ga0105241_10838835 3300009174 Bacteria 849
293 Ga0105241_10980425 3300009174 Bacteria 789
294 Ga0105242_10020707 3300009176 Bacteria 5158
295 Ga0105242_10518323 3300009176 Bacteria 1137
296 Ga0105242_10665963 3300009176 Bacteria 1014
297 Ga0105242_12242143 3300009176 Bacteria 592
298 Ga0105242_12758087 3300009176 Bacteria 541
299 Ga0105248_10006300 3300009177 Bacteria 13020
300 Ga0105248_10008521 3300009177 Bacteria 11257
301 Ga0105248_10124520 3300009177 Bacteria 2907
302 Ga0105248_10169323 3300009177 Bacteria 2462
303 Ga0105248_10205496 3300009177 Bacteria 2219
304 Ga0105248_11233391 3300009177 Bacteria 846
305 Ga0105237_10000538 3300009545 Bacteria 53474
306 Ga0105237_10014774 3300009545 Bacteria 8149
307 Ga0105237_11353890 3300009545 Bacteria 718
308 Ga0105237_12323085 3300009545 Bacteria 546
309 Ga0105238_10001033 3300009551 Bacteria 28272
310 Ga0105238_10086435 3300009551 Bacteria 3124
311 Ga0105238_10234949 3300009551 Bacteria 1810
312 Ga0105238_10287290 3300009551 Bacteria 1627
313 Ga0105238_10437129 3300009551 Bacteria 1304
314 Ga0105238_10489272 3300009551 Bacteria 1230
315 Ga0105238_11315580 3300009551 Bacteria 749
316 Ga0105238_11649146 3300009551 Bacteria 672
317 Ga0105249_10096265 3300009553 Bacteria 2777
318 Ga0105249_11998657 3300009553 Bacteria 652
319 Ga0105249_12337606 3300009553 Bacteria 607
320 Ga0105032_100608 3300009979 Bacteria 3500
321 Ga0099796_10067518 3300010159 Bacteria 1283
322 Ga0105239_10006401 3300010375 Bacteria 13673
323 Ga0105239_10009580 3300010375 Bacteria 10897
324 Ga0105239_10011824 3300010375 Bacteria 9740
325 Ga0105239_10709322 3300010375 Bacteria 1150
326 Ga0105239_11086297 3300010375 Bacteria 921
327 Ga0105239_11251413 3300010375 Bacteria 856
328 Ga0105246_10106220 3300011119 Bacteria 2053
329 Ga0105246_10112426 3300011119 Bacteria 2003
330 Ga0105246_10276145 3300011119 Bacteria 1346
331 Ga0105246_10440277 3300011119 Bacteria 1093
332 Ga0105246_11186552 3300011119 Bacteria 702
333 Ga0157371_11356400 3300013102 Bacteria 551
334 Ga0157370_10000236 3300013104 Bacteria 70330
335 Ga0157370_10813643 3300013104 Bacteria 850
336 Ga0157369_10168826 3300013105 Bacteria 2306
337 Ga0157369_10304643 3300013105 Bacteria 1657
338 Ga0157374_10001116 3300013296 Bacteria 23067
339 Ga0157374_10009543 3300013296 Bacteria 8334
340 Ga0157378_10000055 3300013297 Bacteria 97875
341 Ga0157378_10023745 3300013297 Bacteria 5395
342 Ga0157378_10100308 3300013297 Bacteria 2643
343 Ga0157378_10114074 3300013297 Unclassified 2482
344 Ga0157378_10529040 3300013297 Bacteria 1181
345 Ga0157378_10763343 3300013297 Bacteria 991
346 Ga0157378_10781134 3300013297 Bacteria 980
347 Ga0157378_10973306 3300013297 Bacteria 882
348 Ga0157378_11898442 3300013297 Bacteria 645
349 Ga0157378_12178762 3300013297 Bacteria 605
350 Ga0163162_10017312 3300013306 Bacteria 7051
351 Ga0163162_10493646 3300013306 Bacteria 1355
352 Ga0157372_10000778 3300013307 Bacteria 34511
353 Ga0157372_10230342 3300013307 Bacteria 2148
354 Ga0157372_10254711 3300013307 Bacteria 2038
355 Ga0157372_10945023 3300013307 Bacteria 999
356 Ga0157372_11043405 3300013307 Bacteria 946
357 Ga0157372_11811624 3300013307 Bacteria 702
358 Ga0157375_10053907 3300013308 Bacteria 3959
359 Ga0157375_10877522 3300013308 Bacteria 1042
360 Ga0157375_10889328 3300013308 Bacteria 1035
361 Ga0157375_10981921 3300013308 Bacteria 985
362 Ga0157375_12221727 3300013308 Bacteria 654
363 Ga0163163_10004214 3300014325 Bacteria 12257
364 Ga0163163_10415727 3300014325 Bacteria 1403
365 Ga0163163_10587149 3300014325 Unclassified 1177
366 Ga0163163_10745016 3300014325 Bacteria 1043
367 Ga0163163_13062968 3300014325 Bacteria 521
368 Ga0157380_10011196 3300014326 Bacteria 6474
369 Ga0157380_10032759 3300014326 Bacteria 3999
370 Ga0157380_10034150 3300014326 Bacteria 3922
371 Ga0157380_10189708 3300014326 Bacteria 1813
372 Ga0157380_10447913 3300014326 Bacteria 1239
373 Ga0157380_10450665 3300014326 Bacteria 1236
374 Ga0182008_10097717 3300014497 Bacteria 1449
375 Ga0157377_10008482 3300014745 Bacteria 5014
376 Ga0157379_10035304 3300014968 Bacteria 4458
377 Ga0157379_10306887 3300014968 Bacteria 1447
378 Ga0157379_10540798 3300014968 Bacteria 1083
379 Ga0157379_10907327 3300014968 Bacteria 836
380 Ga0157376_10108691 3300014969 Bacteria 2437
381 Ga0157376_10337434 3300014969 Bacteria 1438
382 Ga0157376_10606335 3300014969 Bacteria 1090
383 Ga0157376_10771696 3300014969 Bacteria 972
384 Ga0157376_11298168 3300014969 Bacteria 758
385 Ga0157376_11733701 3300014969 Bacteria 660
386 Ga0157376_12262547 3300014969 Bacteria 583
387 Ga0182007_10011139 3300015262 Bacteria 3511
388 Ga0182005_1007030 3300015265 Bacteria 3400
389 Ga0163161_10215538 3300017792 Bacteria 1484
390 Ga0163161_10273473 3300017792 Bacteria 1323
391 Ga0163161_10367510 3300017792 Bacteria 1147
392 Ga0163161_10878128 3300017792 Bacteria 758
393 Ga0163161_11032092 3300017792 Bacteria 703
394 Ga0206350_11235408 3300020080 Bacteria 1374
395 Ga0209129_1007024 3300025258 Bacteria 3461
396 Ga0209233_1014105 3300025261 Bacteria 2262
397 Ga0209673_1002671 3300025273 Bacteria 11890
398 Ga0209130_1082060 3300025284 Bacteria 518
399 Ga0209025_1000063 3300025294 Bacteria 303962
400 Ga0209025_1108900 3300025294 Bacteria 856
401 Ga0209564_1001099 3300025295 Bacteria 32101
402 Ga0209758_1000438 3300025297 Bacteria 70094
403 Ga0209758_1004601 3300025297 Bacteria 11338
404 Ga0209758_1015358 3300025297 Bacteria 3973
405 Ga0209758_1109484 3300025297 Bacteria 767
406 Ga0209256_1009989 3300025299 Bacteria 4060
407 Ga0209051_1052633 3300025303 Bacteria 1343
408 Ga0207697_10353581 3300025315 Bacteria 652
409 Ga0207656_10099604 3300025321 Bacteria 1331
410 Ga0207656_10112698 3300025321 Bacteria 1259
411 Ga0207653_10077162 3300025885 Bacteria 1147
412 Ga0207642_10017266 3300025899 Bacteria 2740
413 Ga0207642_10051486 3300025899 Bacteria 1863
414 Ga0207642_10078677 3300025899 Bacteria 1594
415 Ga0207642_10124007 3300025899 Unclassified 1337
416 Ga0207710_10005872 3300025900 Bacteria 5265
417 Ga0207710_10701138 3300025900 Bacteria 531
418 Ga0207688_10004185 3300025901 Bacteria 7864
419 Ga0207680_10169146 3300025903 Bacteria 1471
420 Ga0207645_10186918 3300025907 Bacteria 1360
421 Ga0207643_10000650 3300025908 Bacteria 21685
422 Ga0207705_11391259 3300025909 Unclassified 534
423 Ga0207684_10021939 3300025910 Bacteria 5453
424 Ga0207654_10316866 3300025911 Bacteria 1065
425 Ga0207707_10290653 3300025912 Bacteria 1414
426 Ga0207707_11523255 3300025912 Bacteria 529
427 Ga0207695_10000007 3300025913 Bacteria 1092551
428 Ga0207695_10547160 3300025913 Bacteria 1039
429 Ga0207671_10053773 3300025914 Bacteria 2984
430 Ga0207671_10191788 3300025914 Bacteria 1594
431 Ga0207671_10933253 3300025914 Bacteria 685
432 Ga0207693_10197883 3300025915 Bacteria 1580
433 Ga0207660_10574954 3300025917 Bacteria 917
434 Ga0207660_10828765 3300025917 Bacteria 755
435 Ga0207662_10001102 3300025918 Bacteria 12692
436 Ga0207662_10052706 3300025918 Bacteria 2421
437 Ga0207662_10083157 3300025918 Bacteria 1956
438 Ga0207657_10385936 3300025919 Bacteria 1102
439 Ga0207657_10494601 3300025919 Bacteria 958
440 Ga0207652_10334344 3300025921 Unclassified 1368
441 Ga0207646_10006392 3300025922 Bacteria 12185
442 Ga0207646_10208330 3300025922 Bacteria 1765
443 Ga0207681_10049852 3300025923 Bacteria 2831
444 Ga0207681_10153523 3300025923 Bacteria 1728
445 Ga0207681_10425987 3300025923 Bacteria 1076
446 Ga0207681_10522727 3300025923 Bacteria 974
447 Ga0207694_10006772 3300025924 Bacteria 8701
448 Ga0207694_10096488 3300025924 Bacteria 2338
449 Ga0207694_10303718 3300025924 Bacteria 1314
450 Ga0207694_11049720 3300025924 Bacteria 690
451 Ga0207694_11122602 3300025924 Bacteria 665
452 Ga0207650_10006377 3300025925 Bacteria 8034
453 Ga0207650_10322959 3300025925 Bacteria 1264
454 Ga0207650_10936863 3300025925 Bacteria 736
455 Ga0207659_10004631 3300025926 Bacteria 8327
456 Ga0207659_10009599 3300025926 Bacteria 6053
457 Ga0207659_10155096 3300025926 Bacteria 1792
458 Ga0207659_10187039 3300025926 Bacteria 1645
459 Ga0207659_10301066 3300025926 Bacteria 1317
460 Ga0207687_10037527 3300025927 Bacteria 3306
461 Ga0207687_10145711 3300025927 Bacteria 1801
462 Ga0207687_10804939 3300025927 Bacteria 802
463 Ga0207700_11463407 3300025928 Bacteria 606
464 Ga0207644_10152124 3300025931 Bacteria 1791
465 Ga0207690_10703595 3300025932 Bacteria 831
466 Ga0207706_10016957 3300025933 Bacteria 6570
467 Ga0207706_10163862 3300025933 Bacteria 1954
468 Ga0207686_10021261 3300025934 Bacteria 3721
469 Ga0207686_10722666 3300025934 Bacteria 793
470 Ga0207686_10805219 3300025934 Bacteria 753
471 Ga0207709_10320914 3300025935 Bacteria 1159
472 Ga0207709_10398307 3300025935 Bacteria 1052
473 Ga0207670_10382306 3300025936 Bacteria 1122
474 Ga0207670_10427789 3300025936 Bacteria 1063
475 Ga0207670_10525005 3300025936 Bacteria 964
476 Ga0207670_10575298 3300025936 Bacteria 923
477 Ga0207669_10067522 3300025937 Bacteria 2229
478 Ga0207669_10159591 3300025937 Bacteria 1591
479 Ga0207669_10370958 3300025937 Bacteria 1112
480 Ga0207669_10397303 3300025937 Bacteria 1079
481 Ga0207704_10012565 3300025938 Bacteria 4206
482 Ga0207704_10014706 3300025938 Bacteria 3962
483 Ga0207704_10031868 3300025938 Bacteria 2975
484 Ga0207704_10084472 3300025938 Bacteria 2063
485 Ga0207704_10139727 3300025938 Unclassified 1692
486 Ga0207704_11069959 3300025938 Bacteria 684
487 Ga0207704_11075986 3300025938 Bacteria 683
488 Ga0207665_10180800 3300025939 Bacteria 1527
489 Ga0207691_10144521 3300025940 Bacteria 2094
490 Ga0207691_10178069 3300025940 Bacteria 1859
491 Ga0207691_10186475 3300025940 Bacteria 1811
492 Ga0207691_10572869 3300025940 Bacteria 957
493 Ga0207711_10005116 3300025941 Bacteria 11117
494 Ga0207711_10050170 3300025941 Bacteria 3572
495 Ga0207711_11136012 3300025941 Bacteria 722
496 Ga0207711_11256108 3300025941 Bacteria 682
497 Ga0207689_10006481 3300025942 Bacteria 10340
498 Ga0207689_10696700 3300025942 Bacteria 856
499 Ga0207661_10073819 3300025944 Unclassified 2795
500 Ga0207661_10563439 3300025944 Bacteria 1044
501 Ga0207679_10051208 3300025945 Bacteria 3022
502 Ga0207679_10503947 3300025945 Bacteria 1081
503 Ga0207679_11123560 3300025945 Bacteria 721
504 Ga0207667_10028330 3300025949 Bacteria 6084
505 Ga0207667_10107007 3300025949 Bacteria 2885
506 Ga0207667_10502594 3300025949 Bacteria 1230
507 Ga0207667_11119880 3300025949 Bacteria 770
508 Ga0207651_10581763 3300025960 Bacteria 977
509 Ga0207712_10009508 3300025961 Bacteria 6150
510 Ga0207712_10037345 3300025961 Bacteria 3314
511 Ga0207712_11321852 3300025961 Bacteria 644
512 Ga0207668_10130955 3300025972 Bacteria 1915
513 Ga0207668_10701099 3300025972 Bacteria 890
514 Ga0207640_10104010 3300025981 Unclassified 1998
515 Ga0207640_11590302 3300025981 Bacteria 589
516 Ga0207658_10037419 3300025986 Bacteria 3487
517 Ga0207677_10007668 3300026023 Bacteria 5990
518 Ga0207677_10123909 3300026023 Unclassified 1949
519 Ga0207703_10097432 3300026035 Unclassified 2485
520 Ga0207703_10207091 3300026035 Bacteria 1746
521 Ga0207703_11855875 3300026035 Bacteria 579
522 Ga0207639_10012886 3300026041 Bacteria 5834
523 Ga0207639_10039833 3300026041 Bacteria 3504
524 Ga0207639_10070693 3300026041 Bacteria 2727
525 Ga0207639_10349523 3300026041 Bacteria 1320
526 Ga0207639_11032018 3300026041 Bacteria 770
527 Ga0207639_11676928 3300026041 Bacteria 596
528 Ga0207639_12088125 3300026041 Bacteria 528
529 Ga0207678_10009355 3300026067 Bacteria 8626
530 Ga0207678_10964192 3300026067 Bacteria 754
531 Ga0207678_11103824 3300026067 Bacteria 702
532 Ga0207708_10003395 3300026075 Bacteria 11728
533 Ga0207708_10062675 3300026075 Bacteria 2840
534 Ga0207708_11044877 3300026075 Bacteria 711
535 Ga0207708_11953256 3300026075 Bacteria 514
536 Ga0207702_10004696 3300026078 Bacteria 12073
537 Ga0207702_10529651 3300026078 Bacteria 1151
538 Ga0207702_10644981 3300026078 Bacteria 1041
539 Ga0207641_10089083 3300026088 Bacteria 2696
540 Ga0207641_10186067 3300026088 Unclassified 1905
541 Ga0207641_10465440 3300026088 Bacteria 1224
542 Ga0207641_11283687 3300026088 Bacteria 732
543 Ga0207648_10005183 3300026089 Bacteria 13196
544 Ga0207648_10007179 3300026089 Bacteria 10982
545 Ga0207648_10025921 3300026089 Bacteria 5215
546 Ga0207648_10098787 3300026089 Bacteria 2556
547 Ga0207648_10144056 3300026089 Bacteria 2101
548 Ga0207648_10334981 3300026089 Bacteria 1362
549 Ga0207648_11481651 3300026089 Bacteria 638
550 Ga0207676_10031639 3300026095 Bacteria 3980
551 Ga0207676_10044478 3300026095 Bacteria 3426
552 Ga0207676_10045750 3300026095 Bacteria 3383
553 Ga0207676_10350685 3300026095 Bacteria 1365
554 Ga0207676_11114991 3300026095 Bacteria 780
555 Ga0207674_10081649 3300026116 Bacteria 3235
556 Ga0207674_10975261 3300026116 Bacteria 816
557 Ga0207675_100015323 3300026118 Bacteria 7153
558 Ga0207675_100196154 3300026118 Bacteria 1938
559 Ga0207675_100328273 3300026118 Bacteria 1495
560 Ga0207675_102055532 3300026118 Bacteria 588
561 Ga0207683_10017573 3300026121 Bacteria 6098
562 Ga0207683_10025186 3300026121 Bacteria 5130
563 Ga0207683_10029376 3300026121 Bacteria 4759
564 Ga0207683_10075257 3300026121 Bacteria 2988
565 Ga0207698_10024319 3300026142 Bacteria 4249
566 Ga0207698_11200478 3300026142 Bacteria 772
567 Ga0207698_12263333 3300026142 Bacteria 556
568 Ga0209813_10003431 3300027866 Bacteria 3709
569 Ga0209813_10005645 3300027866 Bacteria 3047
570 Ga0209813_10084655 3300027866 Bacteria 1054
571 Ga0207428_10000110 3300027907 Bacteria 111885
572 Ga0207428_10006589 3300027907 Bacteria 10697
573 Ga0207428_10011350 3300027907 Bacteria 7878
574 Ga0207428_10052447 3300027907 Bacteria 3257
575 Ga0207428_10211860 3300027907 Bacteria 1455
576 Ga0268266_10092653 3300028379 Bacteria 2651
577 Ga0268266_11950958 3300028379 Bacteria 561
578 Ga0268265_10048128 3300028380 Bacteria 3199
579 Ga0268265_10111595 3300028380 Bacteria 2233
580 Ga0268265_10943629 3300028380 Bacteria 849
581 Ga0268265_11169354 3300028380 Bacteria 766
582 Ga0268265_11361374 3300028380 Bacteria 711
583 Ga0268265_12456715 3300028380 Bacteria 527
584 Ga0268264_10038553 3300028381 Bacteria 3944
585 Ga0268264_10069994 3300028381 Unclassified 2969
586 Ga0268264_10647421 3300028381 Bacteria 1045
587 Ga0268264_12637830 3300028381 Bacteria 507
588 Ga0265334_10162473 3300028573 Bacteria 785
589 Ga0265338_10011637 3300028800 Bacteria 10139
590 Ga0265338_10079040 3300028800 Bacteria 2770
591 Ga0265338_10132359 3300028800 Bacteria 1966
592 Ga0265338_10150092 3300028800 Bacteria 1812
593 Ga0265338_10960818 3300028800 Bacteria 580
594 Ga0316182_1143398 3300030745 Bacteria 3194
595 Ga0265332_10207256 3300031238 Bacteria 814
596 Ga0265325_10000589 3300031241 Bacteria 26470
597 Ga0265325_10106377 3300031241 Bacteria 1368
598 Ga0265339_10137506 3300031249 Bacteria 1245
599 Ga0265316_10471588 3300031344 Bacteria 899
600 Ga0307509_10000001 3300031507 Bacteria 629324
601 Ga0307509_10188207 3300031507 Bacteria 1919
602 Ga0307509_10331280 3300031507 Bacteria 1254
603 Ga0307408_100021232 3300031548 Bacteria 4392
604 Ga0307408_100028658 3300031548 Bacteria 3850
605 Ga0307408_100056197 3300031548 Bacteria 2854
606 Ga0307408_101697063 3300031548 Bacteria 602
607 Ga0265314_10018264 3300031711 Bacteria 5473
608 Ga0265314_10377651 3300031711 Bacteria 772
609 Ga0265342_10210599 3300031712 Bacteria 1051
610 Ga0307405_10010944 3300031731 Bacteria 4729
611 Ga0307405_10075099 3300031731 Bacteria 2188
612 Ga0307413_10010428 3300031824 Bacteria 4507
613 Ga0307413_10047974 3300031824 Bacteria 2550
614 Ga0307410_10000597 3300031852 Bacteria 14869
615 Ga0307410_10067969 3300031852 Bacteria 2459
616 Ga0307406_10001404 3300031901 Bacteria 13372
617 Ga0307406_10147013 3300031901 Bacteria 1676
618 Ga0307406_10454925 3300031901 Bacteria 1028
619 Ga0307407_10009088 3300031903 Bacteria 4609
620 Ga0307412_10042287 3300031911 Bacteria 2960
621 Ga0307412_10157276 3300031911 Bacteria 1684
622 Ga0307412_10425593 3300031911 Bacteria 1087
623 Ga0307409_100002976 3300031995 Bacteria 9027
624 Ga0307416_100000503 3300032002 Bacteria 19910
625 Ga0307416_100017986 3300032002 Bacteria 4964
626 Ga0307416_101243301 3300032002 Bacteria 850
627 Ga0307414_10009350 3300032004 Bacteria 5624
628 Ga0307414_10081049 3300032004 Bacteria 2375
629 Ga0307414_10100068 3300032004 Bacteria 2179
630 Ga0307414_10248861 3300032004 Bacteria 1476
631 Ga0307414_10803718 3300032004 Bacteria 858
632 Ga0307411_10003766 3300032005 Bacteria 7119
633 Ga0307411_10688112 3300032005 Bacteria 889
634 Ga0307415_100005805 3300032126 Bacteria 6594
635 Ga0373945_0185268 3300035116 Bacteria 859
636 Ga0373956_0008008 3300035119 Bacteria 4271
637 Ga0373935_0328621 3300035692 Bacteria 1086
638 Ga0373927_0217435 3300035695 Bacteria 1255
639 Ga0373933_1103078 3300035724 Bacteria 523
640 Ga0373947_0056662 3300035725 Bacteria 2369
641 Ga0373937_0468212 3300036401 Bacteria 1197
642 Ga0373937_0602189 3300036401 Bacteria 1043
643 Ga0373937_1292856 3300036401 Bacteria 677
644 Ga0373925_0191595 3300037068 Bacteria 1622
645 Ga0395900_0030020 3300037418 Bacteria 5580
646 Ga0395900_0657243 3300037418 Bacteria 984
647 Ga0395905_0137773 3300037471 Bacteria 2296
648 Ga0395905_0333886 3300037471 Bacteria 1406
649 Ga0395905_1419980 3300037471 Bacteria 598
650 Ga0436365_1912718 3300039437 Bacteria 657
651 Ga0436361_0735050 3300039447 Bacteria 697
652 Ga0439465_0179012 3300041413 Bacteria 766
653 Ga0451793_1881909 3300041452 Bacteria 516
654 Ga0451807_0984767 3300041486 Bacteria 526
655 Ga0451837_0110029 3300041494 Bacteria 547
656 Ga0451843_0846084 3300041509 Bacteria 634
657 Ga0451853_2791953 3300041512 Bacteria 698
658 Ga0439454_123437 3300042011 Bacteria 503
659 Ga0439462_0153924 3300042015 Bacteria 647
660 Ga0439446_0124515 3300042156 Bacteria 832
661 Ga0450908_105202 3300042184 Bacteria 519
662 Ga0439434_0262783 3300042435 Bacteria 592
663 Ga0439459_0198267 3300042438 Bacteria 547
664 Ga0439440_0004802 3300042993 Bacteria 2666
665 Ga0451576_0434062 3300045051 Bacteria 1378
666 Ga0451576_0562032 3300045051 Bacteria 1199
667 Ga0451576_1316324 3300045051 Bacteria 753
668 Ga0451576_1765113 3300045051 Bacteria 640
669 Ga0495603_0111548 3300046455 Bacteria 1595
670 Ga0495603_0397666 3300046455 Bacteria 790
671 Ga0495653_0322604 3300046463 Bacteria 1001
672 Ga0495584_0058626 3300046491 Bacteria 1937
673 Ga0495594_0109323 3300046499 Bacteria 1558
674 Ga0495606_0325552 3300046507 Bacteria 824
675 Ga0495610_0130582 3300046512 Bacteria 1091
676 Ga0495618_0179958 3300046514 Bacteria 1344
677 Ga0495631_0349827 3300046518 Bacteria 629
678 Ga0495643_0031513 3300046522 Bacteria 2950
679 Ga0495643_0334916 3300046522 Bacteria 681
680 Ga0495644_0327829 3300046523 Bacteria 601
681 Ga0495652_0302955 3300046529 Bacteria 1161
682 Ga0495640_0254422 3300046533 Bacteria 1099
683 Ga0495598_0215090 3300046537 Bacteria 699
684 Ga0495598_0217652 3300046537 Bacteria 696
685 Ga0495621_0446058 3300046539 Bacteria 553
686 Ga0495645_0354964 3300046543 Unclassified 944
687 Ga0495645_0429569 3300046543 Bacteria 837
688 Ga0495656_0025046 3300046615 Bacteria 2362
689 Ga0495668_0092680 3300046616 Bacteria 1655
690 Ga0495634_0884072 3300046642 Bacteria 506
691 Ga0495611_0215977 3300046648 Bacteria 893
692 Ga0495661_0635496 3300046665 Bacteria 500
693 Ga0495658_0202262 3300046683 Bacteria 1238
694 Ga0495658_0282182 3300046683 Bacteria 1048
695 Ga0495624_0069253 3300046690 Bacteria 2198
696 Ga0495670_0096967 3300046691 Bacteria 1515
697 Ga0495670_0183920 3300046691 Bacteria 1104
698 Ga0495670_0773878 3300046691 Bacteria 524
699 Ga0495649_0058194 3300046694 Bacteria 2083
700 Ga0495589_0534465 3300046794 Bacteria 535
701 Ga0495660_0158994 3300046810 Bacteria 1110
702 Ga0495581_0267739 3300047315 Bacteria 999
703 Ga0495581_0269731 3300047315 Bacteria 995
704 Ga0495581_0747028 3300047315 Bacteria 563
705 Ga0495674_0066761 3300047319 Bacteria 3119
706 Ga0495680_0280288 3300047322 Bacteria 1175
707 Ga0495615_0026602 3300048090 Bacteria 1352
708 Ga0495626_0251984 3300048091 Bacteria 708
709 Ga0496100_0004586 3300048903 Bacteria 7342
710 Ga0496100_0143049 3300048903 Bacteria 1697
711 Ga0496100_0332209 3300048903 Bacteria 1144
712 Ga0496100_1298087 3300048903 Bacteria 574
713 Ga0496101_0001219 3300048904 Bacteria 15403
714 Ga0496101_0038598 3300048904 Bacteria 3392
715 Ga0496102_0003747 3300048905 Bacteria 12848
716 Ga0496102_0005386 3300048905 Bacteria 10864
717 Ga0496102_0008653 3300048905 Bacteria 8736
718 Ga0496102_0230850 3300048905 Bacteria 1745
719 Ga0496102_0361540 3300048905 Bacteria 1366
720 Ga0496102_1127395 3300048905 Bacteria 704
721 Ga0496103_0001824 3300048906 Bacteria 13872
722 Ga0496103_0007172 3300048906 Bacteria 6648
723 Ga0496103_0238680 3300048906 Bacteria 1169
724 Ga0496104_0000277 3300048907 Bacteria 45742
725 Ga0496104_0000422 3300048907 Bacteria 36991
726 Ga0496104_0006427 3300048907 Bacteria 10332
727 Ga0496104_0007253 3300048907 Bacteria 9782
728 Ga0496104_0458505 3300048907 Unclassified 1186
729 Ga0496105_0001573 3300048908 Bacteria 16183
730 Ga0496105_0010743 3300048908 Bacteria 7208
731 Ga0496105_0030656 3300048908 Bacteria 4407
732 Ga0496105_0430218 3300048908 Bacteria 1044
733 Ga0496106_0003428 3300048909 Bacteria 11817
734 Ga0496106_0069564 3300048909 Bacteria 2687
735 Ga0496106_0317641 3300048909 Bacteria 1250
736 Ga0496106_0559662 3300048909 Bacteria 917
737 Ga0496106_1107889 3300048909 Bacteria 620
738 Ga0496107_0005150 3300048910 Bacteria 8922
739 Ga0496107_0974906 3300048910 Bacteria 616
740 Ga0496107_1096098 3300048910 Bacteria 575
741 Ga0496108_0003138 3300048911 Bacteria 13287
742 Ga0496108_0017796 3300048911 Bacteria 5811
743 Ga0496108_0045123 3300048911 Bacteria 3680
744 Ga0496108_0387722 3300048911 Bacteria 1220
745 Ga0496108_0942208 3300048911 Bacteria 740
746 Ga0496109_0009447 3300048912 Bacteria 8314
747 Ga0496109_0038458 3300048912 Bacteria 4325
748 Ga0496109_0055365 3300048912 Bacteria 3618
749 Ga0496109_0101465 3300048912 Bacteria 2671
750 Ga0496109_0213618 3300048912 Bacteria 1814
751 Ga0496110_0007853 3300048913 Bacteria 8547
752 Ga0496110_0097556 3300048913 Bacteria 2633
753 Ga0496110_0209820 3300048913 Bacteria 1770
754 Ga0496110_0269253 3300048913 Bacteria 1551
755 Ga0496110_1710846 3300048913 Bacteria 539
756 Ga0496111_0000763 3300048914 Bacteria 17195
757 Ga0496111_0009657 3300048914 Bacteria 6447
758 Ga0496111_0039313 3300048914 Bacteria 3391
759 Ga0496112_0002328 3300048915 Bacteria 15243
760 Ga0496112_0002901 3300048915 Bacteria 13961
761 Ga0496112_0342811 3300048915 Unclassified 1437
762 Ga0496113_0003218 3300048916 Bacteria 9736
763 Ga0496113_0003658 3300048916 Bacteria 9251
764 Ga0496113_0010683 3300048916 Bacteria 6081
765 Ga0496113_0253488 3300048916 Bacteria 1405
766 Ga0496114_0003793 3300048917 Bacteria 11648
767 Ga0496114_0134169 3300048917 Bacteria 2140
768 Ga0496114_0311828 3300048917 Bacteria 1390
769 Ga0496114_0545404 3300048917 Bacteria 1025
770 Ga0496115_0008748 3300048918 Bacteria 7505
771 Ga0496115_0145427 3300048918 Bacteria 1956
772 Ga0496115_0303850 3300048918 Bacteria 1307
773 Ga0496115_0418072 3300048918 Bacteria 1086
774 Ga0496115_0543540 3300048918 Bacteria 929
775 Ga0496116_0006766 3300048919 Bacteria 10317
776 Ga0496117_0004333 3300048920 Bacteria 15776
777 Ga0496117_0099111 3300048920 Bacteria 1850
778 Ga0496118_0002241 3300048921 Bacteria 26613
779 Ga0496119_0004802 3300048922 Bacteria 13265
780 Ga0496120_0004013 3300048923 Bacteria 12784
781 Ga0496121_0002565 3300048924 Bacteria 27503
782 Ga0496121_0046229 3300048924 Bacteria 3728
783 Ga0496121_0157792 3300048924 Bacteria 1663
784 Ga0496122_0003928 3300048925 Bacteria 19013
785 Ga0496122_0040056 3300048925 Bacteria 3729
786 Ga0496122_0156224 3300048925 Bacteria 1399
787 Ga0496123_0004431 3300048926 Bacteria 14767
788 Ga0496123_0026525 3300048926 Bacteria 4336
789 Ga0496124_0032456 3300048927 Bacteria 4609
790 Ga0496124_0044198 3300048927 Bacteria 3824
791 Ga0496125_0005315 3300048928 Bacteria 14395
792 Ga0496125_0102087 3300048928 Bacteria 2108
793 Ga0496125_0146646 3300048928 Bacteria 1630
794 Ga0496125_0203263 3300048928 Bacteria 1294
795 Ga0496126_0003987 3300048929 Bacteria 18030
796 Ga0496126_0094309 3300048929 Bacteria 2626
797 Ga0496126_0154596 3300048929 Bacteria 1964
798 Ga0496126_0171520 3300048929 Bacteria 1848
799 Ga0496126_0521020 3300048929 Bacteria 947
800 Ga0496126_1256294 3300048929 Bacteria 541
801 Ga0501031_0136337 3300049568 Bacteria 1603
802 Ga0501032_0031198 3300049569 Bacteria 3654
803 Ga0501033_0000005 3300049570 Bacteria 379089
804 Ga0501034_0096595 3300049571 Bacteria 2951
805 Ga0501034_0453383 3300049571 Bacteria 1200
806 Ga0501034_0750943 3300049571 Bacteria 871
807 Ga0501037_0083008 3300049573 Bacteria 2321
808 Ga0501038_0128874 3300049574 Bacteria 2079
809 Ga0501039_0006122 3300049575 Bacteria 9132
810 Ga0501040_1008252 3300049576 Bacteria 604
811 Ga0501043_0003460 3300049579 Bacteria 12963
812 Ga0501046_0000010 3300049580 Bacteria 331082
813 Ga0501047_0465204 3300049581 Bacteria 1093
814 Ga0501048_0294752 3300049582 Bacteria 1154
815 Ga0501069_0274955 3300049585 Bacteria 985
816 Ga0501076_1028526 3300049592 Bacteria 679
817 Ga0501076_1539448 3300049592 Bacteria 546
818 Ga0501249_070293 3300049679 Bacteria 817
819 Ga0501079_0340023 3300049741 Bacteria 1176
820 Ga0501080_1385014 3300049742 Bacteria 600
821 Ga0501035_0001614 3300049822 Bacteria 22790
822 Ga0501044_0016325 3300049823 Bacteria 7973
823 Ga0501044_0050646 3300049823 Bacteria 4283
824 Ga0501044_0400533 3300049823 Bacteria 1285
825 Ga0501045_0000090 3300049824 Bacteria 43534
826 Ga0501045_0788478 3300049824 Bacteria 700
827 Ga0501045_1215697 3300049824 Bacteria 550
828 nmdc:mga03n38_308636_c1 3300050490 Bacteria 851
829 nmdc:mga03n38_948343_c1 3300050490 Bacteria 508
830 nmdc:mga00v17_120829_c1 3300050491 Bacteria 1668
831 nmdc:mga00v17_523897_c1 3300050491 Bacteria 767
832 nmdc:mga0yw44_148577_c1 3300050492 Bacteria 1527
833 nmdc:mga0yw44_543450_c1 3300050492 Bacteria 789
834 nmdc:mga0k408_207030_c1 3300050493 Bacteria 1171
835 nmdc:mga06z11_170332_c1 3300050494 Bacteria 1250
836 nmdc:mga06z11_195781_c1 3300050494 Bacteria 1172
837 nmdc:mga06z11_39754_c1 3300050494 Bacteria 2343
838 nmdc:mga04h51_5105_c1 3300050495 Bacteria 3325
839 nmdc:mga04h51_526154_c1 3300050495 Bacteria 508
840 nmdc:mga04h51_5603_c1 3300050495 Bacteria 3208
841 nmdc:mga04h51_95862_c1 3300050495 Bacteria 1074
842 nmdc:mga07m45_442689_c1 3300050496 Bacteria 754
843 nmdc:mga05p37_1303039_c1 3300050507 Bacteria 740
844 nmdc:mga05p37_22563_c1 3300050507 Bacteria 7632
845 nmdc:mga05p37_272674_c1 3300050507 Bacteria 2021
846 nmdc:mga05p37_287317_c1 3300050507 Bacteria 1959
847 nmdc:mga05p37_388887_c1 3300050507 Bacteria 1632
848 nmdc:mga05p37_96689_c1 3300050507 Bacteria 3638
849 nmdc:mga09592_152844_c1 3300050508 Bacteria 1992
850 nmdc:mga09592_22502_c1 3300050508 Bacteria 5202
851 nmdc:mga09592_2699_c1 3300050508 Bacteria 14350
852 nmdc:mga09592_416422_c1 3300050508 Bacteria 1161
853 nmdc:mga0qj67_1339842_c1 3300050509 Bacteria 554
854 nmdc:mga0qj67_166292_c1 3300050509 Bacteria 1791
855 nmdc:mga0qj67_23465_c1 3300050509 Bacteria 4747
856 nmdc:mga0qj67_39412_c1 3300050509 Bacteria 3710
857 nmdc:mga0qj67_69899_c1 3300050509 Bacteria 2800
858 nmdc:mga06r32_12218_c1 3300050510 Bacteria 7744
859 nmdc:mga06r32_1351789_c1 3300050510 Bacteria 655
860 nmdc:mga06r32_15002_c1 3300050510 Bacteria 7033
861 nmdc:mga06r32_271752_c1 3300050510 Bacteria 1682
862 nmdc:mga06r32_725615_c1 3300050510 Bacteria 958
863 nmdc:mga06r32_893727_c1 3300050510 Bacteria 845
864 nmdc:mga08y16_15797_c1 3300050511 Bacteria 7938
865 nmdc:mga08y16_231102_c1 3300050511 Bacteria 1913
866 nmdc:mga08y16_463535_c1 3300050511 Bacteria 1291
867 nmdc:mga08y16_47_c1 3300050511 Bacteria 111829
868 nmdc:mga08y16_64280_c1 3300050511 Bacteria 3832
869 nmdc:mga08y16_85916_c1 3300050511 Bacteria 3279
870 nmdc:mga0n895_230015_c1 3300050512 Bacteria 1882
871 nmdc:mga0rr50_113794_c1 3300050513 Unclassified 2144
872 nmdc:mga0a205_1307481_c1 3300050515 Bacteria 573
873 nmdc:mga0a205_444205_c1 3300050515 Bacteria 1157
874 nmdc:mga0a205_641704_c1 3300050515 Bacteria 913
875 nmdc:mga0sz30_12771_c1 3300050516 Bacteria 3272
876 nmdc:mga0sz30_148832_c1 3300050516 Bacteria 1035
877 nmdc:mga0sz30_47897_c1 3300050516 Bacteria 1807
878 Ga0495601_0263129 3300053077 Bacteria 1126
879 Ga0495595_0102698 3300053084 Bacteria 1381
880 Ga0495619_0034642 3300053085 Bacteria 3283
881 Ga0500578_0440212 3300053086 Bacteria 744
882 Ga0500641_0032254 3300053096 Bacteria 2071
883 Ga0500562_034205 3300053108 Bacteria 1344
884 Ga0500595_076282 3300053119 Bacteria 987
885 Ga0500658_0009027 3300053134 Bacteria 3680
886 Ga0500658_0392156 3300053134 Bacteria 636
887 Ga0500568_0066977 3300053139 Bacteria 1381
888 Ga0500589_220459 3300053147 Bacteria 715
889 Ga0500604_0016388 3300053151 Bacteria 2040
890 Ga0500616_0151806 3300053153 Bacteria 1071
891 Ga0500622_0003585 3300053156 Bacteria 10241
892 Ga0500622_0083644 3300053156 Bacteria 1594
893 Ga0500622_0099531 3300053156 Bacteria 1433
894 Ga0500634_0216694 3300053161 Bacteria 826
895 Ga0500636_0075467 3300053177 Bacteria 1950
896 Ga0500636_0180223 3300053177 Bacteria 1135
897 Ga0501084_1561653 3300054114 Bacteria 552
898 Ga0590071_028025 3300059421 Bacteria 1337
899 Ga0590074_068216 3300059423 Bacteria 668
900 Ga0590077_014728 3300059426 Bacteria 1630
901 Ga0501082_1144564 3300060353 Bacteria 680
902 Ga0530510_0018385 3300061734 Bacteria 4956
903 Ga0530510_0331492 3300061734 Bacteria 1142
904 Ga0105249_10574164
905 JGI24743J22301_10035802
906 JGI24738J21930_10034282
907 JGI24744J21845_10032240
908 JGI24744J21845_10113249
909 JGI24751J29686_10044588
910 JGI25152J39213_1005884
911 JGI25151J46595_10000072
912 JGI25406J46586_10004307
913 JGI25406J46586_10021166
914 JGI25165J46597_1032491
915 JGI25153J46596_10014785
916 rootH2_10176863
917 JGI25160J50197_1076211
918 Ga0055526_1002917
919 Ga0055528_1006856
920 Ga0055540_1005427
921 Ga0065165_1116946
922 Ga0070676_11075693
923 Ga0070683_100262573
924 Ga0070683_100835609
925 Ga0070683_101154649
926 Ga0070690_100737925
927 Ga0070670_100063230
928 Ga0070670_100694654
929 Ga0070670_100853162
930 Ga0068869_100503442
931 Ga0068869_100913078
932 Ga0070666_10161118
933 Ga0070680_100201860
934 Ga0070680_101211830
935 Ga0070682_100517008
936 Ga0068868_100014282
937 Ga0068868_100026632
938 Ga0068868_100108394
939 Ga0070689_100230054
940 Ga0070689_100308305
941 Ga0070691_10387331
942 Ga0070691_10565902
943 Ga0070687_100058531
944 Ga0070687_100226901
945 Ga0070692_10073570
946 Ga0070692_10213264
947 Ga0070668_100095666
948 Ga0070668_100462437
949 Ga0070668_100483055
950 Ga0070668_100726371
951 Ga0070668_101952978
952 Ga0070669_100008734
953 Ga0070669_100122377
954 Ga0070669_100351066
955 Ga0070675_100001709
956 Ga0070675_100007238
957 Ga0070675_100285378
958 Ga0070675_100387831
959 Ga0070675_101128369
960 Ga0070671_100017707
961 Ga0070674_100005254
962 Ga0070674_100032868
963 Ga0070674_100105659
964 Ga0070674_100380969
965 Ga0070674_100892758
966 Ga0070673_100320919
967 Ga0070688_100212990
968 Ga0070659_100651084
969 Ga0070659_101965991
970 Ga0070667_100014940
971 Ga0070703_10451157
972 Ga0070709_10611977
973 Ga0070713_100795993
974 Ga0070701_10026478
975 Ga0070701_10121320
976 Ga0070701_10404315
977 Ga0070711_100547687
978 Ga0070705_100344620
979 Ga0070705_101052305
980 Ga0070700_100044114
981 Ga0070700_100152967
982 Ga0070700_100707279
983 Ga0070700_100727299
984 Ga0070708_100162546
985 Ga0070708_100309521
986 Ga0070708_101714544
987 Ga0070663_100023340
988 Ga0070663_100618980
989 Ga0070678_100048978
990 Ga0070678_100079711
991 Ga0070678_100137148
992 Ga0070662_100090357
993 Ga0070662_100431225
994 Ga0070662_100449131
995 Ga0070681_10169674
996 Ga0070681_10651727
997 Ga0068867_100018670
998 Ga0068867_100023816
999 Ga0068867_100039810
1000 Ga0068867_100132901
1001 Ga0068867_100304601
1002 Ga0068867_101021772
1003 Ga0068867_101043100
1004 Ga0068867_101487789
1005 Ga0070706_100381663
1006 Ga0070707_100225561
1007 Ga0070698_100699642
1008 Ga0070698_101036731
1009 Ga0070698_101051637
1010 Ga0070699_100767441
1011 Ga0070699_101993754
1012 Ga0070684_100026085
1013 Ga0070684_100669054
1014 Ga0070684_100771641
1015 Ga0070684_101163666
1016 Ga0070697_100128418
1017 Ga0070697_100802533
1018 Ga0068853_100041079
1019 Ga0068853_100578273
1020 Ga0070672_100073439
1021 Ga0070686_100011385
1022 Ga0070686_100079725
1023 Ga0070686_100166723
1024 Ga0070686_100427847
1025 Ga0070686_100758014
1026 Ga0070695_100022717
1027 Ga0070695_100179920
1028 Ga0070696_100004721
1029 Ga0070696_100166435
1030 Ga0070665_100483887
1031 Ga0070704_100011186
1032 Ga0070704_100248675
1033 Ga0070704_101296619
1034 Ga0070704_101725182
1035 Ga0068855_100007679
1036 Ga0070664_100089122
1037 Ga0070664_101212027
1038 Ga0068857_100241334
1039 Ga0068854_100011182
1040 Ga0068854_100299707
1041 Ga0068854_100328426
1042 Ga0068856_100001927
1043 Ga0068856_100293492
1044 Ga0068856_100722212
1045 Ga0070702_100041605
1046 Ga0070702_100123414
1047 Ga0070702_100581729
1048 Ga0068852_100022289
1049 Ga0068852_100211773
1050 Ga0068859_100003226
1051 Ga0068859_100053585
1052 Ga0068859_100288371
1053 Ga0068859_100673651
1054 Ga0068859_100832690
1055 Ga0068864_100055818
1056 Ga0068864_100099195
1057 Ga0068864_100205735
1058 Ga0068866_10002402
1059 Ga0068866_10018393
1060 Ga0068866_10063690
1061 Ga0068866_10121288
1062 Ga0068866_10508985
1063 Ga0068861_100015511
1064 Ga0068861_101708029
1065 Ga0068861_101947188
1066 Ga0068851_10127365
1067 Ga0068851_10598947
1068 Ga0068870_10012931
1069 Ga0068870_10406458
1070 Ga0068863_100284722
1071 Ga0068863_100420183
1072 Ga0068863_101091274
1073 Ga0068863_101832819
1074 Ga0068858_100003199
1075 Ga0068858_100060728
1076 Ga0068858_100522788
1077 Ga0068860_100045203
1078 Ga0068860_100075102
1079 Ga0068860_101035736
1080 Ga0068860_102034347
1081 Ga0068862_100034384
1082 Ga0068862_100229964
1083 Ga0068862_100855986
1084 Ga0081455_10000861
1085 Ga0081455_10253371
1086 Ga0081538_10031288
1087 Ga0081539_10000170
1088 Ga0081539_10005432
1089 Ga0070717_10203228
1090 Ga0075365_10847455
1091 Ga0075365_10889982
1092 Ga0075368_10010950
1093 Ga0075368_10087749
1094 Ga0075363_100168194
1095 Ga0075363_100309376
1096 Ga0075364_10012038
1097 Ga0075364_10393273
1098 Ga0075432_10000721
1099 Ga0070715_10049814
1100 Ga0070716_101067806
1101 Ga0070712_100262277
1102 Ga0070712_100308030
1103 Ga0075362_10160836
1104 Ga0075367_10006983
1105 Ga0075367_10012500
1106 Ga0075367_10062237
1107 Ga0075369_10023013
1108 Ga0075369_10086268
1109 Ga0075369_10352497
1110 Ga0075366_10247967
1111 Ga0075366_11007741
1112 Ga0097621_100000526
1113 Ga0097621_100182438
1114 Ga0097621_100522449
1115 Ga0068871_100000606
1116 Ga0068871_100099395
1117 Ga0068871_100154071
1118 Ga0075428_100026330
1119 Ga0075428_100195806
1120 Ga0075428_100381229
1121 Ga0075428_100501680
1122 Ga0075428_100868259
1123 Ga0075430_100023627
1124 Ga0075430_100218830
1125 Ga0075430_100274345
1126 Ga0075430_100728518
1127 Ga0075431_100091689
1128 Ga0075431_100153200
1129 Ga0075431_100358554
1130 Ga0075431_100784891
1131 Ga0075431_100831225
1132 Ga0075433_10004624
1133 Ga0075433_10616062
1134 Ga0075433_11148971
1135 Ga0075434_100094791
1136 Ga0075429_100003072
1137 Ga0075429_100036324
1138 Ga0075429_100086891
1139 Ga0075429_100344942
1140 Ga0068865_100009215
1141 Ga0068865_100013057
1142 Ga0068865_100085425
1143 Ga0068865_100112555
1144 Ga0068865_100131237
1145 Ga0068865_101499882
1146 Ga0075436_100003921
1147 Ga0075436_100175889
1148 Ga0097620_100003226
1149 Ga0097620_100053587
1150 Ga0097620_100288380
1151 Ga0097620_100673623
1152 Ga0097620_100794126
1153 Ga0097620_100832747
1154 Ga0097620_100989871
1155 Ga0075435_100008934
1156 Ga0075435_100289561
1157 Ga0099794_10272694
1158 Ga0099795_10084327
1159 Ga0105240_10000024
1160 Ga0105240_10000931
1161 Ga0105240_10029937
1162 Ga0105240_10259156
1163 Ga0111539_10000267
1164 Ga0111539_10004381
1165 Ga0111539_10013014
1166 Ga0111539_10063769
1167 Ga0111539_10085474
1168 Ga0111539_11183014
1169 Ga0111539_11599520
1170 Ga0105245_10040254
1171 Ga0105245_10083031
1172 Ga0105245_10315924
1173 Ga0105245_10518628
1174 Ga0105245_11164984
1175 Ga0105247_10032054
1176 Ga0105247_10242186
1177 Ga0105247_11140761
1178 Ga0114129_10056554
1179 Ga0114129_10069655
1180 Ga0114129_10130560
1181 Ga0114129_10438060
1182 Ga0114129_10556348
1183 Ga0114129_10764027
1184 Ga0114129_11258224
1185 Ga0114129_11320940
1186 Ga0114129_12915392
1187 Ga0105243_10014856
1188 Ga0105243_10036128
1189 Ga0105243_10036834
1190 Ga0105243_11226159
1191 Ga0105243_11790472
1192 Ga0105243_12673717
1193 Ga0105241_10042510
1194 Ga0105241_10229619
1195 Ga0105241_10838835
1196 Ga0105241_10980425
1197 Ga0105242_10020707
1198 Ga0105242_10518323
1199 Ga0105242_10665963
1200 Ga0105242_12242143
1201 Ga0105242_12758087
1202 Ga0105248_10006300
1203 Ga0105248_10008521
1204 Ga0105248_10124520
1205 Ga0105248_10169323
1206 Ga0105248_10205496
1207 Ga0105248_11233391
1208 Ga0105237_10000538
1209 Ga0105237_10014774
1210 Ga0105237_11353890
1211 Ga0105237_12323085
1212 Ga0105238_10001033
1213 Ga0105238_10086435
1214 Ga0105238_10234949
1215 Ga0105238_10287290
1216 Ga0105238_10437129
1217 Ga0105238_10489272
1218 Ga0105238_11315580
1219 Ga0105238_11649146
1220 Ga0105249_10096265
1221 Ga0105249_11998657
1222 Ga0105249_12337606
1223 Ga0105032_100608
1224 Ga0099796_10067518
1225 Ga0105239_10006401
1226 Ga0105239_10009580
1227 Ga0105239_10011824
1228 Ga0105239_10709322
1229 Ga0105239_11086297
1230 Ga0105239_11251413
1231 Ga0105246_10106220
1232 Ga0105246_10112426
1233 Ga0105246_10276145
1234 Ga0105246_10440277
1235 Ga0105246_11186552
1236 Ga0157371_11356400
1237 Ga0157370_10000236
1238 Ga0157370_10813643
1239 Ga0157369_10168826
1240 Ga0157369_10304643
1241 Ga0157374_10001116
1242 Ga0157374_10009543
1243 Ga0157378_10000055
1244 Ga0157378_10023745
1245 Ga0157378_10100308
1246 Ga0157378_10114074
1247 Ga0157378_10529040
1248 Ga0157378_10763343
1249 Ga0157378_10781134
1250 Ga0157378_10973306
1251 Ga0157378_11898442
1252 Ga0157378_12178762
1253 Ga0163162_10017312
1254 Ga0163162_10493646
1255 Ga0157372_10000778
1256 Ga0157372_10230342
1257 Ga0157372_10254711
1258 Ga0157372_10945023
1259 Ga0157372_11043405
1260 Ga0157372_11811624
1261 Ga0157375_10053907
1262 Ga0157375_10877522
1263 Ga0157375_10889328
1264 Ga0157375_10981921
1265 Ga0157375_12221727
1266 Ga0163163_10004214
1267 Ga0163163_10415727
1268 Ga0163163_10587149
1269 Ga0163163_10745016
1270 Ga0163163_13062968
1271 Ga0157380_10011196
1272 Ga0157380_10032759
1273 Ga0157380_10034150
1274 Ga0157380_10189708
1275 Ga0157380_10447913
1276 Ga0157380_10450665
1277 Ga0182008_10097717
1278 Ga0157377_10008482
1279 Ga0157379_10035304
1280 Ga0157379_10306887
1281 Ga0157379_10540798
1282 Ga0157379_10907327
1283 Ga0157376_10108691
1284 Ga0157376_10337434
1285 Ga0157376_10606335
1286 Ga0157376_10771696
1287 Ga0157376_11298168
1288 Ga0157376_11733701
1289 Ga0157376_12262547
1290 Ga0182007_10011139
1291 Ga0182005_1007030
1292 Ga0163161_10215538
1293 Ga0163161_10273473
1294 Ga0163161_10367510
1295 Ga0163161_10878128
1296 Ga0163161_11032092
1297 Ga0206350_11235408
1298 Ga0209129_1007024
1299 Ga0209233_1014105
1300 Ga0209673_1002671
1301 Ga0209130_1082060
1302 Ga0209025_1000063
1303 Ga0209025_1108900
1304 Ga0209564_1001099
1305 Ga0209758_1000438
1306 Ga0209758_1004601
1307 Ga0209758_1015358
1308 Ga0209758_1109484
1309 Ga0209256_1009989
1310 Ga0209051_1052633
1311 Ga0207697_10353581
1312 Ga0207656_10099604
1313 Ga0207656_10112698
1314 Ga0207653_10077162
1315 Ga0207642_10017266
1316 Ga0207642_10051486
1317 Ga0207642_10078677
1318 Ga0207642_10124007
1319 Ga0207710_10005872
1320 Ga0207710_10701138
1321 Ga0207688_10004185
1322 Ga0207680_10169146
1323 Ga0207645_10186918
1324 Ga0207643_10000650
1325 Ga0207705_11391259
1326 Ga0207684_10021939
1327 Ga0207654_10316866
1328 Ga0207707_10290653
1329 Ga0207707_11523255
1330 Ga0207695_10000007
1331 Ga0207695_10547160
1332 Ga0207671_10053773
1333 Ga0207671_10191788
1334 Ga0207671_10933253
1335 Ga0207693_10197883
1336 Ga0207660_10574954
1337 Ga0207660_10828765
1338 Ga0207662_10001102
1339 Ga0207662_10052706
1340 Ga0207662_10083157
1341 Ga0207657_10385936
1342 Ga0207657_10494601
1343 Ga0207652_10334344
1344 Ga0207646_10006392
1345 Ga0207646_10208330
1346 Ga0207681_10049852
1347 Ga0207681_10153523
1348 Ga0207681_10425987
1349 Ga0207681_10522727
1350 Ga0207694_10006772
1351 Ga0207694_10096488
1352 Ga0207694_10303718
1353 Ga0207694_11049720
1354 Ga0207694_11122602
1355 Ga0207650_10006377
1356 Ga0207650_10322959
1357 Ga0207650_10936863
1358 Ga0207659_10004631
1359 Ga0207659_10009599
1360 Ga0207659_10155096
1361 Ga0207659_10187039
1362 Ga0207659_10301066
1363 Ga0207687_10037527
1364 Ga0207687_10145711
1365 Ga0207687_10804939
1366 Ga0207700_11463407
1367 Ga0207644_10152124
1368 Ga0207690_10703595
1369 Ga0207706_10016957
1370 Ga0207706_10163862
1371 Ga0207686_10021261
1372 Ga0207686_10722666
1373 Ga0207686_10805219
1374 Ga0207709_10320914
1375 Ga0207709_10398307
1376 Ga0207670_10382306
1377 Ga0207670_10427789
1378 Ga0207670_10525005
1379 Ga0207670_10575298
1380 Ga0207669_10067522
1381 Ga0207669_10159591
1382 Ga0207669_10370958
1383 Ga0207669_10397303
1384 Ga0207704_10012565
1385 Ga0207704_10014706
1386 Ga0207704_10031868
1387 Ga0207704_10084472
1388 Ga0207704_10139727
1389 Ga0207704_11069959
1390 Ga0207704_11075986
1391 Ga0207665_10180800
1392 Ga0207691_10144521
1393 Ga0207691_10178069
1394 Ga0207691_10186475
1395 Ga0207691_10572869
1396 Ga0207711_10005116
1397 Ga0207711_10050170
1398 Ga0207711_11136012
1399 Ga0207711_11256108
1400 Ga0207689_10006481
1401 Ga0207689_10696700
1402 Ga0207661_10073819
1403 Ga0207661_10563439
1404 Ga0207679_10051208
1405 Ga0207679_10503947
1406 Ga0207679_11123560
1407 Ga0207667_10028330
1408 Ga0207667_10107007
1409 Ga0207667_10502594
1410 Ga0207667_11119880
1411 Ga0207651_10581763
1412 Ga0207712_10009508
1413 Ga0207712_10037345
1414 Ga0207712_11321852
1415 Ga0207668_10130955
1416 Ga0207668_10701099
1417 Ga0207640_10104010
1418 Ga0207640_11590302
1419 Ga0207658_10037419
1420 Ga0207677_10007668
1421 Ga0207677_10123909
1422 Ga0207703_10097432
1423 Ga0207703_10207091
1424 Ga0207703_11855875
1425 Ga0207639_10012886
1426 Ga0207639_10039833
1427 Ga0207639_10070693
1428 Ga0207639_10349523
1429 Ga0207639_11032018
1430 Ga0207639_11676928
1431 Ga0207639_12088125
1432 Ga0207678_10009355
1433 Ga0207678_10964192
1434 Ga0207678_11103824
1435 Ga0207708_10003395
1436 Ga0207708_10062675
1437 Ga0207708_11044877
1438 Ga0207708_11953256
1439 Ga0207702_10004696
1440 Ga0207702_10529651
1441 Ga0207702_10644981
1442 Ga0207641_10089083
1443 Ga0207641_10186067
1444 Ga0207641_10465440
1445 Ga0207641_11283687
1446 Ga0207648_10005183
1447 Ga0207648_10007179
1448 Ga0207648_10025921
1449 Ga0207648_10098787
1450 Ga0207648_10144056
1451 Ga0207648_10334981
1452 Ga0207648_11481651
1453 Ga0207676_10031639
1454 Ga0207676_10044478
1455 Ga0207676_10045750
1456 Ga0207676_10350685
1457 Ga0207676_11114991
1458 Ga0207674_10081649
1459 Ga0207674_10975261
1460 Ga0207675_100015323
1461 Ga0207675_100196154
1462 Ga0207675_100328273
1463 Ga0207675_102055532
1464 Ga0207683_10017573
1465 Ga0207683_10025186
1466 Ga0207683_10029376
1467 Ga0207683_10075257
1468 Ga0207698_10024319
1469 Ga0207698_11200478
1470 Ga0207698_12263333
1471 Ga0209813_10003431
1472 Ga0209813_10005645
1473 Ga0209813_10084655
1474 Ga0207428_10000110
1475 Ga0207428_10006589
1476 Ga0207428_10011350
1477 Ga0207428_10052447
1478 Ga0207428_10211860
1479 Ga0268266_10092653
1480 Ga0268266_11950958
1481 Ga0268265_10048128
1482 Ga0268265_10111595
1483 Ga0268265_10943629
1484 Ga0268265_11169354
1485 Ga0268265_11361374
1486 Ga0268265_12456715
1487 Ga0268264_10038553
1488 Ga0268264_10069994
1489 Ga0268264_10647421
1490 Ga0268264_12637830
1491 Ga0265334_10162473
1492 Ga0265338_10011637
1493 Ga0265338_10079040
1494 Ga0265338_10132359
1495 Ga0265338_10150092
1496 Ga0265338_10960818
1497 Ga0316182_1143398
1498 Ga0265332_10207256
1499 Ga0265325_10000589
1500 Ga0265325_10106377
1501 Ga0265339_10137506
1502 Ga0265316_10471588
1503 Ga0307509_10000001
1504 Ga0307509_10188207
1505 Ga0307509_10331280
1506 Ga0307408_100021232
1507 Ga0307408_100028658
1508 Ga0307408_100056197
1509 Ga0307408_101697063
1510 Ga0265314_10018264
1511 Ga0265314_10377651
1512 Ga0265342_10210599
1513 Ga0307405_10010944
1514 Ga0307405_10075099
1515 Ga0307413_10010428
1516 Ga0307413_10047974
1517 Ga0307410_10000597
1518 Ga0307410_10067969
1519 Ga0307406_10001404
1520 Ga0307406_10147013
1521 Ga0307406_10454925
1522 Ga0307407_10009088
1523 Ga0307412_10042287
1524 Ga0307412_10157276
1525 Ga0307412_10425593
1526 Ga0307409_100002976
1527 Ga0307416_100000503
1528 Ga0307416_100017986
1529 Ga0307416_101243301
1530 Ga0307414_10009350
1531 Ga0307414_10081049
1532 Ga0307414_10100068
1533 Ga0307414_10248861
1534 Ga0307414_10803718
1535 Ga0307411_10003766
1536 Ga0307411_10688112
1537 Ga0307415_100005805
1538 Ga0373945_0185268
1539 Ga0373956_0008008
1540 Ga0373935_0328621
1541 Ga0373927_0217435
1542 Ga0373933_1103078
1543 Ga0373947_0056662
1544 Ga0373937_0468212
1545 Ga0373937_0602189
1546 Ga0373937_1292856
1547 Ga0373925_0191595
1548 Ga0395900_0030020
1549 Ga0395900_0657243
1550 Ga0395905_0137773
1551 Ga0395905_0333886
1552 Ga0395905_1419980
1553 Ga0436365_1912718
1554 Ga0436361_0735050
1555 Ga0439465_0179012
1556 Ga0451793_1881909
1557 Ga0451807_0984767
1558 Ga0451837_0110029
1559 Ga0451843_0846084
1560 Ga0451853_2791953
1561 Ga0439454_123437
1562 Ga0439462_0153924
1563 Ga0439446_0124515
1564 Ga0450908_105202
1565 Ga0439434_0262783
1566 Ga0439459_0198267
1567 Ga0439440_0004802
1568 Ga0451576_0434062
1569 Ga0451576_0562032
1570 Ga0451576_1316324
1571 Ga0451576_1765113
1572 Ga0495603_0111548
1573 Ga0495603_0397666
1574 Ga0495653_0322604
1575 Ga0495584_0058626
1576 Ga0495594_0109323
1577 Ga0495606_0325552
1578 Ga0495610_0130582
1579 Ga0495618_0179958
1580 Ga0495631_0349827
1581 Ga0495643_0031513
1582 Ga0495643_0334916
1583 Ga0495644_0327829
1584 Ga0495652_0302955
1585 Ga0495640_0254422
1586 Ga0495598_0215090
1587 Ga0495598_0217652
1588 Ga0495621_0446058
1589 Ga0495645_0354964
1590 Ga0495645_0429569
1591 Ga0495656_0025046
1592 Ga0495668_0092680
1593 Ga0495634_0884072
1594 Ga0495611_0215977
1595 Ga0495661_0635496
1596 Ga0495658_0202262
1597 Ga0495658_0282182
1598 Ga0495624_0069253
1599 Ga0495670_0096967
1600 Ga0495670_0183920
1601 Ga0495670_0773878
1602 Ga0495649_0058194
1603 Ga0495589_0534465
1604 Ga0495660_0158994
1605 Ga0495581_0267739
1606 Ga0495581_0269731
1607 Ga0495581_0747028
1608 Ga0495674_0066761
1609 Ga0495680_0280288
1610 Ga0495615_0026602
1611 Ga0495626_0251984
1612 Ga0496100_0004586
1613 Ga0496100_0143049
1614 Ga0496100_0332209
1615 Ga0496100_1298087
1616 Ga0496101_0001219
1617 Ga0496101_0038598
1618 Ga0496102_0003747
1619 Ga0496102_0005386
1620 Ga0496102_0008653
1621 Ga0496102_0230850
1622 Ga0496102_0361540
1623 Ga0496102_1127395
1624 Ga0496103_0001824
1625 Ga0496103_0007172
1626 Ga0496103_0238680
1627 Ga0496104_0000277
1628 Ga0496104_0000422
1629 Ga0496104_0006427
1630 Ga0496104_0007253
1631 Ga0496104_0458505
1632 Ga0496105_0001573
1633 Ga0496105_0010743
1634 Ga0496105_0030656
1635 Ga0496105_0430218
1636 Ga0496106_0003428
1637 Ga0496106_0069564
1638 Ga0496106_0317641
1639 Ga0496106_0559662
1640 Ga0496106_1107889
1641 Ga0496107_0005150
1642 Ga0496107_0974906
1643 Ga0496107_1096098
1644 Ga0496108_0003138
1645 Ga0496108_0017796
1646 Ga0496108_0045123
1647 Ga0496108_0387722
1648 Ga0496108_0942208
1649 Ga0496109_0009447
1650 Ga0496109_0038458
1651 Ga0496109_0055365
1652 Ga0496109_0101465
1653 Ga0496109_0213618
1654 Ga0496110_0007853
1655 Ga0496110_0097556
1656 Ga0496110_0209820
1657 Ga0496110_0269253
1658 Ga0496110_1710846
1659 Ga0496111_0000763
1660 Ga0496111_0009657
1661 Ga0496111_0039313
1662 Ga0496112_0002328
1663 Ga0496112_0002901
1664 Ga0496112_0342811
1665 Ga0496113_0003218
1666 Ga0496113_0003658
1667 Ga0496113_0010683
1668 Ga0496113_0253488
1669 Ga0496114_0003793
1670 Ga0496114_0134169
1671 Ga0496114_0311828
1672 Ga0496114_0545404
1673 Ga0496115_0008748
1674 Ga0496115_0145427
1675 Ga0496115_0303850
1676 Ga0496115_0418072
1677 Ga0496115_0543540
1678 Ga0496116_0006766
1679 Ga0496117_0004333
1680 Ga0496117_0099111
1681 Ga0496118_0002241
1682 Ga0496119_0004802
1683 Ga0496120_0004013
1684 Ga0496121_0002565
1685 Ga0496121_0046229
1686 Ga0496121_0157792
1687 Ga0496122_0003928
1688 Ga0496122_0040056
1689 Ga0496122_0156224
1690 Ga0496123_0004431
1691 Ga0496123_0026525
1692 Ga0496124_0032456
1693 Ga0496124_0044198
1694 Ga0496125_0005315
1695 Ga0496125_0102087
1696 Ga0496125_0146646
1697 Ga0496125_0203263
1698 Ga0496126_0003987
1699 Ga0496126_0094309
1700 Ga0496126_0154596
1701 Ga0496126_0171520
1702 Ga0496126_0521020
1703 Ga0496126_1256294
1704 Ga0501031_0136337
1705 Ga0501032_0031198
1706 Ga0501033_0000005
1707 Ga0501034_0096595
1708 Ga0501034_0453383
1709 Ga0501034_0750943
1710 Ga0501037_0083008
1711 Ga0501038_0128874
1712 Ga0501039_0006122
1713 Ga0501040_1008252
1714 Ga0501043_0003460
1715 Ga0501046_0000010
1716 Ga0501047_0465204
1717 Ga0501048_0294752
1718 Ga0501069_0274955
1719 Ga0501076_1028526
1720 Ga0501076_1539448
1721 Ga0501249_070293
1722 Ga0501079_0340023
1723 Ga0501080_1385014
1724 Ga0501035_0001614
1725 Ga0501044_0016325
1726 Ga0501044_0050646
1727 Ga0501044_0400533
1728 Ga0501045_0000090
1729 Ga0501045_0788478
1730 Ga0501045_1215697
1731 nmdc:mga03n38_308636_c1
1732 nmdc:mga03n38_948343_c1
1733 nmdc:mga00v17_120829_c1
1734 nmdc:mga00v17_523897_c1
1735 nmdc:mga0yw44_148577_c1
1736 nmdc:mga0yw44_543450_c1
1737 nmdc:mga0k408_207030_c1
1738 nmdc:mga06z11_170332_c1
1739 nmdc:mga06z11_195781_c1
1740 nmdc:mga06z11_39754_c1
1741 nmdc:mga04h51_5105_c1
1742 nmdc:mga04h51_526154_c1
1743 nmdc:mga04h51_5603_c1
1744 nmdc:mga04h51_95862_c1
1745 nmdc:mga07m45_442689_c1
1746 nmdc:mga05p37_1303039_c1
1747 nmdc:mga05p37_22563_c1
1748 nmdc:mga05p37_272674_c1
1749 nmdc:mga05p37_287317_c1
1750 nmdc:mga05p37_388887_c1
1751 nmdc:mga05p37_96689_c1
1752 nmdc:mga09592_152844_c1
1753 nmdc:mga09592_22502_c1
1754 nmdc:mga09592_2699_c1
1755 nmdc:mga09592_416422_c1
1756 nmdc:mga0qj67_1339842_c1
1757 nmdc:mga0qj67_166292_c1
1758 nmdc:mga0qj67_23465_c1
1759 nmdc:mga0qj67_39412_c1
1760 nmdc:mga0qj67_69899_c1
1761 nmdc:mga06r32_12218_c1
1762 nmdc:mga06r32_1351789_c1
1763 nmdc:mga06r32_15002_c1
1764 nmdc:mga06r32_271752_c1
1765 nmdc:mga06r32_725615_c1
1766 nmdc:mga06r32_893727_c1
1767 nmdc:mga08y16_15797_c1
1768 nmdc:mga08y16_231102_c1
1769 nmdc:mga08y16_463535_c1
1770 nmdc:mga08y16_47_c1
1771 nmdc:mga08y16_64280_c1
1772 nmdc:mga08y16_85916_c1
1773 nmdc:mga0n895_230015_c1
1774 nmdc:mga0rr50_113794_c1
1775 nmdc:mga0a205_1307481_c1
1776 nmdc:mga0a205_444205_c1
1777 nmdc:mga0a205_641704_c1
1778 nmdc:mga0sz30_12771_c1
1779 nmdc:mga0sz30_148832_c1
1780 nmdc:mga0sz30_47897_c1
1781 Ga0495601_0263129
1782 Ga0495595_0102698
1783 Ga0495619_0034642
1784 Ga0500578_0440212
1785 Ga0500641_0032254
1786 Ga0500562_034205
1787 Ga0500595_076282
1788 Ga0500658_0009027
1789 Ga0500658_0392156
1790 Ga0500568_0066977
1791 Ga0500589_220459
1792 Ga0500604_0016388
1793 Ga0500616_0151806
1794 Ga0500622_0003585
1795 Ga0500622_0083644
1796 Ga0500622_0099531
1797 Ga0500634_0216694
1798 Ga0500636_0075467
1799 Ga0500636_0180223
1800 Ga0501084_1561653
1801 Ga0590071_028025
1802 Ga0590074_068216
1803 Ga0590077_014728
1804 Ga0501082_1144564
1805 Ga0530510_0018385
1806 Ga0530510_0331492

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01022

HTH_5

Bacterial regulatory protein, arsR family

25

71

0.98

PF12840

HTH_20

Helix-turn-helix domain

23

71

0.98

PF13412

HTH_24

Winged helix-turn-helix DNA-binding

25

70

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2cwe-assembly1.cif.gz_A crystal structure of hypothetical transcriptional regulator protein, ph1932 from pyrococcus horikoshii ot3 0.9166 10 64
1y0u-assembly1.cif.gz_B crystal structure of the putative arsenical resistance operon repressor from archaeoglobus fulgidus 0.9006 6 74
3f6o-assembly1.cif.gz_B crystal structure of arsr family transcriptional regulator, rha00566 0.8947 5 93
3f6o-assembly1.cif.gz_A crystal structure of arsr family transcriptional regulator, rha00566 0.8943 6 93
2quf-assembly1.cif.gz_A crystal structure of transcription factor axxa-pf0095 from pyrococcus furiosus 0.8914 11 74
ID Description Score Start End Superfamily
af_Q54FU1_288_364_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9483 16 63 1.10.10.10
af_A0A1D6HDX3_114_200_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9405 16 63 1.10.10.10
3tgnA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.912 16 74 1.10.10.10
af_Q5NE14_88_145_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.911 18 73 1.10.10.10
af_P0ACL0_1_57_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9047 18 63 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A4R7HZX1-F1-model_v4 ArsR family transcriptional regulator 0.9468 6 106 GO:0003700
AF-A0A4Q7YXI1-F1-model_v4 DNA-binding transcriptional ArsR family regulator 0.9423 4 110 GO:0003677
GO:0003700
AF-A0A2W6CV98-F1-model_v4 ArsR family transcriptional regulator 0.9402 4 98 GO:0003700
AF-A0A7Y5X961-F1-model_v4 Winged helix-turn-helix transcriptional regulator 0.9377 7 89 GO:0003700
AF-A0A5P8FM22-F1-model_v4 Metalloregulator ArsR/SmtB family transcription factor 0.9375 4 106 GO:0003700

Map